BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7281_g2_i1 len=1069 path=[1047:0-1068]

Length=1069
                                                                      Score     E

gb|KDP31764.1|  hypothetical protein JCGZ_12225                         355   2e-119   
ref|XP_002278788.1|  PREDICTED: rac-like GTP-binding protein RAC2       355   2e-119   Vitis vinifera
ref|XP_010904883.1|  PREDICTED: rac-like GTP-binding protein RAC13      355   4e-119   
ref|XP_002525151.1|  rac gtpase, putative                               354   6e-119   Ricinus communis
ref|XP_008455937.1|  PREDICTED: rac-like GTP-binding protein RAC2       353   2e-118   
ref|XP_004151903.1|  PREDICTED: rac-like GTP-binding protein 7-like     353   2e-118   
ref|XP_007153887.1|  hypothetical protein PHAVU_003G073300g             352   5e-118   
ref|XP_004303136.1|  PREDICTED: rac-like GTP-binding protein RAC2...    352   5e-118   
ref|XP_006446737.1|  hypothetical protein CICLE_v10016797mg             352   5e-118   
ref|XP_002277471.1|  PREDICTED: rac-like GTP-binding protein RAC13      352   6e-118   Vitis vinifera
ref|XP_010279207.1|  PREDICTED: rac-like GTP-binding protein RAC2       352   6e-118   
ref|XP_008778044.1|  PREDICTED: rac-like GTP-binding protein RAC2...    351   8e-118   
ref|XP_006376405.1|  hypothetical protein POPTR_0013s12760g             351   1e-117   
sp|Q41253.1|RAC13_GOSHI  RecName: Full=Rac-like GTP-binding prote...    350   1e-117   Gossypium hirsutum [American cotton]
ref|XP_008784446.1|  PREDICTED: rac-like GTP-binding protein 7          350   2e-117   
ref|XP_009421478.1|  PREDICTED: rac-like GTP-binding protein 7          350   2e-117   
gb|AFK44689.1|  unknown                                                 350   2e-117   
ref|XP_006852540.1|  hypothetical protein AMTR_s00021p00186910          350   2e-117   
ref|XP_010035828.1|  PREDICTED: rac-like GTP-binding protein RAC2       350   2e-117   
ref|XP_003540385.1|  PREDICTED: rac-like GTP-binding protein RAC2...    350   3e-117   
gb|AAW78687.1|  small GTP-binding protein ROP1                          350   3e-117   Vigna radiata [mung bean]
gb|KCW55525.1|  hypothetical protein EUGRSUZ_I01414                     351   4e-117   
sp|Q40220.1|RAC2_LOTJA  RecName: Full=Rac-like GTP-binding protei...    349   6e-117   Lotus japonicus
ref|XP_010916043.1|  PREDICTED: rac-like GTP-binding protein RAC13      348   8e-117   
ref|XP_010028726.1|  PREDICTED: rac-like GTP-binding protein 5          348   1e-116   
ref|XP_007149793.1|  hypothetical protein PHAVU_005G099100g             348   1e-116   
ref|XP_003529357.1|  PREDICTED: rac-like GTP-binding protein 7-like     348   1e-116   
gb|ADE75718.1|  unknown                                                 348   1e-116   
sp|Q6EP31.2|RAC5_ORYSJ  RecName: Full=Rac-like GTP-binding protei...    348   1e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404415.1|  PREDICTED: rac-like GTP-binding protein RAC2       348   2e-116   
gb|AAF43429.1|AF233446_1  rac 1 protein                                 347   2e-116   Physcomitrella patens
gb|ACF83636.1|  unknown                                                 347   2e-116   Zea mays [maize]
ref|XP_004487185.1|  PREDICTED: rac-like GTP-binding protein RAC2...    347   3e-116   
ref|XP_007213176.1|  hypothetical protein PRUPE_ppa027013mg             347   3e-116   
ref|XP_002530817.1|  rac gtpase, putative                               347   3e-116   Ricinus communis
gb|AGL44367.1|  Rop4                                                    347   3e-116   
ref|XP_001773666.1|  rop-family small GTPase                            347   4e-116   
ref|XP_004952335.1|  PREDICTED: rac-like GTP-binding protein 7-like     347   5e-116   
ref|XP_006422604.1|  hypothetical protein CICLE_v10029311mg             347   6e-116   
ref|XP_002522514.1|  rac gtpase, putative                               347   6e-116   Ricinus communis
ref|XP_001761909.1|  rop-family small GTPase                            347   6e-116   
ref|XP_006377446.1|  RAC-like GTP binding protein ARAC2                 346   6e-116   
gb|ABK21895.1|  unknown                                                 346   7e-116   Picea sitchensis
gb|KDP29655.1|  hypothetical protein JCGZ_18817                         346   7e-116   
gb|AFK39736.1|  unknown                                                 346   9e-116   
ref|XP_003543315.1|  PREDICTED: rac-like GTP-binding protein RAC2...    346   9e-116   
ref|XP_009376954.1|  PREDICTED: rac-like GTP-binding protein ARAC3      346   1e-115   
ref|XP_007200549.1|  hypothetical protein PRUPE_ppa011737mg             346   1e-115   
ref|XP_002272532.1|  PREDICTED: rac-like GTP-binding protein 5          346   1e-115   Vitis vinifera
ref|XP_009355676.1|  PREDICTED: rac-like GTP-binding protein 5          346   1e-115   
gb|KHG12635.1|  Rac-like GTP-binding protein RAC13                      345   1e-115   
ref|NP_001105719.1|  Rho-related protein from plants 4                  345   1e-115   Zea mays [maize]
ref|XP_001779421.1|  rop-family small GTPase                            345   1e-115   
ref|XP_009391005.1|  PREDICTED: rac-like GTP-binding protein 5          345   1e-115   
ref|XP_002278595.1|  PREDICTED: rac-like GTP-binding protein 5          345   2e-115   Vitis vinifera
ref|XP_011045876.1|  PREDICTED: rac-like GTP-binding protein RAC13      345   2e-115   
ref|XP_008357291.1|  PREDICTED: rac-like GTP-binding protein 5          345   2e-115   
ref|XP_003635766.1|  Rac-like GTP binding protein                       345   2e-115   
ref|XP_010941321.1|  PREDICTED: rac-like GTP-binding protein 5          345   2e-115   
ref|XP_010690370.1|  PREDICTED: rac-like GTP-binding protein 5          345   2e-115   
gb|ABW24664.1|  Rop7                                                    345   2e-115   Medicago truncatula
ref|XP_008806608.1|  PREDICTED: rac-like GTP-binding protein 5          345   3e-115   
ref|XP_008811402.1|  PREDICTED: rac-like GTP-binding protein 5          345   3e-115   
ref|XP_002982092.1|  Rop2, RHO family GTPase                            344   4e-115   
ref|XP_011046692.1|  PREDICTED: rac-like GTP-binding protein 5          345   4e-115   
ref|XP_010935113.1|  PREDICTED: rac-like GTP-binding protein 5          344   4e-115   
ref|XP_006379285.1|  small GTPase Rac4 family protein                   344   4e-115   
ref|XP_007041844.1|  RAC-like 3                                         344   4e-115   
emb|CAD27895.1|  putative RACD protein                                  344   5e-115   Hordeum vulgare [barley]
ref|NP_001046653.1|  Os02g0312600                                       344   5e-115   Oryza sativa Japonica Group [Japonica rice]
gb|KDP21034.1|  hypothetical protein JCGZ_21505                         344   5e-115   
ref|XP_006435212.1|  hypothetical protein CICLE_v10002551mg             344   5e-115   
ref|XP_003542711.1|  PREDICTED: rac-like GTP-binding protein RAC1...    344   6e-115   
ref|XP_003573198.1|  PREDICTED: rac-like GTP-binding protein 7 is...    344   6e-115   
ref|XP_010265987.1|  PREDICTED: rac-like GTP-binding protein ARAC3      344   6e-115   
emb|CDO96917.1|  unnamed protein product                                344   7e-115   
emb|CDY43414.1|  BnaC07g14810D                                          343   8e-115   
ref|XP_011096382.1|  PREDICTED: rac-like GTP-binding protein RAC13      343   8e-115   
gb|AGL44365.1|  Rop2                                                    343   8e-115   
ref|XP_007132690.1|  hypothetical protein PHAVU_011G116400g             343   8e-115   
ref|XP_010477239.1|  PREDICTED: rac-like GTP-binding protein ARAC5      343   8e-115   
ref|XP_006449441.1|  hypothetical protein CICLE_v10016801mg             343   9e-115   
ref|XP_011083464.1|  PREDICTED: rac-like GTP-binding protein RAC1       343   9e-115   
ref|XP_010266823.1|  PREDICTED: rac-like GTP-binding protein 5          343   1e-114   
gb|ACM07419.1|  Rac/Rop-like small GTPase                               343   1e-114   Scoparia dulcis [escobilla]
ref|XP_006647205.1|  PREDICTED: rac-like GTP-binding protein 7-li...    345   1e-114   
ref|XP_006467698.1|  PREDICTED: rac-like GTP-binding protein RAC1...    343   1e-114   
gb|AGL44366.1|  Rop3                                                    343   1e-114   
ref|XP_007025494.1|  RAC-like 2                                         343   1e-114   
ref|XP_010416495.1|  PREDICTED: rac-like GTP-binding protein ARAC5      344   1e-114   
gb|KHN39876.1|  Rac-like GTP-binding protein RAC1                       343   1e-114   
ref|XP_003540880.1|  PREDICTED: rac-like GTP-binding protein RAC1...    343   1e-114   
ref|XP_004289869.1|  PREDICTED: rac-like GTP-binding protein ARAC...    343   1e-114   
ref|XP_004232945.1|  PREDICTED: rac-like GTP-binding protein RAC13      343   2e-114   
ref|XP_002325588.1|  hypothetical protein POPTR_0019s12210g             343   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_011092983.1|  PREDICTED: rac-like GTP-binding protein 5          343   2e-114   
ref|XP_002510565.1|  rac gtpase, putative                               343   2e-114   Ricinus communis
ref|XP_004505115.1|  PREDICTED: rac-like GTP-binding protein RAC1...    343   2e-114   
ref|XP_006305647.1|  hypothetical protein CARUB_v10010350mg             343   2e-114   
emb|CDY54338.1|  BnaCnng26840D                                          343   2e-114   
gb|ACI03398.1|  rac-like small GTP-binding protein                      342   2e-114   Scoparia dulcis [escobilla]
ref|XP_003539954.1|  PREDICTED: rac-like GTP-binding protein RAC2...    342   2e-114   
ref|XP_009418310.1|  PREDICTED: rac-like GTP-binding protein 5          342   2e-114   
ref|XP_010498441.1|  PREDICTED: rac-like GTP-binding protein ARAC5      342   2e-114   
ref|XP_010090337.1|  Rac-like GTP-binding protein ARAC3                 342   3e-114   
gb|AFK45598.1|  unknown                                                 342   3e-114   
emb|CDP01867.1|  unnamed protein product                                342   3e-114   
ref|XP_009794579.1|  PREDICTED: rac-like GTP-binding protein RAC13      342   3e-114   
sp|O04369.1|RAC1_LOTJA  RecName: Full=Rac-like GTP-binding protei...    342   3e-114   Lotus japonicus
ref|XP_010066279.1|  PREDICTED: rac-like GTP-binding protein 5 is...    342   3e-114   
ref|XP_009414443.1|  PREDICTED: rac-like GTP-binding protein 5          342   3e-114   
ref|XP_007136004.1|  hypothetical protein PHAVU_009G009800g             342   4e-114   
sp|Q41254.1|RAC9_GOSHI  RecName: Full=Rac-like GTP-binding protei...    342   4e-114   Gossypium hirsutum [American cotton]
ref|XP_002305518.1|  small GTPase Rac4 family protein                   342   4e-114   Populus trichocarpa [western balsam poplar]
ref|XP_008813511.1|  PREDICTED: rac-like GTP-binding protein 5          342   4e-114   
ref|XP_010920122.1|  PREDICTED: rac-like GTP-binding protein 5          342   5e-114   
ref|XP_006846898.1|  hypothetical protein AMTR_s00152p00020750          342   5e-114   
gb|AFK47488.1|  unknown                                                 342   5e-114   
ref|XP_008439788.1|  PREDICTED: rac-like GTP-binding protein RAC13      342   5e-114   
ref|XP_004134675.1|  PREDICTED: rac-like GTP-binding protein 7-like     342   5e-114   
ref|NP_001238503.1|  uncharacterized protein LOC100499696               341   6e-114   
ref|XP_008800174.1|  PREDICTED: rac-like GTP-binding protein 5          341   7e-114   
ref|NP_001242570.1|  uncharacterized protein LOC100805035               341   7e-114   
ref|XP_004231040.1|  PREDICTED: rac-like GTP-binding protein 5          341   7e-114   
gb|ABE11611.1|  Rac-like GTP-binding protein                            341   7e-114   Solanum chacoense
ref|XP_009409976.1|  PREDICTED: rac-like GTP-binding protein 5          341   7e-114   
gb|AFK47272.1|  unknown                                                 341   8e-114   
gb|AEQ62559.1|  Rac/Rop GTPase 2                                        341   8e-114   
ref|XP_007136003.1|  hypothetical protein PHAVU_009G009700g             341   8e-114   
pdb|2NTY|C  Chain C, Rop4-Gdp-Prone8                                    340   9e-114   
ref|XP_010533894.1|  PREDICTED: rac-like GTP-binding protein ARAC5      341   9e-114   
ref|XP_003570746.1|  PREDICTED: rac-like GTP-binding protein 5          341   9e-114   
ref|XP_011088603.1|  PREDICTED: rac-like GTP-binding protein 5 is...    341   9e-114   
ref|XP_009418766.1|  PREDICTED: rac-like GTP-binding protein 5          341   1e-113   
ref|XP_002306944.1|  small GTPase Rac4 family protein                   341   1e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002890370.1|  hypothetical protein ARALYDRAFT_472235             341   1e-113   
ref|XP_002301960.1|  RAC-like GTP binding protein ARAC4                 341   1e-113   Populus trichocarpa [western balsam poplar]
gb|AAD47828.2|  RAC-like G-protein Rac1                                 341   1e-113   Gossypium hirsutum [American cotton]
ref|NP_001290012.1|  rac-like GTP-binding protein RHO1                  340   1e-113   
ref|XP_004143001.1|  PREDICTED: rac-like GTP-binding protein RAC1...    340   1e-113   
gb|KFK42023.1|  hypothetical protein AALP_AA2G202200                    340   1e-113   
gb|KFK30140.1|  rac-like gtp-binding protein arac3                      340   1e-113   
ref|XP_009631777.1|  PREDICTED: rac-like GTP-binding protein 5          340   1e-113   
ref|XP_009107160.1|  PREDICTED: rac-like GTP-binding protein ARAC3      340   1e-113   
ref|XP_009614505.1|  PREDICTED: rac-like GTP-binding protein RHO1       340   1e-113   
ref|XP_009612580.1|  PREDICTED: rac-like GTP-binding protein RHO1       340   1e-113   
ref|XP_009591893.1|  PREDICTED: rac-like GTP-binding protein RAC13      340   2e-113   
ref|NP_177712.1|  Rac-like GTP-binding protein ARAC5                    340   2e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDO96719.1|  unnamed protein product                                340   2e-113   
ref|XP_010316434.1|  PREDICTED: rac-like GTP-binding protein RHO1       340   2e-113   
ref|NP_001240094.1|  uncharacterized protein LOC100798550               340   2e-113   
ref|XP_009612726.1|  PREDICTED: rac-like GTP-binding protein RHO1       340   2e-113   
ref|XP_010686365.1|  PREDICTED: rac-like GTP-binding protein RAC1...    340   2e-113   
ref|XP_010539844.1|  PREDICTED: rac-like GTP-binding protein ARAC5      340   2e-113   
ref|XP_009103358.1|  PREDICTED: rac-like GTP-binding protein ARAC4      340   2e-113   
ref|XP_011012556.1|  PREDICTED: rac-like GTP-binding protein RHO1...    340   3e-113   
ref|XP_006383072.1|  RAC-like GTP binding protein RHO1                  340   3e-113   
ref|XP_006340764.1|  PREDICTED: rac-like GTP-binding protein RHO1...    340   3e-113   
emb|CDX73206.1|  BnaC06g36540D                                          340   3e-113   
ref|XP_006343356.1|  PREDICTED: rac-like GTP-binding protein RHO1...    340   3e-113   
ref|NP_190698.1|  Rac-like GTP-binding protein ARAC11                   340   3e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010536416.1|  PREDICTED: rac-like GTP-binding protein ARAC5      340   3e-113   
emb|CAC83043.2|  RACB protein                                           340   3e-113   Hordeum vulgare [barley]
emb|CDY39066.1|  BnaA02g17550D                                          340   3e-113   
ref|XP_006425406.1|  hypothetical protein CICLE_v10026539mg             339   3e-113   
ref|XP_004155550.1|  PREDICTED: LOW QUALITY PROTEIN: rac-like GTP...    339   3e-113   
ref|XP_010459691.1|  PREDICTED: rac-like GTP-binding protein ARAC5      339   4e-113   
ref|XP_010234188.1|  PREDICTED: rac-like GTP-binding protein 7 is...    339   4e-113   
ref|NP_001236429.1|  uncharacterized protein LOC100527464               339   4e-113   
gb|KHG17559.1|  Rac-like GTP-binding protein 5                          340   4e-113   
ref|XP_010494753.1|  PREDICTED: rac-like GTP-binding protein ARAC...    339   4e-113   
ref|XP_007131710.1|  hypothetical protein PHAVU_011G035400g             339   4e-113   
ref|XP_002987330.1|  RHO family GTPase                                  339   4e-113   
ref|XP_009128141.1|  PREDICTED: rac-like GTP-binding protein ARAC5      339   5e-113   
dbj|BAJ53109.1|  JHL20J20.16                                            339   5e-113   
gb|EYU18077.1|  hypothetical protein MIMGU_mgv1a014213mg                339   5e-113   
ref|XP_009104695.1|  PREDICTED: rac-like GTP-binding protein ARAC5      339   5e-113   
ref|XP_002876081.1|  hypothetical protein ARALYDRAFT_906477             339   5e-113   
gb|KHN41616.1|  Rac-like GTP-binding protein RAC2                       339   5e-113   
ref|NP_001048639.1|  Os02g0834000                                       339   5e-113   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006390262.1|  hypothetical protein EUTSA_v10019171mg             339   6e-113   
gb|ABO15583.1|  LLP-Rop1                                                339   6e-113   Lilium longiflorum [Easter lily]
ref|XP_007202540.1|  hypothetical protein PRUPE_ppa011074mg             339   6e-113   
ref|NP_173437.1|  Rac-like GTP-binding protein ARAC4                    338   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010413444.1|  PREDICTED: rac-like GTP-binding protein ARAC1      339   7e-113   
ref|NP_001266008.1|  rac-like GTP-binding protein RAC1-like             339   7e-113   
ref|NP_195228.1|  Rac-like GTP-binding protein ARAC3                    339   7e-113   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC41518.1|  Rac GTPase                                             338   7e-113   Zinnia violacea [garden zinnia]
ref|XP_010692498.1|  PREDICTED: rac-like GTP-binding protein 5          338   8e-113   
ref|XP_010033515.1|  PREDICTED: rac-like GTP-binding protein RHO1       338   8e-113   
ref|XP_009106240.1|  PREDICTED: rac-like GTP-binding protein ARAC5      338   8e-113   
ref|XP_004147042.1|  PREDICTED: rac-like GTP-binding protein RAC1...    338   8e-113   
ref|XP_008393868.1|  PREDICTED: rac-like GTP-binding protein ARAC1      338   8e-113   
ref|XP_006409243.1|  hypothetical protein EUTSA_v10022861mg             338   8e-113   
ref|XP_010426684.1|  PREDICTED: rac-like GTP-binding protein ARAC11     338   8e-113   
ref|XP_007046638.1|  RAC-like 1 isoform 1                               338   8e-113   
ref|XP_010441646.1|  PREDICTED: rac-like GTP-binding protein ARAC...    338   8e-113   
gb|EPS66409.1|  hypothetical protein M569_08365                         338   8e-113   
ref|NP_199409.1|  Rac-like GTP-binding protein ARAC2                    338   9e-113   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57346.1|  BnaC02g47270D                                          338   1e-112   
ref|XP_002531163.1|  rac gtpase, putative                               338   1e-112   Ricinus communis
gb|KFK44134.1|  hypothetical protein AALP_AA1G219700                    338   1e-112   
ref|XP_011086021.1|  PREDICTED: rac-like GTP-binding protein RAC13      338   1e-112   
ref|XP_011099877.1|  PREDICTED: rac-like GTP-binding protein RHO1       338   1e-112   
ref|XP_010548268.1|  PREDICTED: rac-like GTP-binding protein ARAC11     338   1e-112   
gb|EYU30811.1|  hypothetical protein MIMGU_mgv1a014224mg                338   1e-112   
ref|XP_004146153.1|  PREDICTED: rac-like GTP-binding protein ARAC...    338   1e-112   
ref|XP_004234529.1|  PREDICTED: rac-like GTP-binding protein RHO1       338   1e-112   
ref|XP_006281127.1|  hypothetical protein CARUB_v10027157mg             338   1e-112   
ref|NP_001045712.1|  Os02g0120800                                       338   1e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009334760.1|  PREDICTED: rac-like GTP-binding protein RAC1       338   1e-112   
ref|XP_010490393.1|  PREDICTED: rac-like GTP-binding protein ARAC1      338   1e-112   
gb|KCW64122.1|  hypothetical protein EUGRSUZ_G01779                     338   1e-112   
ref|XP_010029661.1|  PREDICTED: rac-like GTP-binding protein RHO1       338   2e-112   
ref|XP_006412162.1|  hypothetical protein EUTSA_v10026291mg             338   2e-112   
gb|AAO42256.1|  putative Rho1Ps homolog Rac protein                     338   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296623.1|  hypothetical protein CARUB_v10014691mg             338   2e-112   
emb|CAA10815.2|  Rop subfamily GTPase                                   338   2e-112   Nicotiana tabacum [American tobacco]
ref|NP_001105615.1|  Rho-related protein from plants2                   338   2e-112   Zea mays [maize]
ref|XP_010113318.1|  Rac-like GTP-binding protein RHO1                  337   2e-112   
gb|ADY16660.1|  ROP6                                                    337   2e-112   
gb|EYU37952.1|  hypothetical protein MIMGU_mgv1a014150mg                338   2e-112   
gb|KHG13478.1|  Rac-like GTP-binding protein 5                          337   2e-112   
ref|NP_179371.1|  Rac-like GTP-binding protein ARAC1                    337   2e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011034995.1|  PREDICTED: rac-like GTP-binding protein ARAC5      337   2e-112   
ref|XP_008387924.1|  PREDICTED: rac-like GTP-binding protein ARAC5      337   2e-112   
gb|AGL44364.1|  Rop1                                                    337   2e-112   
gb|EYU40438.1|  hypothetical protein MIMGU_mgv1a014185mg                337   2e-112   
gb|KFK34371.1|  hypothetical protein AALP_AA5G136700                    337   2e-112   
ref|XP_007017852.1|  RAC-like 3                                         337   2e-112   
gb|AFK48298.1|  unknown                                                 338   2e-112   
gb|ABK22108.1|  unknown                                                 337   2e-112   Picea sitchensis
ref|NP_001232850.1|  rac-like GTP-binding protein 6                     337   2e-112   
gb|AHV83603.1|  ROP5                                                    337   3e-112   
ref|XP_004509382.1|  PREDICTED: rac-like GTP-binding protein RHO1...    337   3e-112   
ref|XP_003629271.1|  Rac-like GTP-binding protein                       337   3e-112   
gb|AAM18134.1|AF498358_1  small G-protein ROP6                          337   3e-112   Medicago truncatula
ref|XP_002865214.1|  hypothetical protein ARALYDRAFT_494381             337   3e-112   
ref|XP_004233565.1|  PREDICTED: rac-like GTP-binding protein ARAC1      337   3e-112   
ref|XP_010447010.1|  PREDICTED: rac-like GTP-binding protein ARAC3      337   3e-112   
ref|XP_010437541.1|  PREDICTED: rac-like GTP-binding protein ARAC3      337   3e-112   
gb|ABI84104.1|  GTP-binding Rop/Rac GTPase                              337   4e-112   Petunia integrifolia subsp. inflata
ref|XP_010481512.1|  PREDICTED: rac-like GTP-binding protein ARAC...    337   4e-112   
