BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c72833_g1_i1 len=316 path=[294:0-315]

Length=316
                                                                      Score     E

ref|XP_009789723.1|  PREDICTED: histidine decarboxylase-like          73.9    5e-13   
ref|XP_009769413.1|  PREDICTED: histidine decarboxylase-like isof...  73.9    5e-13   
ref|XP_004244519.1|  PREDICTED: histidine decarboxylase               73.6    7e-13   
ref|XP_009599698.1|  PREDICTED: histidine decarboxylase-like          72.0    3e-12   
ref|XP_009620691.1|  PREDICTED: histidine decarboxylase-like          71.6    3e-12   
ref|NP_001233859.1|  aromatic amino acid decarboxylase 2              71.6    3e-12   
ref|XP_006357084.1|  PREDICTED: histidine decarboxylase-like          71.2    4e-12   
ref|XP_009600675.1|  PREDICTED: histidine decarboxylase-like          70.9    7e-12   
ref|XP_006357083.1|  PREDICTED: histidine decarboxylase-like          68.9    3e-11   
ref|XP_006365165.1|  PREDICTED: histidine decarboxylase-like          68.9    3e-11   
ref|XP_004245427.1|  PREDICTED: histidine decarboxylase-like          68.9    3e-11   
ref|XP_006365166.1|  PREDICTED: histidine decarboxylase-like          68.9    3e-11   
ref|XP_006365164.1|  PREDICTED: histidine decarboxylase-like isof...  67.8    7e-11   
ref|XP_006365162.1|  PREDICTED: histidine decarboxylase-like isof...  67.8    7e-11   
ref|XP_006365163.1|  PREDICTED: histidine decarboxylase-like isof...  67.8    8e-11   
ref|XP_010325179.1|  PREDICTED: histidine decarboxylase-like isof...  67.8    9e-11   
ref|XP_004245280.1|  PREDICTED: histidine decarboxylase-like isof...  67.8    9e-11   
ref|XP_006365168.1|  PREDICTED: histidine decarboxylase-like          67.4    9e-11   
ref|XP_004245279.1|  PREDICTED: histidine decarboxylase-like          67.4    1e-10   
ref|XP_009779195.1|  PREDICTED: histidine decarboxylase-like          67.4    1e-10   
gb|AHG12639.1|  histidine decarboxylase                               67.0    1e-10   
gb|AIE54278.1|  aromatic amino acid decarboxylase 2                   67.4    1e-10   
ref|XP_006365087.1|  PREDICTED: histidine decarboxylase-like          67.0    1e-10   
ref|NP_001233852.1|  aromatic amino acid decarboxylase 1B             67.0    1e-10   
ref|NP_001233845.1|  aromatic amino acid decarboxylase 1A             67.0    2e-10   
ref|XP_009774334.1|  PREDICTED: histidine decarboxylase-like          66.6    2e-10   
ref|XP_006365167.1|  PREDICTED: histidine decarboxylase-like          66.2    3e-10   
ref|XP_004245281.1|  PREDICTED: histidine decarboxylase-like          66.2    3e-10   
ref|XP_009602156.1|  PREDICTED: histidine decarboxylase-like          64.3    1e-09   
ref|XP_006367691.1|  PREDICTED: histidine decarboxylase-like          63.9    1e-09   
ref|XP_009622262.1|  PREDICTED: LOW QUALITY PROTEIN: histidine de...  63.2    2e-09   
ref|XP_004244809.1|  PREDICTED: histidine decarboxylase-like          62.8    4e-09   
ref|XP_006346847.1|  PREDICTED: histidine decarboxylase-like          59.7    5e-08   
ref|XP_006362640.1|  PREDICTED: histidine decarboxylase-like          55.8    7e-07   
ref|XP_009601848.1|  PREDICTED: histidine decarboxylase-like isof...  55.5    1e-06   
ref|XP_006364727.1|  PREDICTED: histidine decarboxylase-like          55.5    1e-06   
ref|XP_009601849.1|  PREDICTED: histidine decarboxylase-like isof...  55.1    1e-06   
ref|XP_004245146.1|  PREDICTED: histidine decarboxylase-like          55.1    2e-06   
emb|CCJ09762.1|  putative histidine decarboxylase-like                51.2    2e-06   
ref|XP_011044197.1|  PREDICTED: serine decarboxylase-like             53.1    8e-06   
ref|XP_002306690.1|  serine decarboxylase family protein              52.8    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_011101473.1|  PREDICTED: serine decarboxylase-like             52.0    2e-05   
ref|XP_004245144.1|  PREDICTED: histidine decarboxylase               52.0    2e-05   
ref|XP_011042836.1|  PREDICTED: serine decarboxylase-like             51.6    3e-05   
gb|KDP43008.1|  hypothetical protein JCGZ_25194                       51.6    3e-05   
gb|KFK24263.1|  hypothetical protein AALP_AAs40498U000700             51.6    3e-05   
ref|XP_008781392.1|  PREDICTED: serine decarboxylase 1                51.6    3e-05   
ref|XP_003579728.1|  PREDICTED: serine decarboxylase 1                51.2    3e-05   
ref|XP_010931002.1|  PREDICTED: serine decarboxylase 1                51.2    4e-05   
gb|KHN26720.1|  Histidine decarboxylase                               50.8    4e-05   
ref|XP_002302186.1|  serine decarboxylase family protein              50.8    5e-05   Populus trichocarpa [western balsam poplar]
emb|CDY59264.1|  BnaC09g51700D                                        50.8    5e-05   
gb|ABR25820.1|  histidine decarboxylase                               47.8    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_003547587.1|  PREDICTED: histidine decarboxylase               50.4    6e-05   
ref|XP_006393773.1|  hypothetical protein EUTSA_v10011430mg           50.4    6e-05   
ref|XP_010241731.1|  PREDICTED: serine decarboxylase-like             50.4    7e-05   
gb|KHG24953.1|  Histidine decarboxylase                               50.1    8e-05   
ref|XP_010108654.1|  Histidine decarboxylase                          50.1    8e-05   
ref|NP_001241244.1|  uncharacterized protein LOC100795577             50.1    9e-05   
gb|KCW71161.1|  hypothetical protein EUGRSUZ_F04257                   50.1    1e-04   
gb|KEH26769.1|  serine decarboxylase                                  48.1    1e-04   
ref|XP_006366216.1|  PREDICTED: histidine decarboxylase-like          49.7    1e-04   
gb|EAY86197.1|  hypothetical protein OsI_07573                        49.7    1e-04   Oryza sativa Indica Group [Indian rice]
sp|Q6ESZ9.1|SDC1_ORYSJ  RecName: Full=Serine decarboxylase 1          49.7    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001047064.2|  Os02g0541300                                     48.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
emb|CDY41717.1|  BnaA09g15450D                                        49.7    1e-04   
ref|XP_009113392.1|  PREDICTED: serine decarboxylase-like             49.7    1e-04   
ref|XP_007148444.1|  hypothetical protein PHAVU_006G209300g           49.7    1e-04   
ref|XP_006584563.1|  PREDICTED: uncharacterized protein LOC100792...  49.3    1e-04   
ref|XP_006584565.1|  PREDICTED: uncharacterized protein LOC100792...  49.3    1e-04   
gb|KHN39188.1|  Histidine decarboxylase                               49.3    1e-04   
ref|XP_006584560.1|  PREDICTED: uncharacterized protein LOC100792...  49.3    1e-04   
ref|XP_007019463.1|  Pyridoxal phosphate (PLP)-dependent transfer...  49.3    2e-04   
ref|XP_009420591.1|  PREDICTED: serine decarboxylase 1-like           49.3    2e-04   
gb|KCW44086.1|  hypothetical protein EUGRSUZ_L02502                   48.1    2e-04   
ref|XP_009368490.1|  PREDICTED: serine decarboxylase-like             49.3    2e-04   
emb|CBI18554.3|  unnamed protein product                              48.9    2e-04   
ref|XP_002266398.1|  PREDICTED: serine decarboxylase                  48.9    2e-04   Vitis vinifera
ref|XP_008339120.1|  PREDICTED: histidine decarboxylase-like          48.9    2e-04   
ref|XP_003593129.1|  Histidine decarboxylase                          48.9    2e-04   
gb|KCW71157.1|  hypothetical protein EUGRSUZ_F04254                   46.2    2e-04   
gb|ACJ85197.1|  unknown                                               48.9    2e-04   Medicago truncatula
ref|XP_002893962.1|  EMB1075                                          48.9    2e-04   
gb|AES76141.2|  serine decarboxylase                                  48.1    2e-04   
ref|XP_010260914.1|  PREDICTED: serine decarboxylase-like             48.9    2e-04   
ref|XP_010519398.1|  PREDICTED: serine decarboxylase-like             48.5    3e-04   
ref|XP_002533017.1|  group II plp decarboxylase, putative             48.5    3e-04   Ricinus communis
ref|XP_009416900.1|  PREDICTED: serine decarboxylase 1-like           48.5    3e-04   
gb|AFK39410.1|  unknown                                               48.1    3e-04   
ref|XP_010479021.1|  PREDICTED: serine decarboxylase                  48.5    3e-04   
ref|XP_010241734.1|  PREDICTED: serine decarboxylase 1-like           48.5    3e-04   
ref|XP_010063879.1|  PREDICTED: serine decarboxylase-like             48.5    3e-04   
sp|Q8RV06.1|SDC2_ORYSJ  RecName: Full=Serine decarboxylase 2          48.5    3e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006307198.1|  hypothetical protein CARUB_v10008789mg           48.5    3e-04   
ref|XP_006364728.1|  PREDICTED: histidine decarboxylase-like          48.1    4e-04   
ref|XP_008381807.1|  PREDICTED: histidine decarboxylase               48.1    4e-04   
ref|XP_009616512.1|  PREDICTED: serine decarboxylase                  47.8    4e-04   
ref|XP_003619923.1|  L-tyrosine decarboxylase                         47.8    4e-04   
ref|XP_010675834.1|  PREDICTED: serine decarboxylase-like             47.8    4e-04   
ref|XP_001754291.1|  predicted protein                                47.8    5e-04   
emb|CAN70523.1|  hypothetical protein VITISV_034634                   47.8    5e-04   Vitis vinifera
ref|XP_010676037.1|  PREDICTED: serine decarboxylase-like             47.8    5e-04   
ref|XP_010530241.1|  PREDICTED: serine decarboxylase                  47.8    6e-04   
ref|XP_009784234.1|  PREDICTED: serine decarboxylase                  47.8    6e-04   
dbj|BAE07183.1|  putative serine decarboxylase                        47.4    6e-04   Beta vulgaris [beet]
ref|NP_001234136.1|  histidine decarboxylase                          47.4    7e-04   
ref|XP_001761266.1|  predicted protein                                47.4    7e-04   
ref|XP_002452231.1|  hypothetical protein SORBIDRAFT_04g022140        47.4    7e-04   Sorghum bicolor [broomcorn]
ref|XP_010680495.1|  PREDICTED: serine decarboxylase                  47.4    7e-04   
gb|EAY77466.1|  hypothetical protein OsI_32510                        47.4    7e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_004485538.1|  PREDICTED: histidine decarboxylase-like isof...  47.4    8e-04   
gb|KHG04394.1|  Histidine decarboxylase                               47.4    8e-04   
gb|EYU17447.1|  hypothetical protein MIMGU_mgv1a005353mg              47.4    8e-04   
ref|XP_008218831.1|  PREDICTED: histidine decarboxylase-like          47.0    0.001   
ref|XP_008645766.1|  PREDICTED: histidine decarboxylase-like          47.0    0.001   
gb|EMS65243.1|  Histidine decarboxylase                               46.6    0.001   
ref|XP_007227607.1|  hypothetical protein PRUPE_ppa020363mg           47.0    0.001   



