BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7287_g1_i1 len=2006 path=[1984:0-2005]

Length=2006
                                                                      Score     E

ref|XP_009762000.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          674   0.0      
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                              660   0.0      
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                          656   0.0      
gb|AHX25585.1|  3-ketoacyl-CoA synthase 6                               653   0.0      
gb|ABA01490.1|  3-ketoacyl-CoA synthase                                 653   0.0      Gossypium hirsutum [American cotton]
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                               651   0.0      
ref|XP_006344142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          650   0.0      
gb|KHN11421.1|  3-ketoacyl-CoA synthase 6                               648   0.0      
ref|XP_011099559.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               649   0.0      
ref|XP_002315942.1|  ECERIFERUM 6 family protein                        649   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003555901.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          648   0.0      
gb|KDP29403.1|  hypothetical protein JCGZ_18324                         648   0.0      
ref|XP_009786212.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               648   0.0      
ref|XP_006302169.1|  hypothetical protein CARUB_v10020179mg             648   0.0      
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                                 647   0.0      
ref|XP_004238922.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               647   0.0      
gb|KHN05569.1|  3-ketoacyl-CoA synthase 6                               645   0.0      
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               647   0.0      
gb|EYU44641.1|  hypothetical protein MIMGU_mgv1a005164mg                646   0.0      
ref|XP_011097190.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          646   0.0      
ref|XP_007153392.1|  hypothetical protein PHAVU_003G031300g             648   0.0      
ref|XP_004299082.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          646   0.0      
gb|AIV98044.1|  3-ketoacyl-CoA synthase                                 642   0.0      
ref|XP_003536684.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               645   0.0      
ref|XP_006391129.1|  hypothetical protein EUTSA_v10018446mg             645   0.0      
ref|XP_009598968.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               645   0.0      
ref|XP_003614634.1|  3-ketoacyl-CoA synthase                            645   0.0      
ref|XP_006363119.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          644   0.0      
ref|XP_003637444.1|  3-ketoacyl-CoA synthase                            644   0.0      
ref|XP_004232364.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               644   0.0      
ref|XP_004135091.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    642   0.0      
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          644   0.0      
ref|XP_003531926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          644   0.0      
gb|AAM65060.1|  very-long-chain fatty acid condensing enzyme CUT1       644   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004497096.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          644   0.0      
ref|XP_009105040.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               644   0.0      
ref|XP_008446598.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               643   0.0      
gb|AAL50069.1|  At1g68530/T26J14_10                                     643   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_177020.1|  3-ketoacyl-CoA synthase 6                             643   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004135090.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...    643   0.0      
ref|XP_010511851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          642   0.0      
ref|XP_006307339.1|  hypothetical protein CARUB_v10008957mg             642   0.0      
gb|KFK41273.1|  hypothetical protein AALP_AA2G108700                    642   0.0      
gb|EPS61116.1|  hypothetical protein M569_13682                         642   0.0      
ref|XP_006415873.1|  hypothetical protein EUTSA_v10007453mg             641   0.0      
ref|XP_010415473.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               641   0.0      
ref|XP_008389290.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          641   0.0      
emb|CDY04232.1|  BnaC06g25830D                                          641   0.0      
ref|XP_011076851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          641   0.0      
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               641   0.0      
ref|XP_006344141.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          641   0.0      
ref|XP_007142908.1|  hypothetical protein PHAVU_007G027100g             641   0.0      
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               641   0.0      
ref|XP_002888670.1|  hypothetical protein ARALYDRAFT_894621             640   0.0      
gb|EYU34398.1|  hypothetical protein MIMGU_mgv1a005204mg                640   0.0      
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               639   0.0      
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          638   0.0      
ref|XP_004238923.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          638   0.0      
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          638   0.0      
ref|NP_173916.1|  3-ketoacyl-CoA synthase 5                             637   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311457.1|  hypothetical protein POPTR_0008s11920g             637   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002890689.1|  hypothetical protein ARALYDRAFT_472828             637   0.0      
ref|XP_002282526.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               637   0.0      Vitis vinifera
ref|XP_009115318.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               637   0.0      
gb|ACT21783.1|  CER6                                                    637   0.0      Solanum lycopersicum
ref|XP_009597817.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          637   0.0      
ref|XP_011007926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               637   0.0      
emb|CDY42109.1|  BnaA09g28510D                                          637   0.0      
ref|XP_009784659.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          636   0.0      
ref|XP_010499108.1|  PREDICTED: 3-ketoacyl-CoA synthase 5               636   0.0      
ref|XP_010477925.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          635   0.0      
gb|AIE57499.1|  KCS6                                                    635   0.0      
emb|CDP00615.1|  unnamed protein product                                635   0.0      
gb|AAM67234.1|  fatty acid condensing enzyme CUT1, putative             635   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KDO69954.1|  hypothetical protein CISIN_1g011007mg                   635   0.0      
ref|XP_009605061.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          637   0.0      
emb|CDP02779.1|  unnamed protein product                                635   0.0      
gb|KFK44525.1|  hypothetical protein AALP_AA1G267900                    634   0.0      
ref|XP_002531630.1|  acyltransferase, putative                          633   0.0      Ricinus communis
ref|XP_006437664.1|  hypothetical protein CICLE_v10031329mg             633   0.0      
ref|XP_010681548.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          633   0.0      
ref|XP_010527537.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          632   0.0      
gb|AAO42223.1|  putative fatty acid condensing enzyme CUT1              632   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          632   0.0      
ref|XP_008802438.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          628   0.0      
gb|EYU26766.1|  hypothetical protein MIMGU_mgv1a005018mg                627   0.0      
ref|XP_009777704.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          627   0.0      
ref|XP_009390849.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          626   0.0      
ref|XP_011099560.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          625   0.0      
ref|XP_009390357.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          625   0.0      
ref|XP_009356710.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          625   0.0      
emb|CDP00616.1|  unnamed protein product                                625   0.0      
ref|XP_010551269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               624   0.0      
ref|XP_009380079.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          620   0.0      
ref|XP_010926125.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          620   0.0      
ref|NP_001130497.1|  uncharacterized protein LOC100191595               619   0.0      Zea mays [maize]
ref|XP_002465630.1|  hypothetical protein SORBIDRAFT_01g042600          619   0.0      Sorghum bicolor [broomcorn]
ref|XP_008668455.1|  PREDICTED: uncharacterized protein LOC100191...    618   0.0      
ref|XP_006841272.1|  hypothetical protein AMTR_s00135p00117490          617   0.0      
ref|XP_002283730.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               617   0.0      Vitis vinifera
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          617   0.0      
ref|XP_004985167.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          617   0.0      
ref|NP_001049406.1|  Os03g0220100                                       615   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          613   0.0      
ref|XP_009414779.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          613   0.0      
ref|XP_006651174.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          613   0.0      
ref|XP_010692961.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          612   0.0      
ref|XP_008775195.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    612   0.0      
ref|XP_003558474.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          609   0.0      
ref|XP_008660394.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          607   0.0      
gb|EMT20723.1|  3-ketoacyl-CoA synthase 6                               604   0.0      
gb|ABG35744.1|  putative very long chain fatty acid condensing en...    603   0.0      Hordeum vulgare [barley]
ref|XP_010910111.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          602   0.0      
ref|XP_009391408.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               600   0.0      
gb|ABY82171.2|  3-ketoacyl-CoA synthase I                               599   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_008801160.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               596   0.0      
ref|XP_010103772.1|  3-ketoacyl-CoA synthase 6                          584   0.0      
ref|XP_002271250.1|  PREDICTED: 3-ketoacyl-CoA synthase 6               582   0.0      Vitis vinifera
ref|XP_006842379.1|  hypothetical protein AMTR_s00079p00192440          580   0.0      
emb|CAN63425.1|  hypothetical protein VITISV_040442                     579   0.0      Vitis vinifera
ref|XP_010265150.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          575   0.0      
ref|XP_009399728.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          574   0.0      
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692             572   0.0      
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947              571   0.0      
ref|XP_009406296.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          568   0.0      
ref|XP_009605059.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          559   0.0      
gb|AGK29994.1|  3-ketoacyl-CoA synthase 4                               560   0.0      
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               558   0.0      
ref|XP_002510394.1|  acyltransferase, putative                          557   0.0      Ricinus communis
gb|KDP46259.1|  hypothetical protein JCGZ_10099                         557   0.0      
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          556   0.0      
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          556   0.0      
ref|XP_010104374.1|  3-ketoacyl-CoA synthase 4                          556   0.0      
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          553   0.0      
ref|XP_008388058.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          555   0.0      
ref|XP_008357196.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          555   0.0      
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g             555   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002509491.1|  acyltransferase, putative                          554   0.0      Ricinus communis
gb|KDO49072.1|  hypothetical protein CISIN_1g010687mg                   553   0.0      
ref|XP_008236905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          553   0.0      
ref|XP_009336207.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               551   0.0      
ref|XP_006423278.1|  hypothetical protein CICLE_v10028243mg             553   0.0      
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          554   0.0      
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1    553   0.0      
ref|XP_009364915.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          553   0.0      
gb|KDP38510.1|  hypothetical protein JCGZ_04435                         553   0.0      
ref|XP_009389417.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          553   0.0      
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          552   0.0      
ref|XP_008377297.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          552   0.0      
ref|XP_002305431.1|  hypothetical protein POPTR_0004s16290g             552   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          552   0.0      
ref|XP_010539905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               552   0.0      
ref|XP_007200967.1|  hypothetical protein PRUPE_ppa004500mg             551   0.0      
ref|XP_010088926.1|  3-ketoacyl-CoA synthase 4                          551   0.0      
ref|XP_010467354.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          551   0.0      
emb|CDP07508.1|  unnamed protein product                                551   0.0      
ref|XP_006304681.1|  hypothetical protein CARUB_v10011929mg             551   0.0      
ref|NP_179223.1|  3-ketoacyl-CoA synthase 9                             551   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489197.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          550   0.0      
ref|XP_009416553.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          551   0.0      
ref|XP_010924276.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          550   0.0      
ref|XP_002282403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               550   0.0      Vitis vinifera
ref|XP_002321310.2|  very-long-chain fatty acid condensing enzyme...    551   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009365554.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          550   0.0      
ref|XP_006847589.1|  hypothetical protein AMTR_s00014p00234760          550   0.0      
ref|XP_006299088.1|  hypothetical protein CARUB_v10015226mg             550   0.0      
ref|XP_002884160.1|  hypothetical protein ARALYDRAFT_900287             550   0.0      
gb|KFK41268.1|  hypothetical protein AALP_AA2G107900                    550   0.0      
ref|XP_011083903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               550   0.0      
gb|ABS18382.1|  3-ketoacyl-CoA synthase                                 550   0.0      Eranthis hyemalis
ref|XP_004238271.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               550   0.0      
gb|KFK44079.1|  hypothetical protein AALP_AA1G213300                    549   0.0      
ref|XP_006416504.1|  hypothetical protein EUTSA_v10007370mg             549   0.0      
ref|NP_173376.1|  3-ketoacyl-CoA synthase 4                             549   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042184.1|  3-ketoacyl-CoA synthase 4                          548   0.0      
ref|XP_006409460.1|  hypothetical protein EUTSA_v10022654mg             548   0.0      
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g             549   0.0      
ref|XP_010690872.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               548   0.0      
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                            548   0.0      
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          547   0.0      
ref|XP_009760261.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               547   0.0      
ref|XP_002890341.1|  hypothetical protein ARALYDRAFT_472173             547   0.0      
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          547   0.0      
ref|XP_006341948.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          547   0.0      
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          547   0.0      
ref|XP_007160751.1|  hypothetical protein PHAVU_001G014100g             546   0.0      
emb|CDX71278.1|  BnaC07g05570D                                          546   0.0      
ref|XP_010516877.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    546   0.0      
ref|XP_004289669.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          545   0.0      
ref|XP_009627040.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               545   0.0      
ref|XP_010254814.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          545   0.0      
gb|EPS60765.1|  hypothetical protein M569_14036                         545   0.0      
ref|XP_007222865.1|  hypothetical protein PRUPE_ppa004284mg             545   0.0      
ref|XP_008444712.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          544   0.0      
ref|XP_007222962.1|  hypothetical protein PRUPE_ppa006758mg             540   0.0      
ref|XP_002869143.1|  3-ketoacyl-CoA synthase 2                          543   0.0      
ref|XP_010548056.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          543   0.0      
ref|XP_004152699.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          543   0.0      
emb|CDY21665.1|  BnaA09g44160D                                          543   0.0      
ref|XP_009117539.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               543   0.0      
ref|XP_010932594.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          542   0.0      
ref|XP_009112385.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    543   0.0      
emb|CDY46211.1|  BnaA07g03590D                                          543   0.0      
ref|XP_010477163.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          543   0.0      
ref|XP_010243778.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               542   0.0      
ref|XP_006581119.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          538   0.0      
ref|XP_010248169.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          541   0.0      
ref|XP_010498362.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               540   0.0      
ref|XP_009341963.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          540   0.0      
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                    540   0.0      
ref|XP_010548057.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like          538   0.0      
ref|NP_001130638.1|  g14A                                               538   0.0      Zea mays [maize]
ref|XP_009149432.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               539   0.0      
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860          540   0.0      Sorghum bicolor [broomcorn]
ref|XP_010459615.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          539   0.0      
ref|XP_009121221.1|  PREDICTED: 3-ketoacyl-CoA synthase 9               538   0.0      
ref|XP_006284916.1|  hypothetical protein CARUB_v10006212mg             536   0.0      
emb|CDX81929.1|  BnaC08g36720D                                          538   0.0      
ref|XP_006655600.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          537   0.0      
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    537   0.0      
gb|ACO72624.1|  g14a                                                    536   0.0      Zea mays [maize]
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          538   0.0      
ref|XP_011088405.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...    535   0.0      
gb|ACO72625.1|  g14a                                                    536   0.0      Zea mays [maize]
gb|ACO72623.1|  g14a                                                    536   0.0      Zea mays [maize]
ref|NP_001146356.1|  uncharacterized protein LOC100279934               536   0.0      Zea mays [maize]
ref|NP_001267518.1|  uncharacterized protein LOC100797855               536   0.0      
ref|XP_004953823.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          535   0.0      
ref|XP_011088403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...    536   0.0      
ref|NP_195177.1|  3-ketoacyl-CoA synthase 17                            535   1e-180   Arabidopsis thaliana [mouse-ear cress]
gb|AAP74371.1|  FAE1                                                    536   1e-180   Marchantia polymorpha
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          535   1e-180   
ref|XP_002979460.1|  hypothetical protein SELMODRAFT_444233             535   1e-180   
ref|XP_008378462.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          535   2e-180   
gb|AFW81175.1|  acyltransferase                                         535   2e-180   
ref|XP_008800772.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          534   2e-180   
ref|XP_008805392.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          536   2e-180   
ref|XP_002977865.1|  hypothetical protein SELMODRAFT_443640             535   2e-180   
emb|CDX76286.1|  BnaA08g11140D                                          533   2e-180   
dbj|BAK06985.1|  predicted protein                                      534   2e-180   
ref|XP_001753137.1|  predicted protein                                  535   3e-180   
ref|XP_010432405.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      533   4e-180   
ref|XP_006647846.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          533   5e-180   
ref|XP_010263648.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          534   5e-180   
gb|AGH32920.1|  ketoacyl-CoA synthase                                   533   8e-180   
ref|XP_008800778.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          530   8e-180   
emb|CDO97044.1|  unnamed protein product                                533   1e-179   
ref|NP_001130522.1|  uncharacterized protein LOC100191621               533   1e-179   Zea mays [maize]
gb|EYU26763.1|  hypothetical protein MIMGU_mgv1a027040mg                533   1e-179   
ref|NP_001056354.1|  Os05g0568000                                       533   1e-179   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048023.2|  Os02g0731900                                       531   2e-179   Oryza sativa Japonica Group [Japonica rice]
gb|KDO84579.1|  hypothetical protein CISIN_1g010193mg                   533   2e-179   
ref|XP_001757568.1|  predicted protein                                  533   2e-179   
emb|CDY46243.1|  BnaC03g66040D                                          531   2e-179   
ref|XP_006435002.1|  hypothetical protein CICLE_v10000889mg             532   2e-179   
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         532   2e-179   
ref|XP_007143888.1|  hypothetical protein PHAVU_007G110500g             532   3e-179   
ref|XP_007145927.1|  hypothetical protein PHAVU_007G279500g             532   4e-179   
ref|XP_007017550.1|  3-ketoacyl-CoA synthase 4                          531   7e-179   
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4               531   7e-179   
gb|AGK30005.1|  3-ketoacyl-CoA synthase                                 531   7e-179   
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         531   9e-179   
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              530   1e-178   
ref|XP_009108847.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      529   1e-178   
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                    530   2e-178   
ref|XP_007013801.1|  3-ketoacyl-CoA synthase                            530   2e-178   
gb|EMT13637.1|  hypothetical protein F775_42822                         528   2e-178   
gb|EAY99068.1|  hypothetical protein OsI_21025                          530   2e-178   Oryza sativa Indica Group [Indian rice]
ref|XP_004293205.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          529   4e-178   
gb|AGK29996.1|  3-ketoacyl-CoA synthase 18                              529   4e-178   
ref|XP_007034926.1|  3-ketoacyl-CoA synthase                            528   1e-177   
ref|XP_004495403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         528   1e-177   
dbj|BAJ90995.1|  predicted protein                                      527   1e-177   
ref|XP_010447067.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2      526   2e-177   
gb|AGK30016.1|  3-ketoacyl-CoA synthase                                 526   2e-177   
ref|XP_003637542.1|  Beta-ketoacyl-CoA synthase                         528   2e-177   
ref|XP_002284986.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              527   3e-177   Vitis vinifera
gb|AGK29998.1|  3-ketoacyl-CoA synthase 9                               526   3e-177   
dbj|BAJ89275.1|  predicted protein                                      526   3e-177   
ref|XP_001753229.1|  predicted protein                                  528   3e-177   
ref|XP_006412219.1|  hypothetical protein EUTSA_v10025028mg             525   5e-177   
ref|XP_009630522.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          526   7e-177   
dbj|BAJ98276.1|  predicted protein                                      526   9e-177   
ref|XP_010102812.1|  3-ketoacyl-CoA synthase 11                         525   1e-176   
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         525   1e-176   
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         525   2e-176   
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg             525   2e-176   
gb|EMS50435.1|  3-ketoacyl-CoA synthase 4                               525   2e-176   
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         524   3e-176   
gb|ACQ41892.1|  3-ketoacyl-CoA synthase                                 525   3e-176   
ref|XP_009801870.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         524   4e-176   
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              524   4e-176   
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                              522   4e-176   
ref|XP_008659433.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          520   8e-176   
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         523   1e-175   
ref|XP_002960812.1|  hypothetical protein SELMODRAFT_437285             522   1e-175   
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         523   1e-175   
gb|AFK39024.1|  unknown                                                 523   1e-175   
gb|EAY87409.1|  hypothetical protein OsI_08815                          518   2e-175   
gb|KHN15129.1|  3-ketoacyl-CoA synthase 11                              520   3e-175   
ref|XP_003563984.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          521   3e-175   
gb|AFW76936.1|  hypothetical protein ZEAMMB73_155419                    520   5e-175   
ref|XP_004965180.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like          520   6e-175   
ref|XP_009607438.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         521   7e-175   
gb|EMS60411.1|  3-ketoacyl-CoA synthase 6                               520   1e-174   
ref|XP_009347466.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         520   1e-174   
ref|XP_003549787.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         520   2e-174   
gb|KHG17042.1|  3-ketoacyl-CoA synthase 17 -like protein                520   2e-174   
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         520   3e-174   
ref|XP_010254302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         519   3e-174   
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg             519   3e-174   
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         520   3e-174   
ref|XP_002324276.1|  hypothetical protein POPTR_0018s01300g             519   3e-174   
gb|EYU21941.1|  hypothetical protein MIMGU_mgv1a004813mg                519   3e-174   
ref|XP_010932851.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         519   3e-174   
ref|XP_004241809.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         519   4e-174   
ref|XP_004499254.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          519   4e-174   
emb|CDP04806.1|  unnamed protein product                                519   4e-174   
gb|AGK29990.1|  3-ketoacyl-CoA synthase 11                              519   4e-174   
ref|XP_002438192.1|  hypothetical protein SORBIDRAFT_10g009410          518   4e-174   
ref|XP_004965965.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         519   5e-174   
emb|CDP03396.1|  unnamed protein product                                518   6e-174   
ref|XP_001758798.1|  predicted protein                                  519   6e-174   
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         518   6e-174   
ref|XP_009400075.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like          515   6e-174   
gb|KDP40263.1|  hypothetical protein JCGZ_02261                         519   7e-174   
ref|XP_007154946.1|  hypothetical protein PHAVU_003G160400g             518   8e-174   
ref|XP_006353644.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         518   8e-174   
ref|XP_008352048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         518   1e-173   
ref|XP_003524525.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         518   1e-173   
gb|EPS57140.1|  hypothetical protein M569_17681                         516   2e-173   
ref|XP_003570501.2|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          516   2e-173   
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         517   2e-173   
ref|XP_008368384.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         517   2e-173   
ref|XP_003563983.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          516   2e-173   
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg             517   2e-173   
ref|XP_011026502.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         517   2e-173   
ref|XP_006656205.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         517   2e-173   
ref|XP_009348198.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         517   2e-173   
gb|EMS49285.1|  3-ketoacyl-CoA synthase 6                               523   3e-173   
gb|AGK29989.1|  3-ketoacyl-CoA synthase 2                               517   3e-173   
ref|XP_009334788.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         517   3e-173   
gb|KDO80366.1|  hypothetical protein CISIN_1g008975mg                   518   4e-173   
ref|XP_006451013.1|  hypothetical protein CICLE_v10007916mg             517   5e-173   
gb|KDP32347.1|  hypothetical protein JCGZ_13272                         516   5e-173   
gb|EAZ00421.1|  hypothetical protein OsI_22442                          515   5e-173   
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         516   6e-173   
ref|XP_009392409.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         516   6e-173   
gb|KHG01499.1|  3-ketoacyl-CoA synthase 11 -like protein                516   7e-173   
ref|XP_010069186.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         516   8e-173   
ref|XP_009394797.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         515   9e-173   
ref|XP_003626601.1|  3-ketoacyl-CoA synthase                            516   1e-172   
ref|XP_004498007.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         515   1e-172   
ref|XP_008219888.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         515   1e-172   
ref|XP_008391016.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like i...    515   1e-172   
ref|XP_009349773.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         515   1e-172   
ref|XP_002284751.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              515   1e-172   
dbj|BAJ93555.1|  predicted protein                                      515   1e-172   
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         514   1e-172   
ref|XP_010024057.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         515   2e-172   
ref|XP_004134106.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like         514   2e-172   
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                    514   2e-172   
ref|XP_010049954.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              514   3e-172   
gb|AGK29991.1|  3-ketoacyl-CoA synthase 7                               514   3e-172   
ref|XP_008792115.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         514   3e-172   
ref|XP_009792392.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         514   4e-172   
ref|XP_008438597.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         513   4e-172   
gb|ABV60087.1|  beta-ketoacyl-CoA synthase                              514   5e-172   
ref|NP_001057330.1|  Os06g0262800                                       513   5e-172   
ref|NP_001057327.1|  Os06g0260500                                       513   5e-172   
ref|XP_008650048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         513   5e-172   
ref|XP_002308642.1|  hypothetical protein POPTR_0006s26530g             513   5e-172   
ref|XP_004165059.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    513   6e-172   
ref|XP_009601634.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         513   6e-172   
ref|XP_011015110.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         513   7e-172   
ref|XP_007204837.1|  hypothetical protein PRUPE_ppa004269mg             513   8e-172   
ref|XP_008385932.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              513   9e-172   
ref|XP_009779614.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         513   9e-172   
ref|XP_010522508.1|  PREDICTED: 3-ketoacyl-CoA synthase 19              513   1e-171   
ref|XP_009374066.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              513   1e-171   
ref|XP_010918127.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         513   1e-171   
ref|XP_008796071.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         513   1e-171   
ref|XP_010098974.1|  3-ketoacyl-CoA synthase 11                         513   1e-171   
ref|XP_004306622.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          513   1e-171   
gb|EAY99126.1|  hypothetical protein OsI_21086                          513   1e-171   
ref|XP_006854931.1|  hypothetical protein AMTR_s00052p00130070          513   1e-171   
ref|XP_003571537.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              513   1e-171   
ref|XP_003563676.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         513   1e-171   
gb|EEC80357.1|  hypothetical protein OsI_22448                          511   1e-171   
gb|EMT08067.1|  3-ketoacyl-CoA synthase 17                              513   1e-171   
gb|EMS60006.1|  3-ketoacyl-CoA synthase 6                               510   1e-171   
ref|NP_001056391.1|  Os05g0574600                                       513   2e-171   
ref|XP_002441557.1|  hypothetical protein SORBIDRAFT_09g029260          512   2e-171   
ref|XP_011019752.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              512   2e-171   
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         512   2e-171   
gb|EMT13284.1|  3-ketoacyl-CoA synthase 6                               510   2e-171   
gb|AGK29988.1|  3-ketoacyl-CoA synthase 1                               513   2e-171   
emb|CCW28736.1|  putative 3-Oxoacyl-[acyl-carrier-protein (ACP)] ...    512   2e-171   
ref|XP_007013326.1|  3-ketoacyl-CoA synthase                            512   2e-171   
gb|KFK42764.1|  hypothetical protein AALP_AA1G036700                    512   3e-171   
ref|XP_008242707.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              512   3e-171   
gb|KDP28427.1|  hypothetical protein JCGZ_14198                         512   3e-171   
gb|AFW86298.1|  hypothetical protein ZEAMMB73_237043                    510   3e-171   
ref|XP_004247624.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         511   3e-171   
gb|AGK30001.1|  3-ketoacyl-CoA synthase                                 511   3e-171   
ref|XP_008361241.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              511   4e-171   
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                              511   4e-171   
gb|KHG21958.1|  3-ketoacyl-CoA synthase 11 -like protein                512   4e-171   
ref|XP_010683564.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         511   4e-171   
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    511   5e-171   
dbj|BAF98214.1|  CM0216.300.nc                                          511   5e-171   
ref|XP_002453517.1|  hypothetical protein SORBIDRAFT_04g007190          511   5e-171   
gb|AAO48425.1|  beta-ketoacyl-CoA-synthase                              511   7e-171   
gb|EPS63750.1|  hypothetical protein M569_11032                         510   8e-171   
gb|ACY78677.1|  fatty acid elongase                                     510   8e-171   
dbj|BAJ94420.1|  predicted protein                                      510   1e-170   
gb|AHX25587.1|  3-ketoacyl-CoA synthase 11                              510   1e-170   
gb|AGK29992.1|  3-ketoacyl-CoA synthase 19                              510   1e-170   
ref|XP_010274236.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         510   1e-170   
gb|ACR36808.1|  unknown                                                 510   1e-170   
ref|XP_010925263.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         509   1e-170   
gb|ABF51009.1|  putative very long chain fatty acid condensing en...    508   1e-170   
emb|CDO99138.1|  unnamed protein product                                510   1e-170   
gb|EMS59568.1|  3-ketoacyl-CoA synthase 6                               506   1e-170   
ref|XP_009337302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         511   2e-170   
gb|AAU95453.1|  At1g04220                                               509   2e-170   
ref|XP_009381261.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         509   2e-170   
ref|XP_002529975.1|  acyltransferase, putative                          510   2e-170   
ref|XP_002892201.1|  hypothetical protein ARALYDRAFT_470398             509   3e-170   
gb|EMS60200.1|  3-ketoacyl-CoA synthase 17                              509   3e-170   
ref|XP_004170552.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         509   4e-170   
ref|XP_006655984.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like          506   4e-170   
ref|XP_010914942.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         508   5e-170   
ref|XP_004508544.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    508   6e-170   
gb|ACC60973.1|  beta-ketoacyl-CoA synthase                              508   6e-170   
ref|NP_171918.1|  3-ketoacyl-CoA synthase 2                             508   7e-170   
ref|XP_003609222.1|  Beta-ketoacyl-coa synthase family protein          507   8e-170   
ref|XP_011027418.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         508   9e-170   
ref|NP_001151591.1|  fatty acid elongase                                508   1e-169   
ref|XP_003521822.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          508   1e-169   
ref|XP_002312562.1|  hypothetical protein POPTR_0008s15990g             508   1e-169   
ref|XP_004508545.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    507   1e-169   
gb|EMT10755.1|  3-ketoacyl-CoA synthase 6                               507   2e-169   
ref|XP_011091085.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              507   2e-169   
ref|XP_009407649.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         507   2e-169   
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                              506   2e-169   
ref|XP_006362163.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         507   2e-169   
ref|XP_008785403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         506   2e-169   
ref|XP_006361008.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          508   2e-169   
ref|XP_006420077.1|  hypothetical protein CICLE_v10004736mg             507   3e-169   
ref|XP_006654826.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         506   3e-169   
ref|XP_010533183.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    506   3e-169   
ref|XP_008363965.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          507   3e-169   
gb|AAL67132.1|  putative beta-ketoacyl-CoA synthase                     506   5e-169   
gb|AAP74370.1|  FAE3                                                    506   9e-169   
gb|KDO80368.1|  hypothetical protein CISIN_1g008975mg                   501   9e-169   
ref|NP_001168833.1|  uncharacterized protein LOC100382638               500   9e-169   
ref|XP_009351389.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like          506   9e-169   
ref|XP_002264721.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               506   9e-169   
dbj|BAJ85000.1|  predicted protein                                      505   1e-168   
ref|XP_004951508.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         518   1e-168   
ref|XP_006489489.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like         505   1e-168   
gb|AFW87109.1|  putative fatty acid elongase isoform 1                  504   2e-168   
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g             504   2e-168   
gb|KDO53945.1|  hypothetical protein CISIN_1g009935mg                   504   2e-168   
gb|EAZ01557.1|  hypothetical protein OsI_23590                          504   2e-168   
ref|XP_010091264.1|  3-ketoacyl-CoA synthase 11                         504   2e-168   
gb|EMT24470.1|  3-ketoacyl-CoA synthase 11                              504   3e-168   
ref|XP_008796426.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         504   3e-168   
gb|EYU34550.1|  hypothetical protein MIMGU_mgv1a004667mg                504   3e-168   
ref|XP_002283935.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              504   3e-168   
gb|ACO72627.1|  truncated g14a                                          501   4e-168   
ref|XP_007222815.1|  hypothetical protein PRUPE_ppa004243mg             504   4e-168   
ref|XP_009122553.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              504   4e-168   
gb|EMS63108.1|  3-ketoacyl-CoA synthase 6                               501   5e-168   
ref|XP_006293527.1|  hypothetical protein CARUB_v10024547mg             503   5e-168   
emb|CDX70186.1|  BnaA10g25350D                                          503   5e-168   
ref|XP_009601391.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    503   5e-168   
ref|XP_008464980.1|  PREDICTED: 3-ketoacyl-CoA synthase 11              503   6e-168   
ref|XP_009601390.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    503   6e-168   
ref|XP_010557584.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    503   6e-168   
ref|NP_001057996.1|  Os06g0598800                                       503   7e-168   
ref|XP_006398946.1|  hypothetical protein EUTSA_v10013296mg             503   7e-168   
ref|XP_010670713.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         503   7e-168   
ref|XP_004961143.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         503   8e-168   
ref|XP_009606335.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               503   9e-168   
ref|XP_010557583.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...    503   9e-168   
ref|XP_006366859.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         503   9e-168   
ref|XP_002878994.1|  hypothetical protein ARALYDRAFT_901443             502   1e-167   
ref|XP_009366618.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               503   1e-167   
ref|XP_009101767.1|  PREDICTED: 3-ketoacyl-CoA synthase 19              503   1e-167   
ref|XP_002437234.1|  hypothetical protein SORBIDRAFT_10g023290          503   1e-167   
ref|XP_004248096.1|  PREDICTED: 3-ketoacyl-CoA synthase 1               503   1e-167   
emb|CDY14892.1|  BnaA02g22340D                                          503   1e-167   
ref|XP_004287376.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like         502   1e-167   
emb|CDX98800.1|  BnaC09g50350D                                          502   2e-167   
ref|XP_004251585.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...    501   2e-167   
gb|AGT15995.1|  fatty acid elongase                                     501   2e-167   
gb|EMT15934.1|  3-ketoacyl-CoA synthase 11                              502   2e-167   
ref|XP_006378366.1|  hypothetical protein POPTR_0010s08990g             502   2e-167   



>ref|XP_009762000.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=498

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/422 (75%), Positives = 365/422 (86%), Gaps = 7/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR +YLVDYAC++PP   R P A+F+EH+QL+ PT PK++ FQ ++LERSGLGE T +
Sbjct  84    SRPRTIYLVDYACFRPPNMFRAPSASFVEHAQLILPTEPKSVRFQMKMLERSGLGEETAL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+ LAREEA+ VIFS+MD LL KT+LNPK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMVLAREEAELVIFSIMDSLLEKTRLNPKFIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ + NSNAV++STEIITPNSYLGK
Sbjct  204   MLINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQHYPNSNAVVISTEIITPNSYLGK  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSMLLPNCLFR GGAA+ LSNR+ D  RAKYRL+HVVRTH G  DKS++CV QQED EG
Sbjct  264   ERSMLLPNCLFRMGGAAIFLSNRKSDQRRAKYRLVHVVRTHKGADDKSFRCVQQQEDPEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINLCI+LM+VAGEALKSNIT+IGPLVLP  E ++F++  +R K+          N+ 
Sbjct  324   KVGINLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTFIRRKIF-------KKNSK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               VPDFK AFEHFCIHAGGRAVIDELQK+L+LS EHVEASRMTL+RFGNTSSSSLWYEMS
Sbjct  377   PYVPDFKLAFEHFCIHAGGRAVIDELQKSLQLSAEHVEASRMTLYRFGNTSSSSLWYEMS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  PV  +PWADCI +YPV IPD++
Sbjct  437   YIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPVTHSPWADCIDRYPVDIPDVV  496

Query  1659  KV  1664
             K+
Sbjct  497   KL  498



>gb|AGK29999.1| 3-ketoacyl-CoA synthase 13 [Gossypium raimondii]
Length=492

 Score =   660 bits (1702),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/422 (74%), Positives = 362/422 (86%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYACYKPP   RVPFATFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRSIYLVDYACYKPPVTCRVPFATFMEHSRLNLSNNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  199   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  259   ERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  319   NVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PWADCIH+YPV+IP+++
Sbjct  432   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWADCIHRYPVHIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_007044356.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
 gb|EOY00188.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
Length=496

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/422 (74%), Positives = 360/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYACYKPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYACYKPPVTCRVPFATFMEHSRLILSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYKGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSERWRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRM LHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMALHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMKRGDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMKRGDRIWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>gb|AHX25585.1| 3-ketoacyl-CoA synthase 6 [Nicotiana tabacum]
Length=497

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/422 (73%), Positives = 360/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR +YLVDYAC++PP   R P A+F+EH+QL+ PT PK++ FQ ++LERSGLGE T +
Sbjct  84    SRPRTIYLVDYACFRPPNMFRAPSASFVEHAQLILPTEPKSVRFQMKMLERSGLGEETAL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+ LAREEA+ VIFS+MD LL KT+LNPK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMVLAREEAELVIFSIMDSLLEKTRLNPKFIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ + NSNAV++STEIITPNSYLGK
Sbjct  204   MLINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQHYPNSNAVVISTEIITPNSYLGK  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSMLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK+Y+CVF+QED +G
Sbjct  264   ERSMLLPNCLFRMGGAAILLSNKRKDSSRAKYRLMHVVRTHKGADDKAYRCVFEQEDPQG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  324   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDEL+KNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  377   AYIPDFKQAFEHFCIHAGGRAVIDELRKNLQLSDEHVEASRMTLHRFGNTSSSSLWYEMS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
              +EAKGRM++GDRVWQIAFGSGFKCNSAVWKCNRTI     D PW DCI +YPV+IP I+
Sbjct  437   CMEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRTIKTGT-DGPWEDCIDRYPVFIPKIV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>gb|ABA01490.1| 3-ketoacyl-CoA synthase [Gossypium hirsutum]
Length=492

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/422 (74%), Positives = 359/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYACYKPP   RVPFATFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRSIYLVDYACYKPPVTCRVPFATFMEHSRLNLSNNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMEAARGEAEIVIFSAMDSLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  199   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  259   ERAMLLPNCLFRMGGAAILLSNRRSERWRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  319   NVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PWADCI  YP +IP+++
Sbjct  432   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWADCIQGYPAHIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>gb|AGK30000.1| 3-ketoacyl-CoA synthase 5 [Gossypium raimondii]
Length=496

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/422 (73%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYACYKPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRCIYLVDYACYKPPVTCRVPFATFMEHSRLILSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAEVVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDRAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPGSEQLLFLLTLIGRKVF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             Y+EAKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PW DCIH+YPV+IP+++
Sbjct  436   YLEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKKPT-DGPWEDCIHRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_006344142.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=494

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/425 (72%), Positives = 357/425 (84%), Gaps = 8/425 (2%)
 Frame = +3

Query  393   ISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERT  572
             I SRPR +YLVDYAC+ PP   R+PFA+FMEH+ L+  + PK++ FQ +ILERSGL E T
Sbjct  77    IMSRPRTIYLVDYACFLPPITCRIPFASFMEHAHLILSSEPKSVRFQMKILERSGLSEET  136

Query  573   CVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSL  752
              +PPA+HYIPPTPT+ LAREEA+ VIFS MD LLAKT L PK ID+L+VNCS+FSPTPSL
Sbjct  137   ALPPAMHYIPPTPTMDLAREEAELVIFSAMDSLLAKTGLKPKDIDVLVVNCSLFSPTPSL  196

Query  753   SAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYL  932
             SAM++NKY+LRSN+KSFNLSGMGCSAG+ISIDLARD+LQ + NSNAV++STEI+TPN YL
Sbjct  197   SAMVINKYRLRSNIKSFNLSGMGCSAGVISIDLARDILQQYPNSNAVVISTEILTPNGYL  256

Query  933   GKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDE  1112
             GKERSMLL NCLFR GGAA+LLSNR+ D  RAKYRL+H+VRTH G  DKS++CV QQED 
Sbjct  257   GKERSMLLTNCLFRMGGAAILLSNRKSDRARAKYRLVHIVRTHKGADDKSFRCVQQQEDP  316

Query  1113  EGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspn  1292
             EG VGINLCI+LM+VAGEALKSNIT+IGPLVLP  E ++F++ ++  KL           
Sbjct  317   EGKVGINLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTLICRKLF-------KSK  369

Query  1293  nnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYE  1472
                 +PDFK AFEHFCIHAGGRAVIDELQ NL+LS EHVEASRM L+RFGNTSSSSLWYE
Sbjct  370   MKPYIPDFKLAFEHFCIHAGGRAVIDELQNNLQLSAEHVEASRMALYRFGNTSSSSLWYE  429

Query  1473  MSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLD-TPWADCIHQYPVYIP  1649
             MSYIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  PV D  PWADCI +YPV IP
Sbjct  430   MSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKLPVDDHNPWADCIDRYPVDIP  489

Query  1650  DILKV  1664
             +++++
Sbjct  490   EVVRL  494



>gb|KHN11421.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=460

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 360/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  47    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  106

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  107   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSA  166

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  167   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  226

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR  +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  227   ERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  286

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  287   KVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  339

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  340   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELN  399

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNR+I  PV D PWADCI +YPV+IP+I+
Sbjct  400   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVHIPEIV  458

Query  1659  KV  1664
             K+
Sbjct  459   KL  460



>ref|XP_011099559.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Sesamum indicum]
Length=496

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/426 (72%), Positives = 360/426 (85%), Gaps = 8/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + + S+PR++YLVDY+CYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE
Sbjct  79    VYVMSKPRSIYLVDYSCYKPPVTCRVPFSTFMEHSRLILKDNPKSVDFQMRILERSGLGE  138

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT + PK IDILIVNCS+FSPTP
Sbjct  139   ETCLPPAIHYIPPTPTMEAARGEAEVVIFSTIDSLMEKTGIRPKDIDILIVNCSLFSPTP  198

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAM+VNKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNA+++STEIITPN 
Sbjct  199   SLSAMVVNKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNY  258

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G ER+MLLPNCLFR G AA+LLSN+R D  RAKY+L+HVVRTH G  DK+Y+CV++QE
Sbjct  259   YKGSERAMLLPNCLFRMGAAAILLSNKRRDSARAKYKLVHVVRTHKGADDKAYRCVYEQE  318

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D EG VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +
Sbjct  319   DPEGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKMF-------N  371

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
             P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLW
Sbjct  372   PKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLW  431

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YEMSYIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV+I
Sbjct  432   YEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWQDCIDRYPVHI  490

Query  1647  PDILKV  1664
             P+I+K+
Sbjct  491   PEIVKL  496



>ref|XP_002315942.1| ECERIFERUM 6 family protein [Populus trichocarpa]
 gb|ABK94727.1| unknown [Populus trichocarpa]
 gb|EEF02113.1| ECERIFERUM 6 family protein [Populus trichocarpa]
Length=496

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/422 (73%), Positives = 357/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYACYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARD+LQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR     AKYRL+HVVRTH G  DK+Y+CVF+QED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSHRWLAKYRLVHVVRTHKGADDKAYRCVFEQEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGINLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D+PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DSPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_003555901.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
Length=496

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 360/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR  +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNR+I  PV D PWADCI +YPV+IP+I+
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>gb|KDP29403.1| hypothetical protein JCGZ_18324 [Jatropha curcas]
Length=496

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/422 (73%), Positives = 357/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR ++LVDYACYKPP   RVPF+TFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIFLVDYACYKPPVTCRVPFSTFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MIINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR    RAKYRL+HVVRTH G  DK+Y+CV+++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSQQWRAKYRLVHVVRTHKGADDKAYRCVYEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMAIAGEALKSNITTIGPLVLPASEQILFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNR+I  P LD PWADCI +YPV+IP+++
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTP-LDGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009786212.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana sylvestris]
Length=496

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/422 (73%), Positives = 357/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMEAARGEAEVVIFSAIDDLMKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ H NSNA++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNYYKGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRT  G  DK++KCVF+QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRRDRYRAKYRLMHVVRTQKGADDKAFKCVFEQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K         +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLISRKFF-------NPKLK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWQDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_006302169.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
 gb|EOA35067.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
Length=498

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  85    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  144

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  145   PPAIHYIPPTPTMDAARSEAQMVIFTAMDDLFEKTGLKPKDVDILIVNCSLFSPTPSLSA  204

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  205   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  264

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+L+SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED EG
Sbjct  265   ERAMLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGADDKSFFCVYEQEDREG  324

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  325   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIF-------NPKLK  377

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  378   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  437

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  438   YIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  496

Query  1659  KV  1664
             K+
Sbjct  497   KL  498



>gb|ACZ51240.1| 3-ketoacyl-CoA synthase [Arachis hypogaea]
Length=496

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 359/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCN+TI  P+ D PW DCI +YPV+IP+I+
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTPI-DGPWTDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_004238922.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=494

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/425 (72%), Positives = 358/425 (84%), Gaps = 8/425 (2%)
 Frame = +3

Query  393   ISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERT  572
             I SRPR +YLVDYAC+ PP  +R+PFA+FMEH+ L+  T PK++ FQ +ILERSGL E T
Sbjct  77    IMSRPRTIYLVDYACFLPPITNRIPFASFMEHAHLILSTEPKSVRFQMKILERSGLSEET  136

Query  573   CVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSL  752
              +PP +HYIPPTPT+ LAREEA+ VIFS MD LLAKT L PK ID+L+VNCS+FSPTPSL
Sbjct  137   ALPPPMHYIPPTPTMDLAREEAELVIFSAMDSLLAKTGLKPKDIDVLVVNCSLFSPTPSL  196

Query  753   SAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYL  932
             SAM++NKYKLRSN+KSFNLSGMGCSAG+ISIDLARD+LQ + NSNAV++STEI+TPN YL
Sbjct  197   SAMVINKYKLRSNIKSFNLSGMGCSAGVISIDLARDILQQYPNSNAVVISTEILTPNGYL  256

Query  933   GKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDE  1112
             GKERSMLL NCLFR GGAA+LLSN++ D  R+KYRLLH+VRT  G  DKS++CV QQED 
Sbjct  257   GKERSMLLTNCLFRMGGAAILLSNKKSDRGRSKYRLLHIVRTLKGGDDKSFRCVQQQEDP  316