pdb|2WBL|C  Chain C, Three-Dimensional Structure Of A Binary Rop-...    336   4e-112   
ref|XP_009101554.1|  PREDICTED: rac-like GTP-binding protein ARAC2      337   4e-112   
ref|XP_003607186.1|  Rac-like GTP-binding protein                       337   4e-112   
emb|CAG30067.1|  small GTPase Rac4                                      337   4e-112   Medicago sativa [alfalfa]
gb|AAC78242.1|  Rho-like GTP binding protein                            337   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010531098.1|  PREDICTED: rac-like GTP-binding protein ARAC...    337   4e-112   
gb|AAB97458.1|  rac-like small GTP binding protein                      337   4e-112   Brassica rapa
gb|KFK40156.1|  hypothetical protein AALP_AA3G337500                    337   5e-112   
gb|KFK30229.1|  hypothetical protein AALP_AA7G234300                    337   5e-112   
ref|XP_002867045.1|  hypothetical protein ARALYDRAFT_491041             337   5e-112   
ref|XP_003573523.1|  PREDICTED: rac-like GTP-binding protein 6          337   5e-112   
ref|XP_010529177.1|  PREDICTED: rac-like GTP-binding protein ARAC2      337   5e-112   
gb|KFK36759.1|  hypothetical protein AALP_AA4G166100                    337   5e-112   
gb|AAX77217.1|  Rac3                                                    336   6e-112   Gossypium hirsutum [American cotton]
gb|AAB38780.1|  Rho1Ps homolog                                          337   6e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010515533.1|  PREDICTED: rac-like GTP-binding protein ARAC11     336   6e-112   
gb|EPS68917.1|  hypothetical protein M569_05854                         336   6e-112   
ref|XP_008221237.1|  PREDICTED: rac-like GTP-binding protein 5          336   6e-112   
emb|CDX77623.1|  BnaC07g18770D                                          336   8e-112   
gb|ACU23184.1|  unknown                                                 336   9e-112   Glycine max [soybeans]
pdb|3BWD|D  Chain D, Crystal Structure Of The Plant Rho Protein Rop5    335   1e-111   
ref|XP_009392892.1|  PREDICTED: rac-like GTP-binding protein 5          335   1e-111   
gb|EYU28034.1|  hypothetical protein MIMGU_mgv1a013747mg                336   1e-111   
ref|XP_009401490.1|  PREDICTED: rac-like GTP-binding protein 5          335   1e-111   
gb|AAD00114.1|  ATGP3                                                   335   1e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002313709.1|  hypothetical protein POPTR_0009s13700g             336   1e-111   Populus trichocarpa [western balsam poplar]
ref|XP_006412039.1|  hypothetical protein EUTSA_v10026296mg             335   1e-111   
ref|XP_008347346.1|  PREDICTED: rac-like GTP-binding protein ARAC5      335   1e-111   
ref|XP_008777981.1|  PREDICTED: rac-like GTP-binding protein RAC2...    336   2e-111   
ref|XP_004159725.1|  PREDICTED: LOW QUALITY PROTEIN: rac-like GTP...    335   2e-111   
gb|AAO11651.1|  putative ROP family GTPase                              335   2e-111   Brassica napus [oilseed rape]
ref|XP_009121201.1|  PREDICTED: rac-like GTP-binding protein ARAC3      335   2e-111   
gb|AFK35868.1|  unknown                                                 335   2e-111   
ref|XP_010446848.1|  PREDICTED: rac-like GTP-binding protein ARAC6      335   2e-111   
ref|NP_195320.1|  Rac-like GTP-binding protein ARAC6                    335   2e-111   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006838484.1|  hypothetical protein AMTR_s00002p00158490          335   3e-111   
gb|AFK46528.1|  unknown                                                 334   3e-111   
ref|XP_010547413.1|  PREDICTED: rac-like GTP-binding protein ARAC...    335   3e-111   
emb|CAI84892.1|  putative Rho GTPase                                    335   3e-111   
ref|XP_011078976.1|  PREDICTED: rac-like GTP-binding protein RHO1       335   3e-111   
ref|XP_009136611.1|  PREDICTED: rac-like GTP-binding protein RHO1       334   3e-111   
ref|XP_009786997.1|  PREDICTED: rac-like GTP-binding protein 5          334   3e-111   
emb|CDY26832.1|  BnaC09g09590D                                          334   3e-111   
ref|XP_009128832.1|  PREDICTED: rac-like GTP-binding protein ARAC...    335   3e-111   
ref|XP_007223496.1|  hypothetical protein PRUPE_ppa011760mg             334   3e-111   
gb|AFK37671.1|  unknown                                                 334   4e-111   
ref|NP_001239863.1|  uncharacterized protein LOC100808748               334   4e-111   
gb|ABB71820.1|  Rho                                                     334   5e-111   
ref|XP_009121076.1|  PREDICTED: rac-like GTP-binding protein ARAC1      334   5e-111   
emb|CAI84890.1|  putative Rho GTPase                                    334   5e-111   
ref|XP_009408223.1|  PREDICTED: rac-like GTP-binding protein 5          334   5e-111   
ref|XP_009124572.1|  PREDICTED: rac-like GTP-binding protein ARAC1      334   5e-111   
ref|XP_009112460.1|  PREDICTED: rac-like GTP-binding protein ARAC1      334   6e-111   
ref|XP_009148517.1|  PREDICTED: rac-like GTP-binding protein ARAC6      333   6e-111   
ref|XP_010432207.1|  PREDICTED: rac-like GTP-binding protein ARAC6      333   7e-111   
gb|AFK47345.1|  unknown                                                 333   7e-111   
ref|XP_003547918.1|  PREDICTED: rac-like GTP-binding protein RHO1...    333   7e-111   
emb|CDY30344.1|  BnaA09g09330D                                          333   7e-111   
gb|AEN71048.1|  small GTPase RacB                                       333   8e-111   
gb|AEN71041.1|  small GTPase RacB                                       333   8e-111   
gb|KDP23992.1|  hypothetical protein JCGZ_25380                         333   9e-111   
ref|XP_009115809.1|  PREDICTED: rac-like GTP-binding protein RHO1       333   9e-111   
gb|AEN71050.1|  small GTPase RacB                                       333   1e-110   
ref|XP_007156181.1|  hypothetical protein PHAVU_003G265200g             333   1e-110   
ref|XP_003612214.1|  Rac-like GTP-binding protein                       333   1e-110   
gb|AAO11655.2|  putative ROP family GTPase                              333   1e-110   
ref|XP_006409399.1|  hypothetical protein EUTSA_v10022857mg             333   1e-110   
ref|XP_010548095.1|  PREDICTED: rac-like GTP-binding protein ARAC3      333   1e-110   
ref|XP_003520161.1|  PREDICTED: rac-like GTP-binding protein RHO1...    333   1e-110   
gb|EPS58180.1|  hypothetical protein M569_16636                         333   1e-110   
gb|AAO11654.1|  putative ROP family GTPase                              333   2e-110   
ref|XP_009138399.1|  PREDICTED: rac-like GTP-binding protein ARAC1      332   2e-110   
gb|KHN36014.1|  Rac-like GTP-binding protein RHO1                       332   2e-110   
gb|ACJ84144.1|  unknown                                                 332   2e-110   
gb|KHG11405.1|  Rac-like GTP-binding protein ARAC11                     332   2e-110   
ref|XP_006646799.1|  PREDICTED: rac-like GTP-binding protein 6-like     332   3e-110   
gb|AAC32124.1|  Rac-like GTP binding protein                            332   3e-110   
gb|AAO11652.1|  putative ROP family GTPase                              332   3e-110   
emb|CAI84891.1|  putative Rho GTPase                                    332   4e-110   
emb|CDX69188.1|  BnaC01g02650D                                          332   4e-110   
ref|XP_007157892.1|  hypothetical protein PHAVU_002G106600g             332   4e-110   
emb|CDY67441.1|  BnaA02g36630D                                          332   4e-110   
gb|AAO11650.1|  putative ROP family GTPase                              332   4e-110   
gb|AAO11653.2|  putative ROP family GTPase                              332   4e-110   
emb|CDY57592.1|  BnaAnng14680D                                          332   4e-110   
emb|CDX90652.1|  BnaA03g41290D                                          332   5e-110   
gb|AAF26755.1|AC007396_4  T4O12.8                                       332   7e-110   
emb|CAB62075.1|  rac G-Protein                                          331   8e-110   
ref|XP_009149173.1|  PREDICTED: rac-like GTP-binding protein RHO1       331   8e-110   
ref|XP_010557582.1|  PREDICTED: rac-like GTP-binding protein ARAC...    331   9e-110   
ref|XP_010538560.1|  PREDICTED: rac-like GTP-binding protein ARAC2      331   1e-109   
ref|XP_006398281.1|  hypothetical protein EUTSA_v10001030mg             331   1e-109   
gb|ADD23346.1|  rac-type small GTP-binding protein                      330   1e-109   
ref|XP_002884086.1|  hypothetical protein ARALYDRAFT_480678             330   3e-109   
ref|XP_009607499.1|  PREDICTED: rac-like GTP-binding protein 5          330   3e-109   
ref|XP_010530897.1|  PREDICTED: rac-like GTP-binding protein ARAC3      329   3e-109   
ref|XP_002262953.1|  PREDICTED: rac-like GTP-binding protein ARAC1      329   3e-109   
gb|KHG28000.1|  Rac-like GTP-binding protein ARAC3                      328   1e-108   
emb|CDX69104.1|  BnaC01g03490D                                          328   1e-108   
ref|XP_009395354.1|  PREDICTED: rac-like GTP-binding protein 5          327   2e-108   
ref|XP_006376407.1|  hypothetical protein POPTR_0013s12760g             325   5e-108   
ref|XP_011093501.1|  PREDICTED: rac-like GTP-binding protein 5          325   2e-107   
ref|NP_001167695.1|  rac-like GTP-binding protein 4                     325   5e-107   
dbj|BAC41517.1|  Rac small GTPase                                       324   5e-107   
ref|XP_010913538.1|  PREDICTED: rac-like GTP-binding protein 3 is...    323   7e-107   
ref|XP_010274525.1|  PREDICTED: rac-like GTP-binding protein RAC2       323   8e-107   
ref|XP_006647206.1|  PREDICTED: rac-like GTP-binding protein 7-li...    324   1e-106   
ref|NP_001105737.1|  Rho-related protein from plants 5                  323   1e-106   
ref|XP_009391172.1|  PREDICTED: ras and EF-hand domain-containing...    344   1e-106   
ref|XP_010095528.1|  Vacuolar protein sorting-associated protein 35B    347   1e-106   
emb|CDY20828.1|  BnaC07g06770D                                          323   1e-106   
emb|CDX72568.1|  BnaC07g45900D                                          337   1e-106   
ref|XP_009391245.1|  PREDICTED: rac-like GTP-binding protein 3          323   1e-106   
ref|XP_006647874.1|  PREDICTED: rac-like GTP-binding protein 3-like     323   2e-106   
ref|XP_010913537.1|  PREDICTED: rac-like GTP-binding protein 3 is...    323   2e-106   
ref|XP_002436763.1|  hypothetical protein SORBIDRAFT_10g008380          323   2e-106   
gb|AEQ62558.1|  Rac/Rop GTPase 1                                        323   2e-106   
ref|XP_010318920.1|  PREDICTED: rac-like GTP-binding protein 3 is...    322   2e-106   
ref|XP_011028604.1|  PREDICTED: rac-like GTP-binding protein ARAC8      322   3e-106   
ref|XP_009601098.1|  PREDICTED: rac-like GTP-binding protein 3 is...    322   3e-106   
ref|XP_004133975.1|  PREDICTED: rac-like GTP-binding protein 7-like     322   3e-106   
ref|XP_008780935.1|  PREDICTED: rac-like GTP-binding protein 3          322   3e-106   
ref|NP_001048088.1|  Os02g0742200                                       322   4e-106   
ref|XP_009786167.1|  PREDICTED: rac-like GTP-binding protein 3 is...    322   4e-106   
ref|XP_010037588.1|  PREDICTED: rac-like GTP-binding protein 3          322   4e-106   
emb|CAD27896.1|  putative ROP4 protein                                  322   4e-106   
ref|XP_010928578.1|  PREDICTED: rac-like GTP-binding protein 3 is...    322   5e-106   
ref|XP_008659034.1|  PREDICTED: rho-related protein from plants 5...    325   5e-106   
ref|XP_010272004.1|  PREDICTED: rac-like GTP-binding protein 3          322   5e-106   
ref|XP_009406225.1|  PREDICTED: rac-like GTP-binding protein 2 is...    322   6e-106   
dbj|BAJ90768.1|  predicted protein                                      322   7e-106   
ref|XP_004965072.1|  PREDICTED: rac-like GTP-binding protein 4-like     322   7e-106   
ref|XP_002269907.1|  PREDICTED: rac-like GTP-binding protein 5          321   8e-106   
ref|XP_011015598.1|  PREDICTED: rac-like GTP-binding protein 3          321   8e-106   
ref|XP_009406224.1|  PREDICTED: rac-like GTP-binding protein ARAC...    321   8e-106   
ref|XP_009416501.1|  PREDICTED: rac-like GTP-binding protein 2          321   9e-106   
ref|XP_002452568.1|  hypothetical protein SORBIDRAFT_04g028280          321   1e-105   
ref|XP_007036140.1|  Rac-like GTP-binding protein 3 isoform 2           321   1e-105   
ref|XP_010494754.1|  PREDICTED: rac-like GTP-binding protein ARAC...    319   1e-105   
gb|AFW78696.1|  hypothetical protein ZEAMMB73_559671                    320   1e-105   
ref|XP_010524446.1|  PREDICTED: rac-like GTP-binding protein RAC1...    320   1e-105   
ref|XP_002322155.2|  hypothetical protein POPTR_0015s08420g             322   1e-105   
ref|XP_004307251.1|  PREDICTED: rac-like GTP-binding protein 7-like     320   1e-105   
gb|AAF43430.1|AF233447_1  rac 4 protein                                 320   1e-105   
ref|NP_001057236.1|  Os06g0234200                                       321   1e-105   
ref|XP_011044337.1|  PREDICTED: rac-like GTP-binding protein ARAC8      320   1e-105   
ref|XP_006345032.1|  PREDICTED: rac-like GTP-binding protein 3-li...    320   2e-105   
ref|XP_010111536.1|  Rac-like GTP-binding protein 3                     320   2e-105   
ref|XP_004229725.1|  PREDICTED: rac-like GTP-binding protein 5          320   2e-105   
ref|XP_002511439.1|  rac gtpase, putative                               320   2e-105   
ref|NP_001105134.1|  rop6 protein                                       320   2e-105   
gb|EAY87489.1|  hypothetical protein OsI_08896                          321   2e-105   
ref|XP_004961513.1|  PREDICTED: rac-like GTP-binding protein 2-like     320   2e-105   
gb|ADD23345.1|  putative small GTP-binding protein                      320   2e-105   
ref|NP_001104929.1|  Rho-related protein from plants 1                  320   2e-105   
emb|CAD57742.1|  RAC-ROP-like G-protein                                 320   2e-105   
ref|XP_006435211.1|  hypothetical protein CICLE_v10002551mg             318   2e-105   
ref|XP_010441647.1|  PREDICTED: rac-like GTP-binding protein ARAC...    318   2e-105   
ref|XP_010066280.1|  PREDICTED: rac-like GTP-binding protein 5 is...    319   2e-105   
ref|XP_008793880.1|  PREDICTED: rac-like GTP-binding protein RAC1       320   3e-105   
ref|XP_007052386.1|  RAC-like 9 isoform 1                               320   3e-105   
ref|XP_006836715.1|  hypothetical protein AMTR_s00088p00117460          319   3e-105   
ref|XP_010254450.1|  PREDICTED: rac-like GTP-binding protein 3 is...    319   3e-105   
ref|XP_010231171.1|  PREDICTED: rac-like GTP-binding protein 2          320   4e-105   
ref|XP_006439765.1|  hypothetical protein CICLE_v10022245mg             320   4e-105   
ref|XP_009407248.1|  PREDICTED: rac-like GTP-binding protein 3          319   4e-105   
ref|XP_003570667.1|  PREDICTED: rac-like GTP-binding protein 3          319   5e-105   
gb|ADW83710.1|  Rho-like protein 1                                      319   5e-105   
emb|CAD27894.1|  putative ROP6 protein                                  319   6e-105   
ref|XP_007211210.1|  hypothetical protein PRUPE_ppa011421mg             319   6e-105   
ref|XP_008438307.1|  PREDICTED: rac-like GTP-binding protein RAC2       318   6e-105   
ref|XP_011012551.1|  PREDICTED: rac-like GTP-binding protein RHO1...    320   6e-105   
ref|XP_008793848.1|  PREDICTED: LOW QUALITY PROTEIN: rac-like GTP...    320   6e-105   
ref|XP_010920642.1|  PREDICTED: rac-like GTP-binding protein 2 is...    319   6e-105   
ref|XP_011071815.1|  PREDICTED: rac-like GTP-binding protein 3 is...    319   6e-105   
ref|XP_008393056.1|  PREDICTED: rac-like GTP-binding protein ARAC8      319   7e-105   
ref|XP_002440067.1|  hypothetical protein SORBIDRAFT_09g025400          319   7e-105   
emb|CDP16997.1|  unnamed protein product                                318   8e-105   
gb|KDO69733.1|  hypothetical protein CISIN_1g028362mg                   318   9e-105   
ref|XP_010052779.1|  PREDICTED: rac-like GTP-binding protein 5          318   9e-105   
ref|XP_010550661.1|  PREDICTED: rac-like GTP-binding protein ARAC10     318   1e-104   
ref|XP_010915861.1|  PREDICTED: rac-like GTP-binding protein 2 is...    318   1e-104   
ref|XP_006375184.1|  RAC-like GTP binding protein ARAC9                 318   1e-104   
gb|ABG66964.1|  small GTPase                                            318   1e-104   
ref|XP_004953886.1|  PREDICTED: rac-like GTP-binding protein 3-like     318   1e-104   
ref|XP_009782450.1|  PREDICTED: rac-like GTP-binding protein 5          318   1e-104   
ref|XP_010481513.1|  PREDICTED: rac-like GTP-binding protein ARAC...    317   1e-104   
ref|XP_010254444.1|  PREDICTED: rac-like GTP-binding protein 3 is...    318   1e-104   
gb|AEN71011.1|  small GTPase RacA                                       318   1e-104   
ref|XP_006476738.1|  PREDICTED: rac-like GTP-binding protein 3-like     318   1e-104   
ref|NP_001105523.1|  Rho-related protein from plants 7                  318   2e-104   
gb|ADW83711.1|  Rho-like protein 1                                      318   2e-104   
gb|KFK37274.1|  hypothetical protein AALP_AA4G235800                    318   2e-104   
ref|XP_008789319.1|  PREDICTED: rac-like GTP-binding protein ARAC7      318   2e-104   
ref|XP_010915860.1|  PREDICTED: rac-like GTP-binding protein 2 is...    319   2e-104   
gb|AAF43923.1|AF239751_1  Rac-like protein Rop1                         317   2e-104   
ref|XP_010249660.1|  PREDICTED: rac-like GTP-binding protein ARAC7      317   3e-104   
gb|KDP31135.1|  hypothetical protein JCGZ_11511                         317   3e-104   
ref|NP_001105063.1|  GTPase protein                                     317   3e-104   
ref|XP_011087157.1|  PREDICTED: rac-like GTP-binding protein ARAC8      317   4e-104   
ref|XP_009415229.1|  PREDICTED: rac-like GTP-binding protein 2          317   4e-104   
ref|XP_006655950.1|  PREDICTED: rac-like GTP-binding protein 4-like     317   4e-104   
ref|XP_004299574.1|  PREDICTED: rac-like GTP-binding protein 3-like     317   4e-104   
ref|XP_006451199.1|  hypothetical protein CICLE_v10009470mg             317   5e-104   
ref|XP_009112040.1|  PREDICTED: rac-like GTP-binding protein ARAC...    317   5e-104   
emb|CDY00332.1|  BnaA06g22330D                                          317   5e-104   
emb|CDY71169.1|  BnaA05g34500D                                          317   5e-104   
ref|XP_009622990.1|  PREDICTED: rac-like GTP-binding protein RAC2       317   5e-104   
ref|XP_009112039.1|  PREDICTED: rac-like GTP-binding protein ARAC...    317   6e-104   
emb|CDY56740.1|  BnaC09g50900D                                          317   6e-104   
ref|XP_008453112.1|  PREDICTED: rac-like GTP-binding protein ARAC8      316   7e-104   
gb|ADY68833.1|  small GTPase                                            316   7e-104   
gb|AAX77218.1|  Rac2                                                    316   7e-104   
ref|XP_002284205.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   7e-104   
ref|XP_010254054.1|  PREDICTED: rac-like GTP-binding protein ARAC7      316   8e-104   
ref|XP_010459411.1|  PREDICTED: rac-like GTP-binding protein ARAC10     316   9e-104   
gb|EYU29925.1|  hypothetical protein MIMGU_mgv1a013827mg                316   9e-104   
emb|CDP09403.1|  unnamed protein product                                316   9e-104   
ref|XP_010656299.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   1e-103   
emb|CDY48250.1|  BnaC04g05090D                                          316   1e-103   
gb|ADY68836.1|  small GTPase                                            316   1e-103   
ref|XP_010503427.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   1e-103   
emb|CAN60154.1|  hypothetical protein VITISV_021505                     315   1e-103   
ref|XP_006281091.1|  hypothetical protein CARUB_v10027121mg             316   1e-103   
ref|NP_201093.1|  Rac-like GTP-binding protein ARAC10                   316   1e-103   
ref|XP_006394342.1|  hypothetical protein EUTSA_v10004903mg             316   1e-103   
ref|XP_010515117.1|  PREDICTED: rac-like GTP-binding protein ARAC...    315   1e-103   
gb|AFW69864.1|  hypothetical protein ZEAMMB73_592329                    315   1e-103   
ref|XP_008783259.1|  PREDICTED: rac-like GTP-binding protein 2          315   1e-103   
ref|XP_009130238.1|  PREDICTED: rac-like GTP-binding protein ARAC...    316   1e-103   
gb|KCW53193.1|  hypothetical protein EUGRSUZ_J02468                     314   1e-103   
gb|AEN71013.1|  small GTPase RacA                                       315   1e-103   
ref|XP_004513008.1|  PREDICTED: rac-like GTP-binding protein ARAC...    315   1e-103   
ref|XP_006390261.1|  hypothetical protein EUTSA_v10019171mg             314   1e-103   
ref|XP_009130239.1|  PREDICTED: rac-like GTP-binding protein ARAC...    315   1e-103   
ref|XP_007052387.1|  RAC-like 9 isoform 2                               315   2e-103   
ref|XP_009375402.1|  PREDICTED: rac-like GTP-binding protein RAC2       315   2e-103   
ref|XP_002526481.1|  rac gtpase, putative                               315   2e-103   
ref|XP_004138120.1|  PREDICTED: rac-like GTP-binding protein 3-like     315   2e-103   
ref|XP_009151409.1|  PREDICTED: rac-like GTP-binding protein ARAC10     316   2e-103   
ref|NP_001056030.1|  Os05g0513800                                       315   2e-103   
ref|XP_002283394.1|  PREDICTED: rac-like GTP-binding protein 3          315   2e-103   
ref|XP_006654640.1|  PREDICTED: rac-like GTP-binding protein 2-like     315   2e-103   
gb|KHN48613.1|  Rac-like GTP-binding protein 3                          315   2e-103   
ref|XP_010508264.1|  PREDICTED: rac-like GTP-binding protein ARAC...    315   2e-103   
ref|XP_006284560.1|  hypothetical protein CARUB_v10005781mg             313   2e-103   
ref|XP_010506399.1|  PREDICTED: rac-like GTP-binding protein ARAC9      315   2e-103   
ref|XP_011093614.1|  PREDICTED: rac-like GTP-binding protein ARAC...    314   3e-103   
ref|XP_009143058.1|  PREDICTED: rac-like GTP-binding protein ARAC9      315   3e-103   
emb|CDY45748.1|  BnaC02g42340D                                          315   3e-103   
ref|XP_009379967.1|  PREDICTED: rac-like GTP-binding protein 3 is...    314   3e-103   
gb|EPS61580.1|  hypothetical protein M569_13212                         314   4e-103   
gb|ADY68837.1|  small GTPase                                            314   4e-103   
gb|KCW83424.1|  hypothetical protein EUGRSUZ_B00349                     314   4e-103   
ref|XP_010928577.1|  PREDICTED: rac-like GTP-binding protein 3 is...    315   4e-103   
ref|XP_008242576.1|  PREDICTED: rac-like GTP-binding protein ARAC...    314   4e-103   
ref|XP_008242578.1|  PREDICTED: rac-like GTP-binding protein ARAC...    314   5e-103   