>ref|XP_009789723.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=465

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T E LD+F NDL+ Q++         PPC+A+D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYH  458

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  459  KIDFIIP  465



>ref|XP_009769413.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009769414.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
sylvestris]
Length=465

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T E LD+F NDL+ Q++         PPC+A+D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITREILDSFINDLLQQRKKWYKDGNVTPPCVAEDIGAQNCACSYH  458

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  459  KIDFIIP  465



>ref|XP_004244519.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=465

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 37/67 (55%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T E LD F NDL+ Q++         PPC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYH  458

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  459  KIDFIIP  465



>ref|XP_009599698.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T + LD+F NDL+ Q++         PPC+A D+G  NC C  H
Sbjct  394  LSCVRDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYH  453

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  454  KIDFIIP  460



>ref|XP_009620691.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=460

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 45/67 (67%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T + LD+F NDL+ Q++         PPC+A D+G  NC C  H
Sbjct  394  LSCVRDMAHVIVMPGITRDILDSFINDLLQQRKKWYKDGNVTPPCVAQDIGAQNCACSYH  453

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  454  KIDFIIP  460



>ref|NP_001233859.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
 gb|ABE77151.1| aromatic amino acid decarboxylase 2 [Solanum lycopersicum]
Length=465

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T E LD F NDL+ Q++         PPC+A+D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFINDLLQQRKKWYQDGRISPPCVANDIGAQNCACSYH  458

Query  136  KLSF  125
            K+ +
Sbjct  459  KIDY  462



>ref|XP_006357084.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 43/67 (64%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T E LD F  DL+ Q++         PPC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISPPCVASDIGAQNCTCSYH  458

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  459  KIDFIIP  465



>ref|XP_009600675.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=456

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC++DMAHVIVMPG+T E LD F NDLV Q++          PC+ADD+G  NC C  H
Sbjct  390  LSCMKDMAHVIVMPGITRETLDNFVNDLVQQRKLWYQHGRVTTPCIADDIGAQNCSCSYH  449