Query  1113  EGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspn  1292
             EG VGINLCI+LM+VAGEALKSNIT+IGPLVLP  E ++F++ ++  KL          N
Sbjct  317   EGKVGINLCIDLMQVAGEALKSNITTIGPLVLPASEQLLFLLTLICRKLF-------KSN  369

Query  1293  nnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYE  1472
                 +PDFK AFEHFCIHAGGRAVIDELQ NL+LS EHVEASRMTL+RFGNTSSSSLWYE
Sbjct  370   MKPYIPDFKLAFEHFCIHAGGRAVIDELQNNLQLSTEHVEASRMTLYRFGNTSSSSLWYE  429

Query  1473  MSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLD-TPWADCIHQYPVYIP  1649
             MSYIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCN+TI  PV D  PWADCI +YPV IP
Sbjct  430   MSYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKLPVDDHNPWADCIDRYPVDIP  489

Query  1650  DILKV  1664
             D++++
Sbjct  490   DVVRL  494



>gb|KHN05569.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=461

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  48    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  107

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  108   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFDKTGLKPKDIDILIVNCSLFSPTPSLSA  167

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  168   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  227

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR  +  RAKYRL+HVVRTH G  DK+Y+CVF++ED EG
Sbjct  228   ERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDREG  287

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  288   KVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  340

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  341   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELN  400

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNR+I  PV D PWADCI +YPV IP+I+
Sbjct  401   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVDIPEIV  459

Query  1659  KV  1664
             K+
Sbjct  460   KL  461



>ref|XP_010066726.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Eucalyptus grandis]
 gb|KCW64742.1| hypothetical protein EUGRSUZ_G02324 [Eucalyptus grandis]
Length=496

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR ++LVDYACYKPP   RVPF+TFMEHS+L     PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIFLVDYACYKPPVTCRVPFSTFMEHSRLNLKDKPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFSVMD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMESARGEAELVIFSVMDSLFQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARD+LQ H NSNAVIVSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISLDLARDILQVHPNSNAVIVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKYRL+HVVRTH G  DK+Y+CV+++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSDRRRAKYRLVHVVRTHKGADDKAYRCVYEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KAGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++G+RVWQIAFGSGFKCNSAVWKCNRTI  P+ D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGNRVWQIAFGSGFKCNSAVWKCNRTIKTPI-DGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>gb|EYU44641.1| hypothetical protein MIMGU_mgv1a005164mg [Erythranthe guttata]
Length=495

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  82    SKPRSIYLVDYSCYKPPVTCRVPFSTFMEHSRLILNQNPKSVDFQMRILERSGLGEETCL  141

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT + PK IDILIVNCS+FSPTPSLSA
Sbjct  142   PPAIHYIPPTPTMEAARGEAELVIFSSIDSLMHKTGIKPKDIDILIVNCSLFSPTPSLSA  201

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ H NSNA++VSTEIITPN Y G 
Sbjct  202   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNYYQGS  261

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK+Y CV++QED +G
Sbjct  262   ERAMLLPNCLFRMGGAAVLLSNKRRDAARAKYRLVHVVRTHKGADDKAYTCVYEQEDPQG  321

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  322   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  374

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQ+NL+LS EHVEASRMTLHRFGNTSSSSLWYE+ 
Sbjct  375   AYIPDFKLAFEHFCIHAGGRAVIDELQRNLQLSAEHVEASRMTLHRFGNTSSSSLWYELG  434

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW DCIH+YPV+IP+I+
Sbjct  435   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPA-DGPWTDCIHRYPVHIPEIV  493

Query  1659  KV  1664
             K+
Sbjct  494   KL  495



>ref|XP_011097190.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYACYK P   RVPF+TFMEHS+L+   +PK+++FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYACYKAPVTCRVPFSTFMEHSRLILKDNPKSVHFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT + PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMEAARGEAEVVIFSCIDSLMQKTGIKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ H NSNA+++STEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNYYKGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+YKCV++QED EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKSRDSRRAKYKLVHVVRTHKGADDKAYKCVYEQEDPEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMLIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  PV D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPV-DGPWVDCIERYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_007153392.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
 gb|ESW25386.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
Length=543

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/428 (71%), Positives = 361/428 (84%), Gaps = 8/428 (2%)
 Frame = +3

Query  381   YLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGL  560
             + +   S+PR V+LVDYAC++PP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGL
Sbjct  124   FTVYFMSKPRTVFLVDYACFEPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGL  183

Query  561   GERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSP  740
             GE TC+PPAIHYIPP PT++ AR EAQ VIFS M+ L  KT L PK IDILIVNCS+FSP
Sbjct  184   GEETCLPPAIHYIPPKPTMEAARGEAQLVIFSAMESLFRKTGLKPKDIDILIVNCSLFSP  243

Query  741   TPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITP  920
             TPSLSAM++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITP
Sbjct  244   TPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQIHLNSNAVVVSTEIITP  303

Query  921   NSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQ  1100
             N Y G ER+MLLPNCLFR GGAA+LLSNR+ +  RAKYRL+HVVRTH G+ DK+++CVF+
Sbjct  304   NYYQGNERAMLLPNCLFRMGGAAILLSNRKSESSRAKYRLVHVVRTHKGSDDKAFRCVFE  363

Query  1101  QEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqs  1280
             +ED+EG VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F+  ++  K+       
Sbjct  364   EEDKEGKVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLFTLIGRKIF------  417

Query  1281  sspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSS  1460
              +P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSS
Sbjct  418   -NPRWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSS  476

Query  1461  LWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             LWYE++YIE+KGRMKRGDRVWQIAFGSGFKCNSAVWKCNR+I  P  D PW+DCIH YPV
Sbjct  477   LWYELNYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRSIETP-FDGPWSDCIHSYPV  535

Query  1641  YIPDILKV  1664
             +IP+I+K+
Sbjct  536   HIPEIVKL  543



>ref|XP_004299082.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/423 (72%), Positives = 359/423 (85%), Gaps = 8/423 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+++LVDYACYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIFLVDYACYKPPVTCRVPFSTFMEHSRLILSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPQPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  203   MVINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+++CVF++ED EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSESRRAKYRLVHVVRTHKGADDKAFRCVFEEEDREG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  KL+       +P   
Sbjct  323   KVGISLQKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKLV-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPV-LDTPWADCIHQYPVYIPDI  1655
             YIEAKGRM++GDRVWQIAFGSGFKCNSAVWKCNRTI      D+PWADCI +YPV+IPD+
Sbjct  436   YIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRTIKTAENDDSPWADCIERYPVHIPDV  495

Query  1656  LKV  1664
             +K+
Sbjct  496   VKL  498



>gb|AIV98044.1| 3-ketoacyl-CoA synthase, partial [Malus domestica]
Length=415

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 356/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  2     SKPRPIYLVDYACFKPPVMCRVPFSTFMEHSRLILSNNPKSVEFQMRILERSGLGEETCL  61

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  62    PPAIHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  121

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  122   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  181

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTH G  DK+YKCVF++ED+EG
Sbjct  182   ERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEG  241

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K++       +P   
Sbjct  242   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLITLIGRKIL-------NPKWK  294

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF++AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  295   PYIPDFRQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  354

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQIAFGSGFKCNSAVWKCNR I     D PWADCI +YPV+IP+++
Sbjct  355   YIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRAIK-TASDGPWADCIDRYPVHIPEVV  413

Query  1659  KV  1664
             K+
Sbjct  414   KL  415



>ref|XP_003536684.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Glycine max]
Length=496

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFNKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR  +  RAKYRL+HVVRTH G  DK+Y+CVF++ED EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRTSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDREG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNR+I  PV D PWADCI +YPV IP+I+
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPV-DGPWADCIDRYPVDIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_006391129.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
 gb|ESQ28415.1| hypothetical protein EUTSA_v10018446mg [Eutrema salsugineum]
Length=497

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EAQ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMEEARSEAQMVIFTAMDDLFKKTGLMPKDIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYKGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+L+SNRR D  RAKY+L H+VRTH G  DKSY CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGSAAILMSNRRSDRWRAKYKLCHLVRTHRGADDKSYYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +GINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  324   NIGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI     D PW+DCI +YPV+IP+++
Sbjct  437   YIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIK-TTNDGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_009598968.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana tomentosiformis]
Length=496

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT+L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMEAARGEAEVVIFSAVDDLMKKTRLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ H NSNA++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNYYKGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLS++R D  RAKYRL+HVVRTH G  DK++KCVF+QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSSKRRDRYRAKYRLMHVVRTHKGADDKAFKCVFEQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLISRKIF-------NPKLK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK L+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKKLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI     D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTST-DGPWQDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_003614634.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES97592.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/421 (72%), Positives = 358/421 (85%), Gaps = 8/421 (2%)
 Frame = +3

Query  402   RPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVP  581
             +PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+P
Sbjct  84    KPRTIYLVDYACFKPPITCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETCLP  143

Query  582   PAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAM  761
             PAIHYIPP PT++ AR EA+ VIFS MD L AKT L PK IDILIVNCS+FSPTPSLSAM
Sbjct  144   PAIHYIPPKPTMEEARREAELVIFSSMDTLFAKTGLKPKDIDILIVNCSLFSPTPSLSAM  203

Query  762   IVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKE  941
             ++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ + NSNAV+VSTEIITPN Y GKE
Sbjct  204   VINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVYPNSNAVVVSTEIITPNYYQGKE  263

Query  942   RSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGF  1121
             R+MLLPNCLFR GGAA+LLSN++ + +RAKYRL+ VVRTH G  DK+Y+CVF++ED EG 
Sbjct  264   RAMLLPNCLFRMGGAAILLSNKKAEHKRAKYRLMQVVRTHKGGDDKAYRCVFEEEDREGK  323

Query  1122  VGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnk  1301
             VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P    
Sbjct  324   VGISLQKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGKKIF-------NPKMKP  376

Query  1302  kVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSY  1481
              +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++Y
Sbjct  377   YIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELNY  436

Query  1482  IEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDILK  1661
             IE+KGRMKRGDRVWQIAFGSGFKCNSAVWKCNR+I  PV + PW DCI +YPV+IP+I+K
Sbjct  437   IESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRSIKTPV-NGPWEDCIDRYPVHIPEIVK  495

Query  1662  V  1664
             +
Sbjct  496   L  496



>ref|XP_006363119.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
 gb|ACF17125.1| CER6 [Solanum tuberosum]
Length=496

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 356/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMETARNEAEVVIFSAIDDLMQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ   NS A++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVVPNSCALVVSTEIITPNYYQGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK++KCVFQQED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRKDSRRAKYRLMHVVRTHKGADDKAFKCVFQQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLH+FGNTSSSSLWYEMS
Sbjct  376   AYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHKFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWDDCIDRYPVFIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_003637444.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH44222.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PP+IHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPSIHYIPPKPTMESARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA++LSNR  +  RAKYRL+HVVRTH G  DK+YKCVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAIMLSNRTTEKRRAKYRLVHVVRTHKGGDDKAYKCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLITLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNR+I  P+ D PW DCI +YPV+IP+I+
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPI-DGPWTDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_004232364.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=496

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 356/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMETARNEAEVVIFSAIDDLMKKTGLKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ   NS A++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSCALVVSTEIITPNYYQGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK++KCVFQQED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRKDSARAKYRLMHVVRTHKGADDKAFKCVFQQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLH+FGNTSSSSLWYEMS
Sbjct  376   AYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHKFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWDDCIDRYPVFIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_004135091.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159296.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
Length=450

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 359/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR ++LVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  37    SKPRTIFLVDYACFKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  96

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  97    PPAIHYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSA  156

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  157   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  216

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF+++D+EG
Sbjct  217   ERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEG  276

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  277   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  329

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHR+GNTSSSSLWYE+ 
Sbjct  330   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRWGNTSSSSLWYELG  389

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCN+TI  P+ D PWADCI +YPV+IP+++
Sbjct  390   YIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPI-DGPWADCIDRYPVHIPEVV  448

Query  1659  KV  1664
             K+
Sbjct  449   KL  450



>ref|XP_009356269.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 356/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+VYLVDYAC+KPP   RVPF+TFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSVYLVDYACFKPPVTCRVPFSTFMEHSRLNLSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPNPTMETARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y GK
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNR+ +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAALLLSNRKSEHRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K++       +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIL-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFREAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI     D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTI-TTTSDGPWADCIDKYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_003531926.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
 gb|KHN14249.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=496

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/432 (71%), Positives = 366/432 (85%), Gaps = 13/432 (3%)
 Frame = +3

Query  384   LIIIS-----SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILE  548
             LIII+     S+PR ++LVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILE
Sbjct  73    LIIIATIYFMSKPRTIFLVDYACFKPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILE  132

Query  549   RSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCS  728
             RSGLGE TC+PPAIHYIPP PT++ AR EA+ V+FS +D L  KT L PK IDILIVNCS
Sbjct  133   RSGLGEETCLPPAIHYIPPKPTMEAARGEAEHVVFSAVDSLFKKTGLKPKDIDILIVNCS  192

Query  729   MFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTE  908
             +FSPTPSLSAM++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAVIVSTE
Sbjct  193   LFSPTPSLSAMVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVIVSTE  252

Query  909   IITPNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYK  1088
             IITPN Y G ER+MLLPNCLFR GGAA+LLSNR+ + +RAKYRL+HVVRTH G+ +K+++
Sbjct  253   IITPNYYQGNERAMLLPNCLFRMGGAAILLSNRKQERKRAKYRLVHVVRTHKGSNEKAFR  312

Query  1089  CVFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMss  1268
             CVF++ED+EG VGI+L  +LM +AGEALKSNITS+GPLVLP  E ++F++ ++  K+   
Sbjct  313   CVFEEEDKEGKVGISLSKDLMAIAGEALKSNITSMGPLVLPASEQLLFLLTLIGRKIF--  370

Query  1269  ksqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNT  1448
                  +P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNT
Sbjct  371   -----NPRWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNT  425

Query  1449  SSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIH  1628
             SSSSLWYE++YIE+KGRMKRGDRVWQIAFGSGFKCNSAVW+CNR+I  P  D PWADCI 
Sbjct  426   SSSSLWYELNYIESKGRMKRGDRVWQIAFGSGFKCNSAVWRCNRSIQTP-FDGPWADCID  484

Query  1629  QYPVYIPDILKV  1664
             +YPV+IP+I+K+
Sbjct  485   RYPVHIPEIVKL  496



>gb|AAM65060.1| very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
Length=492

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF  MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  199   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+ +SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED+EG
Sbjct  259   ERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  432   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_004497096.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cicer arietinum]
Length=496

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 360/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE T +
Sbjct  83    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETSL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD LL KT L PK IDILI+NCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMESARGEAELVIFSAMDSLLNKTGLKPKDIDILIINCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNA++VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAIVVSTEIITPNYYKGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR  + +RAKYRL+HVVRTH G  DK+++CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRGSESKRAKYRLVHVVRTHKGGDDKAFRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  PV D  W+DCIH+YPV+IP+I+
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPV-DGAWSDCIHRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009105040.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Brassica rapa]
 emb|CDY07381.1| BnaA07g24600D [Brassica napus]
Length=497

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRLILKDSPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDEARSEAQMVIFTAMDDLFKKTGLLPKDIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAVIVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNYYKGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+L+SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED EG
Sbjct  264   ERAMLLPNCLFRMGSAAILMSNRRSDRWRAKYKLCHLVRTHRGADDKSFYCVYEQEDREG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +GINL  +LM +AGEALK+NIT+IGPLVLP  E ++F++ ++  K+        +    
Sbjct  324   KIGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIF-------NLKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+ 
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELC  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_008446598.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Cucumis melo]
Length=496

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 360/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR ++LVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIFLVDYACFKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF+++D+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHR+GNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRWGNTSSSSLWYELA  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDR+WQIAFGSGFKCNSAVWKCN+TI  PV D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPV-DGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>gb|AAL50069.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
 gb|AAM16230.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
Length=497

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF  MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+ +SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  324   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|NP_177020.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
 sp|Q9XF43.1|KCS6_ARATH RecName: Full=3-ketoacyl-CoA synthase 6; Short=KCS-6; AltName: 
Full=Cuticular protein 1; AltName: Full=Very long-chain fatty 
acid condensing enzyme 6; Short=VLCFA condensing enzyme 
6 [Arabidopsis thaliana]
 gb|AAD37122.1|AF129511_1 very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
 gb|AAG52390.1|AC011915_4 very-long-chain fatty acid condensing enzyme (CUT1); 56079-54227 
[Arabidopsis thaliana]
 gb|AEE34804.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
Length=497

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF  MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAQMVIFEAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+ +SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  324   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_004135090.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159295.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 gb|KGN52079.1| hypothetical protein Csa_5G609650 [Cucumis sativus]
Length=496

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 359/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR ++LVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIFLVDYACFKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDALFQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF+++D+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEQDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHR+GNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRWGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCN+TI  P+ D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPI-DGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_010511851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Camelina sativa]
Length=497

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE T +
Sbjct  84    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETSL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAQLVIFTAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KS NLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSVNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+L+SNRR D  RAKY+L H+VRTH G+ DKS+ CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGSDDKSFYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  324   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIF-------NPKLK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_006307339.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
 gb|EOA40237.1| hypothetical protein CARUB_v10008957mg [Capsella rubella]
Length=492

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 355/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EAQ VIF+ M+ L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPAPTMESARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KSFNLSGMGCSAGLIS+D+ARDLLQ H NSNAVI+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSFNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DKSY CV ++ED+EG
Sbjct  259   ERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKSYYCVMEEEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK+L+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRSDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWSDCIDRYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>gb|KFK41273.1| hypothetical protein AALP_AA2G108700 [Arabis alpina]
Length=497

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDEARSEAQMVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYKGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+ +SNR  D  RAKY+L H+VRTH G  DKSY CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGAAAIHMSNRNSDRWRAKYKLCHLVRTHRGADDKSYYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  324   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>gb|EPS61116.1| hypothetical protein M569_13682, partial [Genlisea aurea]
Length=504

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/424 (71%), Positives = 360/424 (85%), Gaps = 8/424 (2%)
 Frame = +3

Query  393   ISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERT  572
             ++S+PR++YLVDYACYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE T
Sbjct  89    VTSKPRSIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNPKSVDFQMRILERSGLGEET  148

Query  573   CVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSL  752
             C+PPAIHYIPP P ++ AR EA+ VIFS +D L+ KT + PK IDILIVNCS+FSPTPSL
Sbjct  149   CLPPAIHYIPPKPNMEAARGEAEVVIFSSIDALMKKTGIKPKDIDILIVNCSLFSPTPSL  208

Query  753   SAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYL  932
             SAMIVNKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NS A+++STEIITPN Y 
Sbjct  209   SAMIVNKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYQ  268

Query  933   GKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDE  1112
             G ER+MLLPNCLFR GGAA+LLSN+R DG RAKYRL+HVVRTH G  DK+YKCV++QED 
Sbjct  269   GSERAMLLPNCLFRMGGAAILLSNKRRDGGRAKYRLVHVVRTHKGADDKAYKCVYEQEDP  328

Query  1113  EGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspn  1292
             +G VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+V ++  K+        +P 
Sbjct  329   QGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLVTLIGRKIF-------NPK  381

Query  1293  nnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYE  1472
                 +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE
Sbjct  382   WKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSSSLWYE  441

Query  1473  MSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPD  1652
             ++Y+EAK RMK+GDRVWQIAFGSGFKCNSAVWKCN T+  PV D PW+DCI +YPV+IP+
Sbjct  442   LAYVEAKNRMKKGDRVWQIAFGSGFKCNSAVWKCNTTVKNPV-DGPWSDCIERYPVHIPE  500

Query  1653  ILKV  1664
             I+K+
Sbjct  501   IVKL  504



>ref|XP_006415873.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
 gb|ESQ34226.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
Length=496

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 355/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPFATFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTVYLVDYSCYKPPVTCRVPFATFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPIPTMESARSEAEMVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KS NLSGMGCSAGLIS+D+ARDLLQ H NSNAVIVSTEIITPN Y GK
Sbjct  203   MVINKYKLRSNIKSLNLSGMGCSAGLISVDVARDLLQVHPNSNAVIVSTEIITPNYYQGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+LLSNRR D  RAKY+L H+VRTH G +DKS+ CV++Q+D+EG
Sbjct  263   ERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHKGAEDKSFYCVYEQQDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AG+ALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   HVGINLSKDLMAIAGDALKSNITTIGPLVLPASEQLLFLTSLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQK+L+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKMAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTI  P  + PW+DCI +YPV+IP+++
Sbjct  436   YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKSPT-EGPWSDCIDRYPVFIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_010415473.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
 ref|XP_010470803.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
Length=497

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 353/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE T +
Sbjct  84    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLILKDKPKSVEFQMRILERSGLGEETSL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAQLVIFTAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KS NLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSVNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+L+SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGAAAILMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  324   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIF-------NPKLK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_008389290.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Malus domestica]
Length=496

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYAC+KPP   RVPF+TFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYACFKPPVTCRVPFSTFMEHSRLNLSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K++       +P   
Sbjct  323   NVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIL-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFREAFEHFCIHAGGRAVIDELQKNLQLSXEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI     D PWADCI  YPV+IP+++
Sbjct  436   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTI-TTTSDGPWADCIDNYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>emb|CDY04232.1| BnaC06g25830D [Brassica napus]
Length=497

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 351/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+P  VYLVDY+CYKPP   RVPFATFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPCTVYLVDYSCYKPPVTCRVPFATFMEHSRLILKDSPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDEARSEAQMVIFTAMDDLFKKTGLLPKDIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAVIVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNYYKGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+L+SNRR D  RAKY+L H+VRTH G  DKSY CV++QED EG
Sbjct  264   ERAMLLPNCLFRMGSAAILMSNRRSDRWRAKYKLCHLVRTHRGADDKSYYCVYEQEDREG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +GINL  +LM +AGEALK+NIT+IGPLVLP  E ++F++ ++  K+        +    
Sbjct  324   KIGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLLSLIGRKIF-------NLKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+ 
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELC  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_011076851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYA +KPP + RV FA FMEH++L   T PK+++FQ +ILERSGLGE TC+
Sbjct  83    SRPRTVYLVDYALFKPPRSLRVSFAGFMEHAKLALFTEPKSVHFQMKILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP+P +  AREEA+ VIFS MD L  KT L PK +DILI+NCS+FSPTPSL+A
Sbjct  143   PPAIHYIPPSPNMAHAREEAEFVIFSCMDSLFQKTGLKPKDVDILILNCSLFSPTPSLTA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYK+RSN+KSFNLSGMGCSAGLISIDLA+DLLQ H NSNAV++STEI+TPN YLGK
Sbjct  203   MVINKYKMRSNIKSFNLSGMGCSAGLISIDLAKDLLQYHPNSNAVVISTEILTPNIYLGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKYRL HVVRTH G  DKSY+C+ Q+ED EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRADRRRAKYRLAHVVRTHKGADDKSYRCISQEEDPEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI L I+LM +AGEALKSNIT+IGPLVLP  E ++F + ++  K+        +    
Sbjct  323   HVGIKLNIDLMAIAGEALKSNITTIGPLVLPASEQILFALSLIGRKIF-------NSKLK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK+L+L+ E VEASRMTLHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLTEEQVEASRMTLHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  PV + PWADCI +YPVYIP+++
Sbjct  436   YIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPV-EGPWADCIDKYPVYIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009356268.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Pyrus x bretschneideri]
Length=496

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/422 (73%), Positives = 355/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+VYLVDYAC+KPP   RVPF+TFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSVYLVDYACFKPPVTCRVPFSTFMEHSRLNLSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPNPTMEDARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARD+LQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTH G  DK+YKCVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K++       +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIL-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFRLAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI     D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTI-TTTSDGPWADCIDKYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_006344141.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=493

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 353/423 (83%), Gaps = 9/423 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYACYKPP + RVPF+ FMEHS+++  + PK++ FQ +ILERSGLGE TC+
Sbjct  79    SRPRGVYLVDYACYKPPLSLRVPFSIFMEHSRIILSSEPKSVEFQLKILERSGLGEDTCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP P++  AREEA+ VIFSVMD L  KTQ+ PK ID LIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPAPSMDTAREEAEMVIFSVMDSLFKKTQVKPKDIDFLIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYK+R N+KS+NLSGMGCSAGLISIDLARDLLQ H  S AV+VSTEIITPN Y GK
Sbjct  199   MVVNKYKMRDNIKSYNLSGMGCSAGLISIDLARDLLQVHPKSIAVVVSTEIITPNYYRGK  258

Query  939   ERSMLLPNCLFRTGGAALLLSNR-RVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEE  1115
             +RSMLLPNCLFR GGAA+LLSN+   D  RAKY+LLH VRTH G+ DKSY CVF+ ED E
Sbjct  259   DRSMLLPNCLFRMGGAAILLSNKWWADQRRAKYKLLHTVRTHKGSNDKSYNCVFETEDSE  318

Query  1116  GFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnn  1295
             G  GI+L  +LM +AGEALKSNITS+GPLVLP  E ++F++ ++  K+        +   
Sbjct  319   GKTGISLSKDLMAIAGEALKSNITSLGPLVLPPSEQLLFLLSLIGRKVF-------NTKL  371

Query  1296  nkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEM  1475
                +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+
Sbjct  372   KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEL  431

Query  1476  SYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDI  1655
             SYIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCN+TI  P  D PW+DCIH+YPVYIP+I
Sbjct  432   SYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPS-DGPWSDCIHKYPVYIPEI  490

Query  1656  LKV  1664
             +K+
Sbjct  491   VKL  493



>ref|XP_007142908.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
 gb|ESW14902.1| hypothetical protein PHAVU_007G027100g [Phaseolus vulgaris]
Length=496

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/422 (72%), Positives = 357/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PP+IHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPSIHYIPPKPTMEAARGEAELVIFSAMDSLFTKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR  +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRSNERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLQKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSTEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMKRGDRVWQIAFGSGFKCNSAVWKCNR I  PV D  W+DCI +YPV+IP+I+
Sbjct  436   YIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRNIKTPV-DGAWSDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_008243224.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Prunus mume]
Length=496

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 358/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR V+LVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTVFLVDYACFKPPVTCRVPFSTFMEHSRLILSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT+  AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPNPTMDAARGEAELVIFSAMDALFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN++SFNLSGMGCSAG+ISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIRSFNLSGMGCSAGVISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTH G+ DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAALLLSNRRSERRRAKYRLVHVVRTHKGSDDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K++       +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIV-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQIAFGSGFKCNSAVWKCNR+I  P  + PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRSIEKPS-EGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_002888670.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64929.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 353/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+CYKPP   RVPFATFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTIYLVDYSCYKPPVTCRVPFATFMEHSRLNLKDNPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EAQ VIF+ MD L  KT L PK +DILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAQMVIFTAMDDLFKKTGLKPKDVDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNA+IVSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAIIVSTEIITPNYYQGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+ +SNRR D  RAKY+L H+VRTH G  DKS+ CV++QED+EG
Sbjct  264   ERAMLLPNCLFRMGAAAIHMSNRRSDRWRAKYKLSHLVRTHRGADDKSFYCVYEQEDKEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  324   HVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLTSLIGRKIF-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KG+M+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+DCI +YPV+IP+++
Sbjct  437   YIESKGKMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPK-DGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>gb|EYU34398.1| hypothetical protein MIMGU_mgv1a005204mg [Erythranthe guttata]
Length=493

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/424 (72%), Positives = 355/424 (84%), Gaps = 9/424 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYACYKPP   RVPF+TFMEHS+L    +PK++ FQ +ILERSGLGE TC+
Sbjct  77    SKPRSIYLVDYACYKPPVTFRVPFSTFMEHSRLNLKENPKSVDFQMRILERSGLGEETCL  136

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EA+ VIFS +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  137   PPAIHYIPPTPTMDAARGEAELVIFSTIDSLMEKTNLKPKDIDILIVNCSLFSPTPSLSA  196

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NS A+IVSTEIITPN Y G 
Sbjct  197   MIVNKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSRALIVSTEIITPNYYKGS  256

Query  939   ERSMLLPNCLFRTGGAALLLSN-RRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEE  1115
             ER+MLLPNCLFR GGAA+LLSN RR D  R+KY+L+HVVRTH G  DK+YKCV++QED E
Sbjct  257   ERAMLLPNCLFRMGGAAILLSNKRRRDAARSKYKLVHVVRTHKGADDKAYKCVYEQEDPE  316

Query  1116  GFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnn  1295
             G VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P  
Sbjct  317   GKVGINLSKDLMLIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKW  369

Query  1296  nkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEM  1475
                +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+
Sbjct  370   KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEL  429

Query  1476  SYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIH-PPVLDTPWADCIHQYPVYIPD  1652
              YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRT+      D PW DCIH+YPV+IP+
Sbjct  430   GYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTVRIDSDGDGPWQDCIHRYPVHIPE  489

Query  1653  ILKV  1664
             ++K+
Sbjct  490   VVKL  493



>ref|XP_008339680.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Malus domestica]
Length=496

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 355/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRPIYLVDYACFKPPVMCRVPFSTFMEHSRLILSNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P AIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PXAIHYIPPNPTMEAARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTH G  DK+YKCVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K++       +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLITLIGRKIL-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF++AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFRQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQIAFGSGFKCNSAVWKCNR I     D PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRAIKTAS-DGPWADCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_006346917.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=496

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/422 (72%), Positives = 355/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+ YLVDY+CYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSTYLVDYSCYKPPVVCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P  IHYIPPTPT++ AR EA+ VIF+ +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PRPIHYIPPTPTMEAARGEAEEVIFTTIDDLMNKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ H NS A+++STEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYKGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK++KCVF+QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRRDRYRAKYRLMHVVRTHKGADDKAFKCVFEQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VG+NL  +LM +AGEALKSNIT+IGPLVLP  E ++F + ++  K+        +P   
Sbjct  323   KVGVNLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFQLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW  CI +YPV+IPDI+
Sbjct  436   YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWQHCIDKYPVHIPDIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_004238923.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=494

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/423 (72%), Positives = 353/423 (83%), Gaps = 9/423 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYACYKPP + RV F+ FMEHS+++  + PK++ FQ +ILERS LGE TC+
Sbjct  80    SRPRGVYLVDYACYKPPLSLRVSFSIFMEHSRIILSSEPKSVEFQLKILERSCLGEDTCL  139

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP P+L  AREEAQ VIFSVMD L  KT+L PK IDILIVNCS+FSPTPSLSA
Sbjct  140   PPAIHYIPPAPSLDTAREEAQMVIFSVMDSLFKKTELKPKDIDILIVNCSLFSPTPSLSA  199

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYK+R NVKS+NLSGMGCSAGLISIDLARDLL+ H  S AV+VSTEIITPN Y GK
Sbjct  200   MVVNKYKMRDNVKSYNLSGMGCSAGLISIDLARDLLRVHPKSIAVVVSTEIITPNYYRGK  259

Query  939   ERSMLLPNCLFRTGGAALLLSNR-RVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEE  1115
             +RSMLLPNCLFR GGAA+LLSN+  +D  RAKY+LLH VRTH G+ DKSY CV++ ED E
Sbjct  260   DRSMLLPNCLFRMGGAAILLSNKWWIDLRRAKYKLLHTVRTHKGSNDKSYNCVYETEDSE  319

Query  1116  GFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnn  1295
             G  GI+L  +LM +AGEALKSNITS+GPLVLP  E ++F++ ++  K+        +   
Sbjct  320   GKTGISLSKDLMAIAGEALKSNITSLGPLVLPPSEQLLFLLSLIGRKVF-------NTKL  372

Query  1296  nkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEM  1475
                +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+
Sbjct  373   KPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEL  432

Query  1476  SYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDI  1655
             SYIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCN+TI  P  D PW+DCIH+YPVYIP+I
Sbjct  433   SYIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIETPT-DGPWSDCIHKYPVYIPEI  491

Query  1656  LKV  1664
             +K+
Sbjct  492   VKL  494



>ref|XP_004233492.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=496

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 357/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P + HYIPPTPT+  AR EA+ VIF+ +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PHSTHYIPPTPTMDAARGEAEEVIFTSIDDLMNKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ H NS A+++STEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYRGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN++ D  RAKYRL+HVVRTH G  DK++KCVF+QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKKRDQYRAKYRLMHVVRTHKGADDKAFKCVFEQEDSQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAK RMKRGDRVWQIAFGSGFKCNSAVWKCNRTI+ P  D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKRRMKRGDRVWQIAFGSGFKCNSAVWKCNRTINTPN-DGPWQDCIDKYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|NP_173916.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
 sp|Q9C6L5.1|KCS5_ARATH RecName: Full=3-ketoacyl-CoA synthase 5; Short=KCS-5; AltName: 
Full=Very long-chain fatty acid condensing enzyme 5; Short=VLCFA 
condensing enzyme 5 [Arabidopsis thaliana]
 gb|AAG50800.1|AC079281_2 fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
 gb|AEE30626.1| 3-ketoacyl-CoA synthase 5 [Arabidopsis thaliana]
Length=492

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/422 (71%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EAQ VIF+ M+ L   T L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSA LIS+D+ARDLLQ H NSNA+I+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNSNAIIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DKSY CV +QED+ G
Sbjct  259   ERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKCNRTI  P  D  W+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGAWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_002311457.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
 gb|EEE88824.1| hypothetical protein POPTR_0008s11920g [Populus trichocarpa]
Length=496

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/427 (71%), Positives = 356/427 (83%), Gaps = 8/427 (2%)
 Frame = +3

Query  384   LIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLG  563
             ++   S+PR +YLVDYACYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLG
Sbjct  78    IVYFMSKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLG  137

Query  564   ERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPT  743
             E TC+PP+IHYIPP PT++ AR EA+ VIFS MD L  KT + PK IDILIVNCS+FSPT
Sbjct  138   EETCLPPSIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGIKPKDIDILIVNCSLFSPT  197

Query  744   PSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPN  923
             PSLSAMI+NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H N+NAV+VSTEIITPN
Sbjct  198   PSLSAMIINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNANAVVVSTEIITPN  257

Query  924   SYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQ  1103
              Y G ER+MLLPNCLFR GG+A+LLSNRR     AKYRL+HVVRTH G  DK+Y+CVF++
Sbjct  258   YYQGNERAMLLPNCLFRMGGSAILLSNRRSHRWSAKYRLVHVVRTHKGVDDKAYRCVFEE  317

Query  1104  EDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqss  1283
             ED EG VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ +V  K+        
Sbjct  318   EDREGKVGINLSKDLMTIAGEALKSNITTIGPLVLPASEQLLFLLTLVGRKIF-------  370

Query  1284  spnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSL  1463
             +P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSL
Sbjct  371   NPKWKPFIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSL  430

Query  1464  WYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVY  1643
             WYE+ YIE KGRM+RG+RVWQIAFGSGFKCNSAVWKCNRTI  PV D PW DCI +YPV+
Sbjct  431   WYELGYIEEKGRMRRGNRVWQIAFGSGFKCNSAVWKCNRTIKTPV-DGPWVDCIDRYPVH  489

Query  1644  IPDILKV  1664
             IP+++K+
Sbjct  490   IPEVVKL  496



>ref|XP_002890689.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66948.1| hypothetical protein ARALYDRAFT_472828 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 351/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EAQ VIF+ M+ L   T L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSA LIS+D+ RDLLQ H NSNAVI+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSASLISVDVVRDLLQVHPNSNAVIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNR+ D  RAKY+L H+VRTH G  DKSY CV +QED+ G
Sbjct  259   ERAMLLPNCLFRMGGAAILLSNRKSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKSNITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMKR DRVWQIAFGSGFKCNSAVWKCNRTI  P  D  W+DCI +YPV+IP+++
Sbjct  432   YIEAKGRMKRSDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGAWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_002282526.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=496

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/422 (71%), Positives = 355/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYACYKPP   RVPFATFMEH++LV  + PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYACYKPPVMLRVPFATFMEHARLVLSSQPKSVEFQTRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P  +HYIPP PT++ AR+EAQ VIFS MD LL KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PLTVHYIPPRPTMEAARDEAQLVIFSAMDSLLNKTGLKPKDIDILIVNCSIFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYK+RSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKMRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNCYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +R+ML+PNCLFR GGAA+LL+NRR +  RAKYRL+HVVRTH G  DK+Y+CV ++ED EG
Sbjct  263   QRAMLVPNCLFRMGGAAILLTNRRWEHRRAKYRLVHVVRTHKGADDKAYRCVMEEEDPEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALK+NIT+ GPLVLP  E ++F++ ++  K+          N  
Sbjct  323   KVGISLSKDLMVIAGEALKTNITTTGPLVLPASEQLLFLLTLIGRKIF-------KQNWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQ+NL+LS EHVEASRM LHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKLAFEHFCIHAGGRAVIDELQQNLQLSAEHVEASRMALHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSA+WKCNR+I PP  D PW DCIH+YPV+IP+++
Sbjct  436   YIEAKGRMKKGDRIWQIAFGSGFKCNSAIWKCNRSIEPP-RDGPWLDCIHRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009115318.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Brassica rapa]
Length=497

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 349/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+C+KPP   RVPFATFMEHS+L     PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTIYLVDYSCFKPPVTCRVPFATFMEHSRLNLIDSPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EA+ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAELVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS NLSGMGCSA LIS+D+ARDLLQ H NSNAVIVSTEIITPN Y GK
Sbjct  204   MIINKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAVIVSTEIITPNYYQGK  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+LLSNRR D  RAKY+L H+VRTH G +DKSY CV+QQED+E 
Sbjct  264   ERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAEDKSYYCVYQQEDDES  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +    
Sbjct  324   HVGINLNKDLMAIAGEALKSNITTIGPLVLPASEQLLFLTSLIGRKIF-------NAKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKMAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKG+MKRGDRVWQIAFGSGFKCNSAVWK NRTI  P  + PW+DCI +YPV+IP+++
Sbjct  437   YIEAKGKMKRGDRVWQIAFGSGFKCNSAVWKSNRTIKTPT-EGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>gb|ACT21783.1| CER6 [Solanum lycopersicum]
Length=496

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS +D L+ KT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMETARNEAEVVIFSAIDDLMKKTGLKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ   NS A++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSCALVVSTEIITPNYYQGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK++KCVFQQED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRKDSARAKYRLMHVVRTHKGADDKAFKCVFQQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEH CIHAGGRAVIDELQKNL+LS EHVEAS+MTLH+FGNTS SSLWYEMS
Sbjct  376   AYIPDFKQAFEHSCIHAGGRAVIDELQKNLQLSAEHVEASKMTLHKFGNTSPSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV+IP+I+
Sbjct  436   YIEAKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWDDCIDRYPVFIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009597817.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana tomentosiformis]
Length=496

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +P+++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPESVKFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPPTPT++ AR EA+ VIFS +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPACHYIPPTPTMESARNEAEVVIFSAIDNLMKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ   NS+A++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSSALVVSTEIITPNYYQGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK+Y+CVF+QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRKDSSRAKYRLMHVVRTHKGADDKAYRCVFEQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   AYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSDEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDR+WQIAFGSGFKCNSAVWKCNRTI     D PW DCI +YPV+IP I+
Sbjct  436   YIEAKGRMRKGDRIWQIAFGSGFKCNSAVWKCNRTIKTGT-DGPWEDCIDRYPVFIPKIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_011007926.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Populus euphratica]
Length=495

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/421 (72%), Positives = 352/421 (84%), Gaps = 8/421 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYACYKPP   RVPF+TFMEHS+L+   +PK++ FQ ++LERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNPKSVDFQMRVLERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KSFNLSGMGCSAGLISIDLARD+LQ H NSN V+VSTEIITPN Y G 
Sbjct  203   MIINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNVVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR     AKYRL+HVVRTH G  D +Y+CV++QED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRSHRWFAKYRLVHVVRTHKGADDIAYRCVYEQEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGINLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVE SRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEPSRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQIAFGSGFKCNSAVWKCNRTI  P  D+PWADCI +YPV+IP+++
Sbjct  436   YIEAKGRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DSPWADCIDRYPVHIPEVV  494

Query  1659  K  1661
              
Sbjct  495   N  495



>emb|CDY42109.1| BnaA09g28510D [Brassica napus]
Length=497

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/422 (72%), Positives = 349/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDY+C+KPP   RVPFATFMEHS+L     PK++ FQ +ILERSGLGE TC+
Sbjct  84    SKPRTIYLVDYSCFKPPVTCRVPFATFMEHSRLNLIDSPKSVEFQMRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT+  AR EA+ VIF+ MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  144   PPAIHYIPPTPTMDAARSEAELVIFTAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS NLSGMGCSA LIS+D+ARDLLQ H NSNAVIVSTEIITPN Y GK
Sbjct  204   MIINKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAVIVSTEIITPNYYQGK  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+LLSNRR D  RAKY+L H+VRTH G +DKSY CV+QQED+E 
Sbjct  264   ERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGAEDKSYYCVYQQEDDES  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +    
Sbjct  324   HVGINLNKDLMAIAGEALKSNITTIGPLVLPASEQLLFLTSLIGRKI-------YNAKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  377   PYIPDFKMAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELS  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKG+MKRGDRVWQIAFGSGFKCNSAVWK NRTI  P  + PW+DCI +YPV+IP+++
Sbjct  437   YIEAKGKMKRGDRVWQIAFGSGFKCNSAVWKSNRTIKTPT-EGPWSDCIDRYPVFIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_009784659.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Nicotiana sylvestris]
Length=496

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDY+CYK P   RVPF+TFMEHS+L+   +P+++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSIYLVDYSCYKAPVTCRVPFSTFMEHSRLILKDNPESVKFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPPTPT++ AR EA+ VIFS +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPACHYIPPTPTMESARTEAEVVIFSAIDNLMKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KS+NLSGMGCSAGLISIDLARDLLQ   NS+A++VSTEIITPN Y G 
Sbjct  203   MVVNKYKLRSNIKSYNLSGMGCSAGLISIDLARDLLQVLPNSSALVVSTEIITPNYYQGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R D  RAKYRL+HVVRTH G  DK+Y+CVF+QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRKDSSRAKYRLMHVVRTHKGADDKAYRCVFEQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   AYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSDEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             Y+EAKGRM++GDRVWQIAFGSGFKCNSAVWKCNRTI     D PW DCI +YPV+IP I+
Sbjct  436   YMEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRTIKTGT-DGPWEDCIDRYPVFIPKIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_010499108.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Camelina sativa]
Length=492

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHY+PP PT++ AR EAQ VIF+ M+ L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSAGLIS+D+ARDLLQ H NSNAVI+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DK+Y CV ++ED+EG
Sbjct  259   ERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKAYYCVMEEEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK+L+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKC RTI  P  D PW+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRSDRVWQIAFGSGFKCNSAVWKCIRTIKTPT-DGPWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_010477925.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Camelina sativa]
Length=492

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHY+PP PT++ AR EAQ VIF+ M+ L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSAGLIS+D+ARDLLQ H NSNAVI+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DK+Y CV ++ED+EG
Sbjct  259   ERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKAYYCVMEEEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK+L+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKC RTI  P  D PW+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRSDRVWQIAFGSGFKCNSAVWKCIRTIKTPT-DGPWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>gb|AIE57499.1| KCS6 [Camelina sativa]
Length=492

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/422 (71%), Positives = 354/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHY+PP PT++ AR EAQ VIF+ M+ L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYLPPAPTMEAARNEAQMVIFTAMEDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSAGLIS+D+ARDLLQ H NSNAVI+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSAGLISVDVARDLLQVHPNSNAVIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DK+Y CV ++ED+EG
Sbjct  259   ERAMLLPNCLFRMGGAAVLLSNRRSDRWRAKYKLCHLVRTHQGADDKAYYCVMEEEDKEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK+L+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKC RTI  P  D PW+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCIRTIKTPT-DGPWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>emb|CDP00615.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/422 (71%), Positives = 353/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVD+AC+KPP + R P+A+F+EH++LV P HPK++ FQ ++L RSGLGE TC+
Sbjct  79    SKPRTVYLVDFACFKPPCHFRAPYASFVEHARLVLPDHPKSVSFQTKMLARSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT +LA EEA+ VIFS MD +L +T + P+ IDILIVNCS++SPTPSLSA
Sbjct  139   PPAIHYIPPTPTRELAGEEAELVIFSAMDLILNQTGVKPRDIDILIVNCSVYSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAVIVSTEIITPN Y+G 
Sbjct  199   MIINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNCYVGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSMLLPNCLFR GGAA+LLSNR  D  RAKYRL+HVVRTH G  DKSY+CV Q+ D EG
Sbjct  259   DRSMLLPNCLFRMGGAAILLSNRWTDRWRAKYRLVHVVRTHKGADDKSYRCVEQKVDSEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +GI+L I+LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+             
Sbjct  319   NLGISLSIDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------KLKLK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQK+L+LS EHVEASRM LHRFGNTSSSSLWYEMS
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKSLQLSAEHVEASRMALHRFGNTSSSSLWYEMS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P    PW DCI +YP YIP+++
Sbjct  432   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKAPT-KGPWEDCIDRYPFYIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>gb|AAM67234.1| fatty acid condensing enzyme CUT1, putative [Arabidopsis thaliana]
Length=492