>gb|KDP31764.1| hypothetical protein JCGZ_12225 [Jatropha curcas]
Length=196

 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPVVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+L++HPGATPITT+QGEELKKMIGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQYLIDHPGATPITTSQGEELKKMIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002278788.1| PREDICTED: rac-like GTP-binding protein RAC2 [Vitis vinifera]
 emb|CBI21938.3| unnamed protein product [Vitis vinifera]
Length=196

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQFL++HPGATPITTAQGE+LKKMIGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFLIDHPGATPITTAQGEDLKKMIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010904883.1| PREDICTED: rac-like GTP-binding protein RAC13 [Elaeis guineensis]
Length=197

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/179 (94%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +1

Query  319  IMTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLW  498
            +M+TARFIKCVTVGDGAVGKTCMLI YTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLW
Sbjct  1    MMSTARFIKCVTVGDGAVGKTCMLICYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLW  60

Query  499  DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTK  678
            DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTK
Sbjct  61   DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPNVPIVLVGTK  120

Query  679  LDLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            LDLRDDKQFL++HPGATPITTAQGEELK+MIGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  LDLRDDKQFLIDHPGATPITTAQGEELKRMIGAAGYIECSSKTQQNVKAVFDAAIKVVL  179



>ref|XP_002525151.1| rac gtpase, putative [Ricinus communis]
 gb|EEF37278.1| rac gtpase, putative [Ricinus communis]
Length=197

 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKW+PELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWVPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+L++HPGATPIT AQGEELKKM+GAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQYLIDHPGATPITAAQGEELKKMVGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_008455937.1| PREDICTED: rac-like GTP-binding protein RAC2 [Cucumis melo]
Length=196

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVMVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA PITTAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFLTSHPGAVPITTAQGEELKKSIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_004151903.1| PREDICTED: rac-like GTP-binding protein 7-like [Cucumis sativus]
 ref|XP_004172211.1| PREDICTED: rac-like GTP-binding protein 7-like [Cucumis sativus]
 gb|KGN63214.1| hypothetical protein Csa_2G415560 [Cucumis sativus]
Length=196

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA PITTAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFLTSHPGAVPITTAQGEELKKSIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007153887.1| hypothetical protein PHAVU_003G073300g [Phaseolus vulgaris]
 gb|ESW25881.1| hypothetical protein PHAVU_003G073300g [Phaseolus vulgaris]
Length=196

 Score =   352 bits (902),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV+VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVTVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL +SLISKASYEN+SKKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCYSLISKASYENISKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGAT ITTAQGEELKKMIGA TYIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLRDDKQFLIDHPGATRITTAQGEELKKMIGAVTYIECSSKTQQNVKTVFDAAIKVAL  178



>ref|XP_004303136.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Fragaria vesca 
subsp. vesca]
Length=196

 Score =   352 bits (902),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+L++HPGATPI+TAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQYLIDHPGATPISTAQGEELKKTIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006446737.1| hypothetical protein CICLE_v10016797mg [Citrus clementina]
 ref|XP_006469057.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Citrus sinensis]
 gb|ESR59977.1| hypothetical protein CICLE_v10016797mg [Citrus clementina]
 gb|KDO45764.1| hypothetical protein CISIN_1g029177mg [Citrus sinensis]
Length=197

 Score =   352 bits (902),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  319  IMTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLW  498
            +M TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLW
Sbjct  1    MMNTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLW  60

Query  499  DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTK  678
            DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTK
Sbjct  61   DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTK  120

Query  679  LDLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
             DLR+DKQ+L+NHPGATPITTAQGEELKK+IGAA YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  QDLREDKQYLINHPGATPITTAQGEELKKLIGAAVYIECSSKTQQNVKTVFDAAIKVVL  179



>ref|XP_002277471.1| PREDICTED: rac-like GTP-binding protein RAC13 [Vitis vinifera]
Length=197

 Score =   352 bits (902),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/176 (94%), Positives = 172/176 (98%), Gaps = 0/176 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKV  849
            DLRDDKQ+L+NHPGATPI++AQGEELKKMIGA TYIECSSKTQQNVKAVFD AIKV
Sbjct  121  DLRDDKQYLINHPGATPISSAQGEELKKMIGAVTYIECSSKTQQNVKAVFDIAIKV  176



>ref|XP_010279207.1| PREDICTED: rac-like GTP-binding protein RAC2 [Nelumbo nucifera]
Length=196

 Score =   352 bits (902),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQFL++HPGATPITTAQGEELKK IGAA YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLREDKQFLIDHPGATPITTAQGEELKKAIGAAVYIECSSKTQQNVKTVFDAAIKVVL  178



>ref|XP_008778044.1| PREDICTED: rac-like GTP-binding protein RAC2 isoform X2 [Phoenix 
dactylifera]
Length=196