Query  136  KLSF  125
            K+ +
Sbjct  450  KIDY  453



>ref|XP_006357083.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=465

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 41/64 (64%), Gaps = 0/64 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRDMAHVIVMPG+T E LD F  DL+ Q++          PC+A D+G  NC C  H
Sbjct  399  LSCVRDMAHVIVMPGITRETLDGFITDLLQQRKKWYQDGRISAPCVASDIGAQNCACSYH  458

Query  136  KLSF  125
            K+ +
Sbjct  459  KIDY  462



>ref|XP_006365165.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=482

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ADD+G  NC C  H
Sbjct  417  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYH  476

Query  136  KLSF  125
            K+ +
Sbjct  477  KIDY  480



>ref|XP_004245427.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++         PPC+ +D+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTNPPCVGEDIGAQNCACSYH  464

Query  136  KLSFSYP  116
            K+ F  P
Sbjct  465  KIDFITP  471



>ref|XP_006365166.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=469

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ADD+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVADDIGAQNCACSYH  463

Query  136  KLSF  125
            K+ +
Sbjct  464  KIDY  467



>ref|XP_006365164.1| PREDICTED: histidine decarboxylase-like isoform X3 [Solanum tuberosum]
Length=470

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  464  KIDYISP  470



>ref|XP_006365162.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum tuberosum]
Length=470

 Score = 67.8 bits (164),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  464  KIDYISP  470



>ref|XP_006365163.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum tuberosum]
Length=470

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  464  KIDYISP  470



>ref|XP_010325179.1| PREDICTED: histidine decarboxylase-like isoform X2 [Solanum lycopersicum]
Length=469

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++         PPC+ +D+G  NC C  H
Sbjct  398  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYH  457

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  458  KIDYITP  464



>ref|XP_004245280.1| PREDICTED: histidine decarboxylase-like isoform X1 [Solanum lycopersicum]
Length=476

 Score = 67.8 bits (164),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++         PPC+ +D+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTYPPCVGEDIGAQNCACSYH  464

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  465  KIDYITP  471



>ref|XP_006365168.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score = 67.4 bits (163),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  463

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  464  KIDYISP  470



>ref|XP_004245279.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=471

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYH  464

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  465  KIDYISP  471



>ref|XP_009779195.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDMAHV+VMPG+T E +D+FFNDL+ ++          PPCLADD+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQ  442

Query  136  KL  131
            K+
Sbjct  443  KM  444



>gb|AHG12639.1| histidine decarboxylase [Nicotiana tabacum]
Length=446

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDMAHV+VMPG+T E +D+FFNDL+ ++          PPCLADD+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQ  442

Query  136  KL  131
            K+
Sbjct  443  KM  444



>gb|AIE54278.1| aromatic amino acid decarboxylase 2 [Nicotiana tabacum]
Length=457

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDMAHV+VMPG+T E +D+FFNDL+ ++          PPCLADD+G  NC C   
Sbjct  394  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTTLPPCLADDIGSQNCLCSYQ  453

Query  136  KL  131
            K+
Sbjct  454  KM  455



>ref|XP_006365087.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=467

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  401  LSCVKDMAHVIVMPGITREMLDNFISELVQQRKQWYKDGKAEAPCVGEDIGAQNCACSYH  460

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  461  KIDYICP  467



>ref|NP_001233852.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
 gb|ABE77150.1| aromatic amino acid decarboxylase 1B [Solanum lycopersicum]
Length=471

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++       A  PC+ +D+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFVSELVQQRKQWYRDGKAEAPCVGEDIGAQNCACSYH  464

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  465  KIDYIGP  471



>ref|NP_001233845.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
 gb|ABE77149.1| aromatic amino acid decarboxylase 1A [Solanum lycopersicum]
Length=471

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++LV Q++         PPC+ +D+G  NC C  H
Sbjct  405  LSCVKDMAHVIVMPGITREMLDNFMSELVQQRKVWYQNGKTDPPCVGEDIGAQNCACSYH  464

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  465  KIDYICP  471



>ref|XP_009774334.1| PREDICTED: histidine decarboxylase-like [Nicotiana sylvestris]
Length=446

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDMAHV+VMPG+T E +D+FFNDL+ ++          PPCLADD+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDSFFNDLMQEREKWYQVGTIVPPCLADDIGSQNCLCSKQ  442

Query  136  KL  131
            K+
Sbjct  443  KM  444



>ref|XP_006365167.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=470

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 44/67 (66%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHVIVMPG+T E LD F ++L+ Q++         PPC+ +D+G  NC C  H
Sbjct  404  LSCVKDMAHVIVMPGITREMLDNFISELMQQRKVWYQNGKTNPPCVGEDIGAQNCACSYH  463

Query  136  KLSFSYP  116
            K+ +  P
Sbjct  464  KIDYISP  470



>ref|XP_004245281.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=455

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+DMAHV+VMPG+T E LD F ++LV Q++       A  PC+ADD+G  NC C  H
Sbjct  394  LSCVKDMAHVVVMPGITREMLDNFISELVQQRKHWYQGGKAEAPCVADDIGTQNCACSYH  453

Query  136  KL  131
            K+
Sbjct  454  KI  455



>ref|XP_009602156.1| PREDICTED: histidine decarboxylase-like [Nicotiana tomentosiformis]
Length=446

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 32/62 (52%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDMAHV+VMPG+T E +D FF DL+ +++         PPCLADD+G  NC C   
Sbjct  383  LSCTRDMAHVVVMPGITRETIDNFFKDLMQERKKWYQVGIIVPPCLADDIGSQNCLCSKQ  442

Query  136  KL  131
            K+
Sbjct  443  KM  444



>ref|XP_006367691.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=457

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 34/60 (57%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVRD+AHVIVMP +T E LD FF DLV +++      +  PPC+ADD+G  NC C LH
Sbjct  391  LSCVRDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCACALH  450



>ref|XP_009622262.1| PREDICTED: LOW QUALITY PROTEIN: histidine decarboxylase-like 
[Nicotiana tomentosiformis]
Length=444

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/62 (50%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDMAHV++MPG+T E +D+FF DL+ ++          PPCLADD+G  NC C   
Sbjct  381  LSCTRDMAHVVIMPGITRETIDSFFKDLMQERXKWYQVGTTVPPCLADDIGSQNCICSKQ  440

Query  136  KL  131
            K+
Sbjct  441  KM  442



>ref|XP_004244809.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=457

 Score = 62.8 bits (151),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/60 (55%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCV+D+AHVIVMP +T E LD FF DLV +++      +  PPC+ADD+G  NC C LH
Sbjct  391  LSCVKDIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCACALH  450



>ref|XP_006346847.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=498

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 42/65 (65%), Gaps = 0/65 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSCVR +AHVIVMP +T E LD FF DLV +++      +  PPC+ADD+G  NC C  H
Sbjct  391  LSCVRHIAHVIVMPSITRETLDDFFIDLVQKRKMWYQDGSVKPPCVADDIGAQNCSCAFH  450

Query  136  KLSFS  122
              S S
Sbjct  451  NDSDS  455



>ref|XP_006362640.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=346

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 2/62 (3%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RD AHV+VMPG T E +D FF DL+ ++           PCLADD+G  NC C  H
Sbjct  285  LSCTRDTAHVVVMPGTTKEIIDNFFKDLMQERE--KWCGITLAPCLADDIGSQNCLCSYH  342