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/422 (71%), Positives = 352/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EAQ VIF+ M+ L   T L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSA LIS+D+AR+LLQ H NSNA+I+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSASLISVDVARNLLQVHPNSNAIIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DKSY CV +QED+ G
Sbjct  259   ERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLFLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKCNRTI  P  D  W+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGAWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>gb|KDO69954.1| hypothetical protein CISIN_1g011007mg [Citrus sinensis]
Length=496

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/422 (74%), Positives = 359/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDYACYKPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRHVYLVDYACYKPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS MD LL KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMEAARGEAELVIFSAMDSLLQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRRNRSRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLMTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE KGRMK+GDRVWQIAFGSGFKCNSAVWKCN+TI     D PW+DCI +YPV+IP+I+
Sbjct  436   YIEEKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTTT-DNPWSDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009605061.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=530

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/536 (60%), Positives = 394/536 (74%), Gaps = 25/536 (5%)
 Frame = +3

Query  90    PMKVMSWYVKQLAWYCCVSYIFVFILVPTLLLF-----KFPPPVIVQHYYASSQLLLLHL  254
             P+ +   YVK L +   V+     +LVPT+  F     +  P  I  H+ +     +  L
Sbjct  9     PISLKLKYVK-LGYQYLVNNFLTCLLVPTMPFFLAQVIQLGPEEIFNHWNSLQHDFIKTL  67

Query  255   YKQGITTLPYAAAAEAFFSSTPPQfiimmiifcacacacafGYLIIISS------RPRAV  416
             Y     +L Y        S+ P    I  +            +LII +S      RPR V
Sbjct  68    Y-SSFVSLSYGRDKVCAHSTLP----IPHLWDYTGIVVLYSSFLIIFASILYFMSRPRGV  122

Query  417   YLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVPPAIHY  596
             YL+DY+CYKPP + RVPF+TFMEHS+L+  + PK++ FQ +ILERSGLGE TC+PPAIHY
Sbjct  123   YLIDYSCYKPPVSCRVPFSTFMEHSRLILSSEPKSVEFQMRILERSGLGEETCLPPAIHY  182

Query  597   IPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAMIVNKY  776
             IPP P ++ AR+EA+ VIFS MD L  KT++ PK IDILIVNCS+FSPTPSLSAM++NKY
Sbjct  183   IPPAPNMESARKEAEMVIFSAMDSLFKKTRVKPKDIDILIVNCSLFSPTPSLSAMVINKY  242

Query  777   KLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKERSMLL  956
             K+R N+KSFNLSGMGCSAGLISIDLARDLLQ +  SNAV+VSTEIITPN Y GK+RSMLL
Sbjct  243   KMRDNIKSFNLSGMGCSAGLISIDLARDLLQVYPKSNAVVVSTEIITPNYYRGKDRSMLL  302

Query  957   PNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGFVGINL  1136
             PNCLFR GGAA+LLSN+  D  RAKY+LLHVVRTH G+ DKSY CVF+ ED EG  GI+L
Sbjct  303   PNCLFRMGGAAILLSNKWADQWRAKYKLLHVVRTHKGSDDKSYSCVFEVEDSEGKAGISL  362

Query  1137  CINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnkkVPDF  1316
               +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +      +PDF
Sbjct  363   SKDLMAIAGEALKSNITTIGPLVLPPSEQLLFLFSLIGRKVF-------NLKLKPYIPDF  415

Query  1317  KRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKG  1496
             K+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+SYIEA+G
Sbjct  416   KQAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELSYIEAEG  475

Query  1497  RMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDILKV  1664
             R+K+GDR+WQIAFGSGFKCNSAVWKCN+TI   + D PW+DCIH+YPVYIP+++K+
Sbjct  476   RIKKGDRIWQIAFGSGFKCNSAVWKCNKTIK-NLSDGPWSDCIHKYPVYIPEVVKL  530



>emb|CDP02779.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/422 (71%), Positives = 357/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+VYLVDYACYKPP   RVPF+TFMEHS+L+    PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRSVYLVDYACYKPPVTCRVPFSTFMEHSRLILKDSPKSVDFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+TVIF+ +D L+ KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPNPTMEDARAEAETVIFAAIDSLMKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAG+ISIDLARDLLQ + NS A++VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGIISIDLARDLLQVYPNSYALVVSTEIITPNYYKGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSN+R +  RAKYRL+HVVRTH G  DK+Y+CV++QED +G
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNKRREKSRAKYRLVHVVRTHKGADDKAYRCVYEQEDPQG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+G RVWQIAFGSGFKCNSAVWKCNRTI  P ++ PW DCI +YPV+IP+++
Sbjct  436   YIEAKGRMKKGARVWQIAFGSGFKCNSAVWKCNRTIKAP-MEGPWQDCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>gb|KFK44525.1| hypothetical protein AALP_AA1G267900 [Arabis alpina]
Length=495

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/422 (71%), Positives = 351/422 (83%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+C+KPP   RVPFATFMEHS+L+   +PK++ FQ ++LERSGLGE TC+
Sbjct  83    SKPRTVYLVDYSCFKPPVTCRVPFATFMEHSRLILKDNPKSVEFQMRMLERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EAQ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMESARSEAQMVIFSAMDDLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS NLSGMGCSA LIS+D+ARDLLQ H NSNAVI+STEIITPN Y G 
Sbjct  203   MIINKYKLRSNIKSLNLSGMGCSASLISVDVARDLLQVHPNSNAVIISTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+LLSNRR D  RAKY+L H+VRTH G  DKS+ CV +QED++G
Sbjct  263   ERAMLLPNCLFRMGAAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSFYCVHEQEDKDG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++F+  ++  ++        +P   
Sbjct  323   NVGINLSKDLMAIAGEALKANITTIGPLVLPASEQLLFLSSLIGRRIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKMAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMKRG+RVWQIAFGSGFKCNSAVWKCNRTI P      W+DCI +YPV+IP+++
Sbjct  436   YIEAKGRMKRGERVWQIAFGSGFKCNSAVWKCNRTIKPST--NAWSDCIDRYPVFIPEVV  493

Query  1659  KV  1664
             K+
Sbjct  494   KL  495



>ref|XP_002531630.1| acyltransferase, putative [Ricinus communis]
 gb|EEF30758.1| acyltransferase, putative [Ricinus communis]
Length=488

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 351/422 (83%), Gaps = 16/422 (4%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYACYKPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTIYLVDYACYKPPVTCRVPFSTFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPKPTMEAARGEAELVIFSAMDSLFKKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LL+NRR    RAKYRL+HVVRTH G  DK+Y+CV+++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLTNRRSHRSRAKYRLVHVVRTHKGADDKAYRCVYEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT+IGP          F+  ++  K+        +P   
Sbjct  323   KVGINLSKDLMAIAGEALKSNITTIGP--------XXFLFTLIGRKIF-------NPKWK  367

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLH+FGNTSSSSLWYE+S
Sbjct  368   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHKFGNTSSSSLWYELS  427

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCN+TI  P  D PWADCI +YPV+IP+++
Sbjct  428   YIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTPT-DGPWADCIDRYPVHIPEVV  486

Query  1659  KV  1664
             K+
Sbjct  487   KL  488



>ref|XP_006437664.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
 ref|XP_006484467.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Citrus sinensis]
 gb|ESR50904.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
Length=496

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/422 (73%), Positives = 359/422 (85%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDYACYKPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRHVYLVDYACYKPPVTCRVPFATFMEHSRLILKNNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EA+ VIFS MD LL KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPTPTMEAARGEAELVIFSAMDSLLQKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++N+YKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MLINQYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAAILLSNRRRNRSRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLMTLIGRKIF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  376   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYEMS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE KGRMK+GDRVWQIAFGSGFKCNSAVWKCN+TI     D PW+DCI +YPV+IP+I+
Sbjct  436   YIEEKGRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTTT-DNPWSDCIDRYPVHIPEIV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_010681548.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/525 (59%), Positives = 391/525 (74%), Gaps = 52/525 (10%)
 Frame = +3

Query  111   YVKQLAWYCCVSYIFVFILVPTLLLFKFPPPVIVQHYYASSQLLLLHLYKQGITTLPYAA  290
             Y+K L + C V++ F  IL+P +L       VI Q    SS+++ +       TTL    
Sbjct  13    YIK-LCYQCVVNHFFTIILIPIIL------SVIFQQ--KSSKIITIIF-----TTLKQRN  58

Query  291   AAEAFFSSTPPQfiimmiifcacacacafGYLIIISS-------RPRAVYLVDYACYKPP  449
             + E  F+                       ++++I +       RPR+VYLVDYACYKPP
Sbjct  59    SYEILFT-----------------------FMVVILALTFYYMLRPRSVYLVDYACYKPP  95

Query  450   ANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVPPAIHYIPPTPTLKLAR  629
             +  RVPF++FMEHS L+     K++ FQ +ILERSGLGE TC+PPAIHYIPP P++  AR
Sbjct  96    SLLRVPFSSFMEHSNLIVHNQ-KSVEFQMKILERSGLGEETCLPPAIHYIPPDPSMAAAR  154

Query  630   EEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAMIVNKYKLRSNVKSFNL  809
              E++ +IFS +D+L A T+L  K +DILIVNCS+FSPTPSLSAM+VNKYKLRSN+KSFNL
Sbjct  155   HESEVIIFSCLDKLFANTRLKAKDVDILIVNCSLFSPTPSLSAMVVNKYKLRSNIKSFNL  214

Query  810   SGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKERSMLLPNCLFRTGGAA  989
             SGMGCSAGLIS+DLA+DLLQ H NSNA++VSTEI+TPN Y G ER+MLLPNCLFR GGAA
Sbjct  215   SGMGCSAGLISVDLAKDLLQAHANSNAIVVSTEILTPNYYRGSERAMLLPNCLFRMGGAA  274

Query  990   LLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGFVGINLCINLMEVAGEA  1169
             +LLSN+     R+KYRLLHVVRTH G+ DK++KCV Q ED+EG VGI+L  +LM +AGEA
Sbjct  275   VLLSNKVAYRRRSKYRLLHVVRTHKGSDDKAFKCVSQAEDKEGHVGISLSKDLMTIAGEA  334

Query  1170  LKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnkkVPDFKRAFEHFCIHA  1349
             LK+NIT++GPLVLP  E ++F++ ++  KL+       +      +PDFK+AFEHFCIHA
Sbjct  335   LKTNITTMGPLVLPASEQLLFLLSLIGRKLI-------NAKRKAYIPDFKQAFEHFCIHA  387

Query  1350  GGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKRGDRVWQI  1529
             GGRAVIDELQKNL+L  EHVEASRMTLHRFGNTSSSSLWYE++YIEAKGRM +GDRVWQI
Sbjct  388   GGRAVIDELQKNLQLCAEHVEASRMTLHRFGNTSSSSLWYELAYIEAKGRMNKGDRVWQI  447

Query  1530  AFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDILKV  1664
             AFGSGFKCNSAVWKC +T+  P+ D+PW DCIH+YP++IPD++K+
Sbjct  448   AFGSGFKCNSAVWKCLKTVKTPIKDSPWLDCIHKYPIHIPDVVKL  492



>ref|XP_010527537.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Tarenaya hassleriana]
Length=494

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 352/422 (83%), Gaps = 10/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTVYLVDYSCYKPPLTCRVPFATFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPT  ++ AR EAQ V+FS MD L  KT LNP+ +DILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPT--MEAARGEAQMVVFSAMDDLFKKTGLNPRDVDILIVNCSLFSPTPSLSA  200

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAVIVSTEI+TPN Y G 
Sbjct  201   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEILTPNYYKGN  260

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +R+MLLPNCLFR G AA+LLSNRR D  RAKYRL HVVRTH G  DKSY CV+++ED++G
Sbjct  261   DRAMLLPNCLFRMGAAAILLSNRRTDRWRAKYRLCHVVRTHRGADDKSYCCVYEKEDKDG  320

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  321   KVGINLSKDLMAIAGEALKSNITTLGPLVLPASEQILFLLSLIGRKIF-------NPKWK  373

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  374   PYIPDFRLAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYELS  433

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+ GDRVWQIAFGSGFKCNS VWKCNRTI   + D PW DCI +YPVYIP+I+
Sbjct  434   YIEAKGRMRHGDRVWQIAFGSGFKCNSVVWKCNRTIK-GLTDGPWTDCIDRYPVYIPEIV  492

Query  1659  KV  1664
             K+
Sbjct  493   KL  494



>gb|AAO42223.1| putative fatty acid condensing enzyme CUT1 [Arabidopsis thaliana]
Length=492

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/422 (71%), Positives = 351/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDY+CYKPP   RVPF++FMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRTVYLVDYSCYKPPVTCRVPFSSFMEHSRLILKDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPPTPT++ AR EAQ VIF+ M+ L   T L PK IDILIVNCS+FSPTPSLSA
Sbjct  139   PPAIHYIPPTPTMESARNEAQMVIFTAMEDLFKNTGLKPKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+KS+NLSGMGCSA LIS+D+ARDLLQ H NSNA+I+STEIITPN Y G 
Sbjct  199   MIINKYKLRSNIKSYNLSGMGCSASLISVDVARDLLQVHPNSNAIIISTEIITPNYYKGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLSNRR D  RAKY+L H+VRTH G  DKSY CV +QED+ G
Sbjct  259   ERAMLLPNCLFRMGGAAILLSNRRSDRWRAKYKLCHLVRTHRGADDKSYNCVMEQEDKNG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALK+NIT+IGPLVLP  E ++ +  ++  K+        +P   
Sbjct  319   NVGINLSKDLMTIAGEALKANITTIGPLVLPASEQLLSLSSLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LSGEHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  372   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSGEHVEASRMTLHRFGNTSSSSLWYELS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEA+GRMKR DRVWQIAFGSGFKCNSAVWKCNRTI  P  D  W+DCI +YPV+IP+++
Sbjct  432   YIEAQGRMKRNDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGAWSDCIERYPVFIPEVV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_010916172.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=496

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/422 (71%), Positives = 355/422 (84%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYAC+KPP   RVPFATFMEH++L++ + PK++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPVYLVDYACFKPPNTCRVPFATFMEHTRLIY-SDPKSVQFQTRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP PT++ +R EAQ VIFS +D L+ KT + PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPANHYIPPNPTMEASRAEAQFVIFSAIDDLIKKTGVKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYKLRSN++SFNLSGMGCSAGL+SIDLARDLLQ H NSNA+++STEIITPN Y G 
Sbjct  203   MIVNKYKLRSNIRSFNLSGMGCSAGLLSIDLARDLLQVHSNSNALVISTEIITPNFYSGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +R+MLLPNCLFR G AA+LLSNR  +  RAKYRL+HVVRTH G  D++Y+C++++ED EG
Sbjct  263   QRAMLLPNCLFRMGAAAILLSNRPREARRAKYRLVHVVRTHKGADDRAYRCIYEEEDAEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
             + GI+L  +LM +AGEALKSNIT+IGPLVLPV E ++F   +V  KL+       +    
Sbjct  323   YSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLI-------NMKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQI FGSGFKCNSAVWKC RTI  PV D PWADCIH+YPV+IP+++
Sbjct  436   YIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCIRTIKTPV-DGPWADCIHRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_008802438.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=497

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/434 (70%), Positives = 359/434 (83%), Gaps = 14/434 (3%)
 Frame = +3

Query  378   GYLIIIS------SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQ  539
             G+LI+ +      SRPR V+LVDYAC+KPP++ RVPFATFMEH++L+    PK++ FQ +
Sbjct  71    GFLIVFAAKVYLMSRPRPVFLVDYACFKPPSSCRVPFATFMEHTRLLNLDDPKSVQFQIR  130

Query  540   ILERSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIV  719
             ILERSGLGE TC+PPA H+IPP PT++ +R EAQ VIFS +D L+ KT L PK IDILIV
Sbjct  131   ILERSGLGEETCLPPANHFIPPNPTMEASRAEAQLVIFSAIDDLITKTGLKPKDIDILIV  190

Query  720   NCSMFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIV  899
             NCS+FSPTPSLSAMI+NKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NSNA+++
Sbjct  191   NCSLFSPTPSLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVI  250

Query  900   STEIITPNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDK  1079
             STEIITPN Y G +RSMLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D+
Sbjct  251   STEIITPNFYSGNQRSMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDR  310

Query  1080  SYKCVFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKL  1259
             +Y+CV+++ED +G  GI+L  +LM +AGEALKSNIT+IGPLVLPV E ++F   +V  KL
Sbjct  311   AYQCVYEEEDAQGHSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKL  370

Query  1260  MssksqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRF  1439
             +       +P     +PDFK AFEHFCIHAGGRAVIDELQKNL LS EHVEASRMTLHRF
Sbjct  371   I-------NPKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLHLSPEHVEASRMTLHRF  423

Query  1440  GNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWAD  1619
             GNTSSSSLWYE++YIE+KGRM+RG+RVWQI FGSGFKCNSAVWKC RTI  PV D PWAD
Sbjct  424   GNTSSSSLWYELNYIESKGRMRRGNRVWQIGFGSGFKCNSAVWKCIRTIKTPV-DGPWAD  482

Query  1620  CIHQYPVYIPDILK  1661
             CIH+YPV IP+++K
Sbjct  483   CIHRYPVDIPEVVK  496



>gb|EYU26766.1| hypothetical protein MIMGU_mgv1a005018mg [Erythranthe guttata]
Length=500

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/425 (69%), Positives = 355/425 (84%), Gaps = 8/425 (2%)
 Frame = +3

Query  393   ISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERT  572
             I SRPR VYLVD+A +KPPA+ RV FA FMEH+++   + P++++FQ +ILERSGLGE+T
Sbjct  83    IMSRPRPVYLVDHALFKPPASFRVSFAGFMEHARMAPFSEPRSVHFQMKILERSGLGEQT  142

Query  573   CVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSL  752
              +PPAI YIPP+P + LAREEA+ VIF+ MD L+ KT + PK +DIL++NCS+FSPTPSL
Sbjct  143   SLPPAIRYIPPSPNMNLAREEAELVIFTCMDSLIRKTGVEPKDVDILVLNCSLFSPTPSL  202

Query  753   SAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYL  932
             +AM+VNKY +RSNVKSFNLSGMGCSAGLISIDLA+DLLQ H NSNAV++STEI+TPNSY+
Sbjct  203   TAMVVNKYGMRSNVKSFNLSGMGCSAGLISIDLAKDLLQHHPNSNAVVISTEILTPNSYM  262

Query  933   GKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDE  1112
             GKER+MLLPNCLFR GGAA+LLSNRR D  RAKYRL HVVRTH G  DKSY+CV Q+ED 
Sbjct  263   GKERAMLLPNCLFRMGGAAVLLSNRRSDRRRAKYRLAHVVRTHKGADDKSYRCVSQEEDS  322

Query  1113  EGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspn  1292
             EG VGI L I+LM +AGEALKSNIT++GPLVLP  E ++F +  +  K++       +  
Sbjct  323   EGNVGIKLNIDLMAIAGEALKSNITTMGPLVLPASEQLLFALSFIGRKMI-------NSK  375

Query  1293  nnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYE  1472
               + +PDFK+AF+HFCIHAGGRAVIDELQ++L L+ E VEASRM+LHRFGNTSSSSLWYE
Sbjct  376   WKQYIPDFKQAFDHFCIHAGGRAVIDELQRSLRLTAEQVEASRMSLHRFGNTSSSSLWYE  435

Query  1473  MSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLD-TPWADCIHQYPVYIP  1649
             +SYIE+KGRMKRGDRVWQIAFGSGFKCNSAVWKCNRT+ P   D  PWADCI  YPVYIP
Sbjct  436   LSYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTVDPTAEDGGPWADCIDNYPVYIP  495

Query  1650  DILKV  1664
             +++K+
Sbjct  496   EVVKL  500



>ref|XP_009777704.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana sylvestris]
Length=496

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/421 (70%), Positives = 349/421 (83%), Gaps = 8/421 (2%)
 Frame = +3

Query  402   RPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVP  581
             RPR VYL+DY+C KPP + RVPF+TFMEHS+L+  + PK++ FQ +ILERSGLGE TC+P
Sbjct  84    RPRGVYLIDYSCDKPPVSCRVPFSTFMEHSRLILSSEPKSVEFQMRILERSGLGEETCLP  143

Query  582   PAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAM  761
             PAIHYIPP P ++ AR+EA+ VIFS MD L  KT + PK IDILIVNCS+FSPTPSLSAM
Sbjct  144   PAIHYIPPAPNMESARKEAEMVIFSAMDSLFKKTGVKPKDIDILIVNCSLFSPTPSLSAM  203

Query  762   IVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKE  941
             ++NKYK+R N+KSFNLSGMGCSAGLISIDLARDLLQ +  S AV+V+TEIITPN Y GK+
Sbjct  204   VINKYKMRDNIKSFNLSGMGCSAGLISIDLARDLLQVYPKSKAVVVNTEIITPNYYRGKD  263

Query  942   RSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGF  1121
             RSMLLPNCLFR GGAA+LLSN+  D  RAKY+LLHVVRTH G  DKSY+CVF+ ED EG 
Sbjct  264   RSMLLPNCLFRMGGAAILLSNKWADQWRAKYKLLHVVRTHKGADDKSYRCVFEVEDSEGK  323

Query  1122  VGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnk  1301
              GI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +     
Sbjct  324   AGISLSKDLMAIAGEALKSNITTIGPLVLPPSEQLLFLFSLIGRKVF-------NLKLKP  376

Query  1302  kVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSY  1481
              +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWY +SY
Sbjct  377   YIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYVLSY  436

Query  1482  IEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDILK  1661
             IEAKGRMK GDR+WQIAFGSGFKCNSAVWKCN+TI   + D PW+DCIH+YPVYIP+++K
Sbjct  437   IEAKGRMKEGDRIWQIAFGSGFKCNSAVWKCNKTIK-NLSDGPWSDCIHKYPVYIPEVVK  495

Query  1662  V  1664
             +
Sbjct  496   L  496



>ref|XP_009390849.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/426 (70%), Positives = 356/426 (84%), Gaps = 9/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + ++SRP+ VYLVDYAC+KPP   RVPF+TFMEH++L+  +  K++ FQ +ILERSGLGE
Sbjct  80    VYLTSRPQPVYLVDYACFKPPTTCRVPFSTFMEHTRLI-SSDEKSVRFQMRILERSGLGE  138

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPA HYIPP PT++ +R E Q VIFS +D L+ KT L PK IDIL+VNCS+FSPTP
Sbjct  139   ETCLPPANHYIPPRPTMEASRAETQLVIFSAIDDLVRKTGLRPKDIDILVVNCSLFSPTP  198

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMI+NKYKLRSNV+SFNLSGMGCSAGLIS+DLARDLLQ HR+SNA++VSTEIITPN 
Sbjct  199   SLSAMIINKYKLRSNVRSFNLSGMGCSAGLISVDLARDLLQVHRSSNALVVSTEIITPNF  258

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G +RSMLLPNCLFR G AA+LLSNRR D  RAKYRL+HVVRTH G  D++Y+CV+Q+E
Sbjct  259   YAGNQRSMLLPNCLFRMGAAAILLSNRRRDARRAKYRLVHVVRTHKGADDRAYRCVYQEE  318

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D EG  GI+L  +LM +AGEALKSNIT+IGPLVLP+ E ++F + +V  KL+       +
Sbjct  319   DAEGHSGISLSKDLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVGRKLI-------N  371

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
             P     +PDFK AFEHFCIHAGGRAVIDELQKNLELS EHVEASRMTLHRFGNTSSSSLW
Sbjct  372   PKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSAEHVEASRMTLHRFGNTSSSSLW  431

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++YIE+KGRM+RGDRVWQI FGSGFKCNSAVWKC RT+  PV D PW+DCI +YPV I
Sbjct  432   YELNYIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPV-DGPWSDCIDRYPVDI  490

Query  1647  PDILKV  1664
             P+I+++
Sbjct  491   PEIVRL  496



>ref|XP_011099560.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=497

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/433 (70%), Positives = 357/433 (82%), Gaps = 14/433 (3%)
 Frame = +3

Query  384   LIIIS-----SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILE  548
             LIII+     S+ R++YLVD++C KPP   RVPF+ FMEHS+L+   + K+I FQ +ILE
Sbjct  73    LIIIATVYFMSKARSIYLVDFSCCKPPVTCRVPFSKFMEHSRLIHKGNTKSIDFQMRILE  132

Query  549   RSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCS  728
             RSGLGE TCVPPA+HYIPPTPT   AR+EA+ VIFS +D L+ KT + PK+IDILIVNCS
Sbjct  133   RSGLGEETCVPPAMHYIPPTPTTGAARDEAEAVIFSAIDSLMEKTGIRPKNIDILIVNCS  192

Query  729   MFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTE  908
             +FSPTPSLSAM+VNKYKLRSN+KSFNLSGMGCSAGLISIDLARDLLQ H NS A+++STE
Sbjct  193   VFSPTPSLSAMVVNKYKLRSNIKSFNLSGMGCSAGLISIDLARDLLQVHHNSYALVISTE  252

Query  909   IIT-PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSY  1085
             I+T PN Y G ER+MLLPNCLFR G AA+LLSN+  D  RAKY+LLHVVRTH G  DK+Y
Sbjct  253   ILTSPNYYKGSERAMLLPNCLFRMGAAAILLSNKWRDSARAKYKLLHVVRTHKGADDKAY  312

Query  1086  KCVFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMs  1265
             +CV++QED EG VGINL  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+  
Sbjct  313   RCVYEQEDNEGKVGINLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKMF-  371

Query  1266  sksqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGN  1445
                   +P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGN
Sbjct  372   ------NPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGN  425

Query  1446  TSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCI  1625
             TSSSSLWYEMSYIEAKGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI
Sbjct  426   TSSSSLWYEMSYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPT-DGPWQDCI  484

Query  1626  HQYPVYIPDILKV  1664
              +YPV+IP+I+K+
Sbjct  485   DRYPVHIPEIVKL  497



>ref|XP_009390357.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/422 (70%), Positives = 356/422 (84%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLV+YAC+KPP+N RVPF+TFMEH++L+  +  K++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPVYLVEYACFKPPSNCRVPFSTFMEHTRLI-NSDEKSVQFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP PT++ +R EAQ VIFS +D L+ KT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPANHYIPPHPTMEASRAEAQLVIFSAIDDLIRKTGLKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H  SNA+++STEIITPN Y G 
Sbjct  203   MIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPGSNALVISTEIITPNFYAGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +R+MLLPNCLFR G AA+LLSNRR D  RAKYRL+HVVRTH G  D++Y+CV+++ED EG
Sbjct  263   QRAMLLPNCLFRMGAAAILLSNRRRDAGRAKYRLVHVVRTHKGADDRAYRCVYEEEDAEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L  +LM +AGEALKSNIT+IGPLVLP+ E ++F + +V  KL+       +P   
Sbjct  323   HTGISLSKDLMAIAGEALKSNITTIGPLVLPMSEQLLFFLTLVARKLI-------NPKRK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEH CIHAGGRAVIDELQKNLELS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKKAFEHLCIHAGGRAVIDELQKNLELSAEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQI FGSGFKCNSAVWKC RT+  P+ D PW++CIH+YPV+IP+++
Sbjct  436   YIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCMRTVKTPI-DGPWSECIHRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_009356710.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Pyrus x bretschneideri]
Length=496

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/422 (71%), Positives = 349/422 (83%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR +YLVDYAC+KPP   RVPF+TFMEHS+L+   +PK++ FQ +ILERSGLGE  C 
Sbjct  83    SKPRPIYLVDYACFKPPVTCRVPFSTFMEHSRLILSNNPKSVEFQMRILERSGLGESPCP  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EA+ VIFS MD L  KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  143   PPAIHYIPPNPTMEDARGEAELVIFSAMDSLFEKTGLKPKDIDILIVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLISIDLARD+LQ H NSNAV+VSTEIITPN Y G 
Sbjct  203   MVINKYKLRSNIKSFNLSGMGCSAGLISIDLARDILQVHPNSNAVVVSTEIITPNYYQGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTH G  DK+YKCVF++ED+EG
Sbjct  263   ERAMLLPNCLFRMGGAALLLSNRRSEHRRAKYRLVHVVRTHKGADDKAYKCVFEEEDKEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K++       +P   
Sbjct  323   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIL-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  376   PYIPDFRLAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQIAFGSGFKCNSAVWK N  I     D PW DCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKGNGAIK-TASDGPWVDCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>emb|CDP00616.1| unnamed protein product [Coffea canephora]
Length=496

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/422 (70%), Positives = 353/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYACYKPP   RVPF+ FMEHS+L+  T PK++ FQ +ILERSGLGE TC+
Sbjct  83    SRPRPVYLVDYACYKPPVTCRVPFSCFMEHSRLILSTEPKSVEFQMRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP P+++ AR+EA+ VIFS +D L  KT L  K +DILIVNCS+FSPTPSL+A
Sbjct  143   PPAIHYIPPAPSMEAARKEAEMVIFSAVDTLFKKTGLEAKDVDILIVNCSLFSPTPSLTA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYK+R ++KSFNLSGMGCSAG+ISI+LARDLLQ++ NS AV+VSTEIITPN Y GK
Sbjct  203   MVINKYKMRGDIKSFNLSGMGCSAGMISINLARDLLQSYPNSIAVVVSTEIITPNYYQGK  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSMLLPNCLFR GGAA+ LSNRR D  RAKYRLLHVVRTH G  DK+Y+CVF++ED EG
Sbjct  263   ERSMLLPNCLFRMGGAAIFLSNRRSDSIRAKYRLLHVVRTHKGADDKAYRCVFEEEDPEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K         +P   
Sbjct  323   KSGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLISLMGRKFF-------NPKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AF+HFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  376   PYIPDFKQAFDHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELS  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++G+RVWQIAFGSGFKCNSAVWKC ++I  P  D PW+DCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGNRVWQIAFGSGFKCNSAVWKCIKSIEIPT-DGPWSDCIDRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_010551269.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Tarenaya hassleriana]
Length=490

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/422 (72%), Positives = 347/422 (82%), Gaps = 14/422 (3%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDYACYKPP   RVPF      S+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  83    SKPRTVYLVDYACYKPPVTCRVPF------SRLILKDNPKSVEFQMRILERSGLGEETCL  136

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHYIPP PT++ AR EAQ VIF+ MD L  KT L P+ IDILIVNCS+FSPTPSLSA
Sbjct  137   PPAIHYIPPNPTMESARGEAQMVIFTAMDDLFKKTGLKPRDIDILIVNCSLFSPTPSLSA  196

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAGLIS+DLARDLLQ H NSNAVIVSTEIITPN Y G 
Sbjct  197   MVINKYKLRSNIKSFNLSGMGCSAGLISVDLARDLLQVHPNSNAVIVSTEIITPNYYKGN  256

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +R+MLLPNCLFR G AA+LLSNRR D  RAKYRL HVVRTH G  DKSY CV++QED++G
Sbjct  257   DRAMLLPNCLFRMGAAAILLSNRRSDRWRAKYRLCHVVRTHRGADDKSYYCVYEQEDKDG  316

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P   
Sbjct  317   NVGINLSKDLMAIAGEALKSNITTLGPLVLPASEQILFLLSLIGRKIF-------NPKWK  369

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  370   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELS  429

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+ GDRVWQIAFGSGFKCNSAVWKCNRTI  P  D PW+D I +YPVYIP+I+
Sbjct  430   YIEAKGRMRHGDRVWQIAFGSGFKCNSAVWKCNRTIKVPT-DGPWSDSIDRYPVYIPEIV  488

Query  1659  KV  1664
             K+
Sbjct  489   KL  490



>ref|XP_009380079.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/517 (60%), Positives = 379/517 (73%), Gaps = 38/517 (7%)
 Frame = +3

Query  111   YVKQLAWYCCVSYIFVFILVPTLLLFKFPPPVIVQHYYASSQLLLLHLYKQGITTLPYAA  290
             YVK L + C V+    F+L+P ++      P+++        + L H  +  +T + ++ 
Sbjct  17    YVK-LGYQCLVNNFVAFLLIPVMIAV----PLVLVRRGPDEIMALWHSLQLDLTQVLFSV  71

Query  291   AAEAFFSSTPPQfiimmiifcacacacafGYLIIISSRPRAVYLVDYACYKPPANHRVPF  470
                 F ++                        +   SRPR VYLVDYAC+KPP   RVP 
Sbjct  72    FLLVFVAA------------------------VYFVSRPRPVYLVDYACFKPPTTCRVPS  107

Query  471   ATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVI  650
             ATFMEH+ L+     K++ FQ +ILERSGLGE TC+PPA HYIPP PT++ AR EAQ VI
Sbjct  108   ATFMEHAWLI-NWDEKSVQFQTRILERSGLGEETCLPPASHYIPPNPTMEAARAEAQLVI  166

Query  651   FSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSA  830
             FS +D L  KT L PK+IDIL+VNCS+FSPTPSLS+MI+NKY+LRSN++SFNLSGMGCSA
Sbjct  167   FSAIDDLFKKTGLRPKNIDILVVNCSLFSPTPSLSSMIINKYELRSNIRSFNLSGMGCSA  226

Query  831   GLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKERSMLLPNCLFRTGGAALLLSNRR  1010
             GLISIDLARDLLQ H  SNA+++STEIITPNSY G +RSMLLPNCLFR G AA+LLSNRR
Sbjct  227   GLISIDLARDLLQVHPRSNALVISTEIITPNSYTGNQRSMLLPNCLFRMGAAAILLSNRR  286

Query  1011  VDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGFVGINLCINLMEVAGEALKSNITS  1190
              D  RAKYRLLHVVRTH G  D++Y+CV+Q+ED EG  GI+L  NLM +AGEALKSNIT+
Sbjct  287   RDARRAKYRLLHVVRTHKGADDRAYRCVYQEEDAEGHTGISLSKNLMAIAGEALKSNITT  346

Query  1191  IGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnkkVPDFKRAFEHFCIHAGGRAVID  1370
             IGPLVLP+ E ++F + +V  KL+       +      VPDFK AFEHFCIHAGGRAVID
Sbjct  347   IGPLVLPMSEQLLFFLTLVGRKLI-------NHKWKPYVPDFKLAFEHFCIHAGGRAVID  399

Query  1371  ELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFK  1550
             ELQ NL+L+ EHVEASRMTLHRFGNTSSSSLWYE+SYIE+KGRM+RG RVWQI FGSGFK
Sbjct  400   ELQNNLQLTAEHVEASRMTLHRFGNTSSSSLWYELSYIESKGRMRRGHRVWQIGFGSGFK  459

Query  1551  CNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDILK  1661
             CNSAVWKC RT+   ++D PWADCI++YPV IPD++K
Sbjct  460   CNSAVWKCLRTVE-TLVDGPWADCINRYPVDIPDVVK  495



>ref|XP_010926125.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=497

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/421 (71%), Positives = 350/421 (83%), Gaps = 8/421 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR V+LVDYAC+KPP   RVP A+FMEH +L+    PK++ FQ +ILERSGLGE T +
Sbjct  84    SRPRPVFLVDYACFKPPCYCRVPSASFMEHIRLLNLDDPKSVQFQTRILERSGLGEETYL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA H+IPP PT++ +R EAQ VIFS +D L+ KT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  144   PPANHFIPPNPTMEASRAEAQLVIFSAIDDLIRKTGLKPKDIDILVVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NSNA+++STEIITPN Y GK
Sbjct  204   MIVNKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVISTEIITPNFYPGK  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSMLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y CV+++ED +G
Sbjct  264   QRSMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYLCVYEEEDPQG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L  +LM +AGEALKSNIT+IGPLVLPV E ++F   +V  KL+       +P   
Sbjct  324   HSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLI-------NPKWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  377   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPEHVEASRMTLHRFGNTSSSSLWYELN  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQI FGSGFKCNSAVWKCNRTI  PV D PWADCIH+YPV IP+++
Sbjct  437   YIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCNRTIKTPV-DGPWADCIHRYPVDIPEVV  495

Query  1659  K  1661
             K
Sbjct  496   K  496



>ref|NP_001130497.1| uncharacterized protein LOC100191595 [Zea mays]
 gb|ACF78737.1| unknown [Zea mays]
Length=494

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/426 (69%), Positives = 352/426 (83%), Gaps = 9/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + + SRPR VYLVDYACYKPPA+ RVPFATFMEH++L+     K++ FQ +ILERSGLGE
Sbjct  78    VYVMSRPRPVYLVDYACYKPPASCRVPFATFMEHTRLI-SDDDKSVRFQTRILERSGLGE  136

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPA HYIPP P+++ +R EAQ VIFS +D L+ +T L PK IDIL+VNCS+FSPTP
Sbjct  137   DTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTP  196

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA++VSTEIITPN 
Sbjct  197   SLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNF  256

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G+ D++Y+CV+++E
Sbjct  257   YQGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGSDDRAYRCVYEEE  316

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             DE+GF GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL+       +
Sbjct  317   DEQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLV-------N  369

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AFEHFCIHAGGRAVIDELQKNL+LS  HVEASRMTLHRFGNTSSSSLW
Sbjct  370   KGWRPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLW  429

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC R+I  P  + PW DCIH+YPV +
Sbjct  430   YELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPT-NGPWDDCIHRYPVDV  488

Query  1647  PDILKV  1664
             P+++K+
Sbjct  489   PEVVKL  494



>ref|XP_002465630.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
 gb|EER92628.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
Length=494

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/426 (69%), Positives = 350/426 (82%), Gaps = 9/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + + SRPR VYLVDYACYKPPA+ RVPFATFMEH++L+     K++ FQ +ILERSGLGE
Sbjct  78    VYVMSRPRPVYLVDYACYKPPASCRVPFATFMEHTRLI-SDDDKSVRFQTRILERSGLGE  136

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPA HYIPP P+++ +R EAQ VIFS +D L+ +T L PK IDIL+VNCS+FSPTP
Sbjct  137   DTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTP  196

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA++VSTEIITPN 
Sbjct  197   SLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNF  256

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+Q+E
Sbjct  257   YQGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYQEE  316

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D++GF GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL        +
Sbjct  317   DDQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLF-------N  369

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AFEHFCIHAGGRAVIDELQKNL+LS  HVEASRMTLHRFGNTSSSSLW
Sbjct  370   KAWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLW  429

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC R+I  P  + PW DCIH+YPV +
Sbjct  430   YELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPT-NGPWDDCIHRYPVDV  488

Query  1647  PDILKV  1664
             P+++K+
Sbjct  489   PEVVKL  494



>ref|XP_008668455.1| PREDICTED: uncharacterized protein LOC100191595 isoform X1 [Zea 
mays]
 gb|ACF87925.1| unknown [Zea mays]
 gb|ACN34702.1| unknown [Zea mays]
 tpg|DAA44124.1| TPA: hypothetical protein ZEAMMB73_292233 [Zea mays]
Length=494

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/426 (69%), Positives = 351/426 (82%), Gaps = 9/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + + SRPR VYLVDYACYKPPA+ RVPFATFMEH++L+     K++ FQ +ILERSGLGE
Sbjct  78    VYVMSRPRPVYLVDYACYKPPASCRVPFATFMEHTRLI-SDDDKSVRFQTRILERSGLGE  136

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPA HYIPP P+++ +R EAQ VIFS +D L+ +T L PK IDIL+VNCS+FSPTP
Sbjct  137   DTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTP  196

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA++VSTEIITPN 
Sbjct  197   SLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNF  256

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+++E
Sbjct  257   YQGSRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEE  316

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             DE+GF GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL+       +
Sbjct  317   DEQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLV-------N  369

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AFEHFCIHAGGRAVIDELQKNL+LS  HVEASRMTLHRFGNTSSSSLW
Sbjct  370   KGWRPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLW  429

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC R+I  P  + PW DCIH+YPV +
Sbjct  430   YELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPT-NGPWDDCIHRYPVDV  488

Query  1647  PDILKV  1664
             P+++K+
Sbjct  489   PEVVKL  494



>ref|XP_006841272.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
 gb|ERN02947.1| hypothetical protein AMTR_s00135p00117490 [Amborella trichopoda]
Length=498

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/423 (69%), Positives = 351/423 (83%), Gaps = 8/423 (2%)
 Frame = +3

Query  396   SSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTC  575
             +S+PR +YLVDYACYKPP   RVPF+TF+EHS+L+     K+I FQ +ILERSGLGE TC
Sbjct  84    TSKPRPIYLVDYACYKPPVTCRVPFSTFLEHSRLLPVFDSKSIEFQIRILERSGLGETTC  143

Query  576   VPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLS  755
             +PPA+HYIPP PT+  AR EA+ VIFS MD L  +T + PK +DILIVNCS+FSPTPSLS
Sbjct  144   LPPALHYIPPDPTMADARAEAELVIFSAMDTLFKRTGIKPKDVDILIVNCSLFSPTPSLS  203

Query  756   AMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLG  935
             AM+VNKYK+RSN+KSFNLSGMGCSAG+ISIDLARDLLQ H N+ AV+VSTEII+PN Y G
Sbjct  204   AMVVNKYKMRSNIKSFNLSGMGCSAGVISIDLARDLLQVHANAYAVVVSTEIISPNWYAG  263

Query  936   KERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEE  1115
              +RSMLLPNCLFR GGAALLLSNRR +  RAKY L HVVRTH G  D++Y+CV+++ED +
Sbjct  264   NQRSMLLPNCLFRMGGAALLLSNRRRESRRAKYLLAHVVRTHRGADDRAYRCVYEEEDSQ  323

Query  1116  GFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnn  1295
               VGI L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K+        +P  
Sbjct  324   HNVGIALSKDLMTIAGEALKSNITTMGPLVLPASEQLLFLLSLIGRKIF-------NPKW  376

Query  1296  nkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEM  1475
                +PDFK+AFEHFCIHAGGRAV+DEL+KNL+LS +HVEASRMTLHRFGNTSSSSLWYEM
Sbjct  377   KPYIPDFKQAFEHFCIHAGGRAVVDELEKNLQLSAQHVEASRMTLHRFGNTSSSSLWYEM  436

Query  1476  SYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDI  1655
             SYIE+KGRMK+G+RVWQIAFGSGFKCNSA+WKCNR+I P   D+PWADCI QYPV IP++
Sbjct  437   SYIESKGRMKKGNRVWQIAFGSGFKCNSAIWKCNRSIKPET-DSPWADCIDQYPVLIPEV  495

Query  1656  LKV  1664
             +K+
Sbjct  496   VKL  498



>ref|XP_002283730.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
 emb|CAN74750.1| hypothetical protein VITISV_023219 [Vitis vinifera]
Length=492

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/422 (70%), Positives = 353/422 (84%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR++YLVDYAC+KPP   RVPFATFMEHS+L+   +PK++ FQ +ILERSGLGE TC+
Sbjct  79    SKPRSIYLVDYACFKPPVTCRVPFATFMEHSRLINSDNPKSVEFQMRILERSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P A HYIPP PT++ +R EA+ VIFS +D LL KT +  K IDILIVNCS+FSPTPSLSA
Sbjct  139   PAANHYIPPKPTMEASRGEAELVIFSAIDDLLKKTGIKTKDIDILIVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NS A+++STEIITPN Y G 
Sbjct  199   MVINKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVISTEIITPNYYSGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +R+MLLPNCLFR G AA+LLSNRR +  RAKYRL+H+VRTH G  DK+Y+CV+++ED +G
Sbjct  259   QRAMLLPNCLFRMGAAAILLSNRRRERRRAKYRLVHLVRTHKGADDKAYRCVYEEEDPQG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  K+        +P   
Sbjct  319   KVGISLSKDLMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKIF-------NPKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYEMS
Sbjct  372   PYIPDFKEAFEHFCIHAGGRAVIDELQKNLQLSSEHVEASRMTLHRFGNTSSSSLWYEMS  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+G+RVWQIAFGSGFKCNSAVWKCNRTI  P  D PWADCI +YPVYIP+I+
Sbjct  432   YIEAKGRMKKGNRVWQIAFGSGFKCNSAVWKCNRTITTPT-DGPWADCIDRYPVYIPEIV  490