 Score =   351 bits (901),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARF+KCVTVGDGAVGKTCMLI YTSNTFPTDYVPTVFDNFSANV  DGSTVNLGLWD
Sbjct  1    MTTARFVKCVTVGDGAVGKTCMLICYTSNTFPTDYVPTVFDNFSANVVADGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYEN+ +KWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENIYRKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGA PITTAQGEELKKMIGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFLIDHPGAAPITTAQGEELKKMIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006376405.1| hypothetical protein POPTR_0013s12760g [Populus trichocarpa]
 ref|XP_011037428.1| PREDICTED: rac-like GTP-binding protein RAC2 [Populus euphratica]
 gb|ABK92572.1| unknown [Populus trichocarpa]
 gb|ERP54202.1| hypothetical protein POPTR_0013s12760g [Populus trichocarpa]
Length=197

 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWI ELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWISELRHYAPTVPVVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L++HPGATPITTAQGEELKKMIGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRNDKQYLIDHPGATPITTAQGEELKKMIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>sp|Q41253.1|RAC13_GOSHI RecName: Full=Rac-like GTP-binding protein RAC13; Flags: Precursor 
[Gossypium hirsutum]
 gb|AAB35093.1| pea Rho1 protein homolog/mammalian rac protein homolog [Gossypium 
hirsutum]
Length=196

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYA NVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAHNVPVVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGATPI+T+QGEELKKMIGA TYIECSSKTQQNVKAVFDAAIKV L
Sbjct  121  DLRDDKQFLIDHPGATPISTSQGEELKKMIGAVTYIECSSKTQQNVKAVFDAAIKVAL  178



>ref|XP_008784446.1| PREDICTED: rac-like GTP-binding protein 7 [Phoenix dactylifera]
Length=196

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGATPIT +QGEELKK+IGAA YIECSSKTQQNVKAVFD AIK+VL
Sbjct  121  DLRDDKQFLIDHPGATPITASQGEELKKLIGAAVYIECSSKTQQNVKAVFDVAIKLVL  178



>ref|XP_009421478.1| PREDICTED: rac-like GTP-binding protein 7 [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVIVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL SKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLTSKASYENIYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGATPITTAQGEELKKMIGAA Y ECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGATPITTAQGEELKKMIGAAVYTECSSKTQQNVKAVFDAAIKVVL  178



>gb|AFK44689.1| unknown [Lotus japonicus]
Length=196

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL FSLISKASYEN+SKKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCFSLISKASYENISKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGAT ITTAQGEELKK+IGA TYIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLRDDKQFLIDHPGATRITTAQGEELKKLIGAVTYIECSSKTQQNVKVVFDAAIKVAL  178



>ref|XP_006852540.1| hypothetical protein AMTR_s00021p00186910 [Amborella trichopoda]
 gb|ERN14007.1| hypothetical protein AMTR_s00021p00186910 [Amborella trichopoda]
Length=197

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  319  IMTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLW  498
            +M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLW
Sbjct  1    MMSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLW  60

Query  499  DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTK  678
            DTAGQEDYNRLRPLSYRGADVFLLAFSLISK SYEN+SKKWIPELRHYAP VP+VLVGTK
Sbjct  61   DTAGQEDYNRLRPLSYRGADVFLLAFSLISKPSYENISKKWIPELRHYAPTVPIVLVGTK  120

Query  679  LDLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            LDLR+DKQF ++HPGATPITTAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVV+
Sbjct  121  LDLREDKQFFIDHPGATPITTAQGEELKKQIGAAMYIECSSKTQQNVKAVFDAAIKVVM  179



>ref|XP_010035828.1| PREDICTED: rac-like GTP-binding protein RAC2 [Eucalyptus grandis]
 gb|KCW47290.1| hypothetical protein EUGRSUZ_K01081 [Eucalyptus grandis]
Length=198

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/198 (88%), Positives = 187/198 (94%), Gaps = 0/198 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPTVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVLqp  861
            DLR+D+ +L+NHPGATPITT QGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVLQP
Sbjct  121  DLREDRHYLINHPGATPITTVQGEELKKNIGAAAYIECSSKTQQNVKAVFDAAIKVVLQP  180

Query  862  pkpkrkqrrkssrrCVFL  915
            PKPK+K+R+     C+FL
Sbjct  181  PKPKKKRRKARPSSCIFL  198



>ref|XP_003540385.1| PREDICTED: rac-like GTP-binding protein RAC2-like isoform X1 
[Glycine max]
 ref|XP_006592858.1| PREDICTED: rac-like GTP-binding protein RAC2-like isoform X2 
[Glycine max]
 gb|KHN27920.1| Rac-like GTP-binding protein RAC2 [Glycine soja]
Length=196

 Score =   350 bits (897),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGATPITTAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGATPITTAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AAW78687.1| small GTP-binding protein ROP1 [Vigna radiata]
Length=196

 Score =   350 bits (897),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV+VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVTVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL +SLISKASYEN+SKKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCYSLISKASYENISKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPG T ITTAQGEELKKMIGA TYIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLRDDKQFLIDHPGGTRITTAQGEELKKMIGAVTYIECSSKTQQNVKTVFDAAIKVAL  178



>gb|KCW55525.1| hypothetical protein EUGRSUZ_I01414 [Eucalyptus grandis]
Length=229

 Score =   351 bits (900),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP +P++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGIPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEELKK+IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFLDHPGAVPITTAQGEELKKLIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>sp|Q40220.1|RAC2_LOTJA RecName: Full=Rac-like GTP-binding protein RAC2; Flags: Precursor 
[Lotus japonicus]
 emb|CAA98190.1| RAC2 [Lotus japonicus]
Length=196

 Score =   349 bits (895),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGATPITTAQGEELKK IGAA Y+ECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGATPITTAQGEELKKAIGAAVYLECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010916043.1| PREDICTED: rac-like GTP-binding protein RAC13 [Elaeis guineensis]
Length=196

 Score =   348 bits (894),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGATPITT+QGE+LK++IGAA YIECSSKTQQNVK VFDAAIK+V+
Sbjct  121  DLRDDKQFLIDHPGATPITTSQGEDLKRLIGAAVYIECSSKTQQNVKVVFDAAIKLVI  178



>ref|XP_010028726.1| PREDICTED: rac-like GTP-binding protein 5 [Eucalyptus grandis]
Length=198

 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP +P++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGIPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEELKK+IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFLDHPGAVPITTAQGEELKKLIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007149793.1| hypothetical protein PHAVU_005G099100g [Phaseolus vulgaris]
 gb|ESW21787.1| hypothetical protein PHAVU_005G099100g [Phaseolus vulgaris]
Length=196

 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGST+NLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGATPI+TAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGATPISTAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_003529357.1| PREDICTED: rac-like GTP-binding protein 7-like [Glycine max]
Length=196

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV+VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVTVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL +SLISKASYEN+SKKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCYSLISKASYENISKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPG+  ITTAQGEELKKMIGA TYIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLRDDKQFLIDHPGSARITTAQGEELKKMIGAVTYIECSSKTQQNVKTVFDAAIKVAL  178



>gb|ADE75718.1| unknown [Picea sitchensis]
 gb|ADE76598.1| unknown [Picea sitchensis]
Length=196

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAPNVP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPNVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITT QGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFADHPGAAPITTPQGEELKKQIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>sp|Q6EP31.2|RAC5_ORYSJ RecName: Full=Rac-like GTP-binding protein 5; AltName: Full=GTPase 
protein RacD; AltName: Full=OsRac5; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|AAF28764.1|AF218381_1 small GTP binding protein RACDP [Oryza sativa Japonica Group]
 gb|AAK27450.1|AF329814_1 small GTP binding protein RACDP [Oryza sativa Japonica Group]
 dbj|BAD28463.1| putative RacD protein [Oryza sativa Japonica Group]
 dbj|BAD29588.1| putative RacD protein [Oryza sativa Japonica Group]
 dbj|BAG90452.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74314.1| hypothetical protein OsI_09587 [Oryza sativa Indica Group]
 gb|EEE58123.1| hypothetical protein OsJ_09018 [Oryza sativa Japonica Group]
Length=197

 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEEL+K+IGAA YIECSSKTQQN+KAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVL  178



>ref|XP_009404415.1| PREDICTED: rac-like GTP-binding protein RAC2 [Musa acuminata 
subsp. malaccensis]
Length=196

 Score =   348 bits (892),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSN FPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNIFPTDYVPTVFDNFSANVIVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV KKWIPELRHYAPNVP+VLVGTK+
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVYKKWIPELRHYAPNVPIVLVGTKI  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+QF+++HPG TPIT AQGEELKKMIGAA YIECSSKTQQNVKAVFDAAIKVV+
Sbjct  121  DLREDRQFIIDHPGTTPITIAQGEELKKMIGAAVYIECSSKTQQNVKAVFDAAIKVVI  178



>gb|AAF43429.1|AF233446_1 rac 1 protein [Physcomitrella patens]
Length=186

 Score =   347 bits (890),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP+VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITT+QGEEL+K IGAA+YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFADHPGAAPITTSQGEELRKSIGAASYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|ACF83636.1| unknown [Zea mays]
 gb|ACG40961.1| rac-like GTP-binding protein 5 [Zea mays]
 gb|AFW74173.1| rop4 small GTP binding protein [Zea mays]
Length=197

 Score =   347 bits (891),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEEL+K+IGAA YIECSSKTQQN+KAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVL  178



>ref|XP_004487185.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Cicer arietinum]
 ref|XP_004487186.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Cicer arietinum]
Length=196

 Score =   347 bits (891),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGATPITTAQGEELK+ IGAA Y+ECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGATPITTAQGEELKRAIGAAVYLECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007213176.1| hypothetical protein PRUPE_ppa027013mg [Prunus persica]
 ref|XP_008244853.1| PREDICTED: rac-like GTP-binding protein RAC2 [Prunus mume]
 gb|EMJ14375.1| hypothetical protein PRUPE_ppa027013mg [Prunus persica]
Length=196

 Score =   347 bits (891),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DK++L++HPGATPI+ AQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKEYLIDHPGATPISIAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002530817.1| rac gtpase, putative [Ricinus communis]
 gb|EEF31557.1| rac gtpase, putative [Ricinus communis]
Length=198

 Score =   347 bits (891),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFLIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AGL44367.1| Rop4 [Hevea brasiliensis]
Length=198

 Score =   347 bits (891),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGATPITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGATPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_001773666.1| rop-family small GTPase [Physcomitrella patens]
 gb|AAD44768.1|AF146340_1 Rac-like GTP binding protein [Physcomitrella patens]
 gb|AAD44769.1|AF146341_1 Rac-like GTP binding protein [Physcomitrella patens]
 gb|EDQ61554.1| rop-family small GTPase [Physcomitrella patens]
 dbj|BAO94211.1| Rop/RAC small GTPase [Physcomitrella patens]
Length=196

 Score =   347 bits (890),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP+VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITT+QGEEL+K IGAA+YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFADHPGAAPITTSQGEELRKAIGAASYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_004952335.1| PREDICTED: rac-like GTP-binding protein 7-like [Setaria italica]
Length=197

 Score =   347 bits (889),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPG  PITTAQGEELK+MIGAA YIECSSKTQQNVKAVFD+AIKVVL
Sbjct  121  DLREDKQFFLDHPGLAPITTAQGEELKRMIGAAAYIECSSKTQQNVKAVFDSAIKVVL  178



>ref|XP_006422604.1| hypothetical protein CICLE_v10029311mg [Citrus clementina]
 ref|XP_006486745.1| PREDICTED: rac-like GTP-binding protein ARAC3-like [Citrus sinensis]
 gb|ESR35844.1| hypothetical protein CICLE_v10029311mg [Citrus clementina]
 gb|KDO68062.1| hypothetical protein CISIN_1g029144mg [Citrus sinensis]
Length=198

 Score =   347 bits (889),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFLADHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002522514.1| rac gtpase, putative [Ricinus communis]
 gb|EEF39814.1| rac gtpase, putative [Ricinus communis]
Length=197

 Score =   347 bits (889),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV KKWIPEL+HYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVYKKWIPELKHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR DKQ+L++HPGATPITTAQGEEL+K+IGA TYIECSSKTQQNVK VFD+AIKV L
Sbjct  121  DLRQDKQYLIDHPGATPITTAQGEELRKIIGAITYIECSSKTQQNVKTVFDSAIKVAL  178



>ref|XP_001761909.1| rop-family small GTPase [Physcomitrella patens]
 ref|XP_001770483.1| predicted protein [Physcomitrella patens]
 gb|AAD26198.1|AF115476_1 rac-like GTP binding protein [Physcomitrella patens]
 gb|AAX58754.1| small rho-1 GTP-binding protein [Physcomitrella patens]
 gb|EDQ64652.1| predicted protein [Physcomitrella patens]
 gb|EDQ73350.1| rop-family small GTPase [Physcomitrella patens]
 dbj|BAO94212.1| Rop/RAC small GTPase [Physcomitrella patens]
Length=196

 Score =   347 bits (889),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP+VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITT+QGEEL+K IGAA+YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFADHPGAAPITTSQGEELRKSIGAASYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006377446.1| RAC-like GTP binding protein ARAC2 [Populus trichocarpa]
 gb|ERP55243.1| RAC-like GTP binding protein ARAC2 [Populus trichocarpa]
Length=196

 Score =   346 bits (888),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVN+GLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNIGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L++HPGAT ITTAQGEELKKMIGA  YIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLREDKQYLIDHPGATTITTAQGEELKKMIGAVIYIECSSKTQQNVKTVFDAAIKVAL  178



>gb|ABK21895.1| unknown [Picea sitchensis]
 gb|ADE76884.1| unknown [Picea sitchensis]
Length=196

 Score =   346 bits (888),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP+VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF  +HPGA PI+TAQGE+LK+ IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFADHPGAAPISTAQGEDLKRQIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|KDP29655.1| hypothetical protein JCGZ_18817 [Jatropha curcas]
Length=198

 Score =   346 bits (888),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AFK39736.1| unknown [Lotus japonicus]
Length=196

 Score =   346 bits (888),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSAN  VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANAVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGATPITTAQGEELKK IGAA Y+ECSSKTQQNV+AVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGATPITTAQGEELKKAIGAAVYLECSSKTQQNVEAVFDAAIKVVL  178



>ref|XP_003543315.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Glycine max]
 gb|KHN36675.1| Rac-like GTP-binding protein RAC2 [Glycine soja]
Length=196

 Score =   346 bits (888),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV +DGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVIDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPIVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HP ATPITTAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPAATPITTAQGEELKKEIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009376954.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Pyrus x bretschneideri]
 ref|XP_009376967.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Pyrus x bretschneideri]
Length=198

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKW+PELRHYAP+VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPSVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD+QF V+HPGA PITTAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDRQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007200549.1| hypothetical protein PRUPE_ppa011737mg [Prunus persica]
 gb|EMJ01748.1| hypothetical protein PRUPE_ppa011737mg [Prunus persica]
Length=198

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002272532.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 ref|XP_010664844.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 ref|XP_010664845.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 ref|XP_010664846.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 emb|CAN71069.1| hypothetical protein VITISV_031709 [Vitis vinifera]
 emb|CBI19900.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELKKVIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009355676.1| PREDICTED: rac-like GTP-binding protein 5 [Pyrus x bretschneideri]
Length=197

 Score =   346 bits (887),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|KHG12635.1| Rac-like GTP-binding protein RAC13 [Gossypium arboreum]
Length=196

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGAD+FLLAFSLISKASYENV KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADMFLLAFSLISKASYENVYKKWIPELRHYAPNVPVVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGAT ITT+QGEELKK+IGA +YIECSSKTQQNVKAVFD AIKV L
Sbjct  121  DLRDDKQFLTDHPGATAITTSQGEELKKIIGAVSYIECSSKTQQNVKAVFDTAIKVAL  178



>ref|NP_001105719.1| Rho-related protein from plants 4 [Zea mays]
 gb|AAD34358.1| Rop4 small GTP binding protein [Zea mays]
Length=197

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEEL+K+IGAA YIECSSK QQN+KAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTAQGEELRKLIGAAAYIECSSKIQQNIKAVFDAAIKVVL  178



>ref|XP_001779421.1| rop-family small GTPase [Physcomitrella patens]
 gb|EDQ55811.1| rop-family small GTPase [Physcomitrella patens]
Length=196

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP+VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPSVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITT+QGEEL++ IGAA+YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFADHPGAAPITTSQGEELRRSIGAASYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009391005.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
Length=198

 Score =   345 bits (886),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K+IGAA YIECSSKTQQNVKAVFD AIKVVL
Sbjct  121  DLRDDKQFFIDHPGAMPISTAQGEELRKLIGAAAYIECSSKTQQNVKAVFDTAIKVVL  178



>ref|XP_002278595.1| PREDICTED: rac-like GTP-binding protein 5 [Vitis vinifera]
 emb|CAN73627.1| hypothetical protein VITISV_026639 [Vitis vinifera]
 emb|CBI37875.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_011045876.1| PREDICTED: rac-like GTP-binding protein RAC13 [Populus euphratica]
Length=196

 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVN+GLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNIGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ++++HPGAT ITTAQGEELKKMIGA  YIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLREDKQYIIDHPGATTITTAQGEELKKMIGAVIYIECSSKTQQNVKTVFDAAIKVAL  178



>ref|XP_008357291.1| PREDICTED: rac-like GTP-binding protein 5 [Malus domestica]
Length=197

 Score =   345 bits (886),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_003635766.1| Rac-like GTP binding protein [Medicago truncatula]
 gb|ABV90640.1| ROP8 [Medicago truncatula]
 gb|KEH39219.1| Rho-like GTP-binding protein [Medicago truncatula]
Length=196

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+S+ASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLLSRASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGAT ITTAQGEELK+ IGAA Y+ECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGATAITTAQGEELKRAIGAAVYLECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010941321.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010941322.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010941323.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
Length=197

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010690370.1| PREDICTED: rac-like GTP-binding protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=198

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQG+ELKK IGAA YIECS+KTQQN+KAVFDAAIKVVL
Sbjct  121  DLRDDKQFFLDHPGAVPITTAQGDELKKQIGAAAYIECSAKTQQNIKAVFDAAIKVVL  178



>gb|ABW24664.1| Rop7 [Medicago truncatula]
 gb|KEH30943.1| Rho-like GTP-binding protein [Medicago truncatula]
Length=196

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL FSLISKASYEN+SKKWI ELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCFSLISKASYENISKKWISELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGAT ITTA+GEELKKMIGA +YIECSSKTQQNVK VFDAAIK+ L
Sbjct  121  DLRDDKQFFIDHPGATQITTAKGEELKKMIGAVSYIECSSKTQQNVKVVFDAAIKIAL  178