Query  136  KL  131
             +
Sbjct  343  NM  344



>ref|XP_009601848.1| PREDICTED: histidine decarboxylase-like isoform X1 [Nicotiana 
tomentosiformis]
Length=448

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDM H +VMP +T E +D FF DL+ ++          PPCLADD+   NC C  H
Sbjct  385  LSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDIASQNCLCCCH  444

Query  136  KL  131
            K+
Sbjct  445  KM  446



>ref|XP_006364727.1| PREDICTED: histidine decarboxylase-like, partial [Solanum tuberosum]
Length=422

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L  +R MAHV+VMPG+T E +D+FFNDL+ +++         PPCLADD G  NC C  +
Sbjct  359  LCYLRGMAHVVVMPGITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMCSNN  418

Query  136  KL  131
            K+
Sbjct  419  KM  420



>ref|XP_009601849.1| PREDICTED: histidine decarboxylase-like isoform X2 [Nicotiana 
tomentosiformis]
Length=408

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 29/62 (47%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            LSC RDM H +VMP +T E +D FF DL+ ++          PPCLADD+   NC C  H
Sbjct  345  LSCTRDMTHAVVMPCITRETIDNFFKDLMHEREKWYRVGTTVPPCLADDIASQNCLCCCH  404

Query  136  KL  131
            K+
Sbjct  405  KM  406



>ref|XP_004245146.1| PREDICTED: histidine decarboxylase-like [Solanum lycopersicum]
Length=444

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 30/57 (53%), Positives = 35/57 (61%), Gaps = 2/57 (4%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYC  146
            LSC RD AHV+VMPG T E +D FF DLV ++           PCLADD+G  NC C
Sbjct  383  LSCARDTAHVVVMPGTTKEIIDNFFKDLVQERE--KWCGITLGPCLADDIGSQNCLC  437



>emb|CCJ09762.1| putative histidine decarboxylase-like, partial [Hirudo medicinalis]
Length=65

 Score = 51.2 bits (121),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  +MAH++VMP VT E LD F N+LV  +          P CLA+DVG  NC C LH
Sbjct  5    LACEGNMAHIVVMPNVTIEKLDYFLNELVHARSIWYKDEKVEPLCLAEDVGIENCCCALH  64

Query  136  K  134
            K
Sbjct  65   K  65



>ref|XP_011044197.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=478

 Score = 53.1 bits (126),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          PPC+A DVG  NC C LH
Sbjct  413  LACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSTWYRDGGVQPPCIAADVGCENCACALH  472

Query  136  KLS  128
            KLS
Sbjct  473  KLS  475



>ref|XP_002306690.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE93686.1| serine decarboxylase family protein [Populus trichocarpa]
Length=478

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 40/63 (63%), Gaps = 0/63 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          PPC+A DVG  NC C LH
Sbjct  413  LACQGNIAHVVVMPSVTIEKLDDFLNELVEKRSIWYRDGGVQPPCIAADVGCENCACALH  472

Query  136  KLS  128
            KLS
Sbjct  473  KLS  475



>ref|XP_011101473.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
 ref|XP_011101480.1| PREDICTED: serine decarboxylase-like [Sesamum indicum]
Length=517

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 30/63 (48%), Positives = 39/63 (62%), Gaps = 0/63 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  +MAHV+VMP VT E LD F N+++  +          PPCLA D+G +NC C LH
Sbjct  427  LACEGNMAHVVVMPSVTVEKLDFFLNEIIQGRSIWYKDGNVHPPCLAADIGSNNCSCALH  486

Query  136  KLS  128
            K S
Sbjct  487  KDS  489



>ref|XP_004245144.1| PREDICTED: histidine decarboxylase [Solanum lycopersicum]
Length=444

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L  +R MAHV+VMPG+T E +D+FF DL+ +++         PPCLAD+ G  NC C  +
Sbjct  381  LCYLRGMAHVVVMPGITRETIDSFFKDLMQERKRWFQDGKTQPPCLADEFGSQNCMCSHN  440

Query  136  KL  131
            K+
Sbjct  441  KM  442



>ref|XP_011042836.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
 ref|XP_011042837.1| PREDICTED: serine decarboxylase-like [Populus euphratica]
Length=463

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++        A PPC+A DVG  NC C LH
Sbjct  403  LACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKARPPCIAADVGSQNCSCDLH  462

Query  136  K  134
            K
Sbjct  463  K  463



>gb|KDP43008.1| hypothetical protein JCGZ_25194 [Jatropha curcas]
Length=484

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C   +AHV+VMP VT E LD F N+L+ ++           PC+A DVG  NC C LH
Sbjct  424  LACQGSIAHVVVMPNVTIEKLDNFLNELIEKRSTWYQDGQLQSPCIATDVGSENCACALH  483

Query  136  K  134
            K
Sbjct  484  K  484



>gb|KFK24263.1| hypothetical protein AALP_AAs40498U000700 [Arabis alpina]
Length=489

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD+F  DL VQ R+      + PPCL  +VG HNC C  H
Sbjct  430  LACQGDIAHVVVMPSVTIEKLDSFLKDL-VQHRSVWYADGSQPPCLVSEVGTHNCICPAH  488

Query  136  K  134
            K
Sbjct  489  K  489



>ref|XP_008781392.1| PREDICTED: serine decarboxylase 1 [Phoenix dactylifera]
Length=475

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+L+  + +       P PC+A D+G  NC C LH
Sbjct  414  LACEGNIAHVVVMPNVTVEKLDTFLNELIQNRSSCYEDGNIPFPCIAADIGDENCLCSLH  473

Query  136  K  134
            +
Sbjct  474  Q  474



>ref|XP_003579728.1| PREDICTED: serine decarboxylase 1 [Brachypodium distachyon]
Length=469

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 0/62 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  +++HV+VMP VT   LD+F N+LV ++           PC+A DVG HNC C +H
Sbjct  408  LACEGNISHVVVMPSVTINKLDSFLNELVEKRVTWYQEGICQSPCIAGDVGQHNCLCTMH  467

Query  136  KL  131
            K+
Sbjct  468  KV  469



>ref|XP_010931002.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
 ref|XP_010931003.1| PREDICTED: serine decarboxylase 1 [Elaeis guineensis]
Length=475

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AH++VMP VT E LD F N+L+ ++ +       P PCLA D+G  NC C LH
Sbjct  414  LACEGNIAHIVVMPNVTIEKLDTFLNELIQKRSSWYEGGKIPSPCLAADIGDENCLCSLH  473

Query  136  K  134
            +
Sbjct  474  Q  474



>gb|KHN26720.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T E LD F N+L+ ++          P C++ DVG  NC C LH
Sbjct  425  LACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCALH  484

Query  136  K  134
            K
Sbjct  485  K  485



>ref|XP_002302186.1| serine decarboxylase family protein [Populus trichocarpa]
 gb|EEE81459.1| serine decarboxylase family protein [Populus trichocarpa]
Length=463