Query  1659  KV  1664
             K+
Sbjct  491   KL  492



>ref|XP_010263663.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/435 (69%), Positives = 355/435 (82%), Gaps = 14/435 (3%)
 Frame = +3

Query  378   GYLIIIS------SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQ  539
             G+LII        SRPR +YLVDY+C+KPP   R PF+TFMEHS+L+  ++ K + F+ +
Sbjct  71    GFLIIFVATVFFVSRPRHIYLVDYSCFKPPVTCRAPFSTFMEHSRLINGSNTKVVDFEMR  130

Query  540   ILERSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIV  719
             ILERSGLGE TC+PPAIHYIPPTPT+   R EA+ VIFS +D LL KT + PK IDILI+
Sbjct  131   ILERSGLGEETCLPPAIHYIPPTPTMADCRAEAELVIFSAIDSLLKKTGIKPKDIDILIL  190

Query  720   NCSMFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIV  899
             NCSMFSPTPSL+AMIVNKYK+R N++SFNLSGMGCSAGLISIDLARDLLQ H NS A++V
Sbjct  191   NCSMFSPTPSLTAMIVNKYKMRGNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVV  250

Query  900   STEIITPNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDK  1079
             STEIITP+ Y G +RSMLLPNCLFR G AA+LLSNRR D  RAKYRL HVVRTH G  D+
Sbjct  251   STEIITPSYYSGSQRSMLLPNCLFRMGSAAILLSNRRKDSWRAKYRLAHVVRTHKGADDR  310

Query  1080  SYKCVFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKL  1259
             +Y+CV+++ED +G  G++L   LM +AGEALKSNIT+IGPLVLP  E ++F+  +V  KL
Sbjct  311   AYRCVYEEEDPQGIRGVSLSKELMVIAGEALKSNITTIGPLVLPASEQLLFLFTLVGRKL  370

Query  1260  MssksqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRF  1439
                     +P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRF
Sbjct  371   F-------NPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRF  423

Query  1440  GNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWAD  1619
             GNTSSSSLWYE+SYIE+KGRMK+GDRVWQIAFGSGFKCNSAVWKCNRTI P   ++PW D
Sbjct  424   GNTSSSSLWYELSYIESKGRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKPDP-ESPWFD  482

Query  1620  CIHQYPVYIPDILKV  1664
             CI++YPV+IP+I+K+
Sbjct  483   CINRYPVHIPEIVKL  497



>ref|XP_004985167.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Setaria italica]
Length=494

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/426 (69%), Positives = 350/426 (82%), Gaps = 9/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + + SRPR VYLVDY+CYKPPA+ RVPFATFMEH++L+     K++ FQ +ILERSGLGE
Sbjct  78    VYVMSRPRPVYLVDYSCYKPPASCRVPFATFMEHTRLI-SDDEKSVRFQTRILERSGLGE  136

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPA HYIPP P+++ +R EAQ VIFS +D L+ +T L PK IDIL+VNCS+FSPTP
Sbjct  137   DTCLPPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTP  196

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA++VSTEIITPN 
Sbjct  197   SLSAMIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNF  256

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+Q+E
Sbjct  257   YQGTRRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYQEE  316

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D++GF GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL+       +
Sbjct  317   DDQGFSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLI-------N  369

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AFEHFCIHAGGRAVIDELQKNL+LS  HVEASRMTLHRFGNTSSSSLW
Sbjct  370   KKWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLQLSARHVEASRMTLHRFGNTSSSSLW  429

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC R+I  P  + PW DCI +YPV I
Sbjct  430   YELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPT-NGPWDDCIDRYPVDI  488

Query  1647  PDILKV  1664
             P+++K+
Sbjct  489   PEVVKL  494



>ref|NP_001049406.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|ABF94686.1| very-long-chain fatty acid condensing enzyme, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11320.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|EAY89070.1| hypothetical protein OsI_10556 [Oryza sativa Indica Group]
 gb|EAZ26093.1| hypothetical protein OsJ_09950 [Oryza sativa Japonica Group]
 dbj|BAG90041.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96897.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/422 (69%), Positives = 348/422 (82%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDY+CYKPP + RVPFATFMEH++L+     K++ FQ +ILERSGLGE TC+
Sbjct  82    SRPRPVYLVDYSCYKPPPSCRVPFATFMEHTRLI-TDDEKSVRFQTRILERSGLGEETCL  140

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP P+++ +R EAQ VIFS +D L+ +T L PK IDIL+VNCS+FSPTPSLSA
Sbjct  141   PPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSA  200

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN++SFNLSGMGCSAGLIS+DLARD+LQ H NSNA++VSTEIITPN Y G 
Sbjct  201   MIINKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALVVSTEIITPNFYWGT  260

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              R M+LPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+++EDE+G
Sbjct  261   RRDMMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVVRTHKGADDRAYRCVYEEEDEQG  320

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL+       +    
Sbjct  321   HSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLI-------NKKWK  373

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS +HVEASRMTLHRFGNTSSSSLWYE++
Sbjct  374   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLHRFGNTSSSSLWYELA  433

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC RT+  P  D PW DCIH+YPV IP+++
Sbjct  434   YIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPA-DGPWDDCIHRYPVDIPEVV  492

Query  1659  KV  1664
             K+
Sbjct  493   KL  494



>ref|XP_010265151.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=496

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/435 (68%), Positives = 352/435 (81%), Gaps = 14/435 (3%)
 Frame = +3

Query  378   GYLIII------SSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQ  539
             G+LII        SRPR +YLVDY+C+KPP   R PF+TFMEHS+L+   + K + F+ +
Sbjct  70    GFLIIFVATVYFMSRPRHIYLVDYSCFKPPVTCRAPFSTFMEHSRLINGANTKVVDFEMR  129

Query  540   ILERSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIV  719
             ILERSGLGE TC+PPAIHYIPP PT+   R EA+ VIFS +D LL KT + PK +DILI+
Sbjct  130   ILERSGLGEETCLPPAIHYIPPKPTMADCRAEAELVIFSSIDSLLKKTGIKPKDVDILIL  189

Query  720   NCSMFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIV  899
             NCSMFSPTPS++AMIVNKYK+R N+KSFNLSGMGCSAGLISIDLARDLLQ H NS A++V
Sbjct  190   NCSMFSPTPSMTAMIVNKYKMRGNIKSFNLSGMGCSAGLISIDLARDLLQVHPNSYALVV  249

Query  900   STEIITPNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDK  1079
             STEIITP+ Y G +RSMLLPNCLFR G AA+LLSNRR DG RAKYRL HVVRTH G  DK
Sbjct  250   STEIITPSFYGGSQRSMLLPNCLFRMGSAAILLSNRRKDGWRAKYRLAHVVRTHKGADDK  309

Query  1080  SYKCVFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKL  1259
             +Y+CV+++ED +G  G++L   LM +AGEALKSNIT+IGPLVLP  E ++F+  ++  KL
Sbjct  310   AYRCVYEEEDPQGIRGVSLSKELMVIAGEALKSNITTIGPLVLPASEQLLFLFTLIGRKL  369

Query  1260  MssksqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRF  1439
                     +P     +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRF
Sbjct  370   F-------NPKWKPYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRF  422

Query  1440  GNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWAD  1619
             GNTSSSSLWYE+SYIE+KGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTI     ++PW D
Sbjct  423   GNTSSSSLWYELSYIESKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKADP-ESPWFD  481

Query  1620  CIHQYPVYIPDILKV  1664
             CI +YPV+IP+I+K+
Sbjct  482   CIDRYPVHIPEIVKL  496



>ref|XP_009414779.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=491

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/422 (69%), Positives = 351/422 (83%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYAC+KPP+  RVPFATFMEH++L+  +  K++ FQ +ILERSGLGE TC+
Sbjct  79    SRPRPVYLVDYACFKPPSTCRVPFATFMEHTRLI-NSDKKSVQFQTRILERSGLGEETCL  137

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP PT++ +R EAQ VIFS +D L+ KT L PK ID+L+VNCS+FSPTPSLSA
Sbjct  138   PPANHYIPPNPTMEASRAEAQLVIFSAIDDLMKKTGLRPKDIDVLVVNCSLFSPTPSLSA  197

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSNV+SFNLSGMGCSAGLISIDLARDLL  H  +NA++VSTEIITPN Y G 
Sbjct  198   MIINKYKLRSNVRSFNLSGMGCSAGLISIDLARDLLLVHPRANALVVSTEIITPNFYAGN  257

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSMLLPNCLFR G AA+LLSNRR +  RAKYRL HVVRTH G  D++Y+CV+++ED EG
Sbjct  258   QRSMLLPNCLFRMGAAAILLSNRRREAGRAKYRLAHVVRTHKGADDRAYRCVYEEEDAEG  317

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L  +LM +AGEALKSNIT++GPLVLP+ E ++F + +V  KL+       +P   
Sbjct  318   HSGISLSKDLMAIAGEALKSNITTMGPLVLPMSEQLLFALNLVGRKLI-------NPEWK  370

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AF+HFCIHAGGRAVIDELQK+L+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  371   PYIPDFKQAFDHFCIHAGGRAVIDELQKSLQLSAEHVEASRMTLHRFGNTSSSSLWYELN  430

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RG+RVWQI FGSGFKCNSAVWKC RTI  PV D PW DCI +YPV IP+I+
Sbjct  431   YIESKGRMRRGNRVWQIGFGSGFKCNSAVWKCLRTIKGPV-DGPWTDCIDRYPVDIPEIV  489

Query  1659  KV  1664
             K+
Sbjct  490   KL  491



>ref|XP_006651174.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=526

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/422 (68%), Positives = 347/422 (82%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDY+CYKPP + RVPFATFMEH++L+     K++ FQ +ILERSGLGE TC+
Sbjct  114   SRPRPVYLVDYSCYKPPPSCRVPFATFMEHTRLI-TDDEKSVRFQTRILERSGLGEETCL  172

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP P+++ +R EAQ VIFS +D L+ +T L PK IDIL+VNCS+FSPTPSLSA
Sbjct  173   PPANHYIPPNPSMEASRAEAQLVIFSAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSA  232

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN++SFNLSGMGCSAGLIS+DLARD+LQ H NSNA++VSTEIITPN Y G 
Sbjct  233   MIINKYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALVVSTEIITPNFYWGT  292

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              R M+LPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+++EDE+G
Sbjct  293   RRDMMLPNCLFRMGAAAILLSNRRREARRAKYRLMHVVRTHKGADDRAYRCVYEEEDEQG  352

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL+       +    
Sbjct  353   HSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLI-------NKKWK  405

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNL+LS +HVEASRMTLHRFGNTSSSSLWYE++
Sbjct  406   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLDLSAQHVEASRMTLHRFGNTSSSSLWYELA  465

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC RT+  P    PW DCIH+YPV IP+++
Sbjct  466   YIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKAPT-GGPWDDCIHRYPVDIPEVV  524

Query  1659  KV  1664
             K+
Sbjct  525   KL  526



>ref|XP_010692961.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 347/422 (82%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR VYLVDYA +KPP   RVPFATFMEH++L      K + FQ +ILERSGLGE TC+
Sbjct  77    SKPRPVYLVDYALFKPPYIFRVPFATFMEHNRLNLKGDQKAVEFQMRILERSGLGEETCL  136

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPAIHY+ P PT++ AR EA+ VIFS +D LL KT +  K IDILIVNCS+FSPTPSLSA
Sbjct  137   PPAIHYLNPNPTMEAARNEAEMVIFSAVDDLLKKTGVKTKDIDILIVNCSLFSPTPSLSA  196

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VNKYKLRSN+KSFNLSGMGCS   IS+DLARDLLQ H NS A+++STEIITPN Y GK
Sbjct  197   MVVNKYKLRSNIKSFNLSGMGCSCSPISVDLARDLLQVHPNSYALVISTEIITPNYYQGK  256

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR G AA+LLSN+R + +R+KY+LLHV+RTH G  DK++K V+Q+ED EG
Sbjct  257   ERAMLLPNCLFRMGCAAMLLSNKRKEKKRSKYQLLHVIRTHKGADDKAFKVVYQEEDPEG  316

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AG+ALKSNIT++GPLVLP  E V+F+  ++  K+        +P   
Sbjct  317   KVGISLQKDLMAIAGDALKSNITTMGPLVLPTSEQVLFLFSLIGRKIF-------NPKWK  369

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EHVEASRMTLHRFGNTSSSSLWYE+S
Sbjct  370   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHVEASRMTLHRFGNTSSSSLWYELS  429

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDRVWQIAFGSGFKCNSA+WKCNRTI  P  + PW DCIH+YPVYIPD++
Sbjct  430   YIEAKGRMKKGDRVWQIAFGSGFKCNSAIWKCNRTIKAPT-EGPWDDCIHRYPVYIPDVV  488

Query  1659  KV  1664
             K+
Sbjct  489   KL  490



>ref|XP_008775195.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 6-like 
[Phoenix dactylifera]
Length=496

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/422 (70%), Positives = 348/422 (82%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYAC+KPP + RVP ATFMEH++L+  + PK++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPVYLVDYACFKPPNSCRVPXATFMEHTRLI-NSDPKSVRFQTRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP PT++ +R EA+ VIFS +D L+ KT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPANHYIPPNPTMEASRAEARLVIFSAIDDLIKKTGLKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYKLRSN++SFNLSGMGCSAGLISIDLARDLLQ H NSNA++VSTEIITPN Y G 
Sbjct  203   MIVNKYKLRSNIRSFNLSGMGCSAGLISIDLARDLLQVHPNSNALVVSTEIITPNFYSGN  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             + SMLLPNCLFR G AA+LLSNR  +  RAKYRL+HVVRTH G  D++Y CV+++ED EG
Sbjct  263   QPSMLLPNCLFRMGAAAILLSNRPREARRAKYRLVHVVRTHKGADDRAYFCVYEEEDAEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L  +LM +AGEALKSNIT+IGPLVLPV E ++F   +V  KL+       +    
Sbjct  323   HSGISLSKDLMAIAGEALKSNITTIGPLVLPVSEQLLFFFTLVGRKLI-------NSKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQK+L+LS EHVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKLAFEHFCIHAGGRAVIDELQKSLQLSPEHVEASRMTLHRFGNTSSSSLWYELN  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRM+RGDRVWQI FGSGFKCNSAVWKC RTI  PV D PW DCIH YPV IP+++
Sbjct  436   YIESKGRMRRGDRVWQIGFGSGFKCNSAVWKCIRTIKTPV-DGPWFDCIHHYPVPIPEVV  494

Query  1659  KV  1664
             ++
Sbjct  495   QL  496



>ref|XP_003558474.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
Length=497

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/426 (67%), Positives = 347/426 (81%), Gaps = 9/426 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + + SRPR VYLVDY CYKP  + RVPF TFMEH +L+   + K++ FQ +ILERSGLGE
Sbjct  81    VYVMSRPRPVYLVDYCCYKPSPSFRVPFTTFMEHIKLI-ANNEKSLRFQTRILERSGLGE  139

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              TC+PPA HYIPP P+++ +R EAQ VIF+ +D L+ +T L PK IDIL+VNCS+FSPTP
Sbjct  140   ETCLPPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTP  199

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMI+N+YKLRSN++SFNLSGMGCSAGLIS+DLARD+LQ H NSNA+++STEIITPN 
Sbjct  200   SLSAMIINRYKLRSNIRSFNLSGMGCSAGLISLDLARDMLQVHPNSNALVISTEIITPNF  259

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  R MLLPNCLFR G AA+LLSNRR + +RAKYRLLHVVRTH G  D++Y+CV+++E
Sbjct  260   YKGSRRDMLLPNCLFRMGAAAILLSNRRREAKRAKYRLLHVVRTHKGADDRAYRCVYEEE  319

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D+EG  GI+L   LM +AGEALKSNIT++GPLVLP+ E ++F   +V  K++       +
Sbjct  320   DDEGHSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVI-------N  372

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AFEHFCIHAGGRAVIDELQKNLELS  HVEASRMTLHRFGNTSSSSLW
Sbjct  373   KRWKPYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSSRHVEASRMTLHRFGNTSSSSLW  432

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC RT+  P  D PW DCIH+YPV +
Sbjct  433   YELAYIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPT-DGPWDDCIHRYPVEV  491

Query  1647  PDILKV  1664
             P+++K+
Sbjct  492   PEVVKL  497



>ref|XP_008660394.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Zea mays]
 gb|AFW89171.1| hypothetical protein ZEAMMB73_058916 [Zea mays]
Length=494

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 346/422 (82%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYACYKPP + RVPFATFMEH++L+     +++ FQ +ILERSGLGE TC+
Sbjct  82    SRPRPVYLVDYACYKPPGSCRVPFATFMEHTRLI-SDDDRSVRFQTRILERSGLGEDTCL  140

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA H+IPP P+++ +R EAQ V+FS +D LL +T   PK +DIL+VNCS+FSPTPSLSA
Sbjct  141   PPANHFIPPNPSMEASRAEAQLVVFSAIDDLLRRTGTKPKDVDILVVNCSLFSPTPSLSA  200

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M+VN+YKLRSNV+SFNLSGMGCSAGLISIDLARD+LQ H NSNA++VSTEIITPN Y G 
Sbjct  201   MVVNRYKLRSNVRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVVSTEIITPNFYRGS  260

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+Q+ED++G
Sbjct  261   RRDMLLPNCLFRMGAAAILLSNRRREAPRAKYRLVHVVRTHKGADDRAYRCVYQEEDQQG  320

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
             F GI+L   LM +AG+ALKSNIT+IGPLVLP+ E ++F   +V  KL+       +    
Sbjct  321   FSGISLSKELMAIAGDALKSNITTIGPLVLPMSEQLLFFFRLVGRKLL-------NGGWK  373

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AF+HFCIHAGGRAVIDELQKNL+LS  HVEASRMTLHRFGNTSSSSLWYE++
Sbjct  374   PYIPDFKLAFDHFCIHAGGRAVIDELQKNLQLSPRHVEASRMTLHRFGNTSSSSLWYELA  433

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVWQI FGSGFKCNSAVWKC R+++ P    PW DCIH+YPV +P+++
Sbjct  434   YIEAKGRMRRGDRVWQIGFGSGFKCNSAVWKCLRSVNTPT-SGPWDDCIHRYPVDVPEVV  492

Query  1659  KV  1664
              +
Sbjct  493   SL  494



>gb|EMT20723.1| 3-ketoacyl-CoA synthase 6 [Aegilops tauschii]
Length=496

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 344/422 (82%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR V+LVDY CYKP  + RVPF TFMEH +L+   + K++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPVFLVDYCCYKPSPSFRVPFTTFMEHIKLI-SNNDKSLRFQTRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP P+++ +R EAQ VIF+ +D L+ +T L PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA+++STEIITPN Y G 
Sbjct  203   MIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEIITPNFYHGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+++ED+EG
Sbjct  263   RRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDDEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L   LM +AGEALKSNIT++GPLVLP+ E ++F   +V  K++       +    
Sbjct  323   HSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVI-------NSKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNLELS  HVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSPRHVEASRMTLHRFGNTSSSSLWYELA  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQI FGSGFKCNSAVWKC RT+  P  D PW DCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPT-DGPWDDCIQRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>gb|ABG35744.1| putative very long chain fatty acid condensing enzyme CUT1;3 
[Hordeum vulgare]
Length=501

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/422 (67%), Positives = 345/422 (82%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR V+LVDY CYKP  + RVPF TFMEH +L+   + K++ FQ +ILERSGLGE TC+
Sbjct  89    SRPRPVFLVDYCCYKPSPSFRVPFTTFMEHIKLI-SNNDKSLRFQTRILERSGLGEETCL  147

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP P+++ +R EAQ VIF+ +D L+ +T + PK IDIL+VNCS+FSPTPSLSA
Sbjct  148   PPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGIKPKDIDILVVNCSLFSPTPSLSA  207

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA+++STEIITPN Y G 
Sbjct  208   MIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEIITPNFYHGS  267

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+++ED+EG
Sbjct  268   RRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDDEG  327

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L   LM +AGEALKSNIT++GPLVLP+ E ++F   +V  K++       +    
Sbjct  328   HSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVI-------NKKWK  380

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDELQKNLELS  HVEASRMTLHRFGNTSSSSLWYE++
Sbjct  381   PYIPDFKLAFEHFCIHAGGRAVIDELQKNLELSPRHVEASRMTLHRFGNTSSSSLWYELA  440

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQI FGSGFKCNSAVWKC RT++ P  D PW DCI +YPV+IP+++
Sbjct  441   YIEAKGRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVNTPT-DGPWDDCIQRYPVHIPEVV  499

Query  1659  KV  1664
             K+
Sbjct  500   KL  501



>ref|XP_010910111.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=498

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 346/422 (82%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR +YLVDYAC++P    RVPF+TFMEH++ +     K++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPIYLVDYACFRPSRTCRVPFSTFMEHARQMPFFDEKSVRFQLRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP  +++ +R EA  VIFS +D+L AKT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  144   PPANHYIPPQSSMEASRAEASLVIFSAIDELFAKTGLKPKDIDILVVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+ SFNLSGMGCSAGLISIDLARDLLQ HRNS A++VSTEIITPN Y G 
Sbjct  204   MVINKYKLRSNILSFNLSGMGCSAGLISIDLARDLLQVHRNSYALVVSTEIITPNYYSGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSMLLPNCLFR G AA+LLSNRR +  RAKYRL+ +VRTH G  D+SY+CV+++ED+EG
Sbjct  264   QRSMLLPNCLFRMGAAAVLLSNRRRERARAKYRLVRIVRTHKGADDRSYRCVYEEEDDEG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GINL  +LM VAG+ALK+NIT+IGPLVLP  E ++F++ ++  K++        P   
Sbjct  324   NAGINLSKDLMAVAGDALKANITTIGPLVLPASEQLLFLLSLIGRKII-------YPAWK  376

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFKRAFEHFCIHAGGRAVIDELQK+L+LS EHVEASRM LHRFGNTSSSSLWYE++
Sbjct  377   PYIPDFKRAFEHFCIHAGGRAVIDELQKSLDLSAEHVEASRMALHRFGNTSSSSLWYELN  436

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVW I FGSGFKCNSAVWKC RTI  PV + PW+  IH+YPV+IP+++
Sbjct  437   YIEAKGRMRRGDRVWMIGFGSGFKCNSAVWKCLRTIRTPV-EGPWSGSIHRYPVHIPEVV  495

Query  1659  KV  1664
             K+
Sbjct  496   KL  497



>ref|XP_009391408.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Musa acuminata subsp. malaccensis]
Length=499

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/422 (68%), Positives = 341/422 (81%), Gaps = 7/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVDYAC++P  N RVPFATF EH++L+     K++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPVYLVDYACFQPARNCRVPFATFFEHARLMPFFDEKSVRFQVRILERSGLGEETCL  143

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP P+++ +R EA  VIFS +D L+AKT L PK IDIL+VNCS+FSPTPSLSA
Sbjct  144   PPANHYIPPCPSMEASRAEAHLVIFSAIDDLIAKTGLKPKDIDILVVNCSLFSPTPSLSA  203

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN+ SFNLSGMGCSAGLIS+DLARDLLQ H NS A++VSTEIITPN Y G 
Sbjct  204   MIINKYKLRSNIMSFNLSGMGCSAGLISVDLARDLLQAHPNSYALVVSTEIITPNYYAGN  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSMLLPNCLFR G AA+LLSNRR +  RAKYRLLHVVRTH G  D++Y+CV+++ED +G
Sbjct  264   ERSMLLPNCLFRMGAAAVLLSNRRRERARAKYRLLHVVRTHKGADDRAYRCVYEEEDGDG  323

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI L  +LM +AGEAL+SNIT +GPLVLPV E + F+  +V  +L+       S    
Sbjct  324   NSGIKLSKDLMAIAGEALRSNITDVGPLVLPVTEQLRFLASLVARRLL------GSRGWK  377

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFKRAFEHFCIHAGGRAVIDELQ NL LS  HVEASRM LHRFGNTSSSSLWYE++
Sbjct  378   PYIPDFKRAFEHFCIHAGGRAVIDELQLNLRLSAAHVEASRMALHRFGNTSSSSLWYELA  437

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVW I FGSGFKCNSAVW+  RT+  PV D PW+D IH+YPV+IP+++
Sbjct  438   YIEAKGRMRRGDRVWMIGFGSGFKCNSAVWRSLRTVATPV-DGPWSDSIHRYPVHIPEVV  496

Query  1659  KV  1664
             K+
Sbjct  497   KL  498



>gb|ABY82171.2| 3-ketoacyl-CoA synthase I [Triticum aestivum]
Length=496

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/422 (67%), Positives = 342/422 (81%), Gaps = 9/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR V+LVDY CYKP  + RVPF TFMEH +L+   + K++ FQ +ILERSGLGE TC+
Sbjct  84    SRPRPVFLVDYCCYKPSPSFRVPFTTFMEHIKLI-SNNDKSLRFQTRILERSGLGEETCL  142

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP P+++ +R EAQ VIF+ +D L+ +T L PK IDIL+VNCS+FSPTPSLSA
Sbjct  143   PPANHYIPPNPSMEASRAEAQLVIFNAIDDLVRRTGLKPKDIDILVVNCSLFSPTPSLSA  202

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLRSN++SFNLSGMGCSAGLISIDLARD+LQ H NSNA+++STEIITPN Y G 
Sbjct  203   MIINKYKLRSNIRSFNLSGMGCSAGLISIDLARDMLQVHPNSNALVISTEIITPNFYHGS  262

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              R MLLPNCLFR G AA+LLSNRR +  RAKYRL+HVVRTH G  D++Y+CV+++ED+EG
Sbjct  263   RRDMLLPNCLFRMGAAAILLSNRRREARRAKYRLVHVVRTHKGADDRAYRCVYEEEDDEG  322

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GI+L   LM +AGEALKSNIT++GPLVLP+ E ++F   +V  K++       +    
Sbjct  323   HSGISLSKELMAIAGEALKSNITTMGPLVLPMSEQLLFFFRLVGRKVI-------NNKWK  375

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCI AGGRAVIDEL KNLELS  HVEASRMTLHRFGNTSSSSLWYE++
Sbjct  376   PYIPDFKLAFEHFCIRAGGRAVIDELHKNLELSPRHVEASRMTLHRFGNTSSSSLWYELA  435

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQI FGSGFKCNSAVWKC RT+  P  D PW DCI +YPV+IP+++
Sbjct  436   YIEAKGRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPT-DGPWDDCIQRYPVHIPEVV  494

Query  1659  KV  1664
             K+
Sbjct  495   KL  496



>ref|XP_008801160.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Phoenix dactylifera]
Length=528

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 343/422 (81%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR +YLVDYAC++P    RVPF+TFMEH++ +     K++ FQ +ILERSGLGE TC+
Sbjct  114   SRPRPIYLVDYACFRPSQTCRVPFSTFMEHARQIPFFDEKSVRFQLRILERSGLGEETCL  173

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA HYIPP  +++ +R EA  VIFS +D+L AKT LNPK IDIL+VNCS+FSPTPSLSA
Sbjct  174   PPANHYIPPQGSMEASRAEASLVIFSAVDELFAKTGLNPKDIDILVVNCSLFSPTPSLSA  233

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+ SFNLSGMGCSAGLISIDLARDLLQ  RNS A++VSTEIITPN Y+G 
Sbjct  234   MVINKYKLRSNIVSFNLSGMGCSAGLISIDLARDLLQVRRNSYALVVSTEIITPNYYMGN  293

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              RSMLLPNCLFR G +A+LLSNRR +  RAKYRL+ VVRTH G  D+SY CV+++ED+E 
Sbjct  294   RRSMLLPNCLFRMGCSAVLLSNRRRERARAKYRLVRVVRTHKGADDRSYHCVYEEEDDEC  353

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GINL  +LM VAG+ALK NIT+IGPLVLP  E + F++ ++  K++       +P   
Sbjct  354   NSGINLSKDLMAVAGDALKDNITTIGPLVLPASEQLRFLLSLIGRKII-------NPAFK  406

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFKRAFEHFCIHAGGRAVIDELQK+L+LS EHVEASRM LHRFGNTSSSSLWYE++
Sbjct  407   PYIPDFKRAFEHFCIHAGGRAVIDELQKSLDLSAEHVEASRMALHRFGNTSSSSLWYELN  466

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM+RGDRVW I FGSGFKCNSAVWKC RTI  PV D PW+  IH+YPV+IP+++
Sbjct  467   YIEAKGRMRRGDRVWMIGFGSGFKCNSAVWKCLRTITTPV-DGPWSSSIHRYPVHIPEVV  525

Query  1659  KV  1664
             K+
Sbjct  526   KL  527



>ref|XP_010103772.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
 gb|EXB97050.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
Length=482

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/422 (69%), Positives = 341/422 (81%), Gaps = 22/422 (5%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR V+LVDYACYKPP   RVPF+TFMEHS+L+   +PK++                  
Sbjct  83    SKPRTVFLVDYACYKPPVTCRVPFSTFMEHSRLILKNNPKSVEPCPPP------------  130

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
                IHYIPPTPT++ AR EA+ VIFS MD LL KT L PK IDILIVNCS+FSPTPSLSA
Sbjct  131   --PIHYIPPTPTMEAARGEAELVIFSAMDSLLQKTGLKPKDIDILIVNCSLFSPTPSLSA  188

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSAG+ISIDLARDLLQ H NSNAV++STEIITPN Y G 
Sbjct  189   MVINKYKLRSNIKSFNLSGMGCSAGVISIDLARDLLQVHPNSNAVVISTEIITPNYYQGN  248

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+L+SNRR +  RAKYRL+HVVRTH G  DK+Y+CVF++ED+EG
Sbjct  249   ERAMLLPNCLFRMGGAAILISNRRSERRRAKYRLVHVVRTHKGADDKAYRCVFEEEDKEG  308

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT+IGPLVLP  E ++F++ ++  K+        +P   
Sbjct  309   KVGISLSKDLMAIAGEALKSNITTIGPLVLPASEQLLFLLTLIGRKIF-------NPKWK  361

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYEMS
Sbjct  362   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYEMS  421

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMKRGDR+WQIAFGSG KCNSAVWKCNRTI  P  D PWADCI +YPV+IP+I+
Sbjct  422   YIEAKGRMKRGDRIWQIAFGSGLKCNSAVWKCNRTIKTPT-DGPWADCIDRYPVHIPEIV  480

Query  1659  KV  1664
             K+
Sbjct  481   KL  482



>ref|XP_002271250.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=492

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 338/422 (80%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+VYLVDYAC+KPPA++RVP AT ++H +L    +P+ + FQ++IL+RSGLG+ TC+
Sbjct  79    SKPRSVYLVDYACFKPPASYRVPHATLVKHLRLSNKDNPEIVEFQRRILQRSGLGDETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
              PA  YIPPTP+L+ +R EA+ ++FSV+D LL KT    K IDILIVNCS+ SPTPSLSA
Sbjct  139   APANLYIPPTPSLEASRAEAELILFSVIDDLLKKTGTKTKDIDILIVNCSIVSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSA LISIDLAR+LLQ H NS A++VSTEI TPN Y G 
Sbjct  199   MVINKYKLRSNIKSFNLSGMGCSASLISIDLARELLQVHPNSCAIVVSTEITTPNYYSGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSM+L NCLFR GGAA+LLSN++ D  R+KY+LLH+VRTH G  DK+Y+C+ +QED +G
Sbjct  259   ERSMVLINCLFRMGGAAILLSNKKADRSRSKYQLLHLVRTHKGADDKAYRCIHEQEDTQG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               G++L  +LM +AGEALKSNIT+IGPLVLP  E + F+  ++  K++            
Sbjct  319   IQGVSLSKDLMLIAGEALKSNITTIGPLVLPASEQLNFLFTLIGQKIL-------KLKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGR VIDELQK L+LS + VEASRMTLHRFGNTSSSS+WYEM+
Sbjct  372   PYIPDFKQAFEHFCIHAGGRGVIDELQKKLQLSAKDVEASRMTLHRFGNTSSSSIWYEMN  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV I  +L
Sbjct  432   YIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTITTPT-DGPWLDCIGRYPVSISQVL  490

Query  1659  KV  1664
              +
Sbjct  491   DL  492



>ref|XP_006842379.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
 gb|ERN04054.1| hypothetical protein AMTR_s00079p00192440 [Amborella trichopoda]
Length=462

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/422 (65%), Positives = 332/422 (79%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+P  +YLVDY CYKPP  +RVP + F+EH +L     P+++ FQ +ILERSGLGERTCV
Sbjct  47    SKPYPIYLVDYTCYKPPGTYRVPRSFFLEHLKLSPSFDPESVKFQFRILERSGLGERTCV  106

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA+HYI P PT+  AR EA+ VIFS MD L  +T + P+ +D LIVNCSMFSPTPSLS 
Sbjct  107   PPALHYIAPDPTMADARAEAELVIFSAMDALFERTGIKPQDVDFLIVNCSMFSPTPSLSD  166

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYK+RSN+KSFNLSGMGCS   IS+++ARDLLQ H N+ AV+VSTEI+TPN Y G 
Sbjct  167   MVINKYKMRSNIKSFNLSGMGCSPSPISVNIARDLLQVHANAYAVVVSTEIVTPNWYTGN  226

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSMLLPNCLFR G A LLLSNRR +  RAKYRL+HVVRTH G  D++Y CVFQ+ED + 
Sbjct  227   QRSMLLPNCLFRMGAATLLLSNRRRESRRAKYRLMHVVRTHRGADDRAYHCVFQEEDVQR  286

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ +   K+        +    
Sbjct  287   NVGISLSKDLMGIAGEALKSNITTMGPLVLPASEQLLFLLSLFARKIF-------NLKLK  339

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDEL+KNL+LS EHVEASRMTLHRFGNTSSSSLWYEM+
Sbjct  340   PYIPDFKQAFEHFCIHAGGRAVIDELEKNLQLSPEHVEASRMTLHRFGNTSSSSLWYEMN  399

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRMK+GDR WQI FGSGFKCNS VWKCNR+I     D PWADCI QYPV+  + +
Sbjct  400   YIEAKGRMKKGDRSWQIGFGSGFKCNSLVWKCNRSIKAEA-DGPWADCIDQYPVHTVEAV  458

Query  1659  KV  1664
             K+
Sbjct  459   KL  460



>emb|CAN63425.1| hypothetical protein VITISV_040442 [Vitis vinifera]
Length=492

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/422 (65%), Positives = 338/422 (80%), Gaps = 8/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR+VYLVDYAC+KPPA++RVP AT +EH +L    +P+ + FQ++IL+RSGLG+ TC+
Sbjct  79    SKPRSVYLVDYACFKPPASYRVPHATLVEHLRLSNKDNPEIVEFQRRILQRSGLGDETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
              PA  YIPPTP+L+ +R EA+ ++FSV+D LL KT +  K IDILIVNCS+ SPTPSLSA
Sbjct  139   APANLYIPPTPSLEASRVEAELILFSVIDDLLKKTGIKTKDIDILIVNCSIVSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN+KSFNLSGMGCSA LISIDLAR+LLQ H NS A++VSTEI TPN Y G 
Sbjct  199   MVINKYKLRSNIKSFNLSGMGCSASLISIDLARELLQVHPNSCAIVVSTEITTPNYYSGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSM+L NCLFR GGAA+LLSN++ D  R+K +LLH+VRTH G  DK+Y+C+ +QED +G
Sbjct  259   ERSMVLINCLFRMGGAAILLSNKKADRSRSKXQLLHLVRTHKGADDKAYRCIHEQEDTQG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               G++L  +LM +AGEALKSNIT+IGPLVLP  E + F+  ++  K++            
Sbjct  319   IQGVSLSKDLMLIAGEALKSNITTIGPLVLPASEQLNFLFTLIGQKIL-------KLKWK  371

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGR VIDELQK L+LS + VEASRMTLHRFGNTSSSS+WYEM+
Sbjct  372   PYIPDFKQAFEHFCIHAGGRGVIDELQKKLQLSAKDVEASRMTLHRFGNTSSSSIWYEMN  431

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIE+KGRMK+GDR+WQIAFGSGFKCNSAVWKCNRTI  P  D PW DCI +YPV I  +L
Sbjct  432   YIESKGRMKKGDRIWQIAFGSGFKCNSAVWKCNRTITTPT-DGPWLDCIGRYPVSISQVL  490

Query  1659  KV  1664
              +
Sbjct  491   DL  492



>ref|XP_010265150.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/435 (63%), Positives = 337/435 (77%), Gaps = 14/435 (3%)
 Frame = +3

Query  378   GYLIII------SSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQ  539
             G+LIII       SRPR +YLVD++C+KP    R P  TF+EH +++     K + F  +
Sbjct  70    GFLIIIIVTVYLMSRPRHIYLVDFSCFKPLGTLRAPLTTFVEHGRIIKGPDSKAVQFSLK  129

Query  540   ILERSGLGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIV  719
             I ER GLG+ TCVPPA+ YIPP  T+  +REEA+ VIFS +D LL KT + PK IDILI+
Sbjct  130   IFERCGLGDETCVPPALRYIPPALTIANSREEAELVIFSAIDSLLEKTGVKPKSIDILIL  189

Query  720   NCSMFSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIV  899
             NCS+FSPTPSL+AMIVNKYK+R ++KSFNLSGMGCSAG+ISI LARDLLQ H NS A++V
Sbjct  190   NCSIFSPTPSLTAMIVNKYKMRGDIKSFNLSGMGCSAGMISIGLARDLLQVHPNSYALVV  249

Query  900   STEIITPNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDK  1079
             STEIIT + Y G++ SM+LPNC+FR G AALLLSN R +  RAKYRL HV+RTH G  D 
Sbjct  250   STEIITYSGYYGEQPSMMLPNCIFRMGSAALLLSNMRKERSRAKYRLFHVIRTHKGADDT  309

Query  1080  SYKCVFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKL  1259
             +Y+CV+Q+ED +GF G++L  ++  VAG+ALKSNIT+IGPLVLP  E ++FV+ +V  KL
Sbjct  310   AYRCVYQEEDPDGFKGVSLSKDITMVAGQALKSNITTIGPLVLPASEQLLFVLTLVGRKL  369

Query  1260  MssksqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRF  1439
                            +PDFK+AF+HFCIHAGGRAVIDEL+K L LS E VEASRMTLHRF
Sbjct  370   F-------ERKWKPYIPDFKQAFDHFCIHAGGRAVIDELEKYLNLSAEDVEASRMTLHRF  422

Query  1440  GNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWAD  1619
             GNTSSSS+WYE+SYIE KGRMK+GDR+WQI FGSGFKCNS VWKCNR I PPV D+PW++
Sbjct  423   GNTSSSSIWYELSYIETKGRMKKGDRIWQIGFGSGFKCNSVVWKCNRNIRPPV-DSPWSE  481

Query  1620  CIHQYPVYIPDILKV  1664
             CIH+YPV IPD++K+
Sbjct  482   CIHRYPVKIPDVVKI  496



>ref|XP_009399728.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=494

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/422 (65%), Positives = 334/422 (79%), Gaps = 7/422 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVD+AC++PP + RVPFATF EH+ LV     K++ FQ + LE SGLGE TC+
Sbjct  79    SRPRPVYLVDHACFRPPRSFRVPFATFFEHASLVPFFDEKSVRFQVRFLESSGLGEETCL  138

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P A  YIPP P+++ A  EA+ VIFS +D+L+AKT L P+ +DIL+VNCS+FSPTPSLSA
Sbjct  139   PLANRYIPPCPSMEAACAEARLVIFSAIDELIAKTDLKPRDVDILVVNCSLFSPTPSLSA  198

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYK+RSN+ SFNLSGMGCSAGLISIDLAR LLQ H NS A++VSTEIITPN Y G 
Sbjct  199   MIVNKYKMRSNIMSFNLSGMGCSAGLISIDLARSLLQAHPNSYALVVSTEIITPNFYAGN  258

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ERSMLLPNCLFR G AA+LLSN R + +RAKYRLLHVVRTH G  D++Y+CV+++ED EG
Sbjct  259   ERSMLLPNCLFRMGAAAVLLSNSRREEDRAKYRLLHVVRTHEGADDRAYRCVYEEEDGEG  318

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               GINL   L  V GEAL++NIT++GPLVLPV E + F+  +V  +L+       +    
Sbjct  319   NSGINLSKELTTVTGEALRANITAVGPLVLPVTEQLRFLASLVARRLL------GARGGK  372

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFKRAF+H CIHAGGRAVIDELQ++L L    VEASRMTLHRFGNTSSSSLWYE++
Sbjct  373   PYIPDFKRAFDHLCIHAGGRAVIDELQRSLGLPAALVEASRMTLHRFGNTSSSSLWYELA  432

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAK RM+RGDRVW I FGSGFKCNSAVW+C R    PV D PW+DCIH+YPV++P+++
Sbjct  433   YIEAKSRMRRGDRVWMIGFGSGFKCNSAVWRCLRAPKAPV-DGPWSDCIHRYPVHVPEMV  491

Query  1659  KV  1664
             K+
Sbjct  492   KL  493



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/419 (63%), Positives = 335/419 (80%), Gaps = 8/419 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR+V+LVDYAC+KP  N RVPFA+FMEHS+L      K++ FQ++ILERSGLGE+T +
Sbjct  120   SRPRSVFLVDYACHKPSPNIRVPFASFMEHSKLSGSFDDKSLEFQRRILERSGLGEQTAL  179

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA+HY+PP P++  AR+EA+TV+FS +D+L  KT + PK + IL+VNCS+F+PTPSLSA
Sbjct  180   PPAMHYLPPRPSMDAARQEAETVMFSALDELFHKTGVKPKDVGILVVNCSLFNPTPSLSA  239

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYK+R N++S+NL GMGCSAG+I+IDLA+D+LQ H N  A++VSTE IT N Y G 
Sbjct  240   MIVNKYKMRGNIRSYNLGGMGCSAGVIAIDLAKDMLQVHGNDYAIVVSTENITQNWYFGN  299

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              RSML+PNCLFR GGAA+LLSNRR D  RAKY LLH VRTH G  DKS++CV+Q+EDE  
Sbjct  300   RRSMLIPNCLFRVGGAAMLLSNRRSDRRRAKYELLHTVRTHKGADDKSFRCVYQEEDENA  359

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +G++L  +LM +AG+ALK+NIT++GPLVLP+ E ++F   +V  K+             
Sbjct  360   KMGVSLSKDLMAIAGQALKTNITTMGPLVLPLSEQIIFFSFLVARKVF-------KRAVK  412

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AF HFCIHAGGRAVIDEL+KNL+L+ EHVEASRMTL+RFGNTSSSS+WYE++
Sbjct  413   PYIPDFRLAFHHFCIHAGGRAVIDELEKNLQLTAEHVEASRMTLYRFGNTSSSSIWYELA  472

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDI  1655
             YIEAKGRM++G+RVWQIAFGSGFKCNSAVW+  RTI       PWADCI Q+PV IP++
Sbjct  473   YIEAKGRMRKGNRVWQIAFGSGFKCNSAVWRALRTIKASE-KGPWADCIDQFPVAIPEV  530



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/419 (63%), Positives = 335/419 (80%), Gaps = 8/419 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR+V+LVDYAC+KP  N RVPFA+FMEHS+L      K++ FQ++ILERSGLGE+T +
Sbjct  120   SRPRSVFLVDYACHKPSPNIRVPFASFMEHSKLSGSFDDKSLEFQRRILERSGLGEQTAL  179

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA+HY+PP P++  AR+EA+TV+FS +D+L  KT + PK + IL+VNCS+F+PTPSLSA
Sbjct  180   PPAMHYLPPRPSMDAARQEAETVMFSALDELFHKTGVKPKDVGILVVNCSLFNPTPSLSA  239

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYK+R N++S+NL GMGCSAG+I+IDLA+D+LQ H N  A++VSTE IT N Y G 
Sbjct  240   MIVNKYKMRGNIRSYNLGGMGCSAGVIAIDLAKDMLQVHGNDYAIVVSTENITQNWYFGN  299

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              RSML+PNCLFR GGAA+LLSNRR D  RAKY LLH VRTH G  DKS++CV+Q+EDE  
Sbjct  300   RRSMLIPNCLFRVGGAAMLLSNRRSDRRRAKYELLHTVRTHKGADDKSFRCVYQEEDENS  359