>ref|XP_008806608.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008806609.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008806611.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008806612.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=197

 Score =   345 bits (884),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_008811402.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008811409.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
 ref|XP_008811416.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=197

 Score =   345 bits (884),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002982092.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
 ref|XP_002994630.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ04304.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ16760.1| Rop2, RHO family GTPase [Selaginella moellendorffii]
Length=196

 Score =   344 bits (883),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYEN+SKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENISKKWIPELKHYAPTVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGATPITT QGEEL+K IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFADHPGATPITTVQGEELRKQIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_011046692.1| PREDICTED: rac-like GTP-binding protein 5 [Populus euphratica]
Length=198

 Score =   345 bits (884),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGAD+FLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADIFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFLDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010935113.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010935114.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
 ref|XP_010935115.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
Length=197

 Score =   344 bits (883),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKAIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006379285.1| small GTPase Rac4 family protein [Populus trichocarpa]
 ref|XP_011046252.1| PREDICTED: rac-like GTP-binding protein 5 [Populus euphratica]
 gb|ERP57082.1| small GTPase Rac4 family protein [Populus trichocarpa]
Length=198

 Score =   344 bits (883),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIK VL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKAVL  178



>ref|XP_007041844.1| RAC-like 3 [Theobroma cacao]
 gb|EOX97675.1| RAC-like 3 [Theobroma cacao]
Length=198

 Score =   344 bits (883),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>emb|CAD27895.1| putative RACD protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score =   344 bits (883),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVTKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEELKK+IGA  YIECSSKTQQN+KAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTAQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVL  178



>ref|NP_001046653.1| Os02g0312600 [Oryza sativa Japonica Group]
 sp|Q6Z7L8.1|RAC7_ORYSJ RecName: Full=Rac-like GTP-binding protein 7; AltName: Full=GTPase 
protein ROP5; AltName: Full=OsRac7; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|AAK53060.1|AF376055_1 putative Rop family GTPase ROP5 [Oryza sativa]
 dbj|BAD15789.1| putative small GTP binding protein [Oryza sativa Japonica Group]
 dbj|BAD15966.1| putative small GTP binding protein [Oryza sativa Japonica Group]
 dbj|BAF08567.1| Os02g0312600 [Oryza sativa Japonica Group]
 gb|EEC73003.1| hypothetical protein OsI_06922 [Oryza sativa Indica Group]
 gb|EEE56825.1| hypothetical protein OsJ_06426 [Oryza sativa Japonica Group]
Length=197

 Score =   344 bits (883),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPG  PI+TAQGEELK+MIGAA YIECSSKTQQNVK+VFD+AIKVVL
Sbjct  121  DLREDKQFFLDHPGLAPISTAQGEELKRMIGAAAYIECSSKTQQNVKSVFDSAIKVVL  178



>gb|KDP21034.1| hypothetical protein JCGZ_21505 [Jatropha curcas]
Length=197

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFP DYVPTVFDNFSANV VDGS VNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPPDYVPTVFDNFSANVVVDGSIVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYEN  KKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENTYKKWIPELKHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L++HPGATPITTAQGEELKKMIGA TYIECSSKTQQNVKAVFD+AIKVVL
Sbjct  121  DLREDKQYLIDHPGATPITTAQGEELKKMIGAVTYIECSSKTQQNVKAVFDSAIKVVL  178



>ref|XP_006435212.1| hypothetical protein CICLE_v10002551mg [Citrus clementina]
 ref|XP_006473689.1| PREDICTED: rac-like GTP-binding protein 5-like [Citrus sinensis]
 gb|ESR48452.1| hypothetical protein CICLE_v10002551mg [Citrus clementina]
 gb|KDO84911.1| hypothetical protein CISIN_1g029215mg [Citrus sinensis]
Length=197

 Score =   344 bits (882),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_003542711.1| PREDICTED: rac-like GTP-binding protein RAC13-like isoform X1 
[Glycine max]
 ref|XP_006594296.1| PREDICTED: rac-like GTP-binding protein RAC13-like isoform X2 
[Glycine max]
Length=196

 Score =   344 bits (882),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV+VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVTVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL +SLISKASYEN+SKKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCYSLISKASYENISKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRD+KQFL++HPG+  ITTAQGEELKKMIGA TYIECSSKTQ NVK VFDAAIKV L
Sbjct  121  DLRDNKQFLIDHPGSARITTAQGEELKKMIGAVTYIECSSKTQLNVKTVFDAAIKVAL  178



>ref|XP_003573198.1| PREDICTED: rac-like GTP-binding protein 7 isoform X2 [Brachypodium 
distachyon]
Length=198

 Score =   344 bits (882),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF + HPG  PI+TAQGEELKKMIGAA YIECSSKTQQNVK+VFD+AIKVVL
Sbjct  121  DLREDKQFFLEHPGLAPISTAQGEELKKMIGAAAYIECSSKTQQNVKSVFDSAIKVVL  178



>ref|XP_010265987.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Nelumbo nucifera]
 ref|XP_010265988.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Nelumbo nucifera]
Length=198

 Score =   344 bits (882),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTAQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>emb|CDO96917.1| unnamed protein product [Coffea canephora]
Length=198

 Score =   344 bits (882),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSL+SKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLVSKASYENVSKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+IGAA+YIECS+KTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLIGAASYIECSAKTQQNVKGVFDAAIKVVL  178



>emb|CDY43414.1| BnaC07g14810D [Brassica napus]
Length=197

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_011096382.1| PREDICTED: rac-like GTP-binding protein RAC13 [Sesamum indicum]
Length=197

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVN+GLWD
Sbjct  1    MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNIGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PELRHY+PNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWMPELRHYSPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQFL +HP A PITTAQGEELKKMIGA  YIECS+KTQQNVKAVFD AIKVVL
Sbjct  121  DLREDKQFLSDHPTALPITTAQGEELKKMIGAVAYIECSAKTQQNVKAVFDTAIKVVL  178



>gb|AGL44365.1| Rop2 [Hevea brasiliensis]
Length=197

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007132690.1| hypothetical protein PHAVU_011G116400g [Phaseolus vulgaris]
 gb|ESW04684.1| hypothetical protein PHAVU_011G116400g [Phaseolus vulgaris]
Length=197

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGS VNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSIVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPEL HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELTHYAPTVPVVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L++HPGAT ITTAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQYLIDHPGATAITTAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010477239.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
Length=196

 Score =   343 bits (881),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT+QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTSQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006449441.1| hypothetical protein CICLE_v10016801mg [Citrus clementina]
 gb|ESR62681.1| hypothetical protein CICLE_v10016801mg [Citrus clementina]
Length=196

 Score =   343 bits (881),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF   HPGATPITT+QGEELKKMIGA TY+ECS+KTQ+N+K VFDAAIKV L
Sbjct  121  DLREDKQFSSGHPGATPITTSQGEELKKMIGAVTYLECSAKTQENIKTVFDAAIKVAL  178



>ref|XP_011083464.1| PREDICTED: rac-like GTP-binding protein RAC1 [Sesamum indicum]
 ref|XP_011083465.1| PREDICTED: rac-like GTP-binding protein RAC1 [Sesamum indicum]
Length=195

 Score =   343 bits (881),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+  RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+ ++HPGA PITTAQGEELKK+IGA  Y+ECSSKTQQNVKAVFDAAIK+VL
Sbjct  121  DLRDDKQYFIDHPGAVPITTAQGEELKKLIGAPVYVECSSKTQQNVKAVFDAAIKIVL  178



>ref|XP_010266823.1| PREDICTED: rac-like GTP-binding protein 5 [Nelumbo nucifera]
 ref|XP_010266824.1| PREDICTED: rac-like GTP-binding protein 5 [Nelumbo nucifera]
Length=199

 Score =   343 bits (881),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEELKK IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTAQGEELKKQIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|ACM07419.1| Rac/Rop-like small GTPase [Scoparia dulcis]
Length=197

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+KMIGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKMIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006647205.1| PREDICTED: rac-like GTP-binding protein 7-like isoform X1 [Oryza 
brachyantha]
Length=234

 Score =   345 bits (884),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  38   MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  97

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  98   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL  157

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPG  PI+TAQGEELK+MIGAA YIECSSKTQQNVK+VFD+AIKVVL
Sbjct  158  DLREDKQFFLDHPGLAPISTAQGEELKRMIGAAAYIECSSKTQQNVKSVFDSAIKVVL  215



>ref|XP_006467698.1| PREDICTED: rac-like GTP-binding protein RAC13-like [Citrus sinensis]
Length=196

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDY+PTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYIPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVYKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF   HPGATPITT+QGEELKKMIGA TY+ECS+KTQ+N+K VFDAAIKV L
Sbjct  121  DLREDKQFSSGHPGATPITTSQGEELKKMIGAVTYLECSAKTQENIKTVFDAAIKVAL  178



>gb|AGL44366.1| Rop3 [Hevea brasiliensis]
Length=198

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF +++PGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDYPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007025494.1| RAC-like 2 [Theobroma cacao]
 gb|EOY28116.1| RAC-like 2 [Theobroma cacao]
Length=197

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWI ELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIAELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+L +HPGAT  TT+QGEELKKMIGA TYIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLRDDKQYLSDHPGATATTTSQGEELKKMIGAVTYIECSSKTQQNVKTVFDAAIKVAL  178



>ref|XP_010416495.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
Length=223

 Score =   344 bits (882),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 182/207 (88%), Gaps = 4/207 (2%)
 Frame = +1

Query  235  SINLTWPHSLVFIP*LFKIAGGLTGKNNIMTTARFIKCVTVGDGAVGKTCMLISYTSNTF  414
            S N   PHS  FI  L +    L G+   M+ +RFIKCVTVGDGAVGKTCMLISYTSNTF
Sbjct  3    SFNFMPPHSDFFISFLEEFVN-LRGE---MSASRFIKCVTVGDGAVGKTCMLISYTSNTF  58

Query  415  PTDYVPTVFDNFSANVSVDGSTVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISKA  594
            PTDYVPTVFDNFSANV VDG+TVNLGLWDTAGQEDYNRLRPLSYRGADVF+LAFSLISKA
Sbjct  59   PTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQEDYNRLRPLSYRGADVFILAFSLISKA  118

Query  595  SYENVSKKWIPELRHYAPNVPLVLVGTKLDLRDDKQFLVNHPGATPITTAQGEELKKMIG  774
            SYENV+KKWIPELRHYAP VP++LVGTKLDLRDDKQF ++HPGA PITT QGEELKK+IG
Sbjct  119  SYENVAKKWIPELRHYAPGVPIILVGTKLDLRDDKQFFIDHPGAVPITTNQGEELKKLIG  178

Query  775  AATYIECSSKTQQNVKAVFDAAIKVVL  855
            +  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  179  SLIYIECSSKTQQNVKAVFDAAIKVVL  205



>gb|KHN39876.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPGAVPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_003540880.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Glycine max]
 gb|KHN25471.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_004289869.1| PREDICTED: rac-like GTP-binding protein ARAC3-like [Fragaria 
vesca subsp. vesca]
Length=198

 Score =   343 bits (880),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITTAQGEELKK IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFTDHPGAVPITTAQGEELKKTIGAPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_004232945.1| PREDICTED: rac-like GTP-binding protein RAC13 [Solanum lycopersicum]
 ref|XP_006367198.1| PREDICTED: rac-like GTP-binding protein RAC13-like [Solanum tuberosum]
Length=197

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAP + +VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPTIQIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L +HPGATPI+TAQGEELKKMIGA  YIECSSKTQQNVKAVFD AIKV L
Sbjct  121  DLREDKQYLSDHPGATPISTAQGEELKKMIGAVAYIECSSKTQQNVKAVFDTAIKVAL  178



>ref|XP_002325588.1| hypothetical protein POPTR_0019s12210g [Populus trichocarpa]
 ref|XP_011002670.1| PREDICTED: rac-like GTP-binding protein RAC2 [Populus euphratica]
 gb|EEE99969.1| hypothetical protein POPTR_0019s12210g [Populus trichocarpa]
Length=197

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV V GSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVHGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWI ELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWISELRHYAPAVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPGA PITTAQGEELKKMIGAA Y+ECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRNDRQYLIDHPGAAPITTAQGEELKKMIGAAVYLECSSKTQQNVKGVFDAAIKVVL  178



>ref|XP_011092983.1| PREDICTED: rac-like GTP-binding protein 5 [Sesamum indicum]
Length=198

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF V+HPGA PITTAQGE+LK++IGAA YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFVDHPGAVPITTAQGEDLKRVIGAAAYIECSAKTQQNVKAVFDAAIKVVL  178



>ref|XP_002510565.1| rac gtpase, putative [Ricinus communis]
 gb|EEF52752.1| rac gtpase, putative [Ricinus communis]
Length=197

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSK+QQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKSQQNVKAVFDAAIKVVL  178



>ref|XP_004505115.1| PREDICTED: rac-like GTP-binding protein RAC13-like [Cicer arietinum]
Length=195

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL FSLISKAS+EN+SKKWI ELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCFSLISKASFENISKKWISELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGAT ITT+QGEELKK IGA TYIECSSKTQQNVK VFDAAIKV L
Sbjct  121  DLRDDKQFFIDHPGATRITTSQGEELKKTIGAVTYIECSSKTQQNVKVVFDAAIKVAL  178



>ref|XP_006305647.1| hypothetical protein CARUB_v10010350mg [Capsella rubella]
 ref|XP_006416436.1| hypothetical protein EUTSA_v10008827mg [Eutrema salsugineum]
 ref|XP_009110241.1| PREDICTED: rac-like GTP-binding protein ARAC4 [Brassica rapa]
 gb|EOA38545.1| hypothetical protein CARUB_v10010350mg [Capsella rubella]
 gb|ESQ34789.1| hypothetical protein EUTSA_v10008827mg [Eutrema salsugineum]
 emb|CDY62937.1| BnaA08g31150D [Brassica napus]
Length=196

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>emb|CDY54338.1| BnaCnng26840D [Brassica napus]
Length=197

 Score =   343 bits (879),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|ACI03398.1| rac-like small GTP-binding protein [Scoparia dulcis]
Length=196

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+  RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSATRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIK+VL
Sbjct  121  DLRDDKQFFIDHPGAIPISTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKIVL  178



>ref|XP_003539954.1| PREDICTED: rac-like GTP-binding protein RAC2-like [Glycine max]
Length=197

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTTRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPG T I TAQGEELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGTTAIATAQGEELKKAIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009418310.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
 gb|ABQ15204.1| rop [Musa acuminata]
Length=196

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRD++QF ++HPGA PI+TAQGEEL+K IGAA+YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDEQQFFIDHPGAVPISTAQGEELRKQIGAASYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010498441.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
Length=196

 Score =   342 bits (878),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010090337.1| Rac-like GTP-binding protein ARAC3 [Morus notabilis]
 gb|EXB39307.1| Rac-like GTP-binding protein ARAC3 [Morus notabilis]
Length=198

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ ++FIKCVTVGDGAVGKTCMLISYTSNTFP DYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASKFIKCVTVGDGAVGKTCMLISYTSNTFPMDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AFK45598.1| unknown [Lotus japonicus]
Length=197

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQN+KAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPGAVPITTAQGEELRKLIGAPMYIECSSKTQQNIKAVFDAAIKVVL  178



>emb|CDP01867.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+KMIGA  YIECSSKTQQNVK+VFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKMIGAPAYIECSSKTQQNVKSVFDAAIKVVL  178



>ref|XP_009794579.1| PREDICTED: rac-like GTP-binding protein RAC13 [Nicotiana sylvestris]
Length=197

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAP +P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPTIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L +HPGATPITT+QGEELKKMIGA  Y ECSSKTQQNVK VFD AIKV L
Sbjct  121  DLREDKQYLSDHPGATPITTSQGEELKKMIGAVAYTECSSKTQQNVKTVFDTAIKVAL  178



>sp|O04369.1|RAC1_LOTJA RecName: Full=Rac-like GTP-binding protein RAC1; Flags: Precursor 
[Lotus japonicus]
 emb|CAA98189.1| RAC1 [Lotus japonicus]
Length=197

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDK FL +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKHFLADHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010066279.1| PREDICTED: rac-like GTP-binding protein 5 isoform X1 [Eucalyptus 
grandis]
 gb|KCW64123.1| hypothetical protein EUGRSUZ_G01779 [Eucalyptus grandis]
 gb|KCW64124.1| hypothetical protein EUGRSUZ_G01779 [Eucalyptus grandis]
Length=198

 Score =   342 bits (878),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL SKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLTSKASYENVAKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPG  PITTAQGEELKK+IGAA YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFLDHPGTVPITTAQGEELKKLIGAAAYIECSSKTQQNVKVVFDAAIKVVL  178



>ref|XP_009414443.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   342 bits (877),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD+QF ++HPGA PI+TAQGEELKK+IGA+ YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDQQFFIDHPGAAPISTAQGEELKKVIGASAYIECSSKTQQNVKTVFDAAIKVVL  178



>ref|XP_007136004.1| hypothetical protein PHAVU_009G009800g [Phaseolus vulgaris]
 gb|ESW07998.1| hypothetical protein PHAVU_009G009800g [Phaseolus vulgaris]
Length=197

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDK FLV+HPGA PI+TAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKHFLVDHPGAVPISTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>sp|Q41254.1|RAC9_GOSHI RecName: Full=Rac-like GTP-binding protein RAC9; Flags: Precursor 
[Gossypium hirsutum]
 gb|AAB35094.1| mammalian rac protein homolog [Gossypium hirsutum]
Length=196

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MNTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYENV KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENVHKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL ++PGA  ITT+QGEELKKMIGA TYIECSSKTQQNVKAVFD AIK+ L
Sbjct  121  DLRDDKQFLSDNPGAISITTSQGEELKKMIGAVTYIECSSKTQQNVKAVFDVAIKIAL  178



>ref|XP_002305518.1| small GTPase Rac4 family protein [Populus trichocarpa]
 gb|EEE86029.1| small GTPase Rac4 family protein [Populus trichocarpa]
Length=198