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          PPC+A D+G  NC C LH
Sbjct  403  LACQGNIAHVVVMPSVTIEKLDDFVNELVEKRSTWYQDEKVRPPCIAADIGSQNCSCDLH  462

Query  136  K  134
            K
Sbjct  463  K  463



>emb|CDY59264.1| BnaC09g51700D [Brassica napus]
Length=470

 Score = 50.8 bits (120),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DLV  +      + +  PCL  DVG  NC C  H
Sbjct  410  LACQGDIAHVVVMPSVTIEKLDHFLKDLVENRSVWYEEYGSQLPCLVKDVGIKNCICPAH  469

Query  136  K  134
            K
Sbjct  470  K  470



>gb|ABR25820.1| histidine decarboxylase [Oryza sativa Indica Group]
Length=103

 Score = 47.8 bits (112),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 35/67 (52%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AH++VMP VT E L  F  +L  ++           P LA D+G  NCYC+LH
Sbjct  35   LACEGNLAHIVVMPNVTFEKLTVFVEELAEKRNDWYQDKGFDIPFLAVDIGKENCYCNLH  94

Query  136  KLSFSYP  116
                  P
Sbjct  95   AKKLRIP  101



>ref|XP_003547587.1| PREDICTED: histidine decarboxylase [Glycine max]
 gb|KHN33495.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T E LD F N+L+ ++          P C++ DVG  NC C LH
Sbjct  425  LACKGNIAHVVVMPNITIEKLDDFLNELLDKRATWFQDGKDQPYCISSDVGEKNCLCALH  484

Query  136  K  134
            K
Sbjct  485  K  485



>ref|XP_006393773.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
 gb|ESQ31059.1| hypothetical protein EUTSA_v10011430mg [Eutrema salsugineum]
Length=489

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DL V+ R+      + PPCLA DVG +NC C  H
Sbjct  430  LACQGDIAHVVVMPSVTIEKLDHFLKDL-VEHRSVWYEDGSQPPCLAKDVGTNNCICPTH  488

Query  136  K  134
            K
Sbjct  489  K  489



>ref|XP_010241731.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
 ref|XP_010241733.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score = 50.4 bits (119),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T E LD F N+L+ ++        + PPC+A DVG  NC C LH
Sbjct  423  LACQGNIAHVVVMPNITIEKLDNFLNELIQKRLTWFQDGKSQPPCIAADVGKENCACVLH  482

Query  136  K  134
            K
Sbjct  483  K  483



>gb|KHG24953.1| Histidine decarboxylase [Gossypium arboreum]
Length=478

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+L V+KR+   +    PPC+A ++G  NC C LH
Sbjct  419  LACEGNIAHVVVMPNVTIEKLDFFLNEL-VEKRSTWYQGNVQPPCIAAEIGKANCVCALH  477

Query  136  K  134
            K
Sbjct  478  K  478



>ref|XP_010108654.1| Histidine decarboxylase [Morus notabilis]
 gb|EXC19910.1| Histidine decarboxylase [Morus notabilis]
Length=483

 Score = 50.1 bits (118),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  +MAHV+VMP VT E LD F N+L+ ++ A        PPCLA ++G  NC C LH
Sbjct  424  LACQGNMAHVVVMPNVTIEKLDVFLNELIEERSAWYQDENVQPPCLAAEIGAENCACKLH  483



>ref|NP_001241244.1| uncharacterized protein LOC100795577 [Glycine max]
 gb|ACU18100.1| unknown [Glycine max]
Length=483

 Score = 50.1 bits (118),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T E LD F N+L+ ++          P C++ DVG  NC C LH
Sbjct  423  LACKGNIAHVVVMPNITIEKLDDFLNELLEKRATWFQDGKDQPYCISSDVGEKNCLCALH  482

Query  136  K  134
            K
Sbjct  483  K  483



>gb|KCW71161.1| hypothetical protein EUGRSUZ_F04257 [Eucalyptus grandis]
Length=517

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+ E LD F N+L+ ++          PPCLA D+G  NC C LH
Sbjct  457  LACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALH  516

Query  136  K  134
            K
Sbjct  517  K  517



>gb|KEH26769.1| serine decarboxylase [Medicago truncatula]
Length=192

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG ++C C  H
Sbjct  132  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  191

Query  136  K  134
            K
Sbjct  192  K  192



>ref|XP_006366216.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=418

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 39/62 (63%), Gaps = 1/62 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRa-apprhaapppclADDVGPHNCYCHL  140
            LSC RDM HV+VMPGVT + LD F ++   ++       +   PPCLA+D+G HNC C  
Sbjct  356  LSCERDMTHVVVMPGVTTQMLDNFVSEFAKKRLIWYQDGNKVQPPCLANDIGMHNCVCPH  415

Query  139  HK  134
            HK
Sbjct  416  HK  417



>gb|EAY86197.1| hypothetical protein OsI_07573 [Oryza sativa Indica Group]
Length=484

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT + LD F N+L  ++       +  PPCLA DVG  NC C +H
Sbjct  423  LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH  482

Query  136  K  134
            K
Sbjct  483  K  483



>sp|Q6ESZ9.1|SDC1_ORYSJ RecName: Full=Serine decarboxylase 1 [Oryza sativa Japonica Group]
 dbj|BAD28070.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 dbj|BAD28221.1| putative serine decarboxylase [Oryza sativa Japonica Group]
 gb|EAZ23358.1| hypothetical protein OsJ_07054 [Oryza sativa Japonica Group]
Length=482

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT + LD F N+L  ++       +  PPCLA DVG  NC C +H
Sbjct  421  LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH  480

Query  136  K  134
            K
Sbjct  481  K  481



>ref|NP_001047064.2| Os02g0541300 [Oryza sativa Japonica Group]
 dbj|BAF08978.2| Os02g0541300, partial [Oryza sativa Japonica Group]
Length=207

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT + LD F N+L  ++       +  PPCLA DVG  NC C +H
Sbjct  146  LACEGNIAHVVVMPSVTIDKLDYFLNELTEKRATWYQDGSCQPPCLAKDVGEENCLCSIH  205

Query  136  K  134
            K
Sbjct  206  K  206



>emb|CDY41717.1| BnaA09g15450D [Brassica napus]
Length=467

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DL V+ R+      + PPCL  DVG  NC C  H
Sbjct  408  LACQGDIAHVVVMPSVTIEKLDHFLKDL-VENRSVWYEDGSQPPCLVKDVGIKNCICPAH  466

Query  136  K  134
            K
Sbjct  467  K  467



>ref|XP_009113392.1| PREDICTED: serine decarboxylase-like [Brassica rapa]
Length=477

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DL V+ R+      + PPCL  DVG  NC C  H
Sbjct  418  LACQGDIAHVVVMPSVTIEKLDHFLKDL-VENRSVWYEDGSQPPCLVKDVGIKNCICPAH  476