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +G++L  +LM +AG+ALK+NIT++GPLVLP+ E ++F   +V  K+             
Sbjct  360   KMGVSLSKDLMAIAGQALKTNITTMGPLVLPLSEQIIFFSFLVARKVF-------KRAVK  412

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AF HFCIHAGGRAVIDEL+KNL+L+ EHVEASRMTL+RFGNTSSSS+WYE++
Sbjct  413   PYIPDFRLAFHHFCIHAGGRAVIDELEKNLQLTAEHVEASRMTLYRFGNTSSSSIWYELA  472

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDI  1655
             YIEAKGRM++G+RVWQIAFGSGFKCNSAVW+  RTI       PWADCI Q+PV IP++
Sbjct  473   YIEAKGRMRKGNRVWQIAFGSGFKCNSAVWRALRTIKASE-KGPWADCIDQFPVAIPEV  530



>ref|XP_009406296.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/425 (63%), Positives = 331/425 (78%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP   +VPF  FM+HSQL    +  ++ FQ++ILERSG
Sbjct  95    GATVYIMTRPRPVYLVDYACYRPPPKLQVPFRRFMKHSQLSGEFNESSLEFQRRILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ TC+P A+HYIPP P++  AREEA+ V+F  +D L   T + PK + IL+VNCS+F+
Sbjct  155   LGQETCLPSALHYIPPRPSMAYAREEAEDVMFGALDTLFRNTGVKPKDVGILVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVN+YKLR N+KSFNL GMGCSAG+ISIDLARDLLQ HR++ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNRYKLRGNIKSFNLGGMGCSAGVISIDLARDLLQVHRSTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR G AA+LLSNR VD  RA+Y+L+HVVRTH G  DK+++CV+
Sbjct  275   QNWYFGNRKSMLIPNCLFRVGAAAVLLSNRTVDRRRARYKLVHVVRTHRGADDKAFRCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE G VG++L   LM +AGEALK NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  335   QEQDEAGKVGVSLSKELMAIAGEALKINITTLGPLVLPISEQLLFFATLVAKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  390   --NGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRPEHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G RVWQIAFGSGFKCNSAVW+  R++ P   D PW DCIH+YP
Sbjct  448   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWQALRSVKPSP-DGPWEDCIHRYP  506

Query  1638  VYIPD  1652
             V I D
Sbjct  507   VEIVD  511



>ref|XP_009605059.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=343

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/348 (77%), Positives = 301/348 (86%), Gaps = 7/348 (2%)
 Frame = +3

Query  621   LAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAMIVNKYKLRSNVKS  800
             LAREEA+  IFSVMD LL KT LNPK IDILIVNCS+FSPTPSLS M++NKYKLRSN+KS
Sbjct  3     LAREEAEITIFSVMDSLLEKTGLNPKDIDILIVNCSLFSPTPSLSVMVINKYKLRSNIKS  62

Query  801   FNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKERSMLLPNCLFRTG  980
             FNLSGMGCSAG+ISIDLARDLLQ + NSNAV++STEIITPNSYLGKERSMLLPNCLFR G
Sbjct  63    FNLSGMGCSAGVISIDLARDLLQHYPNSNAVVISTEIITPNSYLGKERSMLLPNCLFRMG  122

Query  981   GAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGFVGINLCINLMEVA  1160
             GAA+LLSNR+ D  RAKYRL+HVVRTH G  DKS+KCV QQED EG VGINLCI+LM+VA
Sbjct  123   GAAILLSNRKSDQRRAKYRLVHVVRTHKGADDKSFKCVQQQEDLEGKVGINLCIDLMQVA  182

Query  1161  GEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnkkVPDFKRAFEHFC  1340
             GEALKSNIT+IGPLVLP  E ++FV+ ++R K+          N+   +PDFK AFEHFC
Sbjct  183   GEALKSNITTIGPLVLPASEQLLFVLTLIRRKIF-------KKNSKPYIPDFKLAFEHFC  235

Query  1341  IHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSYIEAKGRMKRGDRV  1520
             IHAGGRAVIDELQ +L+LS EHVEASRMTL+RFGNTSSSSLWYEMSYIEAKGRMK+GDR+
Sbjct  236   IHAGGRAVIDELQNSLQLSAEHVEASRMTLYRFGNTSSSSLWYEMSYIEAKGRMKKGDRI  295

Query  1521  WQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDILKV  1664
             WQIAFGSGFKCNSAVWKCNRTI  PV   PWADCI +YPV IPD++K+
Sbjct  296   WQIAFGSGFKCNSAVWKCNRTIKTPVTHNPWADCIDRYPVDIPDVVKL  343



>gb|AGK29994.1| 3-ketoacyl-CoA synthase 4 [Gossypium raimondii]
Length=504

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/423 (61%), Positives = 331/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYL+DY+CY PP++ +V +  FMEHS+L       ++ FQ++ILERSG
Sbjct  88    GSTVYIMTRPRSVYLLDYSCYLPPSHLKVKYQQFMEHSKLTGDFDESSLEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE TCVP A+HY+PP P++  AREEA+ V+F  +D+L A T + P+ I IL+VNCS+F+
Sbjct  148   LGEETCVPEAMHYLPPRPSMAAAREEAEQVMFGALDKLFANTNVKPRDIGILVVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+NKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRNS AV+VSTE IT
Sbjct  208   PTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNSYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSNR VD  R+KY+L+HVVRTH G  DK++KCV+
Sbjct  268   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRRRSKYKLVHVVRTHCGANDKAFKCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  328   QEQDDNGKTGVSLSKDLMAIAGGALKTNITTMGPLVLPISEQILFFVTLVAKKLF-----  382

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   H EASRMTLHRFGNTSSS
Sbjct  383   --NAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHAEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNS VW   R + P   + PW DCIH+YP
Sbjct  441   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSTVWVALRNVKPSP-NNPWEDCIHRYP  499

Query  1638  VYI  1646
             V +
Sbjct  500   VQL  502



>ref|XP_003631663.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=504

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/423 (61%), Positives = 333/423 (79%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR++YLVDYACY+PP++ +V +  FMEHS+L        + FQ++ILERSG
Sbjct  88    GSTVYIMTRPRSIYLVDYACYRPPSHLQVRYHQFMEHSRLTGDFDESALEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V+F  +D+L A T + PK I IL+VNCS+F+
Sbjct  148   LGEETYVPEAMHYIPPQPSMAAAREEAEQVMFGSLDKLFANTNVKPKDIGILVVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  208   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+H+VRTH G  DK+++CV+
Sbjct  268   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSGDRRRAKYKLVHLVRTHRGADDKAFRCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  328   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLF-----  382

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  383   --NAKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPSHVEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE+SYIEAKGRM++G+RVWQIAFGSGFKCNSAVW+  R ++P   + PW DCI++YP
Sbjct  441   SIWYELSYIEAKGRMRKGNRVWQIAFGSGFKCNSAVWQALRNVNPSP-NGPWEDCINKYP  499

Query  1638  VYI  1646
             V +
Sbjct  500   VEV  502



>ref|XP_002510394.1| acyltransferase, putative [Ricinus communis]
 gb|EEF52581.1| acyltransferase, putative [Ricinus communis]
Length=502

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/421 (62%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CY+ P + + PF  FMEHS+L       ++ FQ++ILERSG
Sbjct  86    GLTVYIMTRPRPVYLVDYSCYRAPDHLKAPFGRFMEHSKLTGDFDESSLEFQRKILERSG  145

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V+F  +D L A T +NPK+I IL+VNCS+F+
Sbjct  146   LGEDTYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGILVVNCSLFN  205

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSA+IVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  206   PTPSLSAIIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  265

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSNR VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  266   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  325

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  326   QEQDDAGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVKKLF-----  380

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  381   --NKKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  438

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAK RM++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  439   SIWYELAYVEAKRRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSP-NGPWEDCIDKYP  497

Query  1638  V  1640
             V
Sbjct  498   V  498



>gb|KDP46259.1| hypothetical protein JCGZ_10099 [Jatropha curcas]
Length=510

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/423 (62%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDYACYKPP   +V F  FMEHS+L       ++ FQ++ILERSG
Sbjct  94    GSTVYIMTRPRSVYLVDYACYKPPPKLQVKFHQFMEHSKLTGDFDESSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H+IPP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  154   LGEETYVPEAMHHIPPRPSMAAAREEAEQVMFGALDILFANTNIKPKDIGILVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+NKYKLR N+ SFNL GMGCSAG+I+IDL +DLLQ HRNS AV+VSTE IT
Sbjct  214   PTPSLSAMIINKYKLRGNILSFNLGGMGCSAGVIAIDLTKDLLQIHRNSYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+H+VRTH G  DK+++CV+
Sbjct  274   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSTDRRRAKYKLVHLVRTHRGADDKAFRCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+EG  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R I P   + PW DCI +YP
Sbjct  447   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNIKPST-NNPWEDCIDRYP  505

Query  1638  VYI  1646
             V +
Sbjct  506   VQL  508



>ref|XP_011037520.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 328/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDYACYKPPA  +V +  FMEHS+L       ++ FQ++ILERSG
Sbjct  94    GATVYIVTRPRSVYLVDYACYKPPAKLQVKYEQFMEHSKLTGDFDDSSLEFQRRILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V+F  +D L A T + PK I +L+VNCS+F+
Sbjct  154   LGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDILFANTNIKPKDIGVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+++FNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIRTFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  DK++KCV+
Sbjct  274   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDKAFKCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGR++RGDRVWQIAFGSGFKCNSAVW+  R + P     PW DCI +YP
Sbjct  447   SIWYELAYTEAKGRVRRGDRVWQIAFGSGFKCNSAVWEALRYVKPST-SNPWEDCIDKYP  505

Query  1638  VYI  1646
             V I
Sbjct  506   VQI  508



>ref|XP_009378513.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=506

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/421 (61%), Positives = 331/421 (79%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CYKPP++ +V +  FMEHS+L       ++ FQ++ILERSG
Sbjct  90    GSTVYIMTRPRSVYLVDYSCYKPPSHLQVRYQQFMEHSKLTGDFDESSLEFQRKILERSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ VIF  +D L A T + PK   IL+VNCS+F+
Sbjct  150   LGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDFGILVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  210   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  270   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHCGADDKAFRCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  330   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFVTLVAKKLF-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  385   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  +++ P    +PW DCIH YP
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQSVKPSP-HSPWEDCIHGYP  501

Query  1638  V  1640
             V
Sbjct  502   V  502



>ref|XP_010104374.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB99937.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=513

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 327/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CY+ P N + PF  FM HS+L       ++ FQ++ILERSG
Sbjct  97    GLTVYIMTRPRPVYLVDYSCYRAPDNLKAPFDRFMTHSELTGDFDDSSLEFQRKILERSG  156

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H+IPP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  157   LGEETYVPEAMHFIPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFN  216

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  217   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  276

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+ +D  RAKYRL+HVVRTH G  DK+++CV+
Sbjct  277   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSMDRRRAKYRLVHVVRTHKGADDKAFRCVY  336

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  K       
Sbjct  337   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVVKKFF-----  391

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + +    +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  392   --NADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQVHVEASRMTLHRFGNTSSS  449

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EA+GRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  450   SIWYELAYTEAQGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVKPS-RNGPWEDCIDKYP  508

Query  1638  V  1640
             V
Sbjct  509   V  509



>ref|XP_010925903.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Elaeis guineensis]
Length=465

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/425 (61%), Positives = 330/425 (78%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP   +V + +FMEHS+L    +   + FQ++ILERSG
Sbjct  40    GSTVYIMTRPRPVYLVDYACYRPPDRLQVRYRSFMEHSRLCGEFNEDALEFQRKILERSG  99

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H++PP P++  AREEAQ V+F  +D L   T + PK I IL+VNCS+F+
Sbjct  100   LGEETYVPEAMHFLPPRPSMANAREEAQQVMFGALDALFRNTGVKPKDISILVVNCSLFN  159

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVN YKLRSN+KSFNL GMGCSAG+I++DLARDLLQ HR++ AV+VSTE IT
Sbjct  160   PTPSLSAMIVNHYKLRSNIKSFNLGGMGCSAGVIAVDLARDLLQAHRSTYAVVVSTENIT  219

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSNR  D  R+KYRL+HVVRTH G  D++++CV+
Sbjct  220   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNRSADRRRSKYRLVHVVRTHRGADDRAFRCVY  279

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G VG++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  280   QEQDDQGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLF-----  334

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+  HVE SRMTLHRFGNTSSS
Sbjct  335   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTPVHVEPSRMTLHRFGNTSSS  392

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG RVWQIAFGSGFKCNSAVW+  R + P   ++PW DCI +YP
Sbjct  393   SIWYELAYIEAKGRMRRGHRVWQIAFGSGFKCNSAVWQALRNVKPSP-NSPWEDCIDRYP  451

Query  1638  VYIPD  1652
             V + D
Sbjct  452   VQLVD  456



>ref|XP_008388058.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/423 (61%), Positives = 331/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + + P+  FMEHS+L       ++ FQ++ILERSG
Sbjct  100   GLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AR+EA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  160   LGEETYVPEAMHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE+G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  340   QEQDEKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  395   --KSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  453   SIWYELAYMEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPS-RNGPWEDCIDKYP  511

Query  1638  VYI  1646
             V +
Sbjct  512   VKV  514



>ref|XP_008357196.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=516

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/423 (61%), Positives = 331/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + + P+  FMEHS+L       ++ FQ++ILERSG
Sbjct  100   GLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  160   LGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  340   QEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVKKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  395   --KSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPXHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG+R+WQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  453   SIWYELAYMEAKGRIRRGNRIWQIAFGSGFKCNSAVWEALRNVKPSC-NGPWEDCIDKYP  511

Query  1638  VYI  1646
             V +
Sbjct  512   VKV  514



>ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
 gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
Length=510

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+++LVDYACYKPP+N +V F  FMEHS L       ++ FQ++ILERSG
Sbjct  94    GATVYIMTRPRSLFLVDYACYKPPSNLQVKFEQFMEHSSLTGDFDDSSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEAQ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  154   LGEETYVPEAMHYIPPRPSMAAAREEAQQVMFGALDVLFANTNIKPKDIGILVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  DK++KCV+
Sbjct  274   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDKRRAKYKLVHVVRTHKGADDKAFKCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L   LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDAGKTGVSLSKELMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAK R++RGDR+WQIAFGSGFKCNSA+W+  R I P   + PW DCI +YP
Sbjct  447   SIWYELAYTEAKERVRRGDRIWQIAFGSGFKCNSAIWEALRHIKPSS-NNPWQDCIDRYP  505

Query  1638  VYI  1646
             V I
Sbjct  506   VQI  508



>ref|XP_002509491.1| acyltransferase, putative [Ricinus communis]
 gb|EEF50878.1| acyltransferase, putative [Ricinus communis]
Length=508

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/423 (61%), Positives = 325/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+V+LVDYACYKPPAN +V F  FMEHS+L       ++ FQ++ILERSG
Sbjct  92    GGTVYIMTRPRSVFLVDYACYKPPANLQVKFHQFMEHSKLTGDFDDSSLEFQRKILERSG  151

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P+   AREEA+ V+F  +D L A   + PK I +L+VNCS+F+
Sbjct  152   LGEETYVPEAMHYIPPRPSTAAAREEAEQVMFGALDILFANANIKPKAIGVLVVNCSLFN  211

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+ SFNL GMGCSAG+I+IDLA+DLLQ HRN+ AV+VSTE IT
Sbjct  212   PTPSLSAMIVNKYKLRGNIMSFNLGGMGCSAGVIAIDLAKDLLQIHRNTYAVVVSTENIT  271

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  272   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRAKYKLVHVVRTHRGADDKAFRCVY  331

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  332   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVSKKLF-----  386

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEH+CIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  387   --NAKVKPYIPDFKLAFEHYCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  444

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+    + P     PW DCI +YP
Sbjct  445   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALSNVKPST-SNPWEDCIDRYP  503

Query  1638  VYI  1646
             V +
Sbjct  504   VQL  506



>gb|KDO49072.1| hypothetical protein CISIN_1g010687mg [Citrus sinensis]
Length=504

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR++YLVD++CY+PP++ +V F  FMEHS+L       ++ FQ++ILERSG
Sbjct  88    GSTVYIMTRPRSIYLVDFSCYRPPSHLQVKFHQFMEHSRLTGDFDESSLEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  148   LGEETYVPDAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  208   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  D ++KCV+
Sbjct  268   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDNAFKCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D  G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  K       
Sbjct  328   QEQDNAGKTGVSLSKDLMAIAGMALKANITTLGPLVLPISEQLLFFATLVAKKF------  381

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              S+      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  382   -SNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   ++PW DCI +YP
Sbjct  441   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVKPSP-NSPWEDCIDKYP  499

Query  1638  V  1640
             V
Sbjct  500   V  500



>ref|XP_008236905.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Prunus mume]
Length=506

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/421 (61%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CYKPP++ +V F  FMEHS+L       ++ FQ++ILERSG
Sbjct  90    GSTVYIMTRPRSVYLVDYSCYKPPSHLQVRFQQFMEHSKLTGDFDESSLEFQRKILERSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ VIF  +D L A T + PK I IL+VNCS+F+
Sbjct  150   LGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+++LQ H N+ AV+VSTE IT
Sbjct  210   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNTYAVVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSNR +D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  270   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNRSLDRRRAKYKLVHVVRTHRGADDKAFRCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  330   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLF-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  385   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  + + P  L +PW DCI  YP
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQNVKPS-LHSPWEDCIDWYP  501

Query  1638  V  1640
             V
Sbjct  502   V  502



>ref|XP_009336207.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Pyrus x bretschneideri]
Length=446

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + + P+  FMEHS+L       ++ FQ++IL RSG
Sbjct  30    GLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQRKILVRSG  89

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AR+EA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  90    LGEETYVPEAMHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFN  149

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  150   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENIT  209

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  210   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  269

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  270   QEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLF-----  324

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  325   --KSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  382

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  383   SIWYELAYMEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPS-RNGPWEDCIDKYP  441

Query  1638  V  1640
             V
Sbjct  442   V  442



>ref|XP_006423278.1| hypothetical protein CICLE_v10028243mg [Citrus clementina]
 ref|XP_006469151.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Citrus sinensis]
 gb|ESR36518.1| hypothetical protein CICLE_v10028243mg [Citrus clementina]
Length=504

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR++YLVD++CY+PP + +V F  FMEHS+L       ++ FQ++ILERSG
Sbjct  88    GSTVYIMSRPRSIYLVDFSCYRPPCHLQVKFHQFMEHSRLTGDFDESSLEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  148   LGEETYVPDAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  208   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  D ++KCV+
Sbjct  268   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDNAFKCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D  G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  K       
Sbjct  328   QEQDNAGKTGVSLSKDLMAIAGMALKANITTLGPLVLPISEQLLFFATLVAKKF------  381

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              S+      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  382   -SNAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   ++PW DCI +YP
Sbjct  441   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVKPSP-NSPWEDCIDKYP  499

Query  1638  V  1640
             V
Sbjct  500   V  500



>ref|XP_010028602.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Eucalyptus grandis]
Length=513

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/423 (61%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CYKPP + +V F  FMEHS+L       ++ FQ++IL RSG
Sbjct  97    GSTVYIMSRPRSVYLVDYSCYKPPEHLQVKFHQFMEHSKLTGDFDESSLEFQRKILARSG  156

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP P++  AREE++ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  157   LGEETYVPEAMHYLPPRPSMAAAREESEQVMYGALDNLFANTNVKPKDIGILVVNCSLFN  216

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  217   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  276

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  277   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSSDRRRAKYKLVHVVRTHRGADDKAFRCVY  336

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  K       
Sbjct  337   QEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKFF-----  391

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRM LHRFGNTSSS
Sbjct  392   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPSHVEASRMALHRFGNTSSS  449

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P    +PW DCIH+YP
Sbjct  450   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWQALRNVTPSP-SSPWEDCIHKYP  508

Query  1638  VYI  1646
             V +
Sbjct  509   VQL  511



>ref|XP_010530834.1| PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1 [Tarenaya hassleriana]
 ref|XP_010530836.1| PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X2 [Tarenaya hassleriana]
Length=515

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/429 (60%), Positives = 334/429 (78%), Gaps = 14/429 (3%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+V+LVDY+CYKPP++ +V F  FM+HS+L+      ++ FQ++ILERSG
Sbjct  93    GSTVYIMTRPRSVFLVDYSCYKPPSHMQVKFQKFMDHSRLIEDFDDSSLQFQRKILERSG  152

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREEA+ V+F  +D L   T++ P+ I IL+VNCS+F+
Sbjct  153   LGEETYLPEALHCIPPKPTMAAAREEAEQVMFGALDSLFENTKIKPRDIGILVVNCSLFN  212

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+NKYKLR N+KS+NL GMGCSAG+ISIDLA+DLLQ HRN+ AV+VSTE IT
Sbjct  213   PTPSLSAMIINKYKLRGNIKSYNLGGMGCSAGVISIDLAKDLLQVHRNTYAVVVSTENIT  272

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  R+KY+L+H +RTH G  DK++KCV+
Sbjct  273   QNWYFGNKKSMLIPNCLFRVGGAAMLLSNKSGDRRRSKYKLVHTIRTHKGADDKAFKCVY  332

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  +L      
Sbjct  333   QEQDDNGKTGVSLSKDLMAIAGEALKTNITTLGPLVLPISEQLLFFMTLVAKRLF-----  387

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGG------RAVIDELQKNLELSGEHVEASRMTLHRF  1439
               +      +PDFK AFEHFCIHAGG      RAVIDEL+KNL+LS  HVEASRMTLHRF
Sbjct  388   --NAKIKPYIPDFKLAFEHFCIHAGGRAGIDERAVIDELEKNLQLSPTHVEASRMTLHRF  445

Query  1440  GNTSSSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWAD  1619
             GNTSSSS+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P V ++PW D
Sbjct  446   GNTSSSSIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVKPSV-NSPWED  504

Query  1620  CIHQYPVYI  1646
             CI++YPV I
Sbjct  505   CIYRYPVKI  513



>ref|XP_009364915.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + + P+  FMEHS+L       ++ FQ++ILERSG
Sbjct  100   GLTVYIMTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AR+EA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  160   LGEETYVPEAMHYIPPRPSMAAARDEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  340   QEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSIVVNKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  395   --KSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  453   SIWYELAYMEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPS-RNGPWEDCIDKYP  511

Query  1638  V  1640
             V
Sbjct  512   V  512



>gb|KDP38510.1| hypothetical protein JCGZ_04435 [Jatropha curcas]
Length=502

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+ P + + PF  FMEHS+L       ++ FQ++ILERSG
Sbjct  86    GLTVYIMTRPRPVYLVDYACYRAPDHLKAPFDQFMEHSRLTGDFDESSLEFQRKILERSG  145

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V+F  +D L A T +NPK+I IL+VNCS+F+
Sbjct  146   LGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFANTNVNPKNIGILVVNCSLFN  205

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  206   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  265

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KY+L+HVVRTH G  D++++CV+
Sbjct  266   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSGDKNRSKYKLVHVVRTHRGADDRAFRCVY  325

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D  G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  326   QEQDGAGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQLLFFATLVVKKLF-----  380

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  381   --NKKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  438

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAK RM++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  439   SIWYELAYVEAKRRMRKGNRVWQIAFGSGFKCNSAVWEALRNVKPSA-NGPWEDCIDKYP  497

Query  1638  V  1640
             V
Sbjct  498   V  498



>ref|XP_009389417.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/425 (61%), Positives = 325/425 (76%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP   + PF  FMEHSQL    +   + FQ++ILERSG
Sbjct  94    GTTVYIMTRPRPVYLVDYACYRPPPELKAPFHRFMEHSQLCGGFNESALEFQRRILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ TC+P A+HY+PP P++  AREEA+ V+F  +D L   T + PK + +L+VNCS+F+
Sbjct  154   LGQDTCLPVALHYLPPRPSMAAAREEAEQVMFGALDTLFNNTGVKPKDVGVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVN+YKLR N+KSFNL GMGCSAG++++DLARDLLQ HR + AV+VSTE IT
Sbjct  214   PTPSLSAMIVNRYKLRGNIKSFNLGGMGCSAGVLAVDLARDLLQVHRATYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR G AALLLSNR  D  RAKY+L+H+VRTH G  D++++CV+
Sbjct  274   QNWYFGNRKAMLIPNCLFRVGAAALLLSNRAADRRRAKYKLVHIVRTHRGADDRAFRCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE G VG++L  +LM +AGEALK NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDEVGKVGVSLSKDLMAIAGEALKINITTLGPLVLPISEQLLFFATLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  389   --NGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRPIHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G RVWQIAFGSGFKCNSAVW+  R + P   D PW DCIH YP
Sbjct  447   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWQALRNVKPS-HDGPWEDCIHGYP  505

Query  1638  VYIPD  1652
             V I D
Sbjct  506   VEIID  510



>ref|XP_011048431.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/423 (61%), Positives = 326/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+++LVDYACYKPP+N +V F  FMEHS L       ++ FQ++ILERSG
Sbjct  94    GATVYIMTRPRSLFLVDYACYKPPSNLQVKFEQFMEHSNLTGDFDDSSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEAQ V+F  ++ L A T + PK I IL+VNCS+F+
Sbjct  154   LGEETYVPEAMHYIPPRPSMAAAREEAQQVMFGALNVLFANTNIKPKDIGILVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  DK++KCV+
Sbjct  274   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDKRRAKYKLVHVVRTHKGADDKAFKCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L   LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDAGKTGVSLSKELMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAK R++RGDRVWQIAFGSGFKCNSA+W+  R + P     PW DCI +YP
Sbjct  447   SIWYELAYTEAKERVRRGDRVWQIAFGSGFKCNSAIWEALRHVKPSS-SNPWQDCIDRYP  505

Query  1638  VYI  1646
             V I
Sbjct  506   VQI  508



>ref|XP_008377297.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=506

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 331/421 (79%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CYKPP++ +V +  FMEHS+L       ++ FQ++ILERSG
Sbjct  90    GSTVYIMTRPRSVYLVDYSCYKPPSHLQVRYQQFMEHSKLTGDFDESSLEFQRKILERSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ VIF  +D L A T + PK I IL+VNCS+F+
Sbjct  150   LGEETYVPEAMHYIPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  210   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ +D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  270   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDWRRAKYKLVHVVRTHCGADDKAFRCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  330   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFVTLVAKKLF-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  385   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  +++ P    +PW DCI  YP
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQSVKPSP-HSPWEDCIRGYP  501

Query  1638  V  1640
             V
Sbjct  502   V  502



>ref|XP_002305431.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
 gb|EEE85942.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
Length=510

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/423 (61%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDYACYKPPA  +V +  FMEHS+L       ++ FQ++ILERSG
Sbjct  94    GATVYIVTRPRSVYLVDYACYKPPAKLQVKYEQFMEHSKLTGDFDDSSLEFQRRILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T  P A+HYIPP P++  AREEA+ V+F  +D L A T + PK I +L+VNCS+F+
Sbjct  154   LGEETYAPEAMHYIPPRPSMAAAREEAEQVMFGALDVLFANTNIKPKDIGVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+++FNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIRTFNLGGMGCSAGVIAVDLAKDMLQIHRNTCAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  DK++KCV+
Sbjct  274   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKAKDRRRAKYKLVHVVRTHKGADDKAFKCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGR++RG+RVWQIAFGSGFKCNSAVW+  R + P     PW DCI +YP
Sbjct  447   SIWYELAYTEAKGRVRRGNRVWQIAFGSGFKCNSAVWEALRYVKPST-SNPWEDCIDKYP  505

Query  1638  VYI  1646
             V I
Sbjct  506   VQI  508



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/423 (61%), Positives = 330/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVD++CYKPP+N  V F  F+EHS+L       ++ FQ++ILERSG
Sbjct  89    GSTVYIMTRPRSVYLVDFSCYKPPSNLSVKFTKFVEHSRLKGDFDESSLEFQRKILERSG  148

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPPTP++  AREEA+ V++  +D L A T++ PK I IL+VNCS+F+
Sbjct  149   LGEETYLPEAMHQIPPTPSMASAREEAEQVMYGALDNLFANTKIKPKDIGILVVNCSLFN  208

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  209   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  268

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK++KCV+
Sbjct  269   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGSDRRRAKYKLVHVVRTHKGADDKAFKCVY  328

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL      
Sbjct  329   QEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFTTLVVKKLF-----  383

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  384   --NAKAKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPMHVEASRMTLHRFGNTSSS  441

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM++G+R+WQIAFGSGFKCNSAVW+  + +      +PW DCI +YP
Sbjct  442   SIWYELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQAMKHVRASS-KSPWEDCIDRYP  500

Query  1638  VYI  1646
             V I
Sbjct  501   VEI  503



>ref|XP_010539905.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Tarenaya hassleriana]
Length=514

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 327/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVDY+CY+PP + + PF  FMEHS+L        + FQ++ILERSG
Sbjct  98    GLTVYVMTRPRPVYLVDYSCYRPPDHLKAPFNRFMEHSRLTGDFEESALEFQRKILERSG  157

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPP P++  AREEA+ V+F  +D L + T +NPK I IL+VNCS+F+
Sbjct  158   LGEETYVPEAMHCIPPRPSMAAAREEAEQVMFGALDNLFSNTNVNPKDIGILVVNCSLFN  217

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  218   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGIIAVDLAKDLLQVHRNTYAVVVSTENIT  277

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  278   QNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDRRRAKYQLVHVVRTHRGADDKAFRCVY  337

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F V ++  KL      
Sbjct  338   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQLLFFVTLIMKKL------  391

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              S       +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  392   -SKGKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  450

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   ++ W DCIH YP
Sbjct  451   SIWYELAYTEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSK-NSAWEDCIHNYP  509

Query  1638  V  1640
             V
Sbjct  510   V  510



>ref|XP_007200967.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
 gb|EMJ02166.1| hypothetical protein PRUPE_ppa004500mg [Prunus persica]
Length=506

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CYKPP++ +V F  FMEHS+L       ++ FQ++ILERSG
Sbjct  90    GSTVYIMTRPRSVYLVDYSCYKPPSHLQVRFQQFMEHSKLTGDFDESSLEFQRKILERSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP P++  AREEA+ VIF  +D L A T + PK I IL+VNCS+F+
Sbjct  150   LGEETYVPEAMHYLPPRPSMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+++LQ H N+ AV+VSTE IT
Sbjct  210   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKEMLQVHGNAYAVVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+ +D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  270   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSLDRRRAKYKLVHVVRTHRGADDKAFRCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D  G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  330   QEQDNTGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLF-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  385   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  + + P  L +PW DCI +YP
Sbjct  443   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQNVKPS-LHSPWEDCIDRYP  501

Query  1638  V  1640
             V
Sbjct  502   V  502



>ref|XP_010088926.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB37130.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=503

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/418 (61%), Positives = 327/418 (78%), Gaps = 8/418 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + I +RPR+VYL+DY+CY PPA+ +V +  FM+HS+L       ++ FQ++I+ERSGLGE
Sbjct  91    VYIMTRPRSVYLIDYSCYHPPAHLKVTYEKFMKHSRLTGDFEDSSLEFQRKIMERSGLGE  150

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              T  P A+H IPP PT+  AREEA+ V+F  +D L AKT + PK + IL+VNCS+F+PTP
Sbjct  151   ETYCPEAMHMIPPRPTMAKAREEAEQVMFGALDNLFAKTNVKPKDVGILVVNCSLFNPTP  210

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLS+MIVNKYKLR N++SFNL GMGCSAG+I+IDL +D+LQ HRN+ AV+VS E IT N 
Sbjct  211   SLSSMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLVKDMLQVHRNTYAVVVSFENITQNW  270

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+Y CVFQ++
Sbjct  271   YFGNKKSMLIPNCLFRVGGAAILLSNKSSDRRRAKYKLVHVVRTHKGADDKAYNCVFQEQ  330

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D+ G  G++L  +LM +AG ALKSNIT++GPLVLP+ E ++F + +V  KL       S+
Sbjct  331   DDAGKTGVSLSKDLMAIAGGALKSNITTLGPLVLPISEQLLFFLTLVLKKL-------SA  383

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AF+HFCIHAGGR VIDEL+KNL+L  EHVEASRMTLHRFGNTSSSS+W
Sbjct  384   AKLKPHIPDFKLAFDHFCIHAGGRGVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIW  443

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             YE++YIEAKGRM++G+R+WQIAFGSGFKCNSAVW+  R + P   ++PWADCI  YPV
Sbjct  444   YELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQALRNVKPSS-NSPWADCIDMYPV  500



>ref|XP_010467354.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Camelina sativa]
Length=511

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CY PP   +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  95    GSTVYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHSKLIEDFNESSLEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREEA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  155   LGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTEINPRDIGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  275   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  335   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  448   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>emb|CDP07508.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 328/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY CY+ P   + PF +FMEHS+L       ++ FQ++ILERSG
Sbjct  102   GSTVYIMTRPRPVYLVDYFCYRAPDELKAPFESFMEHSRLTGDFDESSLQFQRKILERSG  161

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+H++PP P+++ AREEA+ V+F  +D L A T++  K I IL+VNCS+F+
Sbjct  162   LGDETYVPEAMHFVPPRPSMQAAREEAEQVMFGALDNLFANTKVKAKDIGILVVNCSLFN  221

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  222   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  281

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GGAA+LLSN+ VD  RAKYRL+HVVRTH G+ DK+++CV+
Sbjct  282   QNWYFGNKKAMLIPNCLFRVGGAAVLLSNKSVDRRRAKYRLVHVVRTHRGSDDKAFRCVY  341

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G+ L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  342   QEQDDAGKTGVTLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVLKKLF-----  396

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  397   --QKNIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGR++RG R+WQIAFGSGFKCNSAVW+  R +  P  + PW DCI +YP
Sbjct  455   SIWYELAYTEAKGRIRRGQRIWQIAFGSGFKCNSAVWQALRHVK-PAPNGPWEDCIDRYP  513

Query  1638  VYI  1646
             V +
Sbjct  514   VKV  516



>ref|XP_006304681.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
 gb|EOA37579.1| hypothetical protein CARUB_v10011929mg [Capsella rubella]
Length=512

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + P++ FMEHS+L       ++ FQ++ILERSG
Sbjct  96    GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFMEHSKLTGDFDDSSLEFQRKILERSG  155

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP  ++  AR+EA+ V+F  +D L A T +NPK I IL+VNCS+F+
Sbjct  156   LGEDTYVPEAMHYVPPRISMAAARKEAEQVMFGALDNLFADTNVNPKDIGILVVNCSLFN  215

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  216   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  275

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KYRL+HVVRTH G  DK+++CV+
Sbjct  276   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSKDKRRSKYRLVHVVRTHRGADDKAFRCVY  335

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  336   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLF-----  390

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  391   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  448

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW DCI +YP
Sbjct  449   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSN-NSPWEDCIDKYP  507

Query  1638  V  1640
             V
Sbjct  508   V  508



>ref|NP_179223.1| 3-ketoacyl-CoA synthase 9 [Arabidopsis thaliana]
 sp|Q9SIX1.1|KCS9_ARATH RecName: Full=3-ketoacyl-CoA synthase 9; Short=KCS-9; AltName: 
Full=Very long-chain fatty acid condensing enzyme 9; Short=VLCFA 
condensing enzyme 9 [Arabidopsis thaliana]
 gb|AAD22309.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEC06480.1| 3-ketoacyl-CoA synthase 9 [Arabidopsis thaliana]
Length=512

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CY PP + +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  96    GSTVYIMSRPRSVYLVDYSCYLPPESLQVKYQKFMDHSKLIEDFNESSLEFQRKILERSG  155

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREE++ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  156   LGEETYLPEALHCIPPRPTMMAAREESEQVMFGALDKLFENTKINPRDIGVLVVNCSLFN  215

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  216   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  275

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  276   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVY  335

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  336   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-----  390

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  391   --NSKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  448

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  449   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALNNVKPSV-SSPWEHCIDRYP  507

Query  1638  V  1640
             V
Sbjct  508   V  508



>ref|XP_010489197.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Camelina sativa]
Length=511

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/421 (61%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CY PP   +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  95    GSTVYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHSKLIEDFNESSLEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREEA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  155   LGEETYLPEALHCIPPRPTMMAAREEAEQVMFVALDKLFENTEINPRDIGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  275   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  335   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  448   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>ref|XP_009416553.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Musa acuminata subsp. 
malaccensis]
Length=526

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/427 (62%), Positives = 326/427 (76%), Gaps = 12/427 (3%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I + PR VYLVDYACY+PP N R PF  FM+HSQL    +   + FQ++ILERSG
Sbjct  100   GTTVYIMTGPRPVYLVDYACYRPPPNLRAPFPRFMKHSQLCGEFNESALEFQRRILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T +P A+HY+PP P++  AREEA+ V+F  +D L   T + PK I IL+VNCS+F+
Sbjct  160   LGQETYLPSALHYLPPRPSMASAREEAEEVMFGALDALFRNTGVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVN+YK R N+KSFNL GMGCSAG+ISIDLARDLLQ HR++ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNRYKFRGNIKSFNLGGMGCSAGVISIDLARDLLQIHRSTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR G AA+LLSNR  D  R+KY+L+HVVRTH G  D++++CV+
Sbjct  280   QNWYFGNRKSMLIPNCLFRVGAAAMLLSNRSADRWRSKYKLVHVVRTHSGADDRAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G VG++L  +LM +AGEALK NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  340   QEQDDAGKVGVSLSKDLMAIAGEALKINITTLGPLVLPISEQLLFFATLVAKKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L  +HVEASRMTLHRFGNTSSS
Sbjct  395   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLRPDHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWK--CNRTIHPPVLDTPWADCIHQ  1631
             S+WYE++Y EAKGRM++G RVWQIAFGSGFKCNSAVW+  CN    P   D PW DCIH+
Sbjct  453   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWQALCNVKPSP---DGPWEDCIHR  509

Query  1632  YPVYIPD  1652
             YPV I D
Sbjct  510   YPVEIVD  516



>ref|XP_010924276.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Elaeis guineensis]
Length=517

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/425 (61%), Positives = 329/425 (77%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + +VP+  FM HS+L    +  ++ FQ+++LERSG
Sbjct  92    GTTVYIMTRPRPVYLVDYACYRPPESLQVPYEKFMGHSRLCGEFNDASLEFQRKVLERSG  151

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T +P A+H +PP PT+  AREEAQ V+F  +D L   T + P+ I IL+VNCS+F+
Sbjct  152   LGQETYLPEALHALPPRPTMAHAREEAQQVMFGALDALFRNTGIKPRDISILVVNCSLFN  211

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAM+VN YKLRSN+KSFNL GMGCSAG+ISIDLARDLLQ HRNS AV+VS E IT
Sbjct  212   PTPSLSAMVVNHYKLRSNIKSFNLGGMGCSAGVISIDLARDLLQAHRNSYAVVVSAENIT  271

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N YLG  +SML+PNCLFR GGAA+LLSNR  D  R+KYRL+HVVRTH G  DK+++CV+
Sbjct  272   QNWYLGNRKSMLIPNCLFRVGGAAVLLSNRSADRRRSKYRLVHVVRTHRGADDKAFQCVY  331

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G VG++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL      
Sbjct  332   QEQDDDGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLF-----  386

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVE SRMTLHRFGNTSSS
Sbjct  387   --NAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEPSRMTLHRFGNTSSS  444

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR++RG +VWQIAFGSGFKCNSAVW+  R + P   ++PW DCI +YP
Sbjct  445   SIWYELAYIEAKGRIRRGHKVWQIAFGSGFKCNSAVWQSLRNVKPSP-NSPWEDCIDRYP  503

Query  1638  VYIPD  1652
             V + D
Sbjct  504   VQLVD  508



>ref|XP_002282403.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Vitis vinifera]
Length=509

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/420 (62%), Positives = 326/420 (78%), Gaps = 8/420 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             + I+ RPR V+LVDYACY+PP + +V F  FM+HS+L       T+ FQ++ILERSGLGE
Sbjct  96    VYITRRPRPVFLVDYACYRPPDHLQVRFHQFMDHSKLTGDFTESTLEFQRKILERSGLGE  155

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              T VP A+HY+PP P++  AREEA+ V+F  +D L + T + PK I IL+VNCS+F+PTP
Sbjct  156   ETYVPQAMHYLPPRPSMSAAREEAEQVMFGALDALFSDTCIKPKDIGILVVNCSLFNPTP  215

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA DLLQ HRN+ AV+VSTE IT N 
Sbjct  216   SLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLASDLLQVHRNTYAVVVSTENITQNW  275

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G +RSML+PNCLFR GGAA+LLSNR  D  RAKYRL+HVVRTH G  DK++ CV+Q++
Sbjct  276   YFGNDRSMLIPNCLFRVGGAAILLSNRSRDRRRAKYRLVHVVRTHRGADDKAFSCVYQKQ  335

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  KL+        
Sbjct  336   DDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKLL-------K  388

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
              N    +PDFK AF HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSSS+W
Sbjct  389   SNAKPYIPDFKLAFNHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIW  448

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YPV +
Sbjct  449   YELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRHVQPS-RNGPWEDCIDKYPVKV  507



>ref|XP_002321310.2| very-long-chain fatty acid condensing enzyme family protein [Populus 
trichocarpa]
 gb|EEE99625.2| very-long-chain fatty acid condensing enzyme family protein [Populus 
trichocarpa]
Length=539

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 327/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G+ + I +RPR VYL+DY+CY+ P + + PF  FMEHS+L       ++ FQ++ILERSG
Sbjct  123   GFTVFIMTRPRPVYLIDYSCYRAPDHLKAPFNQFMEHSRLTGDFDDTSLEFQRKILERSG  182

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V+F  +D L   TQ+NPK I IL+VNCS+F+
Sbjct  183   LGEETYVPEAMHYIPPRPSMAAAREEAEQVMFGALDNLFTNTQVNPKSIGILVVNCSLFN  242

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKY+LR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  243   PTPSLSAMIVNKYRLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  302

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN   D  + KY+L+HVVRTH G  DK+++CV+
Sbjct  303   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNESADKRKGKYKLVHVVRTHRGADDKAFRCVY  362

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL+     
Sbjct  363   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVVKKLL-----  417

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  418   --NKKMMPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  475

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAK RM++G+RVWQIAFGSGFKCNSAVW+  R + P   ++PW DCI  YP
Sbjct  476   SIWYELAYIEAKQRMQKGNRVWQIAFGSGFKCNSAVWEALRDVKPSC-NSPWEDCIDMYP  534

Query  1638  V  1640
             V
Sbjct  535   V  535



>ref|XP_009365554.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 330/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + + P+  FMEHS+L       ++ FQ++ILERSG
Sbjct  100   GLTVYIVTRPRPVYLVDYACYRPPDHLKAPYQRFMEHSRLTQDFDDSSLEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  160   LGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  340   QEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVKKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  395   --NSNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG+R+WQIAFGSGFKCNSAVW+  R +     + PW DCI  YP
Sbjct  453   SIWYELAYMEAKGRIRRGNRIWQIAFGSGFKCNSAVWEALRNVKAS-RNGPWEDCIDTYP  511

Query  1638  VYI  1646
             V +
Sbjct  512   VKV  514



>ref|XP_006847589.1| hypothetical protein AMTR_s00014p00234760 [Amborella trichopoda]
 gb|ERN09170.1| hypothetical protein AMTR_s00014p00234760 [Amborella trichopoda]
Length=512

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/425 (61%), Positives = 329/425 (77%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR +YLVDYACYKPP++ +V FA FMEHS+L        + FQ++ILERSG
Sbjct  91    GSTVYIMTRPRPIYLVDYACYKPPSHLKVAFAQFMEHSKLSGKFDEPALEFQRKILERSG  150

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T  P A+H +PP  ++  AREEA+ V+F  +D+L + T++ PK + ILIVNCS+F+
Sbjct  151   LGEETYFPDAMHQLPPRLSMAAAREEAEQVMFGALDKLFSNTRIRPKDVGILIVNCSLFN  210

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+DLLQ H ++ AV+VSTE IT
Sbjct  211   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDLLQVHGSTYAVVVSTENIT  270

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +RSML+PNCLFR GG+A+LLSN+  D  R+KY L+HVVRTH G  DK+++CV+
Sbjct  271   QNWYFGNKRSMLIPNCLFRVGGSAVLLSNKSSDKRRSKYELVHVVRTHKGADDKAFRCVY  330