 Score =   342 bits (877),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGCTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGAD+FLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADIFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFLDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_008813511.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=198

 Score =   342 bits (876),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+ ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQYFMDHPGAVPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010920122.1| PREDICTED: rac-like GTP-binding protein 5 [Elaeis guineensis]
Length=198

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQ+ ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQYFMDHPGAVPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006846898.1| hypothetical protein AMTR_s00152p00020750 [Amborella trichopoda]
 gb|ERN08479.1| hypothetical protein AMTR_s00152p00020750 [Amborella trichopoda]
Length=198

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITT QGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPITTLQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AFK47488.1| unknown [Lotus japonicus]
Length=197

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDK FL +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKHFLADHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_008439788.1| PREDICTED: rac-like GTP-binding protein RAC13 [Cucumis melo]
Length=197

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIFKKWLPELKHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+++L++HPGATPIT AQGEEL+KMIGA TYIECSSKTQ+NVK VFDAAIKV L
Sbjct  121  DLREDREYLIDHPGATPITAAQGEELRKMIGAITYIECSSKTQKNVKNVFDAAIKVAL  178



>ref|XP_004134675.1| PREDICTED: rac-like GTP-binding protein 7-like [Cucumis sativus]
 gb|KGN49273.1| hypothetical protein Csa_6G518280 [Cucumis sativus]
Length=197

 Score =   342 bits (876),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIFKKWLPELKHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+++L++HPGATPIT AQGEEL+KMIGA TYIECSSKTQ+NVK VFDAAIKV L
Sbjct  121  DLREDREYLIDHPGATPITAAQGEELRKMIGAITYIECSSKTQKNVKNVFDAAIKVAL  178



>ref|NP_001238503.1| uncharacterized protein LOC100499696 [Glycine max]
 gb|ACU13278.1| unknown [Glycine max]
 gb|KHN45934.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=196

 Score =   341 bits (875),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVV+
Sbjct  121  DLRDDKQFFMDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVI  178



>ref|XP_008800174.1| PREDICTED: rac-like GTP-binding protein 5 [Phoenix dactylifera]
Length=198

 Score =   341 bits (875),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGALAYIECSSKTQQNVKVVFDAAIKVVL  178



>ref|NP_001242570.1| uncharacterized protein LOC100805035 [Glycine max]
 gb|ACU13435.1| unknown [Glycine max]
Length=197

 Score =   341 bits (875),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGAD FLLAFSLIS+ASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADAFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPGAVPITTAQGEELRKLIGAPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_004231040.1| PREDICTED: rac-like GTP-binding protein 5 [Solanum lycopersicum]
 ref|XP_006359696.1| PREDICTED: rac-like GTP-binding protein 5-like [Solanum tuberosum]
Length=198

 Score =   341 bits (875),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF V+HPGA P++TAQGEEL+K IGAA YIECS+KTQQN+KAVFDAAIKVVL
Sbjct  121  DLREDKQFFVDHPGAVPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAAIKVVL  178



>gb|ABE11611.1| Rac-like GTP-binding protein [Solanum chacoense]
Length=198

 Score =   341 bits (875),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF V+HPGA P++TAQGEEL+K IGAA YIECS+KTQQN+KAVFDAAIKVVL
Sbjct  121  DLREDKQFFVDHPGAVPLSTAQGEELRKSIGAAAYIECSAKTQQNIKAVFDAAIKVVL  178



>ref|XP_009409976.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009409977.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
Length=196

 Score =   341 bits (875),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLI+YTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLIAYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAAPISTAQGEELQKQIGADAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AFK47272.1| unknown [Lotus japonicus]
Length=197

 Score =   341 bits (875),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ ++FIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLIS+A YEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISRAGYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF +NHPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFINHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AEQ62559.1| Rac/Rop GTPase 2 [Aquilaria microcarpa]
Length=198

 Score =   341 bits (875),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTK+
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKM  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_007136003.1| hypothetical protein PHAVU_009G009700g [Phaseolus vulgaris]
 gb|ESW07997.1| hypothetical protein PHAVU_009G009700g [Phaseolus vulgaris]
Length=197

 Score =   341 bits (875),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFMDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>pdb|2NTY|C Chain C, Rop4-Gdp-Prone8
 pdb|2NTY|D Chain D, Rop4-Gdp-Prone8
Length=180

 Score =   340 bits (873),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010533894.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Tarenaya hassleriana]
 ref|XP_010533902.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Tarenaya hassleriana]
Length=196

 Score =   341 bits (874),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_003570746.1| PREDICTED: rac-like GTP-binding protein 5 [Brachypodium distachyon]
Length=197

 Score =   341 bits (874),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKW+PELRHY+P VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWLPELRHYSPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PI+TAQGEELKK+IGA  YIECSSKTQQN+KAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPISTAQGEELKKVIGATAYIECSSKTQQNIKAVFDAAIKVVL  178



>ref|XP_011088603.1| PREDICTED: rac-like GTP-binding protein 5 isoform X1 [Sesamum 
indicum]
 ref|XP_011088604.1| PREDICTED: rac-like GTP-binding protein 5 isoform X1 [Sesamum 
indicum]
Length=198

 Score =   341 bits (874),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN+ KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIPKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PI+TAQGEEL+K+IGAA YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPISTAQGEELRKLIGAAAYIECSAKTQQNVKAVFDAAIKVVL  178



>ref|XP_009418766.1| PREDICTED: rac-like GTP-binding protein 5 [Musa acuminata subsp. 
malaccensis]
Length=197

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVN+GLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNIGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPEL HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELSHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA P++TAQGEEL+K+IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPMSTAQGEELRKLIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002306944.1| small GTPase Rac4 family protein [Populus trichocarpa]
 ref|XP_011003051.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Populus euphratica]
 gb|ABK92514.1| unknown [Populus trichocarpa]
 gb|EEE93940.1| small GTPase Rac4 family protein [Populus trichocarpa]
Length=197

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF V+HPGA PITTAQGEELKK+IGA  YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLREDKQFFVDHPGAVPITTAQGEELKKLIGAPFYIECSSKTQQNVKGVFDAAIKVVL  178



>ref|XP_002890370.1| hypothetical protein ARALYDRAFT_472235 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66629.1| hypothetical protein ARALYDRAFT_472235 [Arabidopsis lyrata subsp. 
lyrata]
Length=196

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGE+LKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEDLKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002301960.1| RAC-like GTP binding protein ARAC4 [Populus trichocarpa]
 gb|EEE81233.1| RAC-like GTP binding protein ARAC4 [Populus trichocarpa]
Length=196

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF V+HPGA PI TAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFVDHPGAVPINTAQGEELKKLIGAPFYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AAD47828.2| RAC-like G-protein Rac1 [Gossypium hirsutum]
Length=198

 Score =   341 bits (874),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPITTAQGEELRKLIGAHFYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|NP_001290012.1| rac-like GTP-binding protein RHO1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010679891.1| PREDICTED: rac-like GTP-binding protein RHO1 [Beta vulgaris subsp. 
vulgaris]
 sp|Q39435.1|RAC1_BETVU RecName: Full=Rac-like GTP-binding protein RHO1; AltName: Full=RHO1Bv; 
Flags: Precursor [Beta vulgaris]
 emb|CAA89050.1| small G protein [Beta vulgaris subsp. vulgaris]
Length=197

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_004143001.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Cucumis sativus]
 ref|XP_004167822.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Cucumis sativus]
 ref|XP_008445333.1| PREDICTED: rac-like GTP-binding protein 5 [Cucumis melo]
 gb|KGN62254.1| hypothetical protein Csa_2G345950 [Cucumis sativus]
Length=197

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+T QGEEL+K+IGA  YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTVQGEELRKVIGAPAYIECSSKTQQNVKGVFDAAIKVVL  178



>gb|KFK42023.1| hypothetical protein AALP_AA2G202200 [Arabis alpina]
Length=196

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|KFK30140.1| rac-like gtp-binding protein arac3 [Arabis alpina]
Length=198

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+T QGEELKK+IGA+ YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTTQGEELKKLIGASAYIECSAKTQQNVKAVFDAAIKVVL  178



>ref|XP_009631777.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana tomentosiformis]
 ref|XP_009631837.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana tomentosiformis]
 ref|XP_009631902.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana tomentosiformis]
 ref|XP_009789715.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana sylvestris]
 ref|XP_009789716.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana sylvestris]
 ref|XP_009789717.1| PREDICTED: rac-like GTP-binding protein 5 [Nicotiana sylvestris]
 gb|AAD00118.1| NTGP3 [Nicotiana tabacum]
 emb|CAD42723.1| putative rac protein [Nicotiana tabacum]
Length=198

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA P+TTAQGEEL+K IGA+ YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFLDHPGAVPLTTAQGEELRKSIGASAYIECSAKTQQNVKAVFDAAIKVVL  178



>ref|XP_009107160.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Brassica rapa]
 emb|CDX75480.1| BnaA01g02220D [Brassica napus]
Length=198

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V HPGA PI+TAQGEELKK+IGA  YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVL  178



>ref|XP_009614505.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009614506.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009614507.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009793499.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 ref|XP_009793505.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 ref|XP_009793512.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 gb|AAD00117.1| NTGP2 [Nicotiana tabacum]
 emb|CAB57818.1| putative rac protein [Nicotiana tabacum]
Length=197

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009612580.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009797560.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
 gb|AAK31299.1| Rac-like GTPase 1 [Nicotiana tabacum]
Length=197

 Score =   340 bits (873),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009591893.1| PREDICTED: rac-like GTP-binding protein RAC13 [Nicotiana tomentosiformis]
Length=197

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAP +P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYAPTIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L +HPGATPI T+QGEELKKMIGA  Y ECSSKTQQNVK VFD AIKV L
Sbjct  121  DLREDKQYLSDHPGATPIATSQGEELKKMIGAVAYTECSSKTQQNVKTVFDTAIKVAL  178



>ref|NP_177712.1| Rac-like GTP-binding protein ARAC5 [Arabidopsis thaliana]
 ref|XP_002887616.1| hypothetical protein ARALYDRAFT_895459 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006302850.1| hypothetical protein CARUB_v10020981mg [Capsella rubella]
 ref|XP_010428632.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
 ref|XP_010471725.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
 sp|Q38937.1|RAC5_ARATH RecName: Full=Rac-like GTP-binding protein ARAC5; AltName: Full=GTPase 
protein ROP4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF40244.1|AF115472_1 Arac5 [Arabidopsis thaliana]
 gb|AAC49855.1| GTP-binding protein [Arabidopsis thaliana]
 gb|AAL32878.1| similar to ATGP3 [Arabidopsis thaliana]
 gb|AAM10162.1| similar to ATGP3 [Arabidopsis thaliana]
 gb|EFH63875.1| hypothetical protein ARALYDRAFT_895459 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE35764.1| Rac-like GTP-binding protein ARAC5 [Arabidopsis thaliana]
 gb|EOA35748.1| hypothetical protein CARUB_v10020981mg [Capsella rubella]
Length=196

 Score =   340 bits (873),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVL  178



>emb|CDO96719.1| unnamed protein product [Coffea canephora]
Length=197

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHY+P +P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWIPELRHYSPTIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L +HPGATPI+T QGEELKK+IGA  Y+ECSSKTQQNVKAVFD AIKV L
Sbjct  121  DLREDKQYLSDHPGATPISTTQGEELKKLIGAVAYVECSSKTQQNVKAVFDTAIKVAL  178



>ref|XP_010316434.1| PREDICTED: rac-like GTP-binding protein RHO1 [Solanum lycopersicum]
Length=197

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|NP_001240094.1| uncharacterized protein LOC100798550 [Glycine max]
 gb|ACU13791.1| unknown [Glycine max]
 gb|KHN09078.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITT QGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFIDHPGAVPITTTQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009612726.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana tomentosiformis]
 ref|XP_009790913.1| PREDICTED: rac-like GTP-binding protein RHO1 [Nicotiana sylvestris]
Length=197

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA +YIECSSKTQ+NVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPSYIECSSKTQENVKAVFDAAIKVVL  178



>ref|XP_010686365.1| PREDICTED: rac-like GTP-binding protein RAC13 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=198

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL+FSLISKASYEN+ KKWIPEL+HYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLSFSLISKASYENIFKKWIPELKHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR D+QFL +HPG TPITT+QGEELKKMIGA  YIECS+KTQQNVKAVFDAAIKV L
Sbjct  121  DLRGDQQFLKDHPGTTPITTSQGEELKKMIGAVVYIECSAKTQQNVKAVFDAAIKVAL  178



>ref|XP_010539844.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Tarenaya hassleriana]
 ref|XP_010539845.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Tarenaya hassleriana]
Length=197

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT+QGEEL+K+IGA  YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTSQGEELRKLIGAPVYIECSSKTQQNVKGVFDAAIKVVL  178



>ref|XP_009103358.1| PREDICTED: rac-like GTP-binding protein ARAC4 [Brassica rapa]
Length=197

 Score =   340 bits (872),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNL LWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLVLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_011012556.1| PREDICTED: rac-like GTP-binding protein RHO1 isoform X2 [Populus 
euphratica]
Length=197

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIRVVL  178



>ref|XP_006383072.1| RAC-like GTP binding protein RHO1 [Populus trichocarpa]
 ref|XP_006380550.1| hypothetical protein POPTR_0007s09170g [Populus trichocarpa]
 ref|XP_006380551.1| RAC-like GTP binding protein RHO1 [Populus trichocarpa]
 ref|XP_011043163.1| PREDICTED: rac-like GTP-binding protein RHO1 [Populus euphratica]
 gb|ERP58347.1| hypothetical protein POPTR_0007s09170g [Populus trichocarpa]
 gb|ERP58348.1| RAC-like GTP binding protein RHO1 [Populus trichocarpa]
 gb|ERP60869.1| RAC-like GTP binding protein RHO1 [Populus trichocarpa]
Length=197

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIRVVL  178



>ref|XP_006340764.1| PREDICTED: rac-like GTP-binding protein RHO1-like [Solanum tuberosum]
Length=197

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>emb|CDX73206.1| BnaC06g36540D [Brassica napus]
Length=196

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIK+VL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPVYIECSSKTQQNVKAVFDAAIKMVL  178



>ref|XP_006343356.1| PREDICTED: rac-like GTP-binding protein RHO1-like [Solanum tuberosum]
Length=197

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K IGA +Y+ECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKTIGAPSYVECSSKTQQNVKAVFDAAIKVVL  178



>ref|NP_190698.1| Rac-like GTP-binding protein ARAC11 [Arabidopsis thaliana]
 ref|XP_010503823.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010503824.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010503825.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 sp|P92978.2|RAC11_ARATH RecName: Full=Rac-like GTP-binding protein ARAC11; AltName: Full=GTPase 
protein ROP1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK52996.1|AF375412_1 AT3g51300/F24M12_340 [Arabidopsis thaliana]
 gb|AAC78390.1| GTP binding protein Rop1At [Arabidopsis thaliana]
 gb|AAC35850.1| rac-like GTP binding protein Arac11 [Arabidopsis thaliana]
 emb|CAB62652.1| rac-like GTP binding protein Arac11 [Arabidopsis thaliana]
 gb|AAL47421.1| AT3g51300/F24M12_340 [Arabidopsis thaliana]
 gb|AEE78776.1| Rac-like GTP-binding protein ARAC11 [Arabidopsis thaliana]
Length=197

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RF+KCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA TYIECSSKTQ+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVL  178



>ref|XP_010536416.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Tarenaya hassleriana]
Length=196

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT+QGEEL+K+IGA  YIECSSKTQ NVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTSQGEELRKLIGAPVYIECSSKTQMNVKAVFDAAIKVVL  178



>emb|CAC83043.2| RACB protein [Hordeum vulgare subsp. vulgare]
Length=197

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEELKK+IGA  YIECSSKTQ NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPYYIECSSKTQLNVKGVFDAAIKVVL  178



>emb|CDY39066.1| BnaA02g17550D [Brassica napus]
 emb|CDY13528.1| BnaC02g23390D [Brassica napus]
Length=196

 Score =   340 bits (871),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_006425406.1| hypothetical protein CICLE_v10026539mg [Citrus clementina]
 ref|XP_006425407.1| hypothetical protein CICLE_v10026539mg [Citrus clementina]
 ref|XP_006466990.1| PREDICTED: rac-like GTP-binding protein RHO1-like isoform X1 
[Citrus sinensis]
 ref|XP_006466991.1| PREDICTED: rac-like GTP-binding protein RHO1-like isoform X2 
[Citrus sinensis]
 gb|ESR38646.1| hypothetical protein CICLE_v10026539mg [Citrus clementina]
 gb|ESR38647.1| hypothetical protein CICLE_v10026539mg [Citrus clementina]
 gb|KDO71287.1| hypothetical protein CISIN_1g036449mg [Citrus sinensis]
Length=197

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPISTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIRVVL  178



>ref|XP_004155550.1| PREDICTED: LOW QUALITY PROTEIN: rac-like GTP-binding protein 
7-like [Cucumis sativus]
Length=197

 Score =   339 bits (870),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF LAFSLISKASYEN+ KKW+PEL+HYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFXLAFSLISKASYENIFKKWLPELKHYAPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+++L++HPGATPIT AQGEEL+KMIGA TYIECSSKTQ+NVK VFDAAIKV L
Sbjct  121  DLREDREYLIDHPGATPITAAQGEELRKMIGAITYIECSSKTQKNVKNVFDAAIKVAL  178



>ref|XP_010459691.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Camelina sativa]
Length=196

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNT PTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTSPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010234188.1| PREDICTED: rac-like GTP-binding protein 7 isoform X1 [Brachypodium 
distachyon]
Length=199

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 171/179 (96%), Gaps = 1/179 (1%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKWIPELRHYAPNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWIPELRHYAPNVPIVLVGTKL  120

Query  682  -DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
             DLR+DKQF + HPG  PI+TAQGEELKKMIGAA YIECSSKTQQNVK+VFD+AIKVVL
Sbjct  121  ADLREDKQFFLEHPGLAPISTAQGEELKKMIGAAAYIECSSKTQQNVKSVFDSAIKVVL  179