Query  136  K  134
            K
Sbjct  477  K  477



>ref|XP_007148444.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
 gb|ESW20438.1| hypothetical protein PHAVU_006G209300g [Phaseolus vulgaris]
Length=483

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T E LD F N+L+ ++          P C++ DVG  NC C LH
Sbjct  423  LACKGNIAHVVVMPNITIEKLDDFLNELLEKRTTWFQDGKDQPYCISADVGEKNCLCALH  482

Query  136  K  134
            K
Sbjct  483  K  483



>ref|XP_006584563.1| PREDICTED: uncharacterized protein LOC100792053 isoform X4 [Glycine 
max]
 ref|XP_006584564.1| PREDICTED: uncharacterized protein LOC100792053 isoform X5 [Glycine 
max]
Length=468

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG  NC C LH
Sbjct  408  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  467

Query  136  K  134
            +
Sbjct  468  R  468



>ref|XP_006584565.1| PREDICTED: uncharacterized protein LOC100792053 isoform X6 [Glycine 
max]
Length=458

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG  NC C LH
Sbjct  398  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  457

Query  136  K  134
            +
Sbjct  458  R  458



>gb|KHN39188.1| Histidine decarboxylase [Glycine soja]
Length=485

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG  NC C LH
Sbjct  425  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  484

Query  136  K  134
            +
Sbjct  485  R  485



>ref|XP_006584560.1| PREDICTED: uncharacterized protein LOC100792053 isoform X1 [Glycine 
max]
 ref|XP_006584561.1| PREDICTED: uncharacterized protein LOC100792053 isoform X2 [Glycine 
max]
 ref|XP_006584562.1| PREDICTED: uncharacterized protein LOC100792053 isoform X3 [Glycine 
max]
Length=485

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG  NC C LH
Sbjct  425  LACQGNVAHVVVMPNVTIEKLDDFLNELVQKRAVWFRDGNCQPYCIASDVGQENCLCALH  484

Query  136  K  134
            +
Sbjct  485  R  485



>ref|XP_007019463.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
 gb|EOY16688.1| Pyridoxal phosphate (PLP)-dependent transferases superfamily 
protein [Theobroma cacao]
Length=491

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F ++LV ++          PPC+A DVG  NC C LH
Sbjct  431  LACEGNIAHVVVMPNVTIEKLDLFLDELVEKRSTWYQEEHDQPPCIAADVGKENCACALH  490

Query  136  K  134
            K
Sbjct  491  K  491



>ref|XP_009420591.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=473

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 40/61 (66%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F ++LV  + A     + P PC+A ++G  NC+C +H
Sbjct  412  LACEGNIAHVVVMPSVTIEKLDDFLDELVAGRSAWYRDRSRPSPCIAAEIGQENCHCSMH  471

Query  136  K  134
            K
Sbjct  472  K  472



>gb|KCW44086.1| hypothetical protein EUGRSUZ_L02502 [Eucalyptus grandis]
Length=239

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+ E LD F N+L+ ++          PPCLA D+G  NC C LH
Sbjct  179  LACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALH  238

Query  136  K  134
            K
Sbjct  239  K  239



>ref|XP_009368490.1| PREDICTED: serine decarboxylase-like [Pyrus x bretschneideri]
Length=479

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+ E LD F N+L V+KR+        PPCLA DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVSIEKLDNFLNEL-VEKRSTWYDEKVQPPCLAADVGTENCSCRQH  478

Query  136  K  134
            K
Sbjct  479  K  479



>emb|CBI18554.3| unnamed protein product [Vitis vinifera]
Length=438

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F ++L+ ++          PPC+A D+G  NC C LH
Sbjct  378  LACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDLH  437

Query  136  K  134
            K
Sbjct  438  K  438



>ref|XP_002266398.1| PREDICTED: serine decarboxylase [Vitis vinifera]
Length=482

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F ++L+ ++          PPC+A D+G  NC C LH
Sbjct  422  LACQGNIAHVVVMPNVTIEKLDYFLDELIEKRNTWFLDKKVQPPCVAADIGSENCLCDLH  481

Query  136  K  134
            K
Sbjct  482  K  482



>ref|XP_008339120.1| PREDICTED: histidine decarboxylase-like [Malus domestica]
Length=479

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+ E LD F N+L V+KR+        PPCLA DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVSIEKLDNFLNEL-VEKRSTWYDENVQPPCLAADVGTENCSCRQH  478

Query  136  K  134
            K
Sbjct  479  K  479



>ref|XP_003593129.1| Histidine decarboxylase [Medicago truncatula]
 gb|AES63380.1| serine decarboxylase [Medicago truncatula]
Length=486

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG ++C C  H
Sbjct  426  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  485

Query  136  K  134
            K
Sbjct  486  K  486



>gb|KCW71157.1| hypothetical protein EUGRSUZ_F04254 [Eucalyptus grandis]
Length=85

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = -1

Query  301  DMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLHK  134
            ++AHV+VMP V+ E LD F N+L+ ++           PCLA D+G  NC C LHK
Sbjct  30   NIAHVVVMPSVSIEKLDVFVNELIEKRSTWYRDGTVQSPCLAVDIGAENCCCALHK  85



>gb|ACJ85197.1| unknown [Medicago truncatula]
Length=486

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG ++C C  H
Sbjct  426  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  485

Query  136  K  134
            K
Sbjct  486  K  486



>ref|XP_002893962.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70221.1| EMB1075 [Arabidopsis lyrata subsp. lyrata]
Length=462

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DL V+ R+      + PPCLA +VG +NC C  H
Sbjct  403  LACQGDIAHVVVMPSVTIEKLDNFLKDL-VKHRSVWYEDGSQPPCLASEVGTNNCICPTH  461

Query  136  K  134
            K
Sbjct  462  K  462



>gb|AES76141.2| serine decarboxylase [Medicago truncatula]
Length=261

 Score = 48.1 bits (113),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG ++C C  H
Sbjct  201  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  260

Query  136  K  134
            K
Sbjct  261  K  261



>ref|XP_010260914.1| PREDICTED: serine decarboxylase-like [Nelumbo nucifera]
Length=483

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C   +AHV+VMP +T E LD F N+L+ ++        + PPC+A DVG  NC C +H
Sbjct  423  LACQGSIAHVVVMPNITVEKLDDFLNELIGKRSTWFQDGKSQPPCIAADVGKENCACVMH  482

Query  136  K  134
            K
Sbjct  483  K  483



>ref|XP_010519398.1| PREDICTED: serine decarboxylase-like [Tarenaya hassleriana]
Length=489

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 39/61 (64%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F ++L V++R+   +  +   C+A DVG  NC C  H
Sbjct  430  LACQGNIAHVVVMPSVTIEKLDYFLDEL-VEQRSVWYKDGSQALCIASDVGVENCICPAH  488

Query  136  K  134
            K
Sbjct  489  K  489



>ref|XP_002533017.1| group II plp decarboxylase, putative [Ricinus communis]
 gb|EEF29371.1| group II plp decarboxylase, putative [Ricinus communis]
Length=471