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE G  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL+     
Sbjct  331   QEQDETGKPGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLL-----  385

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  386   --NAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLLPGHVEASRMTLHRFGNTSSS  443

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE+SY EAKGRM++G RVWQIAFGSGFKCNSAVWK  +T+ P   D PW DCI++YP
Sbjct  444   SIWYELSYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWKALKTVKPSP-DGPWEDCINEYP  502

Query  1638  VYIPD  1652
             V I D
Sbjct  503   VQILD  507



>ref|XP_006299088.1| hypothetical protein CARUB_v10015226mg [Capsella rubella]
 gb|EOA31986.1| hypothetical protein CARUB_v10015226mg [Capsella rubella]
Length=511

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CY PP + +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  95    GSTVYIMSRPRSVYLVDYSCYLPPESLQVNYQKFMDHSKLIEDFNESSLEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREEA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  155   LGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTKINPRDIGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV++STE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVISTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  275   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  335   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  448   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>ref|XP_002884160.1| hypothetical protein ARALYDRAFT_900287 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60419.1| hypothetical protein ARALYDRAFT_900287 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CY PP + +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  95    GSTVYIMSRPRSVYLVDYSCYLPPESLQVKYQKFMDHSKLIEDFNESSLEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREEA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  155   LGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTEINPRDIGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  275   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  335   QEQDDYGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  448   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>gb|KFK41268.1| hypothetical protein AALP_AA2G107900 [Arabis alpina]
Length=514

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CY PP N +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  98    GSTVFIMTRPRSVYLVDYSCYLPPTNLQVSYQKFMDHSRLIDDFNDSSLEFQRKILERSG  157

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AR+EA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  158   LGEETYLPEALHCIPPRPTMVEARQEAEQVMFGALDKLFENTKINPRDIGVLVVNCSLFN  217

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  218   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  277

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  278   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKSGDRRRSKYKLVHTVRTHKGAIEKAFNCVY  337

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q+ED+ G  G++L   LM +AGEALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  338   QEEDDNGKTGVSLSKELMAIAGEALKANITTLGPLVLPISEQILFFATLVTKKLF-----  392

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  393   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSETHVEASRMTLHRFGNTSSS  450

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  451   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  509

Query  1638  V  1640
             V
Sbjct  510   V  510



>ref|XP_011083903.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Sesamum indicum]
Length=522

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/423 (61%), Positives = 330/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CY+PP +   PF  FMEHS+L       ++ FQ++ILERSG
Sbjct  106   GSTVYIMNRPRPVYLVDYSCYRPPDSLMAPFDRFMEHSRLQGDFDESSLEFQRKILERSG  165

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+H+IPP P+++ AREEA+ V+F  +D L A T + PK I +L+VNCS+F+
Sbjct  166   LGDETYVPEAMHFIPPRPSMQAAREEAEQVMFGALDNLFANTNVKPKEIGVLVVNCSLFN  225

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VS E IT
Sbjct  226   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSMENIT  285

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  286   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKAGDRRRAKYKLVHVVRTHKGADDKAFRCVY  345

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  346   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVIKKLF-----  400

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  401   --NKNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  458

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R++ P   + PW DCI +YP
Sbjct  459   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRSVKPS-RNGPWHDCIDRYP  517

Query  1638  VYI  1646
             V +
Sbjct  518   VKV  520



>gb|ABS18382.1| 3-ketoacyl-CoA synthase [Eranthis hyemalis]
Length=514

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/423 (61%), Positives = 330/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP++ RV +  FMEHS+L       ++ FQ++ILERSG
Sbjct  98    GSTVYIMTRPRPVYLVDYACYRPPSHLRVKYDQFMEHSRLTGDFDESSLEFQRKILERSG  157

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPP P++  AREEA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  158   LGEETYVPEAMHCIPPKPSMATAREEAEQVMYGALDNLFANTSVKPKDIGILVVNCSLFN  217

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I+IDLA+DLLQ HRN+ AV+VSTE IT
Sbjct  218   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAIDLAKDLLQIHRNTYAVVVSTENIT  277

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ V+  RAKYRL+HVVRTH G+ +K+++CV+
Sbjct  278   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVERRRAKYRLVHVVRTHRGSDEKAFRCVY  337

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G VG+ L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  338   QEQDDAGKVGVTLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFSTLVIKKLF-----  392

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  393   --NTKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSS  450

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R + P    +PW DCI +YP
Sbjct  451   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRYVKPSS-KSPWEDCISKYP  509

Query  1638  VYI  1646
             V +
Sbjct  510   VQV  512



>ref|XP_004238271.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Solanum lycopersicum]
Length=517

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 332/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYL+DY+CYK P + + P+  FM+HS+L       ++ FQ++ILERSG
Sbjct  101   GSTVYIMTRPRPVYLIDYSCYKAPEHLKAPYERFMQHSRLTGDFDESSLEFQRKILERSG  160

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+H +PP P+++ AREEA+ V+F  +D+L A T + PK I +L+VNCS+F+
Sbjct  161   LGDETYVPEAMHQLPPQPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVLVVNCSLFN  220

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  221   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  280

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  281   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  340

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  K+      
Sbjct  341   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFGSLIIKKIF-----  395

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + +    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+  HVEASRMTLHRFGNTSSS
Sbjct  396   --NKHIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSS  453

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G++VWQIAFGSGFKCNSAVW+  R + P   D PW DCI +YP
Sbjct  454   SIWYELAYIEAKGRMKKGNKVWQIAFGSGFKCNSAVWQALRNVKPSP-DGPWEDCIDRYP  512

Query  1638  VYI  1646
             V +
Sbjct  513   VKV  515



>gb|KFK44079.1| hypothetical protein AALP_AA1G213300 [Arabis alpina]
Length=515

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 327/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY P  + + PF  FMEHS+L        + FQ++ILERSG
Sbjct  99    GLTVYVMTRPRPVYLVDFSCYLPQDHLKAPFTRFMEHSRLTGDFDDSALEFQRKILERSG  158

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H++PP  ++  AREEA+ V+F  +D L A T +NPK I IL+VNCS+F+
Sbjct  159   LGEHTYLPEAMHHVPPKISMAAAREEAEQVMFGALDNLFANTNVNPKDIGILVVNCSLFN  218

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  219   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  278

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKYRL+HVVRTH G  DK+++CV+
Sbjct  279   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRAKYRLVHVVRTHRGADDKAFRCVY  338

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  339   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-----  393

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  394   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  451

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW DCI +YP
Sbjct  452   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRNVKPSK-NSPWEDCIEKYP  510

Query  1638  V  1640
             V
Sbjct  511   V  511



>ref|XP_006416504.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
 gb|ESQ34857.1| hypothetical protein EUTSA_v10007370mg [Eutrema salsugineum]
Length=520

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 326/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + PF  FM+HS+L        + FQ++ILERSG
Sbjct  104   GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPFTRFMDHSRLTGDFDDSALEFQRKILERSG  163

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP  ++  AREEA+ V+F  +D L A T +NPK I IL+VNCS+F+
Sbjct  164   LGEDTYVPEAMHYVPPRISMAAAREEAEQVMFGALDNLFANTNVNPKDIGILVVNCSLFN  223

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HR + AV+VSTE IT
Sbjct  224   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRKTYAVVVSTENIT  283

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKYRL+HVVRTH G  DK+++CV+
Sbjct  284   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRAKYRLVHVVRTHRGADDKAFRCVY  343

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  344   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVAKKLF-----  398

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  399   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  456

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P    +PW DCI +YP
Sbjct  457   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRNVKPSK-KSPWEDCIDKYP  515

Query  1638  V  1640
             V
Sbjct  516   V  516



>ref|NP_173376.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
 sp|Q9LN49.1|KCS4_ARATH RecName: Full=3-ketoacyl-CoA synthase 4; Short=KCS-4; AltName: 
Full=Very long-chain fatty acid condensing enzyme 4; Short=VLCFA 
condensing enzyme 4 [Arabidopsis thaliana]
 gb|AAF79428.1|AC025808_10 F18O14.21 [Arabidopsis thaliana]
 gb|ACE79746.1| At1g19440 [Arabidopsis thaliana]
 gb|AEE29852.1| 3-ketoacyl-CoA synthase 4 [Arabidopsis thaliana]
Length=516

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + P+A FMEHS+L        + FQ++ILERSG
Sbjct  100   GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDSALEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HY+PP  ++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  160   LGEDTYVPEAMHYVPPRISMAAAREEAEQVMFGALDNLFANTNVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KYRL+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  340   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  395   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW DCI +YP
Sbjct  453   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSN-NSPWEDCIDKYP  511

Query  1638  V  1640
             V
Sbjct  512   V  512



>ref|XP_007042184.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
 gb|EOX98015.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
Length=507

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 326/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+V++VDY+CY PP + +V +  F+EHS L       ++ FQ++ILERSG
Sbjct  91    GSTVYIMTRPRSVFMVDYSCYLPPPHLKVKYQQFIEHSALTGDFDESSLEFQRKILERSG  150

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE TCVP A+HY+PP P++  AREEA+ V+F  +D L A T + P+ I IL+VNCS+F+
Sbjct  151   LGEETCVPEAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTNVKPRDIGILVVNCSLFN  210

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+NKYK R N++SFNL GMGCSAG+I++DLA+D+LQ HRNS A++VSTE IT
Sbjct  211   PTPSLSAMIINKYKFRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNSYAIVVSTENIT  270

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  R+KY+L+HVVRTH G  DK++KCV+
Sbjct  271   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRSKYKLVHVVRTHCGANDKAFKCVY  330

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D  G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  331   QEQDNAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQILFFVTLVAKKLF-----  385

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   H EASRMTLHRFGNTSSS
Sbjct  386   --NAKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHAEASRMTLHRFGNTSSS  443

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P   + PW +CIH+YP
Sbjct  444   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVAIRNVKPSP-NNPWEECIHRYP  502

Query  1638  VYI  1646
             V +
Sbjct  503   VQL  505



>ref|XP_006409460.1| hypothetical protein EUTSA_v10022654mg [Eutrema salsugineum]
 gb|ESQ50913.1| hypothetical protein EUTSA_v10022654mg [Eutrema salsugineum]
Length=510

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CY PP + +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  94    GSTVFIMTRPRSVYLVDYSCYLPPESLKVKYQKFMDHSKLIEDFNDSSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPPTPT+  AR+EA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  154   LGEETYLPEALHCIPPTPTMVAARQEAEQVMFGSLDKLFENTRINPRDIGVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR GG A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  274   QNWYFGNRKAMLIPNCLFRVGGTAVLLSNKSRDRRRSKYKLVHTVRTHKGADEKAFNCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFATLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSERHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  447   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALGNVKPSV-SSPWEHCIDRYP  505

Query  1638  V  1640
             V
Sbjct  506   V  506



>ref|XP_007136167.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
 gb|ESW08161.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
Length=512

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 328/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RP ++YL+DY+CY+PP + RV F  F+ HS L     P ++ FQ++IL+RSG
Sbjct  97    GSTLYIMTRPTSIYLIDYSCYRPPHHLRVHFQKFLHHSTLTGDFLPSSLDFQRKILQRSG  156

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP P++  AREEA+ V+F  +D L A T++ PK I IL+VNCS+F+
Sbjct  157   LGEETYLPEAMHSIPPRPSMDAAREEAEQVMFGALDNLFANTRVKPKDIGILVVNCSLFN  216

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+I+IDLA+D+LQ HRN+  V+VSTE IT
Sbjct  217   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYVVVVSTENIT  276

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR GGAA+LLSN+  D  RAKY+LLHVVRTH G  DK+++CV+
Sbjct  277   QNWYFGNNKAMLIPNCLFRVGGAAILLSNKSSDKRRAKYKLLHVVRTHKGADDKAFRCVY  336

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  337   QEQDDIGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFLTLVLKKLF-----  391

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  392   --NAKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPLHVEASRMTLHRFGNTSSS  449

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R ++P    +PW DCIH+YP
Sbjct  450   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWEALRHVNPSP-KSPWEDCIHKYP  508

Query  1638  VYI  1646
             V I
Sbjct  509   VQI  511



>ref|XP_010690872.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Beta vulgaris subsp. vulgaris]
Length=508

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/423 (61%), Positives = 329/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G+ + I +RPR++YLVD++ Y PP   +V F+ F+EHS+L       ++ FQ++ILERSG
Sbjct  92    GFTLYIMTRPRSIYLVDFSLYYPPNKFKVKFSDFVEHSRLTGDFEESSLDFQRKILERSG  151

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPP P+++ AREE++ V+FS ++ LL+ T +  K I IL+VNCS+F+
Sbjct  152   LGEETVVPEAMHSIPPRPSMQAAREESEQVMFSALENLLSHTGIKTKDIGILVVNCSLFN  211

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNK+KLR N+KSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  212   PTPSLSAMIVNKFKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  271

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+ +LLSN+ +D  RAKYRL+HVVRTH G  DK++KCV+
Sbjct  272   QNWYFGNKKSMLIPNCLFRVGGSVVLLSNKSIDRARAKYRLVHVVRTHRGADDKAFKCVY  331

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG+ALK+NIT++GPLVLP+ E ++F   +V  K       
Sbjct  332   QEQDDVGKTGVSLSKDLMAIAGDALKTNITTLGPLVLPISEQLLFFFTLVVRKFF-----  386

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNLELS  HVEASRMTLHRFGNTSSS
Sbjct  387   --NVKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLELSSVHVEASRMTLHRFGNTSSS  444

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE+ YIEAKGRMK+G RVWQIAFGSGFKCNSAVW+  R + P    +PW DCI +YP
Sbjct  445   SIWYELGYIEAKGRMKKGHRVWQIAFGSGFKCNSAVWQALRNVKPSP-KSPWLDCIDRYP  503

Query  1638  VYI  1646
             V I
Sbjct  504   VEI  506



>ref|XP_003606927.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES89124.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
Length=504

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/423 (60%), Positives = 330/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR++YL+D++CYKPP+N  V F  F++HS+L       ++ FQ++ILERSG
Sbjct  88    GSTVYIMTRPRSIYLIDFSCYKPPSNLAVKFTKFIQHSKLKGDFDESSLEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPPTP +  AREEA+ V++  +D L A T++ PK I IL+VNCS+F+
Sbjct  148   LGEDTYLPEAMHKIPPTPCMASAREEAEQVMYGALDNLFANTKIKPKDIGILVVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  208   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK++KCV+
Sbjct  268   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKGCDRSRAKYKLVHVVRTHKGADDKAFKCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  K       
Sbjct  328   QEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFTTLVIKKWF-----  382

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L  +HVEASRMTLHRFGNTSSS
Sbjct  383   --NAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLMPDHVEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM++G+R+WQIAFGSGFKCNSAVW+  + +    + +PW DCI +YP
Sbjct  441   SIWYELAYIEAKGRMRKGNRIWQIAFGSGFKCNSAVWQAMKHVKASPM-SPWEDCIDRYP  499

Query  1638  VYI  1646
             V I
Sbjct  500   VEI  502



>ref|XP_011088406.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Sesamum indicum]
Length=498

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 328/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPRAVYLVDYACY+PP + RV F  FM HS+L       ++ FQ++ILERSG
Sbjct  82    GLTLYFMTRPRAVYLVDYACYRPPDHLRVDFHKFMHHSRLTGDFDDSSLEFQRKILERSG  141

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P  +H IPP P++  AREEA+ V+F  +D L   T + PK I +L+VNCS+F+
Sbjct  142   LGEETYLPEPLHQIPPQPSMAKAREEAEQVMFGALDNLFKATGVKPKDIGVLVVNCSLFN  201

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+NKYKLR N+KSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  202   PTPSLSAMIINKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQLHRNTYAVVVSTENIT  261

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSNR  D  R+KY+++HVVRTH+G++D +++CV+
Sbjct  262   ENWYFGNKKSMLIPNCLFRMGGSAVLLSNRASDKRRSKYKMMHVVRTHIGSQDTAFRCVY  321

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE G  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F V +V  KL+     
Sbjct  322   QEQDERGKTGVSLSKDLMAIAGNALKTNITTLGPLVLPVSEQLLFFVTLVARKLI-----  376

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +P     +PDFK AF+HFCIHAGGRAVIDEL+KNL L    VEASRMTLHRFGNTSSS
Sbjct  377   --NPKIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLRLEPIQVEASRMTLHRFGNTSSS  434

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR+++G RVWQIAFGSGFKCNSAVW+  R + P   ++PW DCI +YP
Sbjct  435   SIWYELAYIEAKGRIRKGQRVWQIAFGSGFKCNSAVWQALRNVKPSA-NSPWLDCIDRYP  493

Query  1638  VYI  1646
             V I
Sbjct  494   VKI  496



>ref|XP_009760261.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana sylvestris]
Length=516

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 330/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CYK P   + P+  FM+HS+L       ++ FQ++ILERSG
Sbjct  100   GSTVYIMTRPRPVYLVDYSCYKAPDELKAPYERFMQHSRLTGDFDESSLEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+H++PP P+++ AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  160   LGDETYVPEAMHHLPPQPSMQAAREEAEQVMFGALDNLFANTSVKPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  K+      
Sbjct  340   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLIIKKIC-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + +    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+  HVEASRMTLHRFGNTSSS
Sbjct  395   --NKHVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G++VWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  453   SIWYELAYTEAKGRMRKGNKVWQIAFGSGFKCNSAVWQALRNVKPS-QNGPWEDCIDRYP  511

Query  1638  VYI  1646
             V +
Sbjct  512   VKV  514



>ref|XP_002890341.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66600.1| hypothetical protein ARALYDRAFT_472173 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/421 (60%), Positives = 329/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + P+A F+EHS+L        + FQ++ILERSG
Sbjct  99    GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFIEHSRLTGDFDDSALEFQRKILERSG  158

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H++PP  ++  AREEA+ V+F  +D L A T +NPK I IL+VNCS+F+
Sbjct  159   LGEDTYVPEAMHFVPPRISMAAAREEAEQVMFGALDNLFANTSVNPKDIGILVVNCSLFN  218

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  219   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  278

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KYRL+HVVRTH G  DK+++CV+
Sbjct  279   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVY  338

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  339   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-----  393

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFC+HAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  394   --NGKVKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  451

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW DCI +YP
Sbjct  452   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSN-NSPWEDCIDKYP  510

Query  1638  V  1640
             V
Sbjct  511   V  511



>ref|XP_003549437.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max]
Length=513

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPRAVYL+D AC++P  + + PF +FM+HS+L       ++ FQ++ILERSG
Sbjct  97    GLTLYAVTRPRAVYLLDSACFRPADHLKAPFRSFMDHSRLTGDFEDSSLEFQRKILERSG  156

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPP P++  AR EA+ V+F  +D+L   T + PK I ILIVNCS+F+
Sbjct  157   LGEETYVPEAMHSIPPQPSMAAARAEAEQVMFGALDKLFQGTNIKPKDIGILIVNCSLFN  216

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  217   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  276

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR G +ALLLSN+  D  RAKYRL+HVVRTH G  DK+++CV+
Sbjct  277   QNWYFGNKKSMLIPNCLFRVGCSALLLSNKPADRRRAKYRLVHVVRTHRGADDKAFRCVY  336

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V ++  KL      
Sbjct  337   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLLMNKLF-----  391

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  392   --KAGVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSS  449

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR+K+G+R+WQIAFGSGFKCNSAVW+  R + P   + PW DCIH+YP
Sbjct  450   SIWYELAYIEAKGRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSP-NGPWEDCIHKYP  508

Query  1638  VYI  1646
             V I
Sbjct  509   VEI  511



>ref|XP_006341948.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Solanum tuberosum]
Length=519

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 331/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CYK P + + P+  FM+HS+L       ++ FQ++ILERSG
Sbjct  103   GSTVYIMTRPRPVYLVDYSCYKAPEHLKAPYERFMQHSRLTGDFDESSLEFQRKILERSG  162

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+H +PP P+++ AREEA+ V+F  +D+L A T + PK I +L+VNCS+F+
Sbjct  163   LGDETYVPEAMHQLPPQPSMQAAREEAEQVMFGALDKLFANTSVKPKKIGVLVVNCSLFN  222

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  223   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  282

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ +D  RAKY+L+H VRTH G  DK+++CV+
Sbjct  283   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDRRRAKYKLVHAVRTHRGADDKAFRCVY  342

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  K+      
Sbjct  343   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFGSLIIKKIF-----  397

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + +    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+  HVEASRMTLHRFGNTSSS
Sbjct  398   --NKHIKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSS  455

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G++VWQIAFGSGFKCNSAVW+  R + P   D PW DCI +YP
Sbjct  456   SIWYELAYIEAKGRMKKGNKVWQIAFGSGFKCNSAVWQALRNVKPSP-DGPWEDCIDRYP  514

Query  1638  VYI  1646
             V +
Sbjct  515   VKV  517



>ref|XP_009782317.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana sylvestris]
Length=518

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 326/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR++YLVDY+CY PP + +V F+ FM HS+L    +  ++ FQ++ILERSG
Sbjct  102   GTTVYIMTRPRSIYLVDYSCYHPPEHLKVKFSKFMGHSRLSGDFNESSLEFQRKILERSG  161

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H +PP P++  AREEA+ V+F  +D L   T + PK I IL+VNCS+F+
Sbjct  162   LGEETYLPEALHDVPPRPSMATAREEAEQVMFGALDNLFNNTNVKPKDIGILVVNCSLFN  221

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYK+R N+KSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VS E IT
Sbjct  222   PTPSLSAMIVNKYKMRGNIKSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSMENIT  281

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR GGAA+LLSN+  D  RAKY+++HVVRTH G  D ++KCV+
Sbjct  282   QNRYFGNNKAMLIPNCLFRVGGAAILLSNKSGDKRRAKYKVVHVVRTHKGADDTAFKCVY  341

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  342   QEQDDNGKTGVSLSKDLMSIAGNALKTNITTLGPLVLPISEQLLFFMSLVARKLF-----  396

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  397   --HAKIKPYIPDFKMAFEHFCIHAGGRAVIDELEKNLQLSPLHVEASRMTLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR+++G R+WQIAFGSGFKCNSAVW+    + P   ++PW DCIH+YP
Sbjct  455   SIWYELAYIEAKGRIRKGHRIWQIAFGSGFKCNSAVWQALTNVKPSP-NSPWEDCIHRYP  513

Query  1638  VYI  1646
             V +
Sbjct  514   VQL  516



>ref|XP_007160751.1| hypothetical protein PHAVU_001G014100g [Phaseolus vulgaris]
 gb|ESW32745.1| hypothetical protein PHAVU_001G014100g [Phaseolus vulgaris]
Length=511

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/423 (61%), Positives = 325/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPRAVYL+D AC++P  + + PF +FM+HS+L       ++ FQ++ILERSG
Sbjct  95    GLTLYAVTRPRAVYLLDSACFRPAEHLKAPFRSFMDHSRLTGDFEESSLDFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPP P++  AR EA+ V+F  +D L   T L PK I ILIVNCS+F+
Sbjct  155   LGEETYVPEAMHSIPPQPSMAAARAEAEQVMFGALDNLFHNTSLKPKDIGILIVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR G +ALLLSN+  D  RAKYRL+HVVRTH G  DK+++CV+
Sbjct  275   QNWYFGNKKSMLIPNCLFRVGCSALLLSNKPADRRRAKYRLVHVVRTHRGADDKAFRCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V ++  KL      
Sbjct  335   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLLMKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 +    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  390   --KADVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRSEHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW+    I P   + PW DCI +YP
Sbjct  448   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWQALGNIKPSP-NGPWEDCIDKYP  506

Query  1638  VYI  1646
             V I
Sbjct  507   VEI  509



>emb|CDX71278.1| BnaC07g05570D [Brassica napus]
Length=507

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 327/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CY P A+ +VP+  FM+HS L+   +  ++ FQ++ILERSG
Sbjct  91    GTTVFIMTRPRSVYLVDYSCYLPQASLQVPYKKFMDHSALIDDFNESSLEFQRKILERSG  150

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P  +H +PP  T+  AREEA+ V+F  +D+L   T++NPK I +L+VNCS+F+
Sbjct  151   LGEETYLPDGLHCVPPRTTMAAAREEAEQVMFGCLDKLFENTKINPKDIGVLVVNCSLFN  210

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  211   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  270

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG A+LLSN+  D  R+KY+++H VRTH G  +K++ CV+
Sbjct  271   QNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYKMVHTVRTHKGADEKAFNCVY  330

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  331   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFVTLVWKKLF-----  385

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  386   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSLTHVEASRMTLHRFGNTSSS  443

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  444   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  502

Query  1638  V  1640
             V
Sbjct  503   V  503



>ref|XP_010516877.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 9-like 
[Camelina sativa]
Length=511

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I SRPR+VYLVDY+CY PP   +V +  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  95    GSTVYIMSRPRSVYLVDYSCYLPPETLQVNYQKFMDHSKLIEDFNESSLEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H IPP PT+  AREEA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  155   LGEETYLPEALHCIPPRPTMMAAREEAEQVMFGALDKLFENTEINPRDIGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KY+L+H VRTH G  +K++ CV+
Sbjct  275   QNWYFGNKKAMLIPNCLFRVGGSAILLSNKGKDRRRSKYKLVHTVRTHKGAVEKAFNCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  335   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFMTLVTKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+ YE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  448   SIXYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHCIDRYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>ref|XP_004289669.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Fragaria vesca subsp. 
vesca]
Length=509

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/423 (60%), Positives = 326/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CYK P + +V +  FM+HS+L       ++ FQ++ILERSG
Sbjct  93    GSTVYIMTRPRSVYLVDYSCYKAPDHLKVKYQKFMDHSRLTGDFDESSLEFQRKILERSG  152

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H+IPP PT+  AREEA+ VIF  +D L A T + PK I IL+VNCS+F+
Sbjct  153   LGEETYLPEAMHFIPPRPTMAAAREEAEQVIFGALDNLFANTNVKPKDIGILVVNCSLFN  212

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  213   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  272

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ +D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  273   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSLDRRRAKYKLVHVVRTHKGADDKAFRCVY  332

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L   LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  333   QEQDDIGKTGVSLSKELMAIAGGALKTNITTLGPLVLPLSEQLLFFATLVAKKLF-----  387

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVE+SRMTLHRFGNTSSS
Sbjct  388   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVESSRMTLHRFGNTSSS  445

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  + + P     PW DCI  YP
Sbjct  446   SIWYELAYTEAKGRMQKGNRVWQIAFGSGFKCNSAVWEALQNVKPSP-SGPWEDCIDSYP  504

Query  1638  VYI  1646
             V I
Sbjct  505   VQI  507



>ref|XP_009627040.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nicotiana tomentosiformis]
Length=516

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/423 (59%), Positives = 328/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CYK P   + P+  FM+HS+L       ++ FQ++ILERSG
Sbjct  100   GSTVYIMTRPRPVYLVDYSCYKAPDELKAPYERFMQHSRLTGDFDESSLEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+HY+PP P+++ AR EA+ V+F  +D L A T + PK I +L+VNCS+F+
Sbjct  160   LGDETYVPEAMHYLPPQPSMQAARGEAEQVMFGALDNLFANTSVKPKDIGVLVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSVDRRRAKYKLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  K+      
Sbjct  340   QEQDDAGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLIIKKIC-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + +    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+  HVEASRMTLHRFGNTSSS
Sbjct  395   --NKHVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTQVHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G++VWQIAFGSGFKCNSAVW+  R + P     PW DCI +YP
Sbjct  453   SIWYELAYTEAKGRMRKGNKVWQIAFGSGFKCNSAVWQALRNVKPS-QKGPWEDCIDRYP  511

Query  1638  VYI  1646
             V +
Sbjct  512   VKV  514



>ref|XP_010254814.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=506

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/423 (60%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR+VYLVD++CY PP++ RV +  FMEHS+        ++ FQ++ILERSG
Sbjct  90    GATVYVMTRPRSVYLVDFSCYLPPSDLRVNYKDFMEHSKATGDFDDSSLEFQRRILERSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+ YIPP PT+  AREEA+ V+F  +D L   T LNPK I IL+VNCS+F+
Sbjct  150   LGEETYVPDAMRYIPPRPTMAKAREEAEQVMFGALDNLFTNTSLNPKDIGILVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+N+YKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  210   PTPSLSAMIINRYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  D+++ CV+
Sbjct  270   QNWYFGNKKSMLIPNCLFRVGGAAILLSNKSSDRRRAKYKLVHVVRTHCGADDRAFHCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E V+FV+ +   KL      
Sbjct  330   QEQDDRGKTGVSLSKDLMAIAGMALKTNITTLGPLVLPISEQVLFVLTLAAKKLF-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  +HVEASRMTLHRFGNTSSS
Sbjct  385   --NANIRPYIPDFKMAFDHFCIHAGGRAVIDELEKNLQLQPKHVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G R+WQIAFGSGFKCNSAVW+  R +     ++PW  CI +YP
Sbjct  443   SIWYELAYTEAKGRMRKGHRLWQIAFGSGFKCNSAVWEALRNVKASP-NSPWMQCIDRYP  501

Query  1638  VYI  1646
             V I
Sbjct  502   VEI  504



>gb|EPS60765.1| hypothetical protein M569_14036, partial [Genlisea aurea]
Length=503

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/423 (60%), Positives = 328/423 (78%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I + PRAVYLVDY+CY+ P + +  +  FMEHS+L       ++ FQ++ILERSG
Sbjct  88    GSTVYIMTLPRAVYLVDYSCYRAPESLKASYRQFMEHSRLTGDFDDSSLEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+H++PP P+++ AREEA+ V+F  +D L A T L PK I ILIVNCS+F+
Sbjct  148   LGDETYVPEAMHFVPPRPSMQAAREEAEQVMFGALDNLFANTNLRPKEIGILIVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  208   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAALLLSN+  D  R+KY+L+HVVRTH G  DK++ CV+
Sbjct  268   QNWYFGNKKSMLIPNCLFRVGGAALLLSNKAADRRRSKYKLVHVVRTHKGADDKAFHCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F + +V  K+      
Sbjct  328   QEQDENGKTGVSLSKDLMAIAGGALKTNITTLGPVVLPISEQLIFFMTLVIKKVF-----  382

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                 N    +PDFK AF+HFCIHAGGRAVIDE++KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  383   --KYNLRPYIPDFKLAFDHFCIHAGGRAVIDEVEKNLQLLPVHVEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG++VWQIAFGSGFKCNSAVW   R++ P   + PW DCI +YP
Sbjct  441   SIWYELAYIEAKGRMRRGNKVWQIAFGSGFKCNSAVWVALRSVAPSK-NGPWDDCIDRYP  499

Query  1638  VYI  1646
             V +
Sbjct  500   VKV  502



>ref|XP_007222865.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
 ref|XP_008220808.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Prunus mume]
 gb|EMJ24064.1| hypothetical protein PRUPE_ppa004284mg [Prunus persica]
Length=518

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP + + P+  FMEHS+L       ++ FQ++ILERSG
Sbjct  102   GLTVYIMTRPRPVYLVDYACYRPPDHLKAPYHRFMEHSRLTQDFDDSSLEFQRKILERSG  161

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+HYIPP P++  AREEA+ V++  +D L A T + PK I IL+VNCS+F+
Sbjct  162   LGEETYVPEAMHYIPPRPSMAAAREEAEQVMYGALDNLFANTHVKPKDIGILVVNCSLFN  221

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+ DLA+DLLQ HRN+ A++VSTE IT
Sbjct  222   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAADLAKDLLQIHRNTYAIVVSTENIT  281

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR G +A+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  282   QNWYFGNKKSMLIPNCLFRVGCSAVLLSNKSADWRRAKYKLVHVVRTHRGADDKAFRCVY  341

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  342   QEQDDKGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFSSLVVKKLF-----  396

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  397   --NANVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR+++G+RVWQIAFGSGFKCNSAVW+  R + P   + PW DCI +YP
Sbjct  455   SIWYELAYMEAKGRIRKGNRVWQIAFGSGFKCNSAVWEALRNVKPS-RNGPWEDCIDKYP  513

Query  1638  V  1640
             V
Sbjct  514   V  514



>ref|XP_008444712.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis melo]
Length=514

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/421 (60%), Positives = 324/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPR VYLVDY+CY+P  + + PF  FMEHS+L       ++ FQ++ILERSG
Sbjct  98    GLTVYTMTRPRPVYLVDYSCYRPADDLKAPFHRFMEHSRLTGDFDDSSLEFQRKILERSG  157

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPPTP++  AREEA+ V+F  +D+L A T + PK I IL+VNCS+F+
Sbjct  158   LGEETYVPEAMHCIPPTPSMAAAREEAEQVMFGALDKLFANTNVKPKDIGILVVNCSLFN  217

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  218   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTLAVVVSTENIT  277

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKYRL+H+VRTH G  DK+++CV+
Sbjct  278   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADDKAFRCVY  337

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  K       
Sbjct  338   QEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKFF-----  392

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  393   --NGNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  450

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM +G+RVWQIAFGSGFKCNSAVW+  R + P    +PW DCI  YP
Sbjct  451   SIWYELAYTEAKGRMHKGNRVWQIAFGSGFKCNSAVWEALRNVRPS-QSSPWEDCIDNYP  509

Query  1638  V  1640
             V
Sbjct  510   V  510



>ref|XP_007222962.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
 gb|EMJ24161.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
Length=396

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/422 (63%), Positives = 316/422 (75%), Gaps = 61/422 (14%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             S+PR V+LVDYAC+KPP   RVPF+TFMEHS+L+   +PK+                   
Sbjct  36    SKPRTVFLVDYACFKPPVTCRVPFSTFMEHSRLILSNNPKS-------------------  76

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
                                               T L P  IDILIVNCS+FSPTPSLSA
Sbjct  77    ----------------------------------TGLKPTDIDILIVNCSLFSPTPSLSA  102

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             M++NKYKLRSN++SFNLSGMGCSAG+ISIDLARDLLQ H NSNAV+VSTEIITPN Y G 
Sbjct  103   MVINKYKLRSNIRSFNLSGMGCSAGVISIDLARDLLQVHPNSNAVVVSTEIITPNYYQGN  162

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAALLLSNRR +  RAKYRL+HVVRTHMG+ DK+Y+CVF++ED+EG
Sbjct  163   ERAMLLPNCLFRMGGAALLLSNRRSERRRAKYRLVHVVRTHMGSDDKAYRCVFEEEDKEG  222

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGI+L  +LM +AGEALKSNIT++GPLVLP  E ++F++ ++  K++       +P   
Sbjct  223   KVGISLSKDLMAIAGEALKSNITTMGPLVLPASEQLLFLLTLIGRKIV-------NPKWK  275

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK+AFEHFCIHAGGRAVIDELQKNL+LS EH EASRMTLHRFGNTSSSSLWYE+ 
Sbjct  276   PYIPDFKQAFEHFCIHAGGRAVIDELQKNLQLSAEHCEASRMTLHRFGNTSSSSLWYELG  335

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             YIEAKGRM++GDRVWQIAFGSGFKCNSAVWKCNR I  P  + PWADCI +YPV+IP+++
Sbjct  336   YIEAKGRMRKGDRVWQIAFGSGFKCNSAVWKCNRNIETPS-EGPWADCIDRYPVHIPEVV  394

Query  1659  KV  1664
             K+
Sbjct  395   KL  396



>ref|XP_002869143.1| 3-ketoacyl-CoA synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45402.1| 3-ketoacyl-CoA synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=487

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 328/423 (78%), Gaps = 7/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G ++   SRPR++YL+DY+CY PP+N +V + TFM +S L+      ++ FQ++IL RSG
Sbjct  70    GSIVFFMSRPRSIYLLDYSCYLPPSNQKVSYQTFMNNSSLIQDFSESSLEFQRKILIRSG  129

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P +IH IPP PT+  AREEA+ VIF  +D L   T++NP+ I +L+VNCS+F+
Sbjct  130   LGEETYLPESIHCIPPRPTMAAAREEAEQVIFGALDSLFENTKINPREIGVLVVNCSLFN  189

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I+IDLA D+LQ HRN+ A++VSTE IT
Sbjct  190   PTPSLSAMIVNKYKLRVNIKSFNLGGMGCSAGVIAIDLASDMLQIHRNTFALVVSTENIT  249

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR GG+A+LLSN+ +D +R+KY+L+H VRTH G+ +K++KCV+
Sbjct  250   QNWYFGNNKAMLIPNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGSDEKAFKCVY  309

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE    G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F    V  +       
Sbjct  310   QEQDECLKTGVSLSKDLMAIAGEALKTNITTLGPLVLPISEQILFFAAFVAKRFF-----  364

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              +       +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS +HVEASRMTLHRFGNTSSS
Sbjct  365   -NVKEKKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLKLSPKHVEASRMTLHRFGNTSSS  423

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P V + PW  CIH+YP
Sbjct  424   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRDVKPSV-NNPWEHCIHRYP  482

Query  1638  VYI  1646
             V I
Sbjct  483   VKI  485



>ref|XP_010548056.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Tarenaya hassleriana]
Length=509

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/423 (60%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CYKPP+N  V F  FM HS+L+      ++ FQ++I++RSG
Sbjct  93    GSTVFIMTRPRPVYLVDYSCYKPPSNLVVNFQKFMNHSRLIEDFDDSSLEFQRKIIQRSG  152

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+  IPP  T+  AREEA+ V+F  +D LL  T+++P+ I IL+VNCS+F+
Sbjct  153   LGEETHLPEALQCIPPNSTMAAAREEAEQVMFGALDNLLENTKISPRDIGILVVNCSLFN  212

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KS+NL GMGCSAG+I+IDLA+DLLQ HRN+ AV+VSTE IT
Sbjct  213   PTPSLSAMIVNKYKLRGNIKSYNLGGMGCSAGVIAIDLAKDLLQVHRNTYAVVVSTENIT  272

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D   +KY+L+H VRTH G  DK++KCV 
Sbjct  273   QNWYFGNKKSMLIPNCLFRVGGSAILLSNKPSDRRHSKYKLIHTVRTHKGADDKAFKCVH  332

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D +G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  333   QEQDGKGKTGVSLSKDLMAIAGEALKTNITTLGPLVLPISEQIIFFMTLVAKKLF-----  387

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFC+HAGGRAVIDEL+KNL+LS  HVEAS+MTLHRFGN SSS
Sbjct  388   --NAKIKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSDTHVEASKMTLHRFGNISSS  445

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P V ++PW DCI +YP
Sbjct  446   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWMALRNVRPSV-NSPWDDCIGRYP  504

Query  1638  VYI  1646
             V I
Sbjct  505   VKI  507



>ref|XP_004152699.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis sativus]
 gb|KGN62598.1| hypothetical protein Csa_2G361630 [Cucumis sativus]
Length=514

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 324/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPR VYLVDY+CY+P  + + PF  FMEHS+L       ++ FQ++ILERSG
Sbjct  98    GLTVYTMTRPRPVYLVDYSCYRPADDLKAPFHRFMEHSRLTGDFDDSSLEFQRKILERSG  157

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPPTP++  AREEA+ V+F  +D+L A T + PK I IL+VNCS+F+
Sbjct  158   LGEETYVPEAMHCIPPTPSMAAAREEAEQVMFGALDKLFASTNVKPKDIGILVVNCSLFN  217

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  218   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHRNTLAVVVSTENIT  277

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  RAKYRL+H+VRTH G  DK+++CV+
Sbjct  278   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSADRRRAKYRLIHIVRTHRGADDKAFRCVY  337

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  K       
Sbjct  338   QEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLLVKKFF-----  392

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  393   --NGNVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  450

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM +G+RVWQIAFGSGFKCNSAVW+  R + P    +PW DCI  YP
Sbjct  451   SIWYELAYTEAKGRMHKGNRVWQIAFGSGFKCNSAVWEALRNVRPS-QSSPWEDCIDNYP  509

Query  1638  V  1640
             V
Sbjct  510   V  510



>emb|CDY21665.1| BnaA09g44160D [Brassica napus]
Length=510

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/423 (59%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR +YLVD++CY PP + +VP + FM HS L       ++ FQ++ILERSG
Sbjct  94    GLTVYVMTRPRPIYLVDFSCYLPPDHLKVPVSRFMNHSTLTGDFDESSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H++PPT ++  AREEA+ V+F  +D+L A T +  K I +L+VNCS+F+
Sbjct  154   LGEDTYLPEAMHHVPPTISMAAAREEAEQVMFGALDKLFANTNVKAKDIGVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KYRL HVVRTH G  DK+++CV+
Sbjct  274   QNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADDKAFRCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L   LM +AGE LK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  334   QEQDDTGRTGVSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  389   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   D+PW DCI +YP
Sbjct  447   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSK-DSPWEDCIDKYP  505

Query  1638  VYI  1646
             V +
Sbjct  506   VTL  508



>ref|XP_009117539.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=511

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 326/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR +YLVD++CY PP + +VP + FM HS L       ++ FQ++ILERSG
Sbjct  95    GLTVYVMTRPRPIYLVDFSCYLPPDHLKVPVSRFMNHSTLTGDFDESSLEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H++PPT ++  AREEA+ V+F  +D+L A T +  K I +L+VNCS+F+
Sbjct  155   LGEDTYLPEAMHHVPPTISMAAAREEAEQVMFGALDKLFANTNVKAKDIGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KYRL HVVRTH G  DK+++CV+
Sbjct  275   QNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADDKAFRCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L   LM +AGE LK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  335   QEQDDTGRTGVSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFVTLVVKKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   D+PW DCI +YP
Sbjct  448   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSK-DSPWEDCIDKYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>ref|XP_010932594.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Elaeis guineensis]
Length=491

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/419 (62%), Positives = 323/419 (77%), Gaps = 8/419 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             I  +SRPR +YLVD+ACYKPP + R P + FM HS+ +    P +I FQ++ILERSGLGE
Sbjct  71    IYFTSRPRTIYLVDFACYKPPTSCRFPISKFMNHSKQIEDFEPSSIEFQRKILERSGLGE  130

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
              T +PPA H IP TPT+  +REE++ VIFS++D L  KT++ P+ IDIL+VNCS+F+PTP
Sbjct  131   DTSLPPAHHAIPFTPTMAKSREESELVIFSIVDSLFQKTKVKPRDIDILVVNCSLFAPTP  190

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMIVNKYK+RSN++S+NLSGMGCSAG+ISIDLARD L  H NS A++V+TEIIT + 
Sbjct  191   SLSAMIVNKYKMRSNIRSYNLSGMGCSAGIISIDLARDELLVHANSYALVVTTEIITEHW  250

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  RSMLL NCLFR GGAA+LLSN+R +  RAKY LLHVVRTH G  D++Y+CV+Q+E
Sbjct  251   YTGNRRSMLLANCLFRMGGAAVLLSNKRREATRAKYELLHVVRTHKGADDRAYRCVYQEE  310

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             D E  +G++L  +L E+AG ALK+NIT+IGPLVLP+ E V+F V  V  +        ++
Sbjct  311   DGEKKIGVSLSRDLTEIAGGALKANITTIGPLVLPLSEQVLFFVNKVGRRF-------AN  363

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
             P     VPDF +AFEHFCIHAGGRAVI+EL   L LS E  EASRMTLHRFGNTSSSS W
Sbjct  364   PKWRPYVPDFTKAFEHFCIHAGGRAVIEELGTKLRLSEEQTEASRMTLHRFGNTSSSSPW  423

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVY  1643
             YE+ Y+EAKGRM++GDRVWQI  GSGFKCNSAVW+C R++     +  WADCI +YPV+
Sbjct  424   YELGYVEAKGRMRKGDRVWQIGLGSGFKCNSAVWRCRRSVGREE-EGVWADCIDEYPVH  481



>ref|XP_009112385.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 9-like 
[Brassica rapa]
Length=510

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 324/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +R R+VYLVDY+CY PP + +VP+  FM+HS+L+   +  ++ FQ++ILERSG
Sbjct  94    GCTVFVMTRSRSVYLVDYSCYLPPESLQVPYKKFMDHSKLIEDFNDSSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P  +H +PP  T+  AREEA+ V+F  +D+L   T++NP+ I +L+VNCS+F+
Sbjct  154   LGEETYLPEGLHCVPPRTTMVAAREEAEQVMFGCLDKLFENTKVNPRDISVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HR + AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRKTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG A+LLSN+  D  R+KY ++H VRTH G  +K++ CV+
Sbjct  274   QNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYMMVHTVRTHKGANEKAFNCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  334   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFATLVAKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNLELS  HVEASRMTLHRFGNTSSS
Sbjct  389   --NAKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLELSVTHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+GDRVWQIAFGSGFKCNSAVW     + P V  +PW  CI +YP
Sbjct  447   SIWYELAYIEAKGRMKKGDRVWQIAFGSGFKCNSAVWVALNNVKPSV-SSPWEHCIDRYP  505