>ref|NP_001236429.1| uncharacterized protein LOC100527464 [Glycine max]
 gb|ACU16556.1| unknown [Glycine max]
 gb|KHN45933.1| Rac-like GTP-binding protein RAC1 [Glycine soja]
Length=197

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNL LWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQFFMDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|KHG17559.1| Rac-like GTP-binding protein 5 [Gossypium arboreum]
Length=205

 Score =   340 bits (871),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 163/185 (88%), Positives = 171/185 (92%), Gaps = 7/185 (4%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  -------DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAA  840
                   DLRDDKQF V+HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAA
Sbjct  121  AATFLTVDLRDDKQFFVDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAA  180

Query  841  IKVVL  855
            IKVVL
Sbjct  181  IKVVL  185



>ref|XP_010494753.1| PREDICTED: rac-like GTP-binding protein ARAC2 isoform X1 [Camelina 
sativa]
Length=201

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP++P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPSIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>ref|XP_007131710.1| hypothetical protein PHAVU_011G035400g [Phaseolus vulgaris]
 gb|ESW03704.1| hypothetical protein PHAVU_011G035400g [Phaseolus vulgaris]
Length=197

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HP A PITT QGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPSAVPITTGQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002987330.1| RHO family GTPase [Selaginella moellendorffii]
 ref|XP_002989171.1| RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ09765.1| RHO family GTPase [Selaginella moellendorffii]
 gb|EFJ11645.1| RHO family GTPase [Selaginella moellendorffii]
Length=196

 Score =   339 bits (870),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYEN+SKKWIPELRHYA  VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENISKKWIPELRHYASTVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDK F  +HPGAT ITTAQGEEL+K IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKHFFNDHPGATAITTAQGEELRKQIGAAAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_009128141.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Brassica rapa]
Length=196

 Score =   339 bits (870),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVL  178



>dbj|BAJ53109.1| JHL20J20.16 [Jatropha curcas]
 gb|KDP36899.1| hypothetical protein JCGZ_08190 [Jatropha curcas]
Length=197

 Score =   339 bits (870),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD QF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDDQFFIDHPGAAPITTAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIKVVL  178



>gb|EYU18077.1| hypothetical protein MIMGU_mgv1a014213mg [Erythranthe guttata]
Length=197

 Score =   339 bits (870),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PIT AQGEEL+K+IGA  YIECSSKTQ+NVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITAAQGEELRKLIGAPAYIECSSKTQENVKAVFDAAIKVVL  178



>ref|XP_009104695.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Brassica rapa]
 emb|CDX85925.1| BnaC06g22090D [Brassica napus]
 emb|CDX68116.1| BnaA07g21560D [Brassica napus]
Length=195

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+T QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPISTNQGEELKKLIGSPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_002876081.1| hypothetical protein ARALYDRAFT_906477 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006293293.1| hypothetical protein CARUB_v10019628mg [Capsella rubella]
 gb|EFH52340.1| hypothetical protein ARALYDRAFT_906477 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EOA26191.1| hypothetical protein CARUB_v10019628mg [Capsella rubella]
Length=197

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RF+KCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA TYIECSSKTQ+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKQIGAPTYIECSSKTQENVKAVFDAAIRVVL  178



>gb|KHN41616.1| Rac-like GTP-binding protein RAC2 [Glycine soja]
Length=197

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTTRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+SKKWIPELRHYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENISKKWIPELRHYAPTVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+D+Q+L++HPG T I TAQ +ELKK IGAA YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDRQYLIDHPGTTAIATAQAKELKKAIGAAVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|NP_001048639.1| Os02g0834000 [Oryza sativa Japonica Group]
 dbj|BAD28462.1| putative RacD protein [Oryza sativa Japonica Group]
 dbj|BAD29589.1| putative RacD protein [Oryza sativa Japonica Group]
 dbj|BAF10553.1| Os02g0834000 [Oryza sativa Japonica Group]
 dbj|BAG90603.1| unnamed protein product [Oryza sativa Japonica Group]
Length=195

 Score =   339 bits (869),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 2/178 (1%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TA  EDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TA--EDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  118

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+TAQGEEL+K+IGAA YIECSSKTQQN+KAVFDAAIKVVL
Sbjct  119  DLRDDKQFFVDHPGAVPISTAQGEELRKLIGAAAYIECSSKTQQNIKAVFDAAIKVVL  176



>ref|XP_006390262.1| hypothetical protein EUTSA_v10019171mg [Eutrema salsugineum]
 gb|ESQ27548.1| hypothetical protein EUTSA_v10019171mg [Eutrema salsugineum]
Length=196

 Score =   339 bits (869),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGE+LKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEDLKKLIGSPVYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|ABO15583.1| LLP-Rop1 [Lilium longiflorum]
Length=197

 Score =   339 bits (869),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PIT+AQGEEL+K IGA  Y+ECSSKTQQNV+AVFDAAIK VL
Sbjct  121  DLRDDKQFFIDHPGALPITSAQGEELRKTIGAPAYVECSSKTQQNVRAVFDAAIKAVL  178



>ref|XP_007202540.1| hypothetical protein PRUPE_ppa011074mg [Prunus persica]
 ref|XP_008242051.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Prunus mume]
 ref|XP_008337990.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Malus domestica]
 ref|XP_009363468.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Pyrus x bretschneideri]
 gb|EMJ03739.1| hypothetical protein PRUPE_ppa011074mg [Prunus persica]
Length=197

 Score =   339 bits (869),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIRVVL  178



>ref|NP_173437.1| Rac-like GTP-binding protein ARAC4 [Arabidopsis thaliana]
 sp|Q38919.1|RAC4_ARATH RecName: Full=Rac-like GTP-binding protein ARAC4; AltName: Full=GTPase 
protein ROP2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF40243.1|AF115471_1 Arac4 [Arabidopsis thaliana]
 gb|AAF79903.1|AC022472_12 Contains similarity to a geranylgeranylated protein ATGP3 mRNA 
from Arabidopsis thaliana gb|U64920 and is a member of the 
Ras family PF|00071. ESTs gb|AV534858, gb|AV539036, gb|AV538716, 
gb|AV539736, gb|AI998259, gb|H76963, gb|AV525988 come 
from this gene [Arabidopsis thaliana]
 gb|AAG48801.1|AF332438_1 putative RAC GTP-binding protein ARAC4 [Arabidopsis thaliana]
 gb|AAK25864.1|AF360154_1 putative RAC GTP-binding protein ARAC4 [Arabidopsis thaliana]
 gb|AAC49854.1| Description: rac-like protein; GTP binding protein; Method: conceptual 
translation supplied by author [Arabidopsis thaliana]
 gb|AAC78391.1| GTP binding protein Rop2At [Arabidopsis thaliana]
 gb|AAL07157.1| putative RAC GTP-binding protein ARAC4 [Arabidopsis thaliana]
 dbj|BAE99391.1| RAC-like GTP-binding protein ARAC4 [Arabidopsis thaliana]
 gb|AEE29934.1| Rac-like GTP-binding protein ARAC4 [Arabidopsis thaliana]
Length=195

 Score =   338 bits (868),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 158/175 (90%), Positives = 169/175 (97%), Gaps = 0/175 (0%)
 Frame = +1

Query  331  ARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWDTAG  510
            +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWDTAG
Sbjct  3    SRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAG  62

Query  511  QEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKLDLR  690
            QEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKLDLR
Sbjct  63   QEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKLDLR  122

Query  691  DDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DDKQF ++HPGA PITT QGEELKK+IG+A YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  123  DDKQFFIDHPGAVPITTNQGEELKKLIGSAVYIECSSKTQQNVKAVFDAAIKVVL  177



>ref|XP_010413444.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Camelina sativa]
 ref|XP_010467579.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Camelina sativa]
Length=197

 Score =   339 bits (869),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEELKK+IGA  YIECSSKTQ+NVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVL  178



>ref|NP_001266008.1| rac-like GTP-binding protein RAC1-like [Cicer arietinum]
 dbj|BAA76424.1| rac-type small GTP-binding protein [Cicer arietinum]
Length=197

 Score =   339 bits (869),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGST+NLGLWD
Sbjct  1    MSGSRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQ+NVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPGAVPITTAQGEELRKLIGAPVYIECSSKTQKNVKAVFDAAIKVVL  178



>ref|NP_195228.1| Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana]
 ref|NP_001190916.1| Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana]
 ref|NP_001190917.1| Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana]
 ref|XP_002869113.1| hypothetical protein ARALYDRAFT_491155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_006282726.1| hypothetical protein CARUB_v10005775mg [Capsella rubella]
 ref|XP_010432356.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Camelina sativa]
 sp|Q38912.1|RAC3_ARATH RecName: Full=Rac-like GTP-binding protein ARAC3; AltName: Full=GTPase 
protein ROP6; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF40242.1|AF115470_1 Arac3 [Arabidopsis thaliana]
 gb|AAC49853.1| Rac-like protein [Arabidopsis thaliana]
 gb|AAC78241.1| Rho-like GTP binding protein [Arabidopsis thaliana]
 emb|CAA17767.1| Rho1Ps homolog/ Rac-like protein [Arabidopsis thaliana]
 emb|CAB80219.1| Rho1Ps homolog/ Rac-like protein [Arabidopsis thaliana]
 gb|AAV85673.1| At4g35020 [Arabidopsis thaliana]
 gb|AAW80876.1| At4g35020 [Arabidopsis thaliana]
 gb|EFH45372.1| hypothetical protein ARALYDRAFT_491155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE86447.1| Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana]
 gb|AEE86448.1| Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana]
 gb|AEE86449.1| Rac-like GTP-binding protein ARAC3 [Arabidopsis thaliana]
 gb|EOA15624.1| hypothetical protein CARUB_v10005775mg [Capsella rubella]
Length=198

 Score =   339 bits (869),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF   HPGA PI+TAQGEELKK+IGA  YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVL  178



>dbj|BAC41518.1| Rac GTPase [Zinnia elegans]
Length=197

 Score =   338 bits (868),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGATPITTAQGEELKK IGA  YIECSSKTQ NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGATPITTAQGEELKKTIGAPEYIECSSKTQLNVKQVFDAAIKVVL  178



>ref|XP_010692498.1| PREDICTED: rac-like GTP-binding protein 5 [Beta vulgaris subsp. 
vulgaris]
Length=196

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PI+T QGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPISTQQGEELRKVIGAPYYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010033515.1| PREDICTED: rac-like GTP-binding protein RHO1 [Eucalyptus grandis]
 gb|ABQ24036.1| RAC-like small GTPase [Eucalyptus gunnii]
 gb|KCW53192.1| hypothetical protein EUGRSUZ_J02468 [Eucalyptus grandis]
Length=197

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEEL+K+IGA  YIECSSKTQQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTQQGEELRKLIGAPAYIECSSKTQQNVKAVFDAAIRVVL  178



>ref|XP_009106240.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Brassica rapa]
 emb|CDX87656.1| BnaA07g32170D [Brassica napus]
Length=196

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEEL+K+IG+  YIECSSKTQQNVKAVFDAAIK+VL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELRKLIGSPVYIECSSKTQQNVKAVFDAAIKMVL  178



>ref|XP_004147042.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Cucumis sativus]
 ref|XP_004158373.1| PREDICTED: rac-like GTP-binding protein RAC1-like [Cucumis sativus]
 ref|XP_008457691.1| PREDICTED: rac-like GTP-binding protein RAC1 [Cucumis melo]
 ref|XP_008457692.1| PREDICTED: rac-like GTP-binding protein RAC1 [Cucumis melo]
 gb|KGN61933.1| Rac-type small GTP-binding protein [Cucumis sativus]
Length=198

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSVSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLIS+ASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISRASYENVAKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQ+L  HPG  PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLREDKQYLNEHPGIVPITTAQGEELRKLIGAPVYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_008393868.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Malus domestica]
 ref|XP_009379341.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Pyrus x bretschneideri]
Length=197

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIRVVL  178



>ref|XP_006409243.1| hypothetical protein EUTSA_v10022861mg [Eutrema salsugineum]
 dbj|BAJ34511.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ50696.1| hypothetical protein EUTSA_v10022861mg [Eutrema salsugineum]
Length=197

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSK+Q+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKSQENVKAVFDAAIRVVL  178



>ref|XP_010426684.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
 ref|XP_010426685.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Camelina sativa]
Length=197

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RF+KCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IG+ TYIECSSKTQ+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKQIGSPTYIECSSKTQENVKAVFDAAIRVVL  178



>ref|XP_007046638.1| RAC-like 1 isoform 1 [Theobroma cacao]
 gb|EOX90795.1| RAC-like 1 isoform 1 [Theobroma cacao]
Length=197

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K+IG+  YIECSSKTQQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPISTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDAAIRVVL  178



>ref|XP_010441646.1| PREDICTED: rac-like GTP-binding protein ARAC2 isoform X1 [Camelina 
sativa]
Length=201

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAPN+P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPNIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD QFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDTQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>gb|EPS66409.1| hypothetical protein M569_08365, partial [Genlisea aurea]
Length=195

 Score =   338 bits (868),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = +1

Query  334  RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWDTAGQ  513
            RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWDTAGQ
Sbjct  2    RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWDTAGQ  61

Query  514  EDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKLDLRD  693
            EDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKW+PELRHYAP VP++LVGTKLDLRD
Sbjct  62   EDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWVPELRHYAPEVPIILVGTKLDLRD  121

Query  694  DKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DKQF V+HPGA PITT+QGEELKK+IGA  YIECSSKTQQNVKAVFDAAIK+VL
Sbjct  122  DKQFFVDHPGAAPITTSQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKIVL  175



>ref|NP_199409.1| Rac-like GTP-binding protein ARAC2 [Arabidopsis thaliana]
 sp|Q38903.1|RAC2_ARATH RecName: Full=Rac-like GTP-binding protein ARAC2; AltName: Full=GTPase 
protein ROP7; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF40241.1|AF115469_1 Arac2 [Arabidopsis thaliana]
 gb|AAC49852.1| Rac-like protein; Method: conceptual translation supplied by 
author [Arabidopsis thaliana]
 dbj|BAB08242.1| Rac-like gtp binding protein ARAC2 [Arabidopsis thaliana]
 gb|AED95321.1| Rac-like GTP-binding protein ARAC2 [Arabidopsis thaliana]
Length=201

 Score =   338 bits (868),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP +P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>emb|CDY57346.1| BnaC02g47270D [Brassica napus]
Length=201

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP++P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWLPELKHYAPSIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDKQFLKDHPGAASITTAQGEELRKMIGAIKYLECSSKTQQNVKAVFDTAIRVAL  178



>ref|XP_002531163.1| rac gtpase, putative [Ricinus communis]
 gb|EEF31248.1| rac gtpase, putative [Ricinus communis]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+IGA  YIECSSKTQQNVKAVFD AI+VVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQQNVKAVFDQAIRVVL  178



>gb|KFK44134.1| hypothetical protein AALP_AA1G219700 [Arabis alpina]
Length=196

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGE+L+K+IG+A YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEDLRKLIGSAVYIECSSKTQQNVKGVFDAAIKVVL  178



>ref|XP_011086021.1| PREDICTED: rac-like GTP-binding protein RAC13 [Sesamum indicum]
Length=198

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 169/198 (85%), Positives = 184/198 (93%), Gaps = 0/198 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVN+GLWD
Sbjct  1    MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNIGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFS+ SKASYEN+ KKW+PELRHY+PNVP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSVTSKASYENIYKKWVPELRHYSPNVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVLqp  861
            DLR+D+Q+L +HPGA PITT QGEELKKMIGA  YIECS+KTQQNVKAVFD+AIKVVL+P
Sbjct  121  DLREDEQYLRDHPGAVPITTEQGEELKKMIGAVAYIECSAKTQQNVKAVFDSAIKVVLRP  180

Query  862  pkpkrkqrrkssrrCVFL  915
            PK K+K  R  SRRC FL
Sbjct  181  PKMKKKLPRCKSRRCTFL  198



>ref|XP_011099877.1| PREDICTED: rac-like GTP-binding protein RHO1 [Sesamum indicum]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HPGA PIT AQGEEL+KMIG+ +Y+ECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFDDHPGAVPITAAQGEELRKMIGSPSYVECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010548268.1| PREDICTED: rac-like GTP-binding protein ARAC11 [Tarenaya hassleriana]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PIT AQGEEL+K+IGA +YIECSSKTQ+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITAAQGEELRKLIGAPSYIECSSKTQENVKAVFDAAIRVVL  178



>gb|EYU30811.1| hypothetical protein MIMGU_mgv1a014224mg [Erythranthe guttata]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEELKK+IG+  YIECSSKTQ+NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELKKLIGSPAYIECSSKTQENVKGVFDAAIKVVL  178



>ref|XP_004146153.1| PREDICTED: rac-like GTP-binding protein ARAC1-like [Cucumis sativus]
 ref|XP_008448529.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Cucumis melo]
 ref|XP_008448530.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Cucumis melo]
 gb|KGN55647.1| hypothetical protein Csa_3G002670 [Cucumis sativus]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K+IGA  YIECSSKTQQNVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPISTAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIRVVL  178



>ref|XP_004234529.1| PREDICTED: rac-like GTP-binding protein RHO1 [Solanum lycopersicum]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K IGA +Y+ECSSKTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKTIGAPSYVECSSKTQQNVKGVFDAAIKVVL  178



>ref|XP_006281127.1| hypothetical protein CARUB_v10027157mg [Capsella rubella]
 gb|EOA14025.1| hypothetical protein CARUB_v10027157mg [Capsella rubella]
Length=201