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F ++LV ++           PC+A DVG  NC C LH
Sbjct  411  LACQGNIAHVVVMPSVTIEKLDNFLDELVKKRSTWYQDGQVQSPCIAADVGSENCACALH  470



>ref|XP_009416900.1| PREDICTED: serine decarboxylase 1-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT + LD+F N+L+  +          PPC+A D+G  NC C LH
Sbjct  418  LACEGNIAHVVVMPNVTIDKLDSFLNELLRHRSCWYQEGNISPPCIAADIGEENCCCALH  477

Query  136  K  134
            +
Sbjct  478  R  478



>gb|AFK39410.1| unknown [Medicago truncatula]
Length=320

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG ++C C  H
Sbjct  260  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  319

Query  136  K  134
            K
Sbjct  320  K  320



>ref|XP_010479021.1| PREDICTED: serine decarboxylase [Camelina sativa]
Length=490

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 36/61 (59%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DL V+ R         PPCL  +VG +NC C  H
Sbjct  431  LACQGDIAHVVVMPSVTIEKLDNFLKDL-VKHRLVWYEDGTQPPCLVSEVGTNNCICPAH  489

Query  136  K  134
            K
Sbjct  490  K  490



>ref|XP_010241734.1| PREDICTED: serine decarboxylase 1-like [Nelumbo nucifera]
Length=486

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 33/63 (52%), Positives = 41/63 (65%), Gaps = 3/63 (5%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaa--pprhaapppclADDVGPHNCYCH  143
            L+C  D+AHV+VMP VT E LD F ++L +QKR+A         PPC+A DVG  NC C 
Sbjct  425  LACQGDIAHVVVMPNVTIEKLDVFVDEL-MQKRSAWFRNGRILQPPCIAADVGNENCACI  483

Query  142  LHK  134
            LHK
Sbjct  484  LHK  486



>ref|XP_010063879.1| PREDICTED: serine decarboxylase-like [Eucalyptus grandis]
Length=477

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+ E LD F N+L+ ++          PPCLA D+G  NC C LH
Sbjct  417  LACEGNIAHVVVMPSVSIEKLDGFVNELIEKRSTWYRDGTVQPPCLAVDIGAENCCCALH  476

Query  136  K  134
            K
Sbjct  477  K  477



>sp|Q8RV06.1|SDC2_ORYSJ RecName: Full=Serine decarboxylase 2 [Oryza sativa Japonica Group]
 gb|AAG12476.2|AC037197_1 Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAL75763.1| Putative histidine decarboxylase [Oryza sativa Japonica Group]
 gb|AAP51789.1| Histidine decarboxylase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ15061.1| hypothetical protein OsJ_30471 [Oryza sativa Japonica Group]
Length=467

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AH++VMP VT E L  F  +L  +++          PCLA D+G  NCYC+LH
Sbjct  399  LACEGNLAHIVVMPNVTFEKLTVFVEELAEKRKDWYQDKGFDIPCLAVDIGKENCYCNLH  458

Query  136  KLSFSYP  116
                  P
Sbjct  459  AKKLRIP  465



>ref|XP_006307198.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
 gb|EOA40096.1| hypothetical protein CARUB_v10008789mg, partial [Capsella rubella]
Length=542

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  D+AHV+VMP VT E LD F  DL V+ R         PPCLA +VG +NC C  H
Sbjct  483  LACQGDIAHVVVMPSVTIEKLDDFLKDL-VKHRLVWYEDGTQPPCLASEVGTNNCICPAH  541

Query  136  K  134
            K
Sbjct  542  K  542



>ref|XP_006364728.1| PREDICTED: histidine decarboxylase-like [Solanum tuberosum]
Length=447

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 34/51 (67%), Gaps = 0/51 (0%)
 Frame = -1

Query  298  MAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYC  146
            MAH++VMP +T E +D+FFNDL+ +++         PPCLADD G  NC C
Sbjct  387  MAHIVVMPFITREIIDSFFNDLMQERKRWFQDGKTRPPCLADDFGTQNCMC  437



>ref|XP_008381807.1| PREDICTED: histidine decarboxylase [Malus domestica]
Length=479

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V  E LD F N+L V+KR+         PC+A DVG  NC C  H
Sbjct  420  LACQGNIAHVVVMPSVNIEKLDDFLNEL-VEKRSTWYDEKVQAPCIAADVGTENCSCGQH  478

Query  136  K  134
            K
Sbjct  479  K  479



>ref|XP_009616512.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
 ref|XP_009616514.1| PREDICTED: serine decarboxylase [Nicotiana tomentosiformis]
Length=487

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C R+M+HV+VMP VT E LD F ++LV  +          PPCLA D+G  NC C  H
Sbjct  423  LACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVKPPCLAADIGSQNCCCPQH  482

Query  136  K  134
            +
Sbjct  483  R  483



>ref|XP_003619923.1| L-tyrosine decarboxylase [Medicago truncatula]
Length=384

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F N+LV ++          P C+A DVG ++C C  H
Sbjct  324  LACKGNIAHVVVMPNVTIEKLDDFLNELVQKRATWFEDGTFQPYCIASDVGENSCLCAQH  383

Query  136  K  134
            K
Sbjct  384  K  384



>ref|XP_010675834.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHVIVMP VT E LD F N+LV ++          PPC+A ++G  NC C LH
Sbjct  388  LACEGNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_001754291.1| predicted protein [Physcomitrella patens]
 gb|EDQ80741.1| predicted protein [Physcomitrella patens]
Length=428

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/61 (41%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C   +AH +VMP VT E LD F  +L+  +  A P      PC+ ++VGP NC C +H
Sbjct  348  LACQGKIAHAVVMPSVTVEKLDDFVEELIEVRNRAFPDGDVVVPCIVEEVGPENCACSVH  407

Query  136  K  134
            +
Sbjct  408  R  408



>emb|CAN70523.1| hypothetical protein VITISV_034634 [Vitis vinifera]
Length=473

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/61 (44%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT E LD F + L+ ++          PPC+A D+G  NC C LH
Sbjct  413  LACQGNIAHVVVMPNVTIEKLDYFLDXLIEKRNTWFLDKKVQPPCVAADIGSENCLCDLH  472

Query  136  K  134
            K
Sbjct  473  K  473



>ref|XP_010676037.1| PREDICTED: serine decarboxylase-like [Beta vulgaris subsp. vulgaris]
Length=447

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 28/60 (47%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHVIVMP VT E LD F N+LV ++          PPC+A ++G  NC C LH
Sbjct  388  LACEGNIAHVIVMPHVTIEKLDTFLNELVEKRLTWFKDGGNQPPCVASELGKENCACPLH  447



>ref|XP_010530241.1| PREDICTED: serine decarboxylase [Tarenaya hassleriana]
Length=498

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 41/61 (67%), Gaps = 1/61 (2%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+   LD+F N+L V++R+   +  + PPC+A DVG  NC C  H
Sbjct  439  LACQGNIAHVVVMPSVSIGKLDSFLNEL-VEQRSLWYKDESQPPCVASDVGTENCICPTH  497