Query  1638  V  1640
             V
Sbjct  506   V  506



>emb|CDY46211.1| BnaA07g03590D [Brassica napus]
Length=507

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 326/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CY P A+ +VP+  FM+HS L+   +  ++ FQ++ILERSG
Sbjct  91    GTTVFIMTRPRSVYLVDYSCYLPQASLQVPYKKFMDHSALIDDFNASSLEFQRKILERSG  150

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P  +H +PP  T+  AREEA+ V+F  +D+L   T++NP+ + +L+VNCS+F+
Sbjct  151   LGEETYLPEGLHCVPPRTTMAAAREEAEQVMFGCLDKLFENTKINPRDVGVLVVNCSLFN  210

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  211   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  270

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG A+LLSN+  D  R+KY+++H VRTH G  +K++ CV+
Sbjct  271   QNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYKMVHTVRTHKGADEKAFNCVY  330

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  331   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFVTLVWKKLF-----  385

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  386   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  443

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIAFGSGFKCNSAVW     + P V  +PW   I +YP
Sbjct  444   SIWYELAYIEAKGRMKKGNRVWQIAFGSGFKCNSAVWVALHNVKPSV-SSPWEHSIDRYP  502

Query  1638  V  1640
             V
Sbjct  503   V  503



>ref|XP_010477163.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=517

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 327/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + P++ FMEHS+L        + FQ++ILERSG
Sbjct  101   GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFMEHSKLTGDFDDSALEFQRKILERSG  160

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H++PP  ++  AREEA+ V+F  +D L A   +NPK I IL+VNCS+F+
Sbjct  161   LGEDTYVPEAMHHVPPRISMAAAREEAEQVMFGALDNLFANANVNPKDIGILVVNCSLFN  220

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  221   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  280

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KY+L+HVVRTH G  DK+++CV+
Sbjct  281   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYKLVHVVRTHRGADDKAFRCVY  340

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  341   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-----  395

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  396   --NSKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  453

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW  CI +YP
Sbjct  454   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSN-NSPWEHCIDKYP  512

Query  1638  V  1640
             V
Sbjct  513   V  513



>ref|XP_010243778.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Nelumbo nucifera]
Length=518

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/421 (60%), Positives = 325/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CY+PP+  +V    FMEHS+L       ++ FQ++I+ERSG
Sbjct  102   GSTLYIMTRPRPVYLVDYSCYRPPSRLQVRSDQFMEHSRLTGDFDDASLEFQRKIVERSG  161

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+HY+PP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  162   LGDETYVPEAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTSVKPKDIGILVVNCSLFN  221

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  222   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  281

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSN+  D  R+KY+L+HVVRTH G +D +++CV+
Sbjct  282   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNKSADRRRSKYKLVHVVRTHKGAEDTAFRCVY  341

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G VG++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  342   QEQDDAGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLVAKKLF-----  396

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRM+LHRFGNTSSS
Sbjct  397   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLMPVHVEASRMSLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G RVWQIAFGSGFKCNSAVW+  R + P     PW DCI +YP
Sbjct  455   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWEALRHVKPSP-KGPWEDCIDRYP  513

Query  1638  V  1640
             V
Sbjct  514   V  514



>ref|XP_006581119.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max]
Length=443

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/423 (60%), Positives = 327/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RP +++L+DY+CY PP + RV F  FM+HS L     P +++FQ++IL RSG
Sbjct  27    GSTLYIMTRPTSIFLLDYSCYLPPQHLRVRFNQFMDHSTLTGDFLPSSLHFQRKILLRSG  86

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H IPP P++  AR EA+ V+F  +D L + T +NPK I IL+VNCS+F+
Sbjct  87    LGEETYVPQAMHSIPPRPSISAARLEAEQVMFGSLDTLFSDTNVNPKDIGILVVNCSLFN  146

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLS+MIVNKYKLR NVKSFNL GMGCSAG+I++DLA+D+LQ H N+ AV+VSTE IT
Sbjct  147   PTPSLSSMIVNKYKLRGNVKSFNLGGMGCSAGVIAVDLAKDMLQVHPNTYAVVVSTENIT  206

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  207   QNWYFGNNKAMLIPNCLFRVGGAAILLSNKSSDRARAKYKLVHVVRTHKGADDKAFRCVY  266

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE G  G++L  +LM +AG AL +NIT++GPLVLP+ E  +F + +V  KL      
Sbjct  267   QEQDEVGKTGVSLSKDLMAIAGGALMTNITTLGPLVLPISEQFLFFLTLVVKKLF-----  321

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSS
Sbjct  322   --NAKMKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLRPEHVEASRMTLHRFGNTSSS  379

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGR+++G RVWQIAFGSGFKCNSAVW+  R ++P   +TPW +CIH+YP
Sbjct  380   SIWYELAYTEAKGRIRKGHRVWQIAFGSGFKCNSAVWEALRHVNPSP-NTPWENCIHRYP  438

Query  1638  VYI  1646
             V+I
Sbjct  439   VHI  441



>ref|XP_010248169.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=518

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 324/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDY+CY+PP+  +V    FMEHS+L       ++ FQ++I+ERSG
Sbjct  102   GSTLYIMTRPRPVYLVDYSCYRPPSRLQVRSDQFMEHSRLTGDFDDASLEFQRKIVERSG  161

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T VP A+HY+PP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  162   LGDETYVPEAMHYLPPRPSMAAAREEAEQVMFGALDNLFANTSVKPKDIGILVVNCSLFN  221

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  222   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENIT  281

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSN+  D  R+KY+L+HVVRTH G +D +++CV+
Sbjct  282   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNKSADRRRSKYKLVHVVRTHKGAEDTAFRCVY  341

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G VG++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  342   QEQDDAGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFXTLVAKKLF-----  396

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRM+LHRFGNTSSS
Sbjct  397   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLMPVHVEASRMSLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G RVWQIAFGSGFKCNSAVW+  R + P     PW DCI +YP
Sbjct  455   SIWYELAYTEAKGRMRKGHRVWQIAFGSGFKCNSAVWEALRHVKPSP-KGPWEDCIDRYP  513

Query  1638  V  1640
             V
Sbjct  514   V  514



>ref|XP_010498362.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Camelina sativa]
Length=516

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 326/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + P+A FMEHS+L        + FQ++ILERSG
Sbjct  100   GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYARFMEHSRLTGDFDDSALEFQRKILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H++P   ++  AREEA+ V+F  +D L A   +NPK I IL+VNCS+F+
Sbjct  160   LGEDTYVPEAMHHVPARISMAAAREEAEQVMFGALDNLFANANVNPKDIGILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE +T
Sbjct  220   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENMT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KYRL+HVVRTH G  DK+++CV+
Sbjct  280   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  340   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  395   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW  CI +YP
Sbjct  453   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSN-NSPWEHCIDKYP  511

Query  1638  V  1640
             V
Sbjct  512   V  512



>ref|XP_009341963.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=503

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/421 (59%), Positives = 330/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR+VYLVDY+CYK P++ +V +  FMEHS+L+   +  ++ FQ +ILERSG
Sbjct  87    GSTVNVMTRPRSVYLVDYSCYKAPSHLKVRYHQFMEHSKLIGDFNESSLEFQGKILERSG  146

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A++YIPP  ++  AREEA+ VIF  +D L A   + PK I IL+VNCS+F+
Sbjct  147   LGEETYVPEAMNYIPPRISMAAAREEAEQVIFGALDDLFANANVKPKDIGILVVNCSLFN  206

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAM+VNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  207   PTPSLSAMVVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENIT  266

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ +D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  267   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSMDRRRAKYKLVHVVRTHCGADDKAFRCVY  326

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  327   QEQDDDGKTGVSLSKDLMAIAGGALKANITTLGPLVLPLSEQLLFFATLVAKKLF-----  381

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  382   --NAKVEPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  439

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM++G+RVWQIAFGSGFKCNSAVW+  +++      +PW DCI +YP
Sbjct  440   SIWYELAYIEAKGRMQKGNRVWQIAFGSGFKCNSAVWEVLQSVKASP-HSPWEDCIDRYP  498

Query  1638  V  1640
             V
Sbjct  499   V  499



>gb|AFW79234.1| hypothetical protein ZEAMMB73_025891 [Zea mays]
Length=514

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/425 (61%), Positives = 323/425 (76%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD+ACYKPPA+ +V F  FM HS+L   +    + FQ++ILERSG
Sbjct  92    GATVYVLTRPRPVYLVDFACYKPPAHLQVRFEEFMRHSKLCGFSD-DALEFQRKILERSG  150

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             L E T VP A+H +PP PT+  AR EA+TV+F  +D L   T + PK + +L+VNCS+F+
Sbjct  151   LSEETYVPEAMHALPPQPTMANARAEAETVMFGALDSLFRSTGVRPKDVGVLVVNCSLFN  210

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NV+SFNL GMGCSAG+I++DLARD+LQ HR + AV+VSTE IT
Sbjct  211   PTPSLSAMIVNKYKLRGNVRSFNLGGMGCSAGVIAVDLARDMLQVHRGTYAVVVSTENIT  270

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSNR  D  RAKY L HVVRTH G  D+++ CV+
Sbjct  271   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGGDRRRAKYVLRHVVRTHKGADDRAFNCVY  330

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D EG  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL+     
Sbjct  331   QEQDGEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLL-----  385

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               S      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  386   -VSAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPAHVEASRMTLHRFGNTSSS  444

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG RVWQIAFGSGFKCNSAVW   R + P   D+PW DCI +YP
Sbjct  445   SIWYELAYMEAKGRVRRGHRVWQIAFGSGFKCNSAVWHALRNVKPSP-DSPWEDCIDRYP  503

Query  1638  VYIPD  1652
             V + D
Sbjct  504   VELVD  508



>ref|XP_010548057.1| PREDICTED: 3-ketoacyl-CoA synthase 9-like [Tarenaya hassleriana]
Length=479

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/423 (59%), Positives = 324/423 (77%), Gaps = 8/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYL+DY+CYKPP+     F  FM+  +LV      ++ FQ++I+ERSG
Sbjct  63    GSTVFIMTRPRSVYLIDYSCYKPPSTLEANFQKFMDQLRLVEDFDDSSLEFQRKIIERSG  122

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A H IPP  T+  +REE + VIF  +D LL  T++NP+ I IL+VNCS+F+
Sbjct  123   LGEETHLPEAFHCIPPRQTMVASREETEQVIFGALDNLLENTKINPREIGILVVNCSLFN  182

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+K++NL GMGCSAG+I+IDL +DLLQ HRN+ AV+VSTE IT
Sbjct  183   PTPSLSAMIVNKYKLRGNIKTYNLGGMGCSAGVIAIDLVKDLLQVHRNTYAVVVSTENIT  242

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N YLG ++SML+PNCLFR GG+A+LLSN+  D   +KY+L+H VRTH G  DK++KCV+
Sbjct  243   QNWYLGNKKSMLIPNCLFRVGGSAILLSNKPSDRRHSKYKLVHTVRTHKGADDKAFKCVY  302

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D  G  G++L  +L+ +AGEALK NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  303   QEQDGNGKSGVSLSKDLVAIAGEALKMNITTLGPLVLPISEQLLFFMTLVAKKLF-----  357

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFC+HAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  358   --NAKIKPYIPDFKLAFEHFCVHAGGRAVIDELEKNLQLSDTHVEASRMTLHRFGNTSSS  415

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P V ++PW DCI +YP
Sbjct  416   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVRPSV-NSPWDDCIGRYP  474

Query  1638  VYI  1646
             V I
Sbjct  475   VKI  477



>ref|NP_001130638.1| g14A [Zea mays]
 gb|ACF78938.1| unknown [Zea mays]
 gb|ACF84285.1| unknown [Zea mays]
 gb|AFW63814.1| g14A [Zea mays]
Length=485

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/427 (60%), Positives = 330/427 (77%), Gaps = 12/427 (3%)
 Frame = +3

Query  384   LIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLG  563
             ++ ++ RPRAVYLVDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLG
Sbjct  69    VLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFMTRLLERSGLG  128

Query  564   ERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPT  743
             E TC+P A HYIPP+  L+ +R EA+ VIFS +D LLAKT ++P+ IDIL+VNCS+F+PT
Sbjct  129   EETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDILVVNCSLFAPT  188

Query  744   PSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITP  920
             PS + M++ +Y LR +V+S +L+GMGCSAGLIS++LAR+LLQ   R + A++VSTE ITP
Sbjct  189   PSFADMVMRRYGLRGDVRSVHLAGMGCSAGLISVELARNLLQVAPRGARALVVSTETITP  248

Query  921   NSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQ  1100
             N Y+GKER+MLLPNCLFR GGAA LLS    DG  A++RL  VVRT  G  D +Y+CV+Q
Sbjct  249   NYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGASDAAYRCVYQ  305

Query  1101  QEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqs  1280
             +EDE G VGINL  +LM +AG+ALK+NIT++GPLVLP  E ++F +  +  K++      
Sbjct  306   EEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIARKVL------  359

Query  1281  sspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSS  1460
              +      +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSS
Sbjct  360   -NDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSS  418

Query  1461  LWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             LWYE++YIEAKGRM+RGDRVW I FGSGFKCNSA W+C R       D PWA+CIH+YPV
Sbjct  419   LWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPA-ANADDGPWANCIHRYPV  477

Query  1641  YIPDILK  1661
             +IPD+LK
Sbjct  478   HIPDVLK  484



>ref|XP_009149432.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brassica rapa]
Length=506

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/421 (59%), Positives = 322/421 (76%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + PF+ FM HS+L        + FQ++IL+RSG
Sbjct  90    GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPFSRFMAHSRLTGDFDDSALEFQRKILQRSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP  +H++PP  ++  AREEA+ V+F  +D L   T +NPK I IL+VNCS+F+
Sbjct  150   LGEDTYVPEGMHHVPPRISMAAAREEAEQVMFGALDSLFENTNINPKDIGILVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HR + AV+VSTE IT
Sbjct  210   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRKTYAVVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  ++ML+PNCLFR GG+A+LLSN+  D  R+KYRL HVVRTH G  DK+++CV+
Sbjct  270   QNWYFGNNKAMLIPNCLFRVGGSAVLLSNKSSDKRRSKYRLSHVVRTHRGADDKAFRCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  330   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFTTLVVKKLF-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  385   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   ++PW DCI +YP
Sbjct  443   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSK-NSPWEDCIDKYP  501

Query  1638  V  1640
             V
Sbjct  502   V  502



>ref|XP_002441534.1| hypothetical protein SORBIDRAFT_09g028860 [Sorghum bicolor]
 gb|EES19964.1| hypothetical protein SORBIDRAFT_09g028860 [Sorghum bicolor]
Length=520

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/425 (61%), Positives = 321/425 (76%), Gaps = 9/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD+ACYKPPA+ +V F  FM HS+L   +    + FQ++ILERSG
Sbjct  96    GATVYVLTRPRPVYLVDFACYKPPAHLQVRFEEFMRHSKLCGFSE-DALEFQRKILERSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             L E T VP A+H IPP PT+  AR EA+TV+F  +D L   T + PK + +L+VNCS+F+
Sbjct  155   LSEETYVPEAMHAIPPQPTMANARAEAETVMFGALDNLFKSTGVKPKDVGVLVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I++DLARD+LQ HR + AV+VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAVDLARDMLQVHRGTYAVVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GG+A+LLSNR  D  RAKY L HVVRTH G  DK++ CV+
Sbjct  275   QNWYFGNRKSMLIPNCLFRVGGSAVLLSNRGADRRRAKYSLRHVVRTHKGADDKAFNCVY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D EG  G++L  +LM +AG ALK+NIT++GPLVLP  E ++F   +V  KL+     
Sbjct  335   QEQDGEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPFSEQLLFFATLVAKKLL-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               S      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  390   --SAKMKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPAHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG R+WQIAFGSGFKCNSAVW   R + P   D PW DCI +YP
Sbjct  448   SIWYELAYMEAKGRVRRGHRIWQIAFGSGFKCNSAVWHALRNVKPSP-DNPWEDCIDRYP  506

Query  1638  VYIPD  1652
             V + D
Sbjct  507   VELVD  511



>ref|XP_010459615.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Camelina sativa]
Length=518

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/421 (59%), Positives = 326/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD++CY PP + + P++ FMEHS+L        + FQ++ILERSG
Sbjct  102   GLTVYVMTRPRPVYLVDFSCYLPPDHLKAPYSRFMEHSRLTGDFDDSALEFQRKILERSG  161

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H++P   ++  AREEA+ V+F  +D L A   +NPK I IL+VNCS+F+
Sbjct  162   LGEDTYVPEAMHHVPARISMAAAREEAEQVMFGALDNLFANANVNPKDIGILVVNCSLFN  221

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE +T
Sbjct  222   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENMT  281

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+  D  R+KYRL+HVVRTH G  DK+++CV+
Sbjct  282   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLVHVVRTHRGADDKAFRCVY  341

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  342   QEQDDTGRTGVSLSKDLMAIAGETLKTNITTLGPLVLPISEQILFFMTLVVKKLF-----  396

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  397   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSA+W+  R + P   ++PW  CI +YP
Sbjct  455   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAIWEALRHVKPSN-NSPWEHCIDKYP  513

Query  1638  V  1640
             V
Sbjct  514   V  514



>ref|XP_009121221.1| PREDICTED: 3-ketoacyl-CoA synthase 9 [Brassica rapa]
Length=507

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/421 (59%), Positives = 325/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDY+CY P A+ +VP+  FM+HS L+   +  ++ FQ++ILERSG
Sbjct  91    GTTVFIMTRPRSVYLVDYSCYLPQASLQVPYKKFMDHSALIDDFNASSLEFQRKILERSG  150

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P  +H +PP  T+  AREEA+ V+F  +D+L   T++NP+ + +L+VNCS+F+
Sbjct  151   LGEETYLPEGLHCVPPRTTMAAAREEAEQVMFGCLDKLFENTKINPRDVGVLVVNCSLFN  210

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+ISIDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  211   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVISIDLAKDMLQVHRNTYAVVVSTENIT  270

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG A+LLSN+  D  R+KY+++H VRTH G  +K++ CV+
Sbjct  271   QNWYFGNKKAMLIPNCLFRVGGTAVLLSNKASDRRRSKYKMVHTVRTHKGADEKAFNCVY  330

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F V +V  KL      
Sbjct  331   QEQDDNGKTGVSLSKDLMAIAGEALKANITTLGPLVLPISEQILFFVTLVWKKLF-----  385

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  386   --NAKLKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLSQTHVEASRMTLHRFGNTSSS  443

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRMK+G+RVWQIA GSGFKCNSAVW     + P V  +PW   I +YP
Sbjct  444   SIWYELAYIEAKGRMKKGNRVWQIACGSGFKCNSAVWVALHNVKPSV-SSPWEHSIDRYP  502

Query  1638  V  1640
             V
Sbjct  503   V  503



>ref|XP_006284916.1| hypothetical protein CARUB_v10006212mg [Capsella rubella]
 gb|EOA17814.1| hypothetical protein CARUB_v10006212mg [Capsella rubella]
Length=481

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/423 (59%), Positives = 326/423 (77%), Gaps = 7/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   SRPR+VYLVDY+CY PP N +V +  FM  S+L+      ++ FQ++IL RSG
Sbjct  64    GSTVFFMSRPRSVYLVDYSCYLPPPNQKVTYQIFMNKSRLIQDFSESSLEFQRKILIRSG  123

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P +IH +PP PT+  AREEA+ VIF  +D L   T++NP+ I +L+VNCS+F+
Sbjct  124   LGEETYLPESIHCVPPRPTMAAAREEAEQVIFGAIDNLFDNTKINPREIGVLVVNCSLFN  183

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLA D+LQ HRN+ A++VSTE IT
Sbjct  184   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLASDMLQIHRNTFALVVSTENIT  243

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +R+ML+PNCLFR GG+A+LLSN+ +D +R+KY+L+H VRTH G+ +K++ CV+
Sbjct  244   QNWYFGNKRAMLIPNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGSDEKAFNCVY  303

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE    G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F    V  +L      
Sbjct  304   QEQDECLKTGVSLSKDLMSIAGEALKTNITTLGPLVLPISEQILFFATFVAKRLF-----  358

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              ++      +PDFK AF+HFCIHAGGRAVIDEL+K+L+LS  HVEASRMTLHRFGNTSSS
Sbjct  359   -NAKKQKPYIPDFKLAFDHFCIHAGGRAVIDELEKSLKLSPRHVEASRMTLHRFGNTSSS  417

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGR+++G+RVWQIAFGSGFKCNSAVW   R + P V + PW  CIH+YP
Sbjct  418   SIWYELAYTEAKGRVRKGNRVWQIAFGSGFKCNSAVWVALRDVKPSV-NNPWQHCIHRYP  476

Query  1638  VYI  1646
             V I
Sbjct  477   VKI  479



>emb|CDX81929.1| BnaC08g36720D [Brassica napus]
Length=510

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 247/421 (59%), Positives = 323/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR +YLVD++CY PP   +VP + FM HS L       ++ FQ++ILERSG
Sbjct  94    GLTVYVMTRPRPIYLVDFSCYLPPDRLKVPVSRFMNHSTLTGDFDESSLEFQRKILERSG  153

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H++PPT ++  AREEA+ V+F  +D+L   T +  K I +L+VNCS+F+
Sbjct  154   LGEDTYLPEAMHHVPPTISMAAAREEAEQVMFGALDKLFTNTNVKAKDIGVLVVNCSLFN  213

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++S+NL GMGCSAG+I++DLA+D+L  HRN+ AV+VSTE IT
Sbjct  214   PTPSLSAMIVNKYKLRGNIRSYNLGGMGCSAGVIAVDLAKDMLLVHRNTYAVVVSTENIT  273

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D  R+KYRL HVVRTH G  DK+++CV+
Sbjct  274   QNWYFGNKKAMLIPNCLFRVGGSAVLLSNKSRDKRRSKYRLSHVVRTHRGADDKAFRCVY  333

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+    G++L   LM +AGE LK+NIT++GPLVLP+ E ++F + +V  KL      
Sbjct  334   QEQDDTRRTGVSLSKELMAIAGETLKTNITTLGPLVLPISEQILFFLTLVVKKLF-----  388

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  389   --NGKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  446

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG+RVWQIAFGSGFKCNSAVW+  R + P   D+PW DCI +YP
Sbjct  447   SIWYELAYIEAKGRMRRGNRVWQIAFGSGFKCNSAVWEALRNVKPSK-DSPWEDCIDKYP  505

Query  1638  V  1640
             V
Sbjct  506   V  506



>ref|XP_006655600.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like, partial [Oryza brachyantha]
Length=495

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/425 (60%), Positives = 320/425 (75%), Gaps = 9/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD+ACYKPP N +V F  F+ HS+L   +    + FQ++ILERSG
Sbjct  71    GATVYVLTRPRPVYLVDFACYKPPDNLKVRFEEFLHHSKLCGFSE-DCLEFQRKILERSG  129

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             L E T VP A+H IPP PT+  AR EA++V+F  +D L   T + PK + +L+VNCS+F+
Sbjct  130   LSEETYVPEAMHLIPPVPTMANARAEAESVMFGALDNLFKATGVKPKDVGVLVVNCSLFN  189

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLARD+LQ HRN+ AV+VSTE IT
Sbjct  190   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLARDMLQVHRNTYAVVVSTENIT  249

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSNR  D  RAKY L HVVRTH G  +K++ CV+
Sbjct  250   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGSDRRRAKYALKHVVRTHRGADNKAFNCVY  309

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             QQ+D+EG  G++L   LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL      
Sbjct  310   QQQDDEGKTGVSLSKALMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLF-----  364

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  365   --NAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLQPVHVEASRMTLHRFGNTSSS  422

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG R+WQIAFGSGFKCNSAVW   R + P    +PW DCI +YP
Sbjct  423   SIWYELAYMEAKGRVRRGHRIWQIAFGSGFKCNSAVWHALRNVKPSP-QSPWEDCIDRYP  481

Query  1638  VYIPD  1652
             V + D
Sbjct  482   VELVD  486



>ref|XP_009594431.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 4-like 
[Nicotiana tomentosiformis]
Length=513

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/421 (59%), Positives = 323/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G ++ I +RPR + LVDY+CY PP + +V F+ FM HS+L       ++ FQ++ILERSG
Sbjct  97    GAIVYIMTRPRPICLVDYSCYHPPEHLKVKFSKFMGHSRLTGDFDESSLEFQRKILERSG  156

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P A+H +PP P++  AREEA+ V+F  +D L   T + PK I+IL+VNCS+F+
Sbjct  157   LGEETYLPEALHDVPPRPSMATAREEAEQVMFGALDNLFNNTNVKPKDIEILVVNCSLFN  216

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VS E IT
Sbjct  217   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAIDLAKDMLQFHRNTYAVVVSMENIT  276

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GGAA+LLSN+  D  RAKY+++HVVRTH G  D ++KCV+
Sbjct  277   QNWYFGNKKAMLIPNCLFRVGGAAILLSNKAGDKRRAKYKVVHVVRTHKGADDTAFKCVY  336

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM + G ALK+NIT++GPL LP+ + ++F + +V  KL      
Sbjct  337   QEQDDNGKTGVSLSKDLMAITGNALKTNITTLGPLXLPISKQLLFFMSLVARKLF-----  391

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
                      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  392   --HAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPVHVEASRMTLHRFGNTSSS  449

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR++RG R+WQIAFGSGFKCNSAVW+    + P   ++PW DCIH+YP
Sbjct  450   SIWYELAYIEAKGRIRRGHRIWQIAFGSGFKCNSAVWQALTNVKPSP-NSPWEDCIHRYP  508

Query  1638  V  1640
             V
Sbjct  509   V  509



>gb|ACO72624.1| g14a [Zea mays]
Length=485

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/427 (60%), Positives = 329/427 (77%), Gaps = 12/427 (3%)
 Frame = +3

Query  384   LIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLG  563
             ++ ++ RPRAVYLVDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLG
Sbjct  69    VLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFMTRLLERSGLG  128

Query  564   ERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPT  743
             E TC+P A HYIPP+  L+ +R EA+ VIFS +D LLAKT ++P+ IDIL+VNCS+F+PT
Sbjct  129   EETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDILVVNCSLFAPT  188

Query  744   PSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITP  920
             PS + M++ +Y LR +V+S +L+GMGCSAGLIS++LAR+LLQ   R + A++VSTE ITP
Sbjct  189   PSFADMVMRRYGLRGDVRSVHLAGMGCSAGLISVELARNLLQVAPRGARALVVSTETITP  248

Query  921   NSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQ  1100
             N Y+GKER+MLLPNCLFR GGAA LLS    DG  A++RL  VVRT  G  D +Y+CV+Q
Sbjct  249   NYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGASDAAYRCVYQ  305

Query  1101  QEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqs  1280
             +EDE G VGINL  +LM +AG+ALK+NIT++GPLVLP  E ++F +  +  K++      
Sbjct  306   EEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIARKVL------  359

Query  1281  sspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSS  1460
              +      +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRF NTSSSS
Sbjct  360   -NDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFSNTSSSS  418

Query  1461  LWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             LWYE++YIEAKGRM+RGDRVW I FGSGFKCNSA W+C R       D PWA+CIH+YPV
Sbjct  419   LWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPA-ANADDGPWANCIHRYPV  477

Query  1641  YIPDILK  1661
             +IPD+LK
Sbjct  478   HIPDVLK  484



>ref|XP_010255306.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=523

 Score =   538 bits (1385),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 324/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVDYACY+PP++ +V    FMEHS+L+      ++ FQ++ILERSG
Sbjct  107   GSTLYVMTRPRPVYLVDYACYRPPSHFQVRPQKFMEHSRLIGDFDEASLEFQRKILERSG  166

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T +P A+H +PP P++  AREEA+ V+F  +D L A T + PK I IL+VNCS+F+
Sbjct  167   LGDETYLPEAMHCLPPRPSMAAAREEAEQVMFGALDTLFANTSVKPKDIGILVVNCSLFN  226

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMI+NKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ H N+ AV+VSTE IT
Sbjct  227   PTPSLSAMIINKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQVHGNTYAVVVSTENIT  286

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GGAA+LLSN+  D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  287   QNWYFGNKKSMLIPNCLFRVGGAAVLLSNKSADRRRAKYKLVHVVRTHRGADDKAFRCVY  346

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q+ED+ G VG++L  +LM +AG ALK NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  347   QEEDDAGKVGVSLSKDLMAIAGGALKINITTLGPLVLPISEQLLFFATLVVKKLF-----  401

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL L   HVEASRM+LHRFGNTSSS
Sbjct  402   --NSKVKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLHLMPVHVEASRMSLHRFGNTSSS  459

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW+  R + P     PW DCI +YP
Sbjct  460   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWESLRHVKPSP-KNPWEDCIDRYP  518

Query  1638  V  1640
             V
Sbjct  519   V  519



>ref|XP_011088405.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like isoform X2 [Sesamum 
indicum]
Length=452

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/425 (59%), Positives = 327/425 (77%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G    IS+RPR V+LVDYACY+PP + R  F  +M H++L       ++ FQ +IL+ SG
Sbjct  36    GLTCYISTRPRPVFLVDYACYRPPEHLRADFRKYMNHARLTGHFDDSSLEFQGKILQHSG  95

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T +P A+H IP  P++  AR+EA+ VIF V+D L + T + PK I +L+VNCS+F+
Sbjct  96    LGDETYLPEALHEIPLQPSMAKARQEAEEVIFGVLDNLFSATAVKPKDIGVLVVNCSLFN  155

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLA+D+LQ HR++ A++VSTE IT
Sbjct  156   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLAKDMLQLHRHTYAIVVSTENIT  215

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              NSY G ++SML+PNCLFR GGAALLLSNR  D  R+KY+++HVVRTH+G+ D +++CV+
Sbjct  216   QNSYFGNKKSMLIPNCLFRLGGAALLLSNRSSDKRRSKYKMMHVVRTHLGSHDTAFRCVY  275

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             QQ+DE+G  G++L  +LM +AG ALK+NIT +GPLVLP+ E ++F V ++  KL+     
Sbjct  276   QQQDEKGKTGVSLSKDLMAIAGNALKTNITRLGPLVLPISEQLLFFVILMARKLI-----  330

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +P     +PDF+ AF+HFCIHAGGRAVIDEL+KNL L    VEASRMTLHRFGNTSSS
Sbjct  331   --NPKMKPYIPDFRLAFDHFCIHAGGRAVIDELEKNLRLEPIQVEASRMTLHRFGNTSSS  388

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR+K+G RVWQIAFGSGFKCNSAVW+  R + P    +PW DC+ +YP
Sbjct  389   SIWYELAYIEAKGRIKKGQRVWQIAFGSGFKCNSAVWQALRNVKPSA-SSPWLDCVDRYP  447

Query  1638  VYIPD  1652
             V + D
Sbjct  448   VKMVD  452



>gb|ACO72625.1| g14a [Zea mays]
Length=485

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/427 (60%), Positives = 329/427 (77%), Gaps = 12/427 (3%)
 Frame = +3

Query  384   LIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLG  563
             ++ ++ RPRAVYLVDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLG
Sbjct  69    VLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFMTRLLERSGLG  128

Query  564   ERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPT  743
             E TC+P A HYIPP+  L+ +R EA+ VIFS +D LLAKT ++P+ IDIL+VNCS+F+PT
Sbjct  129   EETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDILVVNCSLFAPT  188

Query  744   PSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITP  920
             PS + M++ +Y LR +V+S +L+GM CSAGLIS++LAR+LLQ   R + A++VSTE ITP
Sbjct  189   PSFADMVMRRYGLRGDVRSVHLAGMDCSAGLISVELARNLLQVAPRGARALVVSTETITP  248

Query  921   NSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQ  1100
             N Y+GKER+MLLPNCLFR GGAA LLS    DG  A++RL  VVRT  G  D +Y+CV+Q
Sbjct  249   NYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGASDAAYRCVYQ  305

Query  1101  QEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqs  1280
             +EDE G VGINL  +LM +AG+ALK+NIT++GPLVLP  E ++F +  +  K++      
Sbjct  306   EEDERGNVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIARKVL------  359

Query  1281  sspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSS  1460
              +      +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSS
Sbjct  360   -NDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSS  418

Query  1461  LWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             LWYE++YIEAKGRM+RGDRVW I FGSGFKCNSA W+C R       D PWA+CIH+YPV
Sbjct  419   LWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPA-ANADDGPWANCIHRYPV  477

Query  1641  YIPDILK  1661
             +IPD+LK
Sbjct  478   HIPDVLK  484



>gb|ACO72623.1| g14a [Zea mays]
Length=485

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/427 (60%), Positives = 329/427 (77%), Gaps = 12/427 (3%)
 Frame = +3

Query  384   LIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLG  563
             ++ ++ RPRAVYLVDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLG
Sbjct  69    VLYLTLRPRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFMTRLLERSGLG  128

Query  564   ERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPT  743
             E TC+P A HYIPP+  L+ +R EA+ VIFS +D LLAKT ++P+ IDIL+VNCS+F+PT
Sbjct  129   EETCLPYAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPQDIDILVVNCSLFAPT  188

Query  744   PSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITP  920
             PS + M++ +Y LR +V+S +L+GMGCSAGLIS++LAR+LLQ   R + A++VSTE ITP
Sbjct  189   PSFADMVMRRYGLRGDVRSVHLAGMGCSAGLISVELARNLLQVAPRGARALVVSTETITP  248

Query  921   NSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQ  1100
             N Y+GKER+MLLPNCLFR GGAA LLS    DG  A++RL  VVRT  G  D +Y+CV+Q
Sbjct  249   NYYMGKERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGASDAAYRCVYQ  305

Query  1101  QEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqs  1280
             +EDE G V INL  +LM +AG+ALK+NIT++GPLVLP  E ++F +  +  K++      
Sbjct  306   EEDERGNVDINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIARKVL------  359

Query  1281  sspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSS  1460
              +      +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSS
Sbjct  360   -NDRVKPYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSS  418

Query  1461  LWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             LWYE++YIEAKGRM+RGDRVW I FGSGFKCNSA W+C R       D PWA+CIH+YPV
Sbjct  419   LWYELAYIEAKGRMRRGDRVWMIGFGSGFKCNSAAWECIRPA-ANADDGPWANCIHRYPV  477

Query  1641  YIPDILK  1661
             +IPD+LK
Sbjct  478   HIPDVLK  484



>ref|NP_001146356.1| uncharacterized protein LOC100279934 [Zea mays]
 ref|XP_008643503.1| PREDICTED: uncharacterized protein LOC100279934 isoform X1 [Zea 
mays]
 gb|ACL53765.1| unknown [Zea mays]
 gb|ACN28136.1| unknown [Zea mays]
Length=493

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 328/422 (78%), Gaps = 15/422 (4%)
 Frame = +3

Query  402   RPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVP  581
             RPRAVYLVDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLGE TC+P
Sbjct  84    RPRAVYLVDYACFRTSPNCRVPFATFLEHSRVWPGFDERSVRFMTRLLERSGLGEETCLP  143

Query  582   PAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAM  761
              A HYIPP+  L+ +R EA+ VIFS +D LLAKT ++P+ IDIL+VNCS+F+PTPS + M
Sbjct  144   YAQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGVSPRDIDILVVNCSLFAPTPSFADM  203

Query  762   IVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITPNSYLGK  938
             + ++Y+LR +V++ +L+GMGCSAGL+S++LAR+LLQ   R + A++VSTE ITPN Y+G+
Sbjct  204   VAHRYRLRGDVRNVHLAGMGCSAGLVSVELARNLLQVAPRGARALVVSTETITPNYYMGE  263

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA LLS    DG  A++RL  VVRT  G  D +Y+CV+Q+EDE G
Sbjct  264   ERAMLLPNCLFRMGGAAALLST---DGAGARFRLARVVRTLRGASDGAYRCVYQEEDERG  320

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AG+ALK+NIT++GPLVLP  E ++F +  +  K++       +    
Sbjct  321   NVGINLSKDLMSIAGDALKANITAMGPLVLPASEQLLFALSFIARKVL-------NNRIR  373

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSSLWYE++
Sbjct  374   PYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSSLWYELA  433

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPV-LDTPWADCIHQYPVYIPDI  1655
             Y+EAKGRM+RGDRVW I FGSGFKCNSA W+C   I P    D PWA+CIH+YPV+IPD+
Sbjct  434   YVEAKGRMRRGDRVWMIGFGSGFKCNSAAWEC---IRPAANADGPWANCIHRYPVHIPDV  490

Query  1656  LK  1661
             LK
Sbjct  491   LK  492



>ref|NP_001267518.1| uncharacterized protein LOC100797855 [Glycine max]
 gb|AFY23861.1| 3-ketoacyl-CoA synthase [Glycine max]
Length=510

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/414 (60%), Positives = 320/414 (77%), Gaps = 8/414 (2%)
 Frame = +3

Query  405   PRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVPP  584
             PR VYL+D AC++P  + + PF +FM+HS+L       ++ FQ++ILERSGLGE T VP 
Sbjct  103   PRPVYLLDSACFRPADHLKAPFRSFMDHSRLTGDFEESSLEFQRKILERSGLGEETYVPD  162

Query  585   AIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAMI  764
             A+H IPP P++  AR EA+ V+F  +D L   T + PK I ILIVNCS+F+PTPSLS+MI
Sbjct  163   AMHSIPPQPSMAAARAEAEQVMFGALDNLFQSTNIKPKDIGILIVNCSLFNPTPSLSSMI  222

Query  765   VNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGKER  944
             VNKYKLR N++SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT N Y G ++
Sbjct  223   VNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDLLQVHRNTYAVVVSTENITQNWYFGNKK  282

Query  945   SMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGFV  1124
             SML+PNCLFR G + LLLSN+  D  RAKYRL+HVVRTH G  DK+++CV+Q++D+ G  
Sbjct  283   SMLIPNCLFRVGCSVLLLSNKPADRRRAKYRLVHVVRTHRGADDKAFRCVYQEQDDAGKT  342

Query  1125  GINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnkk  1304
             G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V ++  KL          +    
Sbjct  343   GVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLLMKKLF-------KADVKPY  395

Query  1305  VPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSYI  1484
             +PDFK AF+HFCIHAGGRAVIDEL+KNL+L  EHVEASRMTLHRFGNTSSSS+WYE++YI
Sbjct  396   IPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPEHVEASRMTLHRFGNTSSSSIWYELAYI  455

Query  1485  EAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             EAKGR+K+G+R+WQIAFGSGFKCNSAVW+  R + P   + PW DCI +YPV I
Sbjct  456   EAKGRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSP-NGPWEDCIDKYPVEI  508



>ref|XP_004953823.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Setaria italica]
Length=484

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/421 (61%), Positives = 328/421 (78%), Gaps = 15/421 (4%)
 Frame = +3

Query  405   PRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVPP  584
             PRAVYLVDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLGE TC+P 
Sbjct  76    PRAVYLVDYACFRTNPNCRVPFATFLEHSRVWPGFDERSVRFMTRLLERSGLGEETCLPY  135

Query  585   AIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAMI  764
             A HYIPP+  L+ +R EA+ VIFS +D LLAKT L+P+ IDIL+VNCS+F+PTPS + MI
Sbjct  136   AQHYIPPSRDLESSRAEAELVIFSAIDDLLAKTGLSPQDIDILVVNCSLFAPTPSFTDMI  195

Query  765   VNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITPNSYLGKE  941
             + +YKLR +V++ +L+GMGCSAGLIS++LAR+LLQ   R ++A++VSTE ITPN Y+G+E
Sbjct  196   MRRYKLREDVRAVHLAGMGCSAGLISVELARNLLQVAPRGAHALVVSTETITPNYYMGQE  255

Query  942   RSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEGF  1121
             R+MLLPNCLFR GGAA LLS    +G  A++RL  VVRT  G  D +Y+CV+Q+ED+ G 
Sbjct  256   RAMLLPNCLFRMGGAAALLS---TNGANARFRLARVVRTLRGASDSAYRCVYQEEDDRGN  312

Query  1122  VGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnnk  1301
             VGINL  +LM +AG+ALK+NIT++GPLVLP  E ++F +  +  K++       +     
Sbjct  313   VGINLSKDLMNIAGDALKANITAMGPLVLPASEQLLFALSFIARKVL-------NNRIKP  365

Query  1302  kVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMSY  1481
              +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSSLWYE++Y
Sbjct  366   YIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSSLWYELAY  425

Query  1482  IEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPV-LDTPWADCIHQYPVYIPDIL  1658
             IEAKGRM+RGDRVW I FGSGFKCNSA W+C   I P    D PWA+CIH+YPV+IPD+L
Sbjct  426   IEAKGRMRRGDRVWMIGFGSGFKCNSAAWEC---IRPAANADGPWANCIHRYPVHIPDVL  482

Query  1659  K  1661
             K
Sbjct  483   K  483



>ref|XP_011088403.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like isoform X1 [Sesamum 
indicum]
Length=506

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/425 (59%), Positives = 327/425 (77%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G    IS+RPR V+LVDYACY+PP + R  F  +M H++L       ++ FQ +IL+ SG
Sbjct  90    GLTCYISTRPRPVFLVDYACYRPPEHLRADFRKYMNHARLTGHFDDSSLEFQGKILQHSG  149

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T +P A+H IP  P++  AR+EA+ VIF V+D L + T + PK I +L+VNCS+F+
Sbjct  150   LGDETYLPEALHEIPLQPSMAKARQEAEEVIFGVLDNLFSATAVKPKDIGVLVVNCSLFN  209

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLA+D+LQ HR++ A++VSTE IT
Sbjct  210   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLAKDMLQLHRHTYAIVVSTENIT  269

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              NSY G ++SML+PNCLFR GGAALLLSNR  D  R+KY+++HVVRTH+G+ D +++CV+
Sbjct  270   QNSYFGNKKSMLIPNCLFRLGGAALLLSNRSSDKRRSKYKMMHVVRTHLGSHDTAFRCVY  329

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             QQ+DE+G  G++L  +LM +AG ALK+NIT +GPLVLP+ E ++F V ++  KL+     
Sbjct  330   QQQDEKGKTGVSLSKDLMAIAGNALKTNITRLGPLVLPISEQLLFFVILMARKLI-----  384

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +P     +PDF+ AF+HFCIHAGGRAVIDEL+KNL L    VEASRMTLHRFGNTSSS
Sbjct  385   --NPKMKPYIPDFRLAFDHFCIHAGGRAVIDELEKNLRLEPIQVEASRMTLHRFGNTSSS  442

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR+K+G RVWQIAFGSGFKCNSAVW+  R + P    +PW DC+ +YP
Sbjct  443   SIWYELAYIEAKGRIKKGQRVWQIAFGSGFKCNSAVWQALRNVKPSA-SSPWLDCVDRYP  501

Query  1638  VYIPD  1652
             V + D
Sbjct  502   VKMVD  506



>ref|NP_195177.1| 3-ketoacyl-CoA synthase 17 [Arabidopsis thaliana]
 sp|O65677.1|KCS2_ARATH RecName: Full=Probable 3-ketoacyl-CoA synthase 2; Short=KCS-2; 
AltName: Full=Very long-chain fatty acid condensing enzyme 
2; Short=VLCFA condensing enzyme 2 [Arabidopsis thaliana]
 emb|CAA18830.1| putative ketoacyl-CoA synthase [Arabidopsis thaliana]
 emb|CAB80168.1| putative ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEE86387.1| 3-ketoacyl-CoA synthase 17 [Arabidopsis thaliana]
Length=487

 Score =   535 bits (1377),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/423 (58%), Positives = 326/423 (77%), Gaps = 7/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G ++   SRPR++YL+DY+CY PP++ +V +  FM +S L+      ++ FQ++IL RSG
Sbjct  70    GSIVFFMSRPRSIYLLDYSCYLPPSSQKVSYQKFMNNSSLIQDFSETSLEFQRKILIRSG  129

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P +IH IPP PT+  AREEA+ VIF  +D L   T++NP+ I +L+VNCS+F+
Sbjct  130   LGEETYLPDSIHSIPPRPTMAAAREEAEQVIFGALDNLFENTKINPREIGVLVVNCSLFN  189