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP++P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPSIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLREDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>ref|NP_001045712.1| Os02g0120800 [Oryza sativa Japonica Group]
 ref|NP_001105197.1| Rho-related protein from plants 9 [Zea mays]
 ref|XP_002453210.1| hypothetical protein SORBIDRAFT_04g001690 [Sorghum bicolor]
 ref|XP_004952096.1| PREDICTED: rac-like GTP-binding protein 6-like [Setaria italica]
 sp|Q6ZHA3.1|RAC6_ORYSJ RecName: Full=Rac-like GTP-binding protein 6; AltName: Full=GTPase 
protein RacB; AltName: Full=OsRac6; Flags: Precursor [Oryza 
sativa Japonica Group]
 gb|AAF91343.1|AF250327_1 small GTP-binding protein RACBP [Oryza sativa]
 gb|AAO41289.1| putative ROP family GTPase ROP9 [Zea mays]
 gb|AAO41290.1| putative ROP family GTPase ROP9 [Zea mays]
 dbj|BAD08136.1| small GTP-binding protein RACBP [Oryza sativa Japonica Group]
 dbj|BAD07596.1| small GTP-binding protein RACBP [Oryza sativa Japonica Group]
 gb|AAT84075.1| small GTP-binding protein RacB [Oryza sativa]
 dbj|BAF07626.1| Os02g0120800 [Oryza sativa Japonica Group]
 dbj|BAG91434.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94793.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56200.1| hypothetical protein OsJ_05161 [Oryza sativa Japonica Group]
 gb|EES06186.1| hypothetical protein SORBIDRAFT_04g001690 [Sorghum bicolor]
 gb|AFW69865.1| ROP family GTPase ROP9 [Zea mays]
Length=197

 Score =   338 bits (867),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K IGA  YIECSSKTQ NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVL  178



>ref|XP_009334760.1| PREDICTED: rac-like GTP-binding protein RAC1 [Pyrus x bretschneideri]
Length=197

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNL LWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++H GA PITT QGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFCIDHSGAVPITTDQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010490393.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Camelina sativa]
Length=210

 Score =   338 bits (868),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEELKK+IGA  YIECSSKTQ+NVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVL  178



>gb|KCW64122.1| hypothetical protein EUGRSUZ_G01779 [Eucalyptus grandis]
Length=199

 Score =   338 bits (866),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/179 (90%), Positives = 169/179 (94%), Gaps = 1/179 (1%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPT-DYVPTVFDNFSANVSVDGSTVNLGLW  498
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPT DYVPTVFDNFSANV VDGSTVNLGLW
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTQDYVPTVFDNFSANVVVDGSTVNLGLW  60

Query  499  DTAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTK  678
            DTAGQEDYNRLRPLSYRGADVFLLAFSL SKASYENV+KKWIPELRHYAP VP++LVGTK
Sbjct  61   DTAGQEDYNRLRPLSYRGADVFLLAFSLTSKASYENVAKKWIPELRHYAPGVPVILVGTK  120

Query  679  LDLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            LDLRDDKQF ++HPG  PITTAQGEELKK+IGAA YIECSSKTQQNVK VFDAAIKVVL
Sbjct  121  LDLRDDKQFFLDHPGTVPITTAQGEELKKLIGAAAYIECSSKTQQNVKVVFDAAIKVVL  179



>ref|XP_010029661.1| PREDICTED: rac-like GTP-binding protein RHO1 [Eucalyptus grandis]
 gb|KCW56610.1| hypothetical protein EUGRSUZ_I02331 [Eucalyptus grandis]
Length=197

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IG+  YIECSSKTQQNVKAVFD AI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGSPAYIECSSKTQQNVKAVFDQAIRVVL  178



>ref|XP_006412162.1| hypothetical protein EUTSA_v10026291mg [Eutrema salsugineum]
 gb|ESQ53615.1| hypothetical protein EUTSA_v10026291mg [Eutrema salsugineum]
Length=198

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PEL HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELTHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V HPGA PI+TAQGEELKK+IGA  YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVL  178



>gb|AAO42256.1| putative Rho1Ps homolog Rac protein [Arabidopsis thaliana]
Length=198

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF   HPGA PI+TAQGEELKK+IGA  YIECS+KTQQNVKA+FDAAIKVVL
Sbjct  121  DLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAMFDAAIKVVL  178



>ref|XP_006296623.1| hypothetical protein CARUB_v10014691mg [Capsella rubella]
 gb|EOA29521.1| hypothetical protein CARUB_v10014691mg [Capsella rubella]
Length=197

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEELKK+IGA  YIECSSKTQ+NVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPISTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVL  178



>emb|CAA10815.2| Rop subfamily GTPase [Nicotiana tabacum]
Length=197

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+  RFIKCVTVGDGAVGKTC+LISYTSNTFP DYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSAPRFIKCVTVGDGAVGKTCLLISYTSNTFPMDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|NP_001105615.1| Rho-related protein from plants2 [Zea mays]
 gb|AAD34356.1| Rop2 small GTP binding protein [Zea mays]
 gb|AAO41291.1| putative ROP family GTPase ROP2 [Zea mays]
 gb|ACF83299.1| unknown [Zea mays]
 gb|ACG32744.1| rac-like GTP-binding protein 6 [Zea mays]
 gb|ACG35157.1| rac-like GTP-binding protein 6 [Zea mays]
 gb|AFW66558.1| rho protein from plants2 [Zea mays]
Length=197

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K IGA  YIECSSKTQ NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVL  178



>ref|XP_010113318.1| Rac-like GTP-binding protein RHO1 [Morus notabilis]
 gb|EXC35325.1| Rac-like GTP-binding protein RHO1 [Morus notabilis]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEEL+K+IGA  YIECSSKTQQNVKAVFD AI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTTQGEELRKLIGATAYIECSSKTQQNVKAVFDVAIRVVL  178



>gb|ADY16660.1| ROP6 [Lotus japonicus]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+I A  YIECSSKTQQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFLDHPGAVPITTAQGEELRKLINAPAYIECSSKTQQNVKAVFDAAIRVVL  178



>gb|EYU37952.1| hypothetical protein MIMGU_mgv1a014150mg [Erythranthe guttata]
Length=199

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+L+FSLISKASYEN+ KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILSFSLISKASYENIPKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDK F V+HPGA PI+TAQGEELKK+IGA+ YIECS+KTQQNVK VFDAAIKVVL
Sbjct  121  DLRDDKHFFVDHPGAVPISTAQGEELKKLIGASAYIECSAKTQQNVKGVFDAAIKVVL  178



>gb|KHG13478.1| Rac-like GTP-binding protein 5 [Gossypium arboreum]
Length=196

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVTKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD+QF V+HPGA PI+TAQGEEL+K +G++ YIECSSKTQQNVKAVFD+AIKVVL
Sbjct  121  DLRDDQQFFVDHPGAVPISTAQGEELRKQVGSSAYIECSSKTQQNVKAVFDSAIKVVL  178



>ref|NP_179371.1| Rac-like GTP-binding protein ARAC1 [Arabidopsis thaliana]
 ref|NP_001077910.1| Rac-like GTP-binding protein ARAC1 [Arabidopsis thaliana]
 sp|Q38902.1|RAC1_ARATH RecName: Full=Rac-like GTP-binding protein ARAC1; AltName: Full=GTPase 
protein ROP3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF40237.1|AF115466_1 Arac1 [Arabidopsis thaliana]
 gb|AAC49851.1| GTP binding protein [Arabidopsis thaliana]
 gb|AAD00113.1| ATGP2 [Arabidopsis thaliana]
 gb|AAM13045.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15712.1| unknown protein [Arabidopsis thaliana]
 gb|AEC06689.1| Rac-like GTP-binding protein ARAC1 [Arabidopsis thaliana]
 gb|AEC06690.1| Rac-like GTP-binding protein ARAC1 [Arabidopsis thaliana]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEELKK+IGA  YIECSSKTQ+NVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELKKLIGAPAYIECSSKTQENVKGVFDAAIRVVL  178



>ref|XP_011034995.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Populus euphratica]
Length=196

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DL +DKQF V+HPGA PI TAQGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLLEDKQFFVDHPGAVPINTAQGEELKKLIGAPFYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_008387924.1| PREDICTED: rac-like GTP-binding protein ARAC5 [Malus domestica]
Length=196

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNL LWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLALWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPELRHYAP VP++LVGT+L
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTRL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++H GA PITT QGEELKK+IGA  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHSGAVPITTDQGEELKKLIGAPAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AGL44364.1| Rop1 [Hevea brasiliensis]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PIT AQGEEL+K+IGA  YIECSSKTQQNVK VFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITAAQGEELRKLIGAPAYIECSSKTQQNVKGVFDAAIRVVL  178



>gb|EYU40438.1| hypothetical protein MIMGU_mgv1a014185mg [Erythranthe guttata]
Length=198

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+L+FSLISKASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILSFSLISKASYENVSKKWIPELRHYAPGVPVILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF V+HPGA PIT AQGE+LKK+IGA+ YIECS+KTQQ++KAVFDAAIKVVL
Sbjct  121  DLREDKQFFVDHPGAVPITNAQGEDLKKLIGASAYIECSAKTQQHIKAVFDAAIKVVL  178



>gb|KFK34371.1| hypothetical protein AALP_AA5G136700 [Arabis alpina]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RF+KCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFVKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PI+TAQGEEL+K+IGA +YIECSSKTQ+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPISTAQGEELRKLIGAPSYIECSSKTQENVKAVFDAAIRVVL  178



>ref|XP_007017852.1| RAC-like 3 [Theobroma cacao]
 gb|EOY15077.1| RAC-like 3 [Theobroma cacao]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENV+KKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD+QF V+HPGA PI+ AQGEEL+K IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDQQFFVDHPGAVPISAAQGEELRKQIGSPAYIECSSKTQQNVKAVFDAAIKVVL  178



>gb|AFK48298.1| unknown [Medicago truncatula]
Length=203

 Score =   338 bits (866),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+I A  YIECSSK+QQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLINAPAYIECSSKSQQNVKAVFDAAIRVVL  178



>gb|ABK22108.1| unknown [Picea sitchensis]
Length=198

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+T+RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG++VNLGLWD
Sbjct  1    MSTSRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGTSVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLIS+ASYENVSKKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISRASYENVSKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLR+DKQF  +HPGA P+TT QGEEL+K IGAA YIECSSKTQQN+KAVFDAAIKVV+
Sbjct  121  DLREDKQFYADHPGALPVTTDQGEELRKQIGAAVYIECSSKTQQNIKAVFDAAIKVVI  178



>ref|NP_001232850.1| rac-like GTP-binding protein 6 [Zea mays]
 gb|ACG36489.1| rac-like GTP-binding protein 6 [Zea mays]
Length=197

 Score =   337 bits (865),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQ+DYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQZDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K IGA  YIECSSKTQ NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKQIGAPYYIECSSKTQLNVKGVFDAAIKVVL  178



>gb|AHV83603.1| ROP5 [Lotus japonicus]
Length=197

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLL FSLIS+ASYENV+KKWIPELRHYAP VP++L+GTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLCFSLISRASYENVAKKWIPELRHYAPGVPIILIGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF  +HP A PITTAQGEEL+K+IGA  YIECSSKTQ+NVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFQDHPAAVPITTAQGEELRKLIGAPVYIECSSKTQKNVKAVFDAAIKVVL  178



>ref|XP_004509382.1| PREDICTED: rac-like GTP-binding protein RHO1-like [Cicer arietinum]
Length=197

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+I A  YIECSSK+QQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLINAPAYIECSSKSQQNVKAVFDAAIRVVL  178



>ref|XP_003629271.1| Rac-like GTP-binding protein [Medicago truncatula]
 sp|Q35638.1|RHO1_PEA RecName: Full=Rac-like GTP-binding protein RHO1; AltName: Full=GTPase 
protein ROP1; Flags: Precursor [Pisum sativum]
 gb|AAA96980.1| GTP-binding protein [Pisum sativum]
 gb|AET03747.1| Rho-like GTP-binding protein [Medicago truncatula]
Length=197

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+I A  YIECSSK+QQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLINAPAYIECSSKSQQNVKAVFDAAIRVVL  178



>gb|AAM18134.1|AF498358_1 small G-protein ROP6 [Medicago truncatula]
Length=197

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+GSTVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V+HPGA PITTAQGEEL+K+I A  YIECSSK+QQNVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFVDHPGAVPITTAQGEELRKLINAPAYIECSSKSQQNVKAVFDAAIRVVL  178



>ref|XP_002865214.1| hypothetical protein ARALYDRAFT_494381 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41473.1| hypothetical protein ARALYDRAFT_494381 [Arabidopsis lyrata subsp. 
lyrata]
Length=201

 Score =   337 bits (865),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP++P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPSIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPG+  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDKQFLKDHPGSVSITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>ref|XP_004233565.1| PREDICTED: rac-like GTP-binding protein ARAC1 [Solanum lycopersicum]
 ref|XP_006361941.1| PREDICTED: rac-like GTP-binding protein ARAC1-like isoform X1 
[Solanum tuberosum]
 ref|XP_006361942.1| PREDICTED: rac-like GTP-binding protein ARAC1-like isoform X2 
[Solanum tuberosum]
Length=197

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K IGA +YIECSSKTQ+NVK VFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTIGAPSYIECSSKTQENVKGVFDAAIKVVL  178



>ref|XP_010447010.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Camelina sativa]
Length=198

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP  P++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGAPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF   HPGA PI+TAQGEELKK+IGA  YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFAEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVL  178



>ref|XP_010437541.1| PREDICTED: rac-like GTP-binding protein ARAC3 [Camelina sativa]
Length=198

 Score =   337 bits (864),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVIVDGTTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF   HPGA PI+T QGEELKK+IGA  YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFAEHPGAVPISTLQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVL  178



>gb|ABI84104.1| GTP-binding Rop/Rac GTPase [Petunia integrifolia subsp. inflata]
Length=197

 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL+HYAP VP+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELKHYAPGVPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K I A +YIECSSKTQ+NVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKTINAPSYIECSSKTQENVKAVFDAAIKVVL  178



>ref|XP_010481512.1| PREDICTED: rac-like GTP-binding protein ARAC2 isoform X1 [Camelina 
sativa]
Length=201

 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP++P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPSIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD QFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDNQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>pdb|2WBL|C Chain C, Three-Dimensional Structure Of A Binary Rop-Prone Complex
 pdb|2WBL|D Chain D, Three-Dimensional Structure Of A Binary Rop-Prone Complex
Length=180

 Score =   336 bits (862),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYT NTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTGNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP +P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIHKKWLPELKHYAPGIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVKAVFD AI+V L
Sbjct  121  DLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKAVFDTAIRVAL  178



>ref|XP_009101554.1| PREDICTED: rac-like GTP-binding protein ARAC2 [Brassica rapa]
 emb|CDY58056.1| BnaA06g40250D [Brassica napus]
Length=201

 Score =   337 bits (864),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+TARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANV VDGSTVNLGLWD
Sbjct  1    MSTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN+ KKW+PEL+HYAP +P+VLVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIYKKWLPELKHYAPTIPIVLVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQFL +HPGA  ITTAQGEEL+KMIGA  Y+ECSSKTQQNVK+VFD AI+V L
Sbjct  121  DLRDDKQFLKDHPGAASITTAQGEELRKMIGAVRYLECSSKTQQNVKSVFDTAIRVAL  178



>ref|XP_003607186.1| Rac-like GTP-binding protein [Medicago truncatula]
 gb|AAM18133.1|AF498357_1 small G-protein ROP3 [Medicago truncatula]
 gb|AES89383.1| Rho-like GTP-binding protein [Medicago truncatula]
Length=197

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGST+NLGLWD
Sbjct  1    MSGSRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD QF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQ+NVKAVFD+AIKVVL
Sbjct  121  DLRDDSQFFQDHPGAAPITTAQGEELRKLIGAPVYIECSSKTQKNVKAVFDSAIKVVL  178



>emb|CAG30067.1| small GTPase Rac4 [Medicago sativa]
Length=197

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDGST+NLGLWD
Sbjct  1    MSGSRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVDGSTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYEN++KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENIAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDD QF  +HPGA PITTAQGEEL+K+IGA  YIECSSKTQ+NVKAVFD+AIKVVL
Sbjct  121  DLRDDSQFFQDHPGAAPITTAQGEELRKLIGAPVYIECSSKTQKNVKAVFDSAIKVVL  178



>gb|AAC78242.1| Rho-like GTP binding protein [Arabidopsis thaliana]
Length=196

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV VDG+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCILISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYE+V+KKWIPELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYEHVAKKWIPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITT QGEELKK+IG+  YIECSSKTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTNQGEELKKLIGSPIYIECSSKTQQNVKAVFDAAIKVVL  178



>ref|XP_010531098.1| PREDICTED: rac-like GTP-binding protein ARAC1 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010531099.1| PREDICTED: rac-like GTP-binding protein ARAC1 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010531100.1| PREDICTED: rac-like GTP-binding protein ARAC1 isoform X3 [Tarenaya 
hassleriana]
Length=197

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVGDGAVGKTC+LISYTSNTFPTDYVPTVFDNFSANV V+G+TVNLGLWD
Sbjct  1    MSASRFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSANVVVNGATVNLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVF+LAFSLISKASYENVSKKWIPEL HYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVSKKWIPELNHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF ++HPGA PITTAQGEEL+K+IGA  YIECSSKTQ+NVKAVFDAAI+VVL
Sbjct  121  DLRDDKQFFIDHPGAVPITTAQGEELRKLIGAPAYIECSSKTQENVKAVFDAAIRVVL  178



>gb|AAB97458.1| rac-like small GTP binding protein [Brassica rapa subsp. oleifera]
Length=198

 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  322  MTTARFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVSVDGSTVNLGLWD  501
            M+ +RFIKCVTVG+GAVGKTC+LISYTSNTFPTDYVPTVFDN SANV VDG+T+NLGLWD
Sbjct  1    MSASRFIKCVTVGNGAVGKTCLLISYTSNTFPTDYVPTVFDNLSANVIVDGNTINLGLWD  60

Query  502  TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPNVPLVLVGTKL  681
            TAGQEDYNRLRPLSYRGADVFLLAFSL+SKASYENVSKKW+PELRHYAP VP++LVGTKL
Sbjct  61   TAGQEDYNRLRPLSYRGADVFLLAFSLVSKASYENVSKKWVPELRHYAPGVPIILVGTKL  120

Query  682  DLRDDKQFLVNHPGATPITTAQGEELKKMIGAATYIECSSKTQQNVKAVFDAAIKVVL  855
            DLRDDKQF V HPGA PI+TAQGEELKK+IGA  YIECS+KTQQNVKAVFDAAIKVVL
Sbjct  121  DLRDDKQFFVEHPGAVPISTAQGEELKKLIGAPAYIECSAKTQQNVKAVFDAAIKVVL  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2484844096704