Query  136  K  134
            K
Sbjct  498  K  498



>ref|XP_009784234.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
 ref|XP_009784235.1| PREDICTED: serine decarboxylase [Nicotiana sylvestris]
Length=487

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 37/61 (61%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C R+M+HV+VMP VT E LD F ++LV  +          PPCLA D+G  NC C  H
Sbjct  423  LACERNMSHVVVMPSVTVEKLDDFLDELVKARSIWYKDENVNPPCLAADIGSRNCCCPQH  482

Query  136  K  134
            +
Sbjct  483  R  483



>dbj|BAE07183.1| putative serine decarboxylase [Beta vulgaris]
Length=487

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T + L++F ++LV ++          PPC+A D+G  NC C +H
Sbjct  427  LACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFKDGTNKPPCVASDIGQENCVCPMH  486

Query  136  K  134
            K
Sbjct  487  K  487



>ref|NP_001234136.1| histidine decarboxylase [Solanum lycopersicum]
 sp|P54772.1|DCHS_SOLLC RecName: Full=Histidine decarboxylase; Short=HDC; AltName: Full=TOM92 
[Solanum lycopersicum]
 emb|CAA50719.1| histidine decarboxylase [Solanum lycopersicum]
Length=413

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 17/32 (53%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQK  221
            L C+R MAHV++MPG+T E +D+FF DL+ ++
Sbjct  350  LCCLRGMAHVVIMPGITRETIDSFFKDLMQER  381



>ref|XP_001761266.1| predicted protein [Physcomitrella patens]
 gb|EDQ73988.1| predicted protein [Physcomitrella patens]
Length=449

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 25/68 (37%), Positives = 39/68 (57%), Gaps = 0/68 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C   +AH +VMP VT E LD F  +L+  ++ + P      PC+ ++VG  NC C LH
Sbjct  360  LACQGKIAHAVVMPSVTVEKLDNFVEELIEVRKRSFPEGNVKIPCIVEEVGVQNCACSLH  419

Query  136  KLSFSYPF  113
            + + + P 
Sbjct  420  RGAGTIPL  427



>ref|XP_002452231.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
 gb|EES05207.1| hypothetical protein SORBIDRAFT_04g022140 [Sorghum bicolor]
Length=494

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V  + LD F N+LV ++        + PPC+A DVG  NC C LH
Sbjct  434  LACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVENCLCGLH  493

Query  136  K  134
            K
Sbjct  494  K  494



>ref|XP_010680495.1| PREDICTED: serine decarboxylase [Beta vulgaris subsp. vulgaris]
Length=487

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP +T + L++F ++LV ++          PPC+A D+G  NC C +H
Sbjct  427  LACQGNIAHVVVMPNITIDKLESFLDELVEKRSTWFRDGTNKPPCVASDIGQENCVCPMH  486

Query  136  K  134
            K
Sbjct  487  K  487



>gb|EAY77466.1| hypothetical protein OsI_32510 [Oryza sativa Indica Group]
Length=467

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AH++VMP VT E L  F  +L  ++           PCLA D+G  NCYC+LH
Sbjct  399  LACEGNLAHIVVMPNVTFEKLTVFVEELAEKRNDWYQDKGFDIPCLAVDIGKENCYCNLH  458

Query  136  KLSFSYP  116
                  P
Sbjct  459  AKKLRIP  465



>ref|XP_004485538.1| PREDICTED: histidine decarboxylase-like isoform X1 [Cicer arietinum]
 ref|XP_004485539.1| PREDICTED: histidine decarboxylase-like isoform X2 [Cicer arietinum]
 ref|XP_004485540.1| PREDICTED: histidine decarboxylase-like isoform X3 [Cicer arietinum]
Length=485

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP VT + LD F N+L  ++ A        P C+A DVG ++C C LH
Sbjct  425  LACKGNIAHVVVMPNVTIQKLDDFLNELKEKRAAWFEDGKYQPYCIASDVGENHCLCALH  484

Query  136  K  134
            K
Sbjct  485  K  485



>gb|KHG04394.1| Histidine decarboxylase [Gossypium arboreum]
Length=476

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 2/61 (3%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V+ E LD F N+LV  K  +       PPC+A D+G  NC C LH
Sbjct  418  LACEGNIAHVVVMPSVSIEKLDVFLNELV--KNRSTWYQEQQPPCIAADIGKENCACPLH  475

Query  136  K  134
            K
Sbjct  476  K  476



>gb|EYU17447.1| hypothetical protein MIMGU_mgv1a005353mg [Erythranthe guttata]
Length=487

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  +MAH++VMP VT E LD F N+L   +          PPCLA DVG  NC C +H
Sbjct  427  LACEGNMAHIVVMPNVTVEKLDYFLNELAKGRAIWYKDGKEQPPCLAVDVGIENCSCAVH  486

Query  136  K  134
            K
Sbjct  487  K  487



>ref|XP_008218831.1| PREDICTED: histidine decarboxylase-like [Prunus mume]
Length=457

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHVIVMP +T E LD F ++L+  +           PC+A DVG  NC C  H
Sbjct  397  LACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCASH  456

Query  136  K  134
            K
Sbjct  457  K  457



>ref|XP_008645766.1| PREDICTED: histidine decarboxylase-like [Zea mays]
 gb|AFW71722.1| hypothetical protein ZEAMMB73_965103 [Zea mays]
Length=494

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 27/61 (44%), Positives = 38/61 (62%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHV+VMP V  + LD F N+LV ++        + PPC+A DVG  +C C LH
Sbjct  434  LACEGNIAHVVVMPSVNIDKLDYFLNELVEKRATWYQDGISQPPCIARDVGVESCLCGLH  493

Query  136  K  134
            K
Sbjct  494  K  494



>gb|EMS65243.1| Histidine decarboxylase [Triticum urartu]
Length=357

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C   ++HV+VMP V  + LD F N+LV ++           PC+A DVG  NC C LH
Sbjct  296  LACEGGISHVVVMPSVNVDKLDTFLNELVEKRVTWYQEGKCQSPCIAADVGQENCLCTLH  355

Query  136  K  134
            K
Sbjct  356  K  356



>ref|XP_007227607.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
 gb|EMJ28806.1| hypothetical protein PRUPE_ppa020363mg [Prunus persica]
Length=457

 Score = 47.0 bits (110),  Expect = 0.001, Method: Composition-based stats.
 Identities = 26/61 (43%), Positives = 35/61 (57%), Gaps = 0/61 (0%)
 Frame = -1

Query  316  LSCVRDMAHVIVMPGVTAEALDAFFNDLVVQKRaapprhaapppclADDVGPHNCYCHLH  137
            L+C  ++AHVIVMP +T E LD F ++L+  +           PC+A DVG  NC C  H
Sbjct  397  LACQGNIAHVIVMPNITIEKLDDFLSELLQHRAKWFQDGKLQAPCIASDVGTENCLCASH  456

Query  136  K  134
            K
Sbjct  457  K  457



Lambda      K        H        a         alpha
   0.316    0.131    0.397    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510229923304