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLA D+LQ HRN+ A++VSTE IT
Sbjct  190   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLASDMLQIHRNTFALVVSTENIT  249

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+ +D +R+KY+L+H VRTH G+ + ++ CV+
Sbjct  250   QNWYFGNKKAMLIPNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGSDENAFNCVY  309

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE    G++L  +LM +AGEALK+NITS+GPLVLP+ E ++F    V  +L      
Sbjct  310   QEQDECLKTGVSLSKDLMAIAGEALKTNITSLGPLVLPISEQILFFATFVAKRLF-----  364

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              +       +PDFK A +HFCIHAGGRAVIDEL+K+L+LS +HVEASRMTLHRFGNTSSS
Sbjct  365   -NDKKKKPYIPDFKLALDHFCIHAGGRAVIDELEKSLKLSPKHVEASRMTLHRFGNTSSS  423

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P V + PW  CIH+YP
Sbjct  424   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRNVEPSV-NNPWEHCIHRYP  482

Query  1638  VYI  1646
             V I
Sbjct  483   VKI  485



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score =   536 bits (1381),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 250/428 (58%), Positives = 326/428 (76%), Gaps = 8/428 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + SRPR VYLVDYAC+ P  N RV F+ FM+HS+       + + FQ++ILERSG
Sbjct  107   GVTVYVMSRPRPVYLVDYACHLPAENTRVKFSLFMDHSEKSGFFDERALEFQRKILERSG  166

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P ++H +P    +  AR EA+ V+F  +D+L  KT++ PK I IL+VNCS+F+
Sbjct  167   LGEETHLPVSLHRLPANANMAEARNEAEEVMFGALDELFEKTKVKPKDIGILVVNCSLFN  226

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKY +R N++++NL GMGCSAG+ISIDLA+D+LQ H  + A++VSTE IT
Sbjct  227   PTPSLSAMIVNKYHMRGNIRTYNLGGMGCSAGVISIDLAKDMLQVHGGTYAIVVSTENIT  286

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  RSML+PNCLFR GGAA+LLSN+R +  RAKY+L+H VRTH G  DK ++CV+
Sbjct  287   QNWYYGNRRSMLIPNCLFRVGGAAILLSNKRSEKRRAKYQLVHTVRTHKGADDKCFRCVY  346

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q+EDE+ F+G++L  +LM +AG+ALK+NIT++GPLVLP+ E ++F   +V  K+      
Sbjct  347   QEEDEKNFMGVSLSKDLMAIAGDALKTNITTLGPLVLPLSEQLLFFGILVARKVF-----  401

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+ +HVE SRMTLHRFGNTSSS
Sbjct  402   --NMKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTKDHVEPSRMTLHRFGNTSSS  459

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIE+KGRMK+GDRVWQIAFGSGFKCNSAVW+  RT+ PP    PW  CI  YP
Sbjct  460   SIWYELNYIESKGRMKKGDRVWQIAFGSGFKCNSAVWQAVRTLKPPA-RGPWTHCIDSYP  518

Query  1638  VYIPDILK  1661
             V IP++ K
Sbjct  519   VKIPEVYK  526



>ref|XP_009779121.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana sylvestris]
Length=511

 Score =   535 bits (1379),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 248/421 (59%), Positives = 324/421 (77%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G    I +RP +VYLVDY+CY+ P + +  +  FMEHS+L       ++ FQ+++L RSG
Sbjct  95    GSTFYIMTRPGSVYLVDYSCYRGPDHLKATYYKFMEHSRLTGDFDETSLEFQRKMLRRSG  154

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP  ++ IPP P++  AREEA+TV+F  +D L   T + PK I IL+VNCS+F+
Sbjct  155   LGEETYVPETMNCIPPKPSMAAAREEAETVMFGALDNLFKNTNVKPKDIGILVVNCSLFN  214

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ A++VSTE IT
Sbjct  215   PTPSLSAMIVNKYKLRGNIRSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAIVVSTENIT  274

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG A+LLSN+ VD  RAKY+L+HVVRTH G  DK++KC++
Sbjct  275   QNWYFGDKKSMLIPNCLFRVGGVAILLSNKTVDKRRAKYKLVHVVRTHNGADDKAFKCIY  334

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q+ED++G  G++L  +L+E+AG A+K+NIT++GPLVLP+ E  +F + +V  KL      
Sbjct  335   QEEDDKGKTGVSLSKHLIEIAGNAVKTNITTLGPLVLPISEQFLFFMTLVGRKLF-----  389

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +P+FK AFEHFCIH GGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  390   --NAKMKPYIPNFKLAFEHFCIHTGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  447

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGR++RG R+WQIAFGSGFKCNSAVW+  R + P   ++PW DCIH+YP
Sbjct  448   SIWYELAYIEAKGRIQRGHRIWQIAFGSGFKCNSAVWQALRNVRPSP-NSPWEDCIHRYP  506

Query  1638  V  1640
             V
Sbjct  507   V  507



>ref|XP_002979460.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
 gb|EFJ19349.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
Length=510

 Score =   535 bits (1379),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 250/422 (59%), Positives = 323/422 (77%), Gaps = 6/422 (1%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR V+L+D++CY PP +  V F  FMEHS+L      +++ FQ++IL R+GLGE T +
Sbjct  95    SRPRPVFLLDFSCYLPPPHLEVKFQRFMEHSRLSGHFDDRSLDFQRKILSRAGLGEETYL  154

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P A+H +P    +  AR EA+ V+F  +D+LL +T + PK I +L+VNCS+F+PTPSLSA
Sbjct  155   PAALHELPSRACMATARLEAEEVMFGAVDELLQRTGIRPKDIGVLVVNCSLFNPTPSLSA  214

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+N+YK+R NVKS+NL GMGCSAG+I++DLARD+LQ  R + A++VSTE +T N Y G 
Sbjct  215   MIINRYKMRGNVKSYNLGGMGCSAGVIAVDLARDILQVERRTYALVVSTENVTQNWYSGN  274

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSML+PNCLFR GGAALLL+NRR    RAKY L+H VRTH G  DK Y CV+Q++D +G
Sbjct  275   QRSMLIPNCLFRMGGAALLLTNRRAKRHRAKYELVHTVRTHKGADDKCYGCVYQEQDGDG  334

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +G++L   LM +AG+ALK+NIT++GPLVLP+ E ++F V +V  KL             
Sbjct  335   KMGVSLSKELMAIAGDALKTNITTLGPLVLPLSEQIIFFVVLVLRKL-----TKRKNRFK  389

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDEL+KNL+L+  HVEASRMTLHRFGNTSSSS+WYE++
Sbjct  390   TYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLTERHVEASRMTLHRFGNTSSSSIWYELA  449

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             Y+EAKGR+KRGDRVWQIAFGSGFKCNSAVW+  R+I PP    PW DCI +YPV IPD +
Sbjct  450   YLEAKGRVKRGDRVWQIAFGSGFKCNSAVWRALRSIKPPS-HGPWEDCIDKYPVRIPDAV  508

Query  1659  KV  1664
             ++
Sbjct  509   EI  510



>ref|XP_008378462.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Malus domestica]
Length=503

 Score =   535 bits (1378),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 246/421 (58%), Positives = 328/421 (78%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR+VYLVDY+CYK P++ +V +  FMEHS+L+      ++ FQ++ILERSG
Sbjct  87    GSTVYVMTRPRSVYLVDYSCYKAPSHLKVRYHQFMEHSKLIGDFDKSSLEFQRKILERSG  146

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG  T VP A++Y+PP  ++  AR+EA+ V+F  +D L A   + PK I IL+VNCS+F+
Sbjct  147   LGVETYVPEAMNYVPPRISMAAARQEAEQVVFGALDDLFANANVKPKDIGILVVNCSLFN  206

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAM+VNKYKLR N++SFNL GMGCSAG+I++DLA+D+LQ HRN+ AV+VSTE IT
Sbjct  207   PTPSLSAMVVNKYKLRGNIRSFNLGGMGCSAGVIAVDLAKDMLQIHRNTYAVVVSTENIT  266

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR GG+A+LLSN+ +D  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  267   QNWYFGNKKSMLIPNCLFRVGGSAVLLSNKPMDRRRAKYKLVHVVRTHCGADDKAFRCVY  326

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D++G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  327   QEQDDDGKTGVSLSKDLMAIAGGALKANITTLGPLVLPLSEQLLFFATLVAKKLF-----  381

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  382   --NAKVEPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLLPVHVEASRMTLHRFGNTSSS  439

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM++G+RVWQIAFGSGFKCNSAVW+   ++      +PW DCI +YP
Sbjct  440   SIWYELAYIEAKGRMQKGNRVWQIAFGSGFKCNSAVWEVVESVKASP-HSPWEDCIDRYP  498

Query  1638  V  1640
             V
Sbjct  499   V  499



>gb|AFW81175.1| acyltransferase [Zea mays]
Length=505

 Score =   535 bits (1378),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 256/425 (60%), Positives = 321/425 (76%), Gaps = 9/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPR VYLVD+ACY+PPA+ RV F  FM HS+L   +    + FQ++ILERSG
Sbjct  84    GATVYALTRPRPVYLVDFACYRPPAHLRVRFDQFMRHSRLCGFSD-DALEFQRKILERSG  142

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             L E T VP A+H +PP PT+  AR EA+ V+F  +D L   T + PK + +L+VNCS+F+
Sbjct  143   LSEETYVPEAMHALPPQPTMANARAEAEAVMFGALDALFRSTGVKPKDVGVLVVNCSLFN  202

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAM+VN+Y+LR NV+SFNL GMGCSAG+I++DLARD+LQ HR + AV+VSTE IT
Sbjct  203   PTPSLSAMVVNRYRLRGNVRSFNLGGMGCSAGVIAVDLARDMLQVHRATYAVVVSTENIT  262

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSNR  D  RAKY L HVVRTH G  D+++ CV+
Sbjct  263   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGADRRRAKYVLRHVVRTHKGADDRAFGCVY  322

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D EG  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL+     
Sbjct  323   QEQDGEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLL-----  377

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               S      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  378   --SAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPAHVEASRMTLHRFGNTSSS  435

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG RVWQIAFGSGFKCNSAVW   R + P   D+PW DCI +YP
Sbjct  436   SIWYELAYMEAKGRVRRGHRVWQIAFGSGFKCNSAVWHALRNVKPSP-DSPWEDCIDRYP  494

Query  1638  VYIPD  1652
             V + D
Sbjct  495   VELVD  499



>ref|XP_008800772.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=488

 Score =   534 bits (1376),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 253/418 (61%), Positives = 320/418 (77%), Gaps = 8/418 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR +YLVD+ACYKPPA+ R PF+ FM HS       P +I FQ++ILERSGLGE T +
Sbjct  74    SRPRPIYLVDFACYKPPASCRFPFSKFMNHSTKNEVFEPSSIEFQRKILERSGLGEDTSL  133

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA H IP TPT+  +REE++ V+FSV+D L  KT++ P+ IDIL+VNCS+FSPTPSLSA
Sbjct  134   PPAHHVIPFTPTMAKSREESELVLFSVVDSLFRKTKVKPRDIDILVVNCSLFSPTPSLSA  193

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYK+R N++SFNLSGMGCSAG+ISIDLARD L  H NSNA++V+TEIIT   Y G 
Sbjct  194   MIVNKYKMRGNIRSFNLSGMGCSAGIISIDLARDELLVHANSNALVVTTEIITEQWYTGN  253

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              RSMLL NCLFR GGAA+LLSN+R +  +AKY LLHVVRTH G  D++Y+CV+Q+ED+E 
Sbjct  254   RRSMLLANCLFRMGGAAVLLSNKRQEKRKAKYELLHVVRTHHGADDRAYRCVYQEEDDEK  313

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +G++L  +L  +AG ALK+NI ++GPLVLP+ E V+F +  +  +        ++P   
Sbjct  314   KIGVSLSRDLTAIAGAALKANIAALGPLVLPLSEQVLFFLNTLGRRF-------ANPKWR  366

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               VPDF++AF+HFCIHAGG+AVI ++   L LS E  EASRMTLHRFGNTSSSS WYE+ 
Sbjct  367   PYVPDFRKAFDHFCIHAGGKAVILDMGTKLRLSEEQTEASRMTLHRFGNTSSSSPWYELG  426

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPD  1652
             Y+EAKGRM++GDRVWQI  GSGFKCNSAVW+C R++     +  WADCI QYPV + +
Sbjct  427   YVEAKGRMRKGDRVWQIGLGSGFKCNSAVWRCRRSVGREE-EEAWADCIDQYPVQVAE  483



>ref|XP_008805392.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Phoenix dactylifera]
Length=525

 Score =   536 bits (1380),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 258/425 (61%), Positives = 328/425 (77%), Gaps = 8/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR VYLVDYACY+PP   +V F +FMEHS+L    +   + FQ++ILERSG
Sbjct  100   GSTVYIMTRPRPVYLVDYACYRPPERLQVRFRSFMEHSRLSGEFNEGALEFQRRILERSG  159

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T VP A+H++PP P++  AREEA+ V+F  +D L   T + PK I IL+VNCS+F+
Sbjct  160   LGEETYVPEAMHFLPPRPSMAYAREEAEQVMFGALDALFRNTGVKPKDISILVVNCSLFN  219

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVN YKLRSN+KSFNL GMGCSAG+I++DLARDLLQ HR++ AV+VSTE IT
Sbjct  220   PTPSLSAMIVNHYKLRSNIKSFNLGGMGCSAGVIAVDLARDLLQAHRSTYAVVVSTENIT  279

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR G AA+LLSNR  D  R+KYRL+HVVRTH G  D++++CV+
Sbjct  280   QNWYFGNRKSMLIPNCLFRVGAAAVLLSNRSSDRRRSKYRLVHVVRTHRGADDRAFRCVY  339

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G VG++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL      
Sbjct  340   QEQDDRGKVGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFATLVAKKLF-----  394

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+  HVE SRMTLHRFGNTSSS
Sbjct  395   --NAKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTPVHVEPSRMTLHRFGNTSSS  452

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM+RG RVWQIAFGSGFKCNSAVW+  R + P   ++PW DC+ +YP
Sbjct  453   SIWYELAYIEAKGRMRRGHRVWQIAFGSGFKCNSAVWQALRNVKPSP-NSPWEDCMDRYP  511

Query  1638  VYIPD  1652
             V + D
Sbjct  512   VQLVD  516



>ref|XP_002977865.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
 gb|EFJ21203.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
Length=510

 Score =   535 bits (1378),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 250/422 (59%), Positives = 323/422 (77%), Gaps = 6/422 (1%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR V+L+D++CY PP +  V F  FMEHS+L      +++ FQ++IL R+GLGE T +
Sbjct  95    SRPRPVFLLDFSCYLPPPHLEVKFQRFMEHSRLSGHFDDRSLDFQRKILSRAGLGEETYL  154

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P A+H +P    +  AR EA+ V+F  +D+LL +T + PK I +L+VNCS+F+PTPSLSA
Sbjct  155   PAALHELPSRACMATARLEAEEVMFGAVDELLQRTGIRPKDIGVLVVNCSLFNPTPSLSA  214

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+N+YK+R N+KS+NL GMGCSAG+I++DLARD+LQ  R + A++VSTE IT N Y G 
Sbjct  215   MIINRYKMRGNIKSYNLGGMGCSAGVIAVDLARDILQVERRTYALVVSTENITQNWYSGN  274

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             +RSML+PNCLFR GGAALLL+NRR    RAKY L+H VRTH G  DK Y CV+Q++D +G
Sbjct  275   QRSMLIPNCLFRMGGAALLLTNRRAKRHRAKYELVHTVRTHKGADDKCYGCVYQEQDGDG  334

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              +G++L   LM +AG+ALK+NIT++GPLVLP+ E ++F V +V  KL             
Sbjct  335   KMGVSLSKELMAIAGDALKTNITTLGPLVLPLSEQIIFFVVLVLRKL-----TKRKNRFK  389

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AFEHFCIHAGGRAVIDEL+KNL+L+  HVEASRMTLHRFGNTSSSS+WYE++
Sbjct  390   TYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLTERHVEASRMTLHRFGNTSSSSIWYELA  449

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYIPDIL  1658
             Y+EAKGR+KRGDRVWQIAFGSGFKCNSAVW+  R+I PP    PW DCI +YPV IPD +
Sbjct  450   YLEAKGRVKRGDRVWQIAFGSGFKCNSAVWRALRSIKPPS-HGPWEDCIDKYPVRIPDAV  508

Query  1659  KV  1664
             ++
Sbjct  509   EI  510



>emb|CDX76286.1| BnaA08g11140D [Brassica napus]
Length=474

 Score =   533 bits (1374),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 324/423 (77%), Gaps = 6/423 (1%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   SRPR+VYLVDY+CY PP++ +  +  FM+HS L    +  ++ FQ +IL+RSG
Sbjct  56    GTTLFFMSRPRSVYLVDYSCYLPPSSLQFTYEKFMKHSILTNIFNESSLEFQSKILKRSG  115

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG+ T +P AIHY+PP PT+  AREEA+ V+F  +D L   T++N K I +L+VNCS+F+
Sbjct  116   LGDETYLPEAIHYVPPRPTMAAAREEAELVVFGALDSLFENTKVNLKEISVLVVNCSLFN  175

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+I++DLA D+LQ +RN+ A++VSTE IT
Sbjct  176   PTPSLSAMIVNKYKLRENVKSFNLGGMGCSAGVIAVDLANDMLQLYRNTYALVVSTENIT  235

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+  D +R+KY+L+H VRTH G+ +K++ CV+
Sbjct  236   QNWYFGNKKAMLIPNCLFRIGGSAVLLSNKSCDRKRSKYKLVHTVRTHKGSDEKAFNCVY  295

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE    G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F    +  KL      
Sbjct  296   QEQDETLKTGVSLSKDLMSIAGEALKTNITTLGPLVLPMSEQILFFATYLVNKLF-----  350

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
             ++       +PDFK AF+HFCIHAGGRAVIDEL+KNL L  +HVEASRMTLHRFGNTSSS
Sbjct  351   NAKKKMKPYMPDFKLAFDHFCIHAGGRAVIDELEKNLRLLPKHVEASRMTLHRFGNTSSS  410

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P V   PW  CIH+YP
Sbjct  411   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRDVEPSV-KNPWEHCIHRYP  469

Query  1638  VYI  1646
             V I
Sbjct  470   VKI  472



>dbj|BAK06985.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=484

 Score =   534 bits (1375),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 254/425 (60%), Positives = 327/425 (77%), Gaps = 18/425 (4%)
 Frame = +3

Query  402   RPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVP  581
             RPRAVY+VDYAC++   + RVPFA F EH+++      +++ F  ++LERSGLGE TC+P
Sbjct  72    RPRAVYMVDYACFRTSPSCRVPFAAFEEHARVWPGFDERSVRFMSRLLERSGLGEETCLP  131

Query  582   PAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAM  761
              A HYIPP+  L+ +R EA+ ++FS +D LLAKT++ P  IDIL+VNCS+F+PTPS + M
Sbjct  132   YAQHYIPPSCDLESSRAEAELIVFSAIDDLLAKTKVAPVDIDILVVNCSLFAPTPSFADM  191

Query  762   IVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITPNSYLGK  938
             IVN+Y LR +V++ +L+GMGCSAGLIS+ LAR+LLQ   R SNA++VSTE ITPN Y+GK
Sbjct  192   IVNRYNLRKDVRNVHLAGMGCSAGLISVGLARNLLQVAPRGSNALVVSTETITPNYYMGK  251

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLS    +G  A++RL  VVRT  G++D +Y+CV+Q+EDE G
Sbjct  252   ERAMLLPNCLFRMGGAAVLLST---NGANARFRLARVVRTLTGSQDGAYRCVYQEEDERG  308

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM VAGEALK+NIT++GPLVLP  E ++F +  +  +++       +    
Sbjct  309   NVGINLSKDLMSVAGEALKANITAMGPLVLPASEQLLFALSFIARRVV-------NRGIK  361

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSSLWYE++
Sbjct  362   PYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSSLWYELA  421

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPV----LDTPWADCIHQYPVYI  1646
             Y+EAKGRM++GDRVW I FGSGFKCNSA W+C   I PP      D PWA C+H+YPV I
Sbjct  422   YVEAKGRMRKGDRVWMIGFGSGFKCNSAAWEC---IRPPAAPGGADGPWAACVHRYPVDI  478

Query  1647  PDILK  1661
             PD+LK
Sbjct  479   PDVLK  483



>ref|XP_001753137.1| predicted protein [Physcomitrella patens]
 gb|EDQ82178.1| predicted protein [Physcomitrella patens]
Length=519

 Score =   535 bits (1378),  Expect = 3e-180, Method: Compositional matrix adjust.
 Identities = 248/425 (58%), Positives = 327/425 (77%), Gaps = 8/425 (2%)
 Frame = +3

Query  387   IIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGE  566
             I   S PRA++LVD+ACY P    +VP   FME ++L      +++ FQ++ILER+GLG 
Sbjct  101   IFFMSLPRAIFLVDFACYLPEEKLQVPIPLFMERTRLAGFFDERSMEFQEKILERAGLGP  160

Query  567   RTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTP  746
             +T +P A+H  PP P++K AREEA+ V+F  +D+L  KT++ PK + IL+VNCS+F+PTP
Sbjct  161   KTYLPAAMHAQPPCPSMKAAREEAEQVMFGCLDELFEKTKIKPKDVGILVVNCSLFNPTP  220

Query  747   SLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNS  926
             SLSAMIVNKY++R N++++NL GMGCSAG+ISIDLA+DLLQ H NS A++VSTE IT N 
Sbjct  221   SLSAMIVNKYRMRGNIRTYNLGGMGCSAGVISIDLAKDLLQVHGNSYAIVVSTENITQNW  280

Query  927   YLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQE  1106
             Y G  RSML+PNCLFR GG+A+LLSN+  DG R+KY+L HVVRTH G  DK Y CV+Q++
Sbjct  281   YFGNRRSMLIPNCLFRVGGSAVLLSNKLKDGSRSKYKLNHVVRTHKGADDKCYNCVYQEQ  340

Query  1107  DEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqsss  1286
             DE+G +G++L  +LM +AGE LK NIT++GPLVLP+ E ++F   +V  K+        +
Sbjct  341   DEQGILGVSLSKDLMAIAGETLKVNITTLGPLVLPISEQLLFFSTLVARKVF-------N  393

Query  1287  pnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLW  1466
                   +PDFK AF+HFCIHAGGRAVIDEL+KNL+L+ EH E SRMTLHRFGN+SSSS+W
Sbjct  394   LKVKPYIPDFKLAFDHFCIHAGGRAVIDELEKNLQLTAEHCEPSRMTLHRFGNSSSSSIW  453

Query  1467  YEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             YE++Y+EAKGR++RG+RVWQIAFGSGFKCNSAVW+  R I PP   +PWA CIH+YP ++
Sbjct  454   YELAYMEAKGRIRRGNRVWQIAFGSGFKCNSAVWQALRNIKPPE-KSPWAHCIHEYPQHL  512

Query  1647  PDILK  1661
              +I K
Sbjct  513   DEIQK  517



>ref|XP_010432405.1| PREDICTED: probable 3-ketoacyl-CoA synthase 2 [Camelina sativa]
Length=477

 Score =   533 bits (1373),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 247/423 (58%), Positives = 323/423 (76%), Gaps = 7/423 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   SRPR+VYLVDY+CY PP++ +V +  FM +S L+      ++ FQ++IL RSG
Sbjct  60    GCTVFFMSRPRSVYLVDYSCYLPPSDQKVSYQKFMNNSSLIQDFSESSLEFQRKILVRSG  119

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T +P +IH  PP PT+  AREEA+ VIF  +D L   T++NP+ I +L+VNCS+F+
Sbjct  120   LGEETYLPESIHCTPPRPTMAAAREEAEQVIFGALDNLFENTKINPREIGVLVVNCSLFN  179

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NVKSFNL GMGCSAG+I+IDLA D+LQ HRN+ A++VSTE IT
Sbjct  180   PTPSLSAMIVNKYKLRGNVKSFNLGGMGCSAGVIAIDLASDMLQIHRNTFALVVSTENIT  239

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G +++ML+PNCLFR GG+A+LLSN+ +D +R+KY+L+H VRTH G+ +K++ CV+
Sbjct  240   QNWYFGNKKAMLIPNCLFRVGGSAVLLSNKPLDRKRSKYKLVHTVRTHKGSDEKAFSCVY  299

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++DE    G++L  +LM +AGEALK+NIT++GPLVLP+ E ++F    V  +L      
Sbjct  300   QEQDECLKTGVSLSKDLMAIAGEALKTNITTLGPLVLPISEQILFFATFVAKRLF-----  354

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              ++      +PDFK AF+HFCIHAGGRAVIDEL+K+L+LS  HVEASRMTLHRFGNTSSS
Sbjct  355   -NAKKQKPYIPDFKLAFDHFCIHAGGRAVIDELEKSLKLSPRHVEASRMTLHRFGNTSSS  413

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRM++G+RVWQIAFGSGFKCNSAVW   R + P     PW  CI +YP
Sbjct  414   SIWYELAYTEAKGRMRKGNRVWQIAFGSGFKCNSAVWVALRDVEPS-FKNPWEHCIDRYP  472

Query  1638  VYI  1646
             V I
Sbjct  473   VKI  475



>ref|XP_006647846.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=485

 Score =   533 bits (1373),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 254/422 (60%), Positives = 328/422 (78%), Gaps = 15/422 (4%)
 Frame = +3

Query  402   RPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCVP  581
             RPRAVY+VDYAC++   N RVPFATF+EHS++      +++ F  ++LERSGLGE TC+P
Sbjct  76    RPRAVYMVDYACFRTSPNCRVPFATFLEHSRVWPGFEERSVRFMTRLLERSGLGEETCLP  135

Query  582   PAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSAM  761
              A HYIPP+  L+ +R E + VIFS +D LLAKT ++P+ IDI++VNCS+F+PTPS + M
Sbjct  136   YAQHYIPPSRDLESSRAEVELVIFSAIDDLLAKTGISPQDIDIVVVNCSLFAPTPSFTDM  195

Query  762   IVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTH-RNSNAVIVSTEIITPNSYLGK  938
             I+N+YKLR +V++ +L+GMGCSAGLIS+ LAR+LLQ   + ++A++VSTE ITPN Y+G+
Sbjct  196   IINRYKLRKDVRNVHLAGMGCSAGLISVGLARNLLQVAPKGAHALVVSTETITPNYYMGQ  255

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ER+MLLPNCLFR GGAA+LLS    +G +A++RL  VVRT  G KD +Y CV+Q+ED+ G
Sbjct  256   ERAMLLPNCLFRMGGAAVLLST---NGAKARFRLARVVRTLTGAKDGAYHCVYQEEDDRG  312

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
              VGINL  +LM +AG+ALK+NIT++GPLVLP  E ++F    +  K++       S    
Sbjct  313   NVGINLSKDLMNIAGDALKANITAMGPLVLPASEQLLFAFSFIARKVL-------SGRVK  365

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDF+ AFEHFCIHAGGRAVIDELQ++L LS E VEASRMTLHRFGNTSSSSLWYE++
Sbjct  366   PYIPDFRTAFEHFCIHAGGRAVIDELQRSLTLSDEQVEASRMTLHRFGNTSSSSLWYELA  425

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPV-LDTPWADCIHQYPVYIPDI  1655
             Y+EAKGRM++GDRVW I FGSGFKCNSA W+C   I PP   D PWA CIH+YPV IPD+
Sbjct  426   YVEAKGRMRKGDRVWMIGFGSGFKCNSAAWEC---IRPPANADGPWATCIHRYPVDIPDV  482

Query  1656  LK  1661
             LK
Sbjct  483   LK  484



>ref|XP_010263648.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=515

 Score =   534 bits (1376),  Expect = 5e-180, Method: Compositional matrix adjust.
 Identities = 247/416 (59%), Positives = 321/416 (77%), Gaps = 8/416 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             +RPR VYLVD++CY P ++ RV +  FMEHS+L       ++ FQ +ILERSGLGE T V
Sbjct  106   TRPRPVYLVDFSCYLPHSHQRVNYKNFMEHSRLTGDFDESSLEFQHKILERSGLGEETHV  165

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             P A+HY PP PT+  AREEA+ V+F  ++ L + T +  K I IL+VNCS+F+PTPSLSA
Sbjct  166   PDAMHYTPPRPTMANAREEAEQVMFGALENLFSNTSVKAKDIGILVVNCSLFNPTPSLSA  225

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MI+NKYKLR N++SFNL GMGCSAG+++IDLA+D+LQ HRN+ AV+VSTE IT N Y G 
Sbjct  226   MIINKYKLRGNIRSFNLGGMGCSAGVVAIDLAKDMLQVHRNTYAVVVSTENITQNWYFGN  285

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
             ++SML+PNCLFR GG+A+LLSN+  D  RAKY+LLHVVRTH G  DK+++CV+Q++D++G
Sbjct  286   KKSMLIPNCLFRVGGSAVLLSNKSSDRRRAKYKLLHVVRTHCGADDKAFRCVYQEQDDQG  345

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F   ++  KL+        P   
Sbjct  346   KTGVSLSKDLMSIAGMALKTNITTLGPLVLPISEQLLFFFNLLAKKLI-------DPKRK  398

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               +PDFK AF+HFCIHAGGRAVIDEL++NL+L   HVEASRMTLHRFGNTSSSS+WYE++
Sbjct  399   SYIPDFKLAFDHFCIHAGGRAVIDELERNLQLEPTHVEASRMTLHRFGNTSSSSIWYELA  458

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPVYI  1646
             Y EAKGRM++G R+WQIAFGSGFKCNSAVW+  R   P   ++PW  CI +YPV I
Sbjct  459   YTEAKGRMRKGHRLWQIAFGSGFKCNSAVWEAVRNAKPSP-NSPWLHCIDRYPVEI  513



>gb|AGH32920.1| ketoacyl-CoA synthase [Camellia chekiangoleosa]
Length=517

 Score =   533 bits (1374),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 251/421 (60%), Positives = 321/421 (76%), Gaps = 8/421 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RP+ VYLVDYACY+ P + +  +  FM HS+L       ++ FQ++ILERSG
Sbjct  101   GSTVYIMTRPKPVYLVDYACYRAPDHLKASYHKFMNHSRLTGDFDESSLEFQRKILERSG  160

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LGE T  P A+H IPP P++  AR+EA+ V+F  +D L A T +  K I +L+VNCS+F+
Sbjct  161   LGEETYFPEAMHSIPPRPSMAAARDEAEQVMFGALDNLFANTNVKSKDIGVLVVNCSLFN  220

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR NV+SFNL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE IT
Sbjct  221   PTPSLSAMIVNKYKLRGNVRSFNLGGMGCSAGVIAVDLAKDLLQIHRNTCAVVVSTENIT  280

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GG+A+LLSN+ VD  RAKY+L+HVVRTH G  DK+++CV+
Sbjct  281   QNWYFGNNKSMLIPNCLFRVGGSAVLLSNKSVDRRRAKYKLVHVVRTHKGADDKAFRCVY  340

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GP+VLP+ E ++F   +V  KL      
Sbjct  341   QEQDDVGKTGVSLSKDLMAIAGGALKTNITTLGPIVLPISEQLLFFATLVVKKLF-----  395

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               + N    +PDF  AF+HFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  396   --NKNIKPYIPDFTLAFDHFCIHAGGRAVIDELEKNLQLLPIHVEASRMTLHRFGNTSSS  453

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++YIEAKGRM++G RVWQIAFGSGFKCNSAVWK  R +  P  + PW DCI +YP
Sbjct  454   SIWYELAYIEAKGRMRKGHRVWQIAFGSGFKCNSAVWKALRNVKQP-RNGPWEDCIDKYP  512

Query  1638  V  1640
             V
Sbjct  513   V  513



>ref|XP_008800778.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=414

 Score =   530 bits (1364),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 253/414 (61%), Positives = 319/414 (77%), Gaps = 9/414 (2%)
 Frame = +3

Query  399   SRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSGLGERTCV  578
             SRPR VYLVD+ACYKPPA+ R PF+ FM HS+      P +I FQ++ILERSGLGE T +
Sbjct  2     SRPRPVYLVDFACYKPPASSRFPFSKFMNHSKQNEVFEPSSIEFQRKILERSGLGEDTSL  61

Query  579   PPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFSPTPSLSA  758
             PPA H IP  PT+  +REE++ VIFSV+D L  KT++ P+ IDIL+VNCS+FSPTPSLSA
Sbjct  62    PPAHHVIPFAPTMAKSREESELVIFSVVDSLFRKTKVKPRDIDILVVNCSLFSPTPSLSA  121

Query  759   MIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIITPNSYLGK  938
             MIVNKYK+RSN++SFNLSGMGCSAG+ISIDLARD L  H NSNA++V+TEIIT + Y+G 
Sbjct  122   MIVNKYKMRSNIRSFNLSGMGCSAGIISIDLARDELLVHANSNALVVTTEIITEHWYIGN  181

Query  939   ERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVFQQEDEEG  1118
              RSML+ NCLFR GGAA+LLSN+R    +AKY LLH+VRTH G  D++Y+CV+Q+ED E 
Sbjct  182   RRSMLVANCLFRMGGAAVLLSNKRQKKRKAKYELLHLVRTHRGADDRAYRCVYQEEDGEK  241

Query  1119  FVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksqssspnnn  1298
               G++L  +L  +AG ALK+NI ++GPLVLP+ E ++F + +V  +        ++P   
Sbjct  242   -KGVSLSKDLTAIAGSALKANIAALGPLVLPLSEQILFFLNMVGRRF-------ANPKWR  293

Query  1299  kkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSSSLWYEMS  1478
               VPDF +AF+HFCIHAGG+AVI+E+   L LS E  EASRMTLHRFGNTSSSS WYE+ 
Sbjct  294   PYVPDFTKAFDHFCIHAGGKAVIEEMGTKLRLSEEQTEASRMTLHRFGNTSSSSPWYELG  353

Query  1479  YIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYPV  1640
             Y+EAKGRM++GDRVWQ+  GSGFKCNSAVW+C R++     +  WADCI QYPV
Sbjct  354   YVEAKGRMRKGDRVWQMGLGSGFKCNSAVWRCRRSVGREE-EGAWADCIDQYPV  406



>emb|CDO97044.1| unnamed protein product [Coffea canephora]
Length=518

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 248/425 (58%), Positives = 324/425 (76%), Gaps = 7/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + I +RPR+VYLVDYACY+PP + +V F  FM+HS+L       ++ FQ++ILERSG
Sbjct  101   GSTVYIMTRPRSVYLVDYACYRPPHHLQVKFNKFMDHSRLTGDFDESSLEFQRKILERSG  160

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             LG  T +P A+H +PP P++  AREEA+ V+F  +D L   T + PK I IL+VNCS+F+
Sbjct  161   LGVETYLPEAMHCVPPRPSMSTAREEAEQVMFGALDNLFKSTNVKPKDIGILVVNCSLFN  220

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVN+Y LR N++SFNL GMGCSAG+I+IDLA+D+LQ HRN+ AV+VSTE IT
Sbjct  221   PTPSLSAMIVNRYGLRGNIQSFNLGGMGCSAGVIAIDLAKDMLQVHRNTYAVVVSTENIT  280

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G ++SML+PNCLFR G AA LLSN+  +  RAKY+L+HVVRTH G +D +++CV+
Sbjct  281   QNWYFGNKKSMLIPNCLFRVGCAATLLSNKASEKRRAKYKLVHVVRTHKGAQDTAFRCVY  340

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+ G  G++L  +LM +AG ALK+NIT++GPLVLP+ E ++F V +   KL      
Sbjct  341   QEQDDHGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPISEQLLFFVTLAARKLC-----  395

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
              +       +PDFK AF+HFCIHAGGR VIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  396   -NDAKIKPYIPDFKLAFDHFCIHAGGRGVIDELEKNLQLSPIHVEASRMTLHRFGNTSSS  454

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y EAKGRMK+G RVWQIAFGSGFKCNSAVW+  R + P   ++PW DC+ +YP
Sbjct  455   SIWYELAYTEAKGRMKKGHRVWQIAFGSGFKCNSAVWQALRNVKPSP-NSPWQDCVDRYP  513

Query  1638  VYIPD  1652
             V + +
Sbjct  514   VEMAN  518



>ref|NP_001130522.1| uncharacterized protein LOC100191621 [Zea mays]
 gb|ACG28710.1| acyltransferase [Zea mays]
Length=505

 Score =   533 bits (1372),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 255/425 (60%), Positives = 320/425 (75%), Gaps = 9/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  +   +RPR VYLVD+ACY+PPA+ RV F  FM HS+L   +    + FQ++ILERSG
Sbjct  84    GATVYALTRPRPVYLVDFACYRPPAHLRVRFDQFMRHSRLCGFSD-DALEFQRKILERSG  142

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             L E T VP  +H +PP PT+  AR EA+ V+F  +D L   T + PK + +L+VNCS+F+
Sbjct  143   LSEETYVPEXMHALPPQPTMANARAEAEAVMFGALDALFRSTGVKPKDVGVLVVNCSLFN  202

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAM+VN+Y+LR NV+SFNL GMGCSAG+I++DLARD+LQ HR + AV+VSTE IT
Sbjct  203   PTPSLSAMVVNRYRLRGNVRSFNLGGMGCSAGVIAVDLARDMLQVHRATYAVVVSTENIT  262

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSNR  D  RAKY L HVVRTH G  D+++ CV+
Sbjct  263   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGADRRRAKYVLRHVVRTHKGADDRAFGCVY  322

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D EG  G++L  +LM +AG ALK+NIT++GPLVLPV E ++F   +V  KL+     
Sbjct  323   QEQDGEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPVSEQLLFFATLVAKKLL-----  377

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               S      +PDFK AFEHFCIHAGGRAVIDEL+KNL+LS  HVEASRMTLHRFGNTSSS
Sbjct  378   --SAKTKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLSPAHVEASRMTLHRFGNTSSS  435

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG RVWQIAFGSGFKCNSAVW   R + P   D+PW DCI +YP
Sbjct  436   SIWYELAYMEAKGRVRRGHRVWQIAFGSGFKCNSAVWHALRNVKPSP-DSPWEDCIDRYP  494

Query  1638  VYIPD  1652
             V + D
Sbjct  495   VELVD  499



>gb|EYU26763.1| hypothetical protein MIMGU_mgv1a027040mg [Erythranthe guttata]
Length=527

 Score =   533 bits (1374),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 251/425 (59%), Positives = 323/425 (76%), Gaps = 6/425 (1%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G    I +R R VYLVD++CY+PP + ++P   F++  ++       ++ FQ++ILERSG
Sbjct  106   GSTFYILTRTRPVYLVDHSCYRPPNSLKMPGQMFLDRMRIAGCFDESSLEFQRKILERSG  165

Query  558   LGERTCVPPAIHYIPPT--PTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSM  731
             LG+ TC+P ++H +PP   PT+  AR+E++ VIF  +D L A T++NPK I IL+VN S+
Sbjct  166   LGDDTCLPESMHVLPPIRRPTMNAARKESEQVIFGALDNLFANTKINPKEIGILVVNSSL  225

Query  732   FSPTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEI  911
             F+PTPSLSA IVNKYKLR N++S NL GMGCSAG+I++DLA+DLLQ HRN+ AV+VSTE 
Sbjct  226   FNPTPSLSATIVNKYKLRGNIRSLNLGGMGCSAGVIAVDLAKDLLQIHRNTYAVVVSTEN  285

Query  912   ITPNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKC  1091
             IT NSY G ++SML+PNCLFR GGAA+LLSN+  D + AKY+LLH+VRTH G  DK+Y+C
Sbjct  286   ITHNSYRGTQKSMLIPNCLFRVGGAAVLLSNKSSDRKTAKYKLLHIVRTHRGANDKAYRC  345

Query  1092  VFQQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssk  1271
             V+Q+EDEEG  G+NL  NLM +AG ALK+NIT++GPLVLP+ E ++F   +V  KL+   
Sbjct  346   VYQEEDEEGKTGVNLSKNLMAIAGGALKTNITTLGPLVLPISEQLLFFANLVFNKLL---  402

Query  1272  sqssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTS  1451
               +        +PDFK A EHFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTS
Sbjct  403   PNNKKIIKRGYIPDFKLAVEHFCIHAGGRAVIDELEKNLDLEEVHVEASRMTLHRFGNTS  462

Query  1452  SSSLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQ  1631
             SSS+WYE++YIEAK RMK+G+RVWQIAFGSGFKCNSAVW+  R + P   +  W DCI  
Sbjct  463   SSSIWYELAYIEAKRRMKKGNRVWQIAFGSGFKCNSAVWEALRNVEPSE-NGAWEDCIDM  521

Query  1632  YPVYI  1646
             YPV I
Sbjct  522   YPVKI  526



>ref|NP_001056354.1| Os05g0568000 [Oryza sativa Japonica Group]
 gb|AAU10670.1| putative beta-ketoacyl-CoA synthase [Oryza sativa Japonica Group]
 dbj|BAF18268.1| Os05g0568000 [Oryza sativa Japonica Group]
 dbj|BAG94915.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99710.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64728.1| hypothetical protein OsJ_19584 [Oryza sativa Japonica Group]
Length=514

 Score =   533 bits (1373),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/425 (60%), Positives = 322/425 (76%), Gaps = 9/425 (2%)
 Frame = +3

Query  378   GYLIIISSRPRAVYLVDYACYKPPANHRVPFATFMEHSQLVFPTHPKTIYFQKQILERSG  557
             G  + + +RPR VYLVD+ACYKPP   +V F  F+ HS+L   +    + FQ++ILERSG
Sbjct  89    GATVYVLTRPRPVYLVDFACYKPPDKLKVRFDEFLHHSKLCGFSD-DCLEFQRKILERSG  147

Query  558   LGERTCVPPAIHYIPPTPTLKLAREEAQTVIFSVMDQLLAKTQLNPKHIDILIVNCSMFS  737
             L E T VP A+H IPP PT+  AR EA++V+F  +D+L   T + PK + +L+VNCS+F+
Sbjct  148   LSEETYVPEAMHLIPPEPTMANARAEAESVMFGALDKLFKFTGVKPKDVGVLVVNCSLFN  207

Query  738   PTPSLSAMIVNKYKLRSNVKSFNLSGMGCSAGLISIDLARDLLQTHRNSNAVIVSTEIIT  917
             PTPSLSAMIVNKYKLR N+KSFNL GMGCSAG+I++DLARD+LQ HRN+ AV+VSTE IT
Sbjct  208   PTPSLSAMIVNKYKLRGNIKSFNLGGMGCSAGVIAVDLARDMLQVHRNTYAVVVSTENIT  267

Query  918   PNSYLGKERSMLLPNCLFRTGGAALLLSNRRVDGERAKYRLLHVVRTHMGNKDKSYKCVF  1097
              N Y G  +SML+PNCLFR GGAA+LLSNR  D  RAKY L HVVRTH G  +K++ CV+
Sbjct  268   QNWYFGNRKSMLIPNCLFRVGGAAVLLSNRGADRRRAKYALKHVVRTHKGADNKAFNCVY  327

Query  1098  QQEDEEGFVGINLCINLMEVAGEALKSNITSIGPLVLPVWELVMFVVGVVRGKLMssksq  1277
             Q++D+EG  G++L  +LM +AG ALK+NIT++GPLVLP  E ++F   +V  KL      
Sbjct  328   QEQDDEGKTGVSLSKDLMAIAGGALKTNITTLGPLVLPFSEQLLFFATLVAKKLF-----  382

Query  1278  ssspnnnkkVPDFKRAFEHFCIHAGGRAVIDELQKNLELSGEHVEASRMTLHRFGNTSSS  1457
               +      +PDFK AFEHFCIHAGGRAVIDEL+KNL+L   HVEASRMTLHRFGNTSSS
Sbjct  383   --NAKIKPYIPDFKLAFEHFCIHAGGRAVIDELEKNLQLQPVHVEASRMTLHRFGNTSSS  440

Query  1458  SLWYEMSYIEAKGRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIHPPVLDTPWADCIHQYP  1637
             S+WYE++Y+EAKGR++RG R+WQIAFGSGFKCNSAVW   R ++P   ++PW DCI +YP
Sbjct  441   SIWYELAYMEAKGRVRRGHRIWQIAFGSGFKCNSAVWHALRNVNPSP-ESPWEDCIDRYP  499

Query  1638  VYIPD  1652
             V + D
Sbjct  500   VELVD  504



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5998204766208