BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7263_g1_i2 len=1354 path=[5600:0-175 1635:176-1353]

Length=1354
                                                                      Score     E

ref|XP_009783934.1|  PREDICTED: PHD finger protein At1g33420            385   1e-122   
ref|XP_009587240.1|  PREDICTED: PHD finger protein At1g33420            383   8e-122   
ref|XP_004236973.1|  PREDICTED: PHD finger protein At1g33420            367   1e-115   
ref|XP_006360454.1|  PREDICTED: PHD finger protein At1g33420-like       365   4e-115   
ref|XP_011083217.1|  PREDICTED: PHD finger protein At1g33420            347   4e-108   
emb|CDP21393.1|  unnamed protein product                                344   1e-106   
ref|XP_002267837.1|  PREDICTED: PHD finger protein At1g33420            313   2e-95    Vitis vinifera
gb|EYU31209.1|  hypothetical protein MIMGU_mgv1a026000mg                312   5e-95    
ref|XP_007048632.1|  RING/FYVE/PHD zinc finger superfamily protei...    301   8e-93    
ref|XP_006426400.1|  hypothetical protein CICLE_v10025026mg             305   6e-92    
ref|XP_004144350.1|  PREDICTED: PHD finger protein At1g33420-like       303   1e-91    
ref|XP_004165011.1|  PREDICTED: PHD finger protein At1g33420-like       303   2e-91    
ref|XP_006466218.1|  PREDICTED: PHD finger protein At1g33420-like       303   2e-91    
gb|KGN54749.1|  hypothetical protein Csa_4G443130                       303   4e-91    
ref|XP_008449753.1|  PREDICTED: PHD finger protein At1g33420            302   7e-91    
gb|KDP24219.1|  hypothetical protein JCGZ_25876                         300   2e-90    
ref|XP_007048631.1|  RING/FYVE/PHD zinc finger superfamily protei...    300   4e-90    
ref|XP_010096402.1|  PHD finger protein                                 295   6e-89    
ref|XP_011005581.1|  PREDICTED: PHD finger protein At1g33420-like...    293   1e-88    
ref|XP_002305350.1|  hypothetical protein POPTR_0004s14230g             295   1e-88    Populus trichocarpa [western balsam poplar]
ref|XP_002518819.1|  DNA binding protein, putative                      293   1e-87    Ricinus communis
ref|XP_011005579.1|  PREDICTED: PHD finger protein At1g33420-like...    293   1e-87    
ref|XP_007143927.1|  hypothetical protein PHAVU_007G114100g             286   8e-87    
ref|XP_010999680.1|  PREDICTED: PHD finger protein At1g33420-like       288   9e-86    
gb|KEH42842.1|  PHD finger plant-like protein                           281   1e-84    
ref|XP_007143926.1|  hypothetical protein PHAVU_007G114100g             285   3e-84    
gb|KEH42841.1|  PHD finger plant-like protein                           280   5e-84    
ref|XP_002325292.2|  hypothetical protein POPTR_0019s00330g             283   9e-84    Populus trichocarpa [western balsam poplar]
ref|XP_006589256.1|  PREDICTED: PHD finger protein At1g33420-like...    279   2e-83    
gb|KHN30528.1|  PHD finger protein                                      279   3e-83    
ref|XP_008227667.1|  PREDICTED: PHD finger protein At1g33420-like       281   4e-83    
ref|XP_003622362.1|  PHD finger protein                                 280   5e-83    
gb|KEH42843.1|  PHD finger plant-like protein                           280   2e-82    
ref|XP_003536185.1|  PREDICTED: PHD finger protein At1g33420-like...    278   9e-82    
ref|XP_003622361.1|  PHD finger protein                                 280   9e-82    
ref|XP_010252344.1|  PREDICTED: PHD finger protein At1g33420            277   3e-81    
ref|XP_004288656.1|  PREDICTED: PHD finger protein At1g33420-like       275   8e-81    
ref|XP_007212930.1|  hypothetical protein PRUPE_ppa021865mg             271   1e-80    
ref|XP_006606403.1|  PREDICTED: PHD finger protein At1g33420-like...    271   1e-80    
ref|XP_010674289.1|  PREDICTED: PHD finger protein At1g33420            273   1e-79    
ref|XP_008394231.1|  PREDICTED: PHD finger protein At1g33420-like       272   1e-79    
ref|XP_004495439.1|  PREDICTED: PHD finger protein At1g33420-like       271   4e-79    
ref|XP_007019721.1|  DNA binding protein, putative isoform 3            265   5e-79    
ref|XP_006606402.1|  PREDICTED: PHD finger protein At1g33420-like...    270   7e-79    
gb|KHN05025.1|  PHD finger protein                                      271   4e-78    
ref|XP_007019720.1|  DNA binding protein, putative isoform 2            264   5e-78    
ref|XP_008391867.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    260   2e-77    
ref|XP_009366883.1|  PREDICTED: PHD finger protein At1g33420            264   5e-77    
ref|XP_010542547.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    265   6e-77    
ref|XP_007019719.1|  DNA binding protein, putative isoform 1            264   1e-76    
ref|XP_010027490.1|  PREDICTED: PHD finger protein At1g33420-like       264   2e-76    
ref|XP_007199715.1|  hypothetical protein PRUPE_ppa002124mg             262   1e-75    
ref|XP_008237816.1|  PREDICTED: PHD finger protein At1g33420            261   1e-75    
ref|XP_006304773.1|  hypothetical protein CARUB_v10012280mg             254   7e-73    
ref|NP_564424.1|  PHD finger protein                                    252   3e-72    Arabidopsis thaliana [mouse-ear cress]
gb|EPS70707.1|  hypothetical protein M569_04052                         251   3e-72    
ref|XP_006376093.1|  PHD finger family protein                          252   4e-72    
ref|XP_004512621.1|  PREDICTED: PHD finger protein At1g33420-like       252   5e-72    
ref|XP_004292411.1|  PREDICTED: PHD finger protein At1g33420-like       251   9e-72    
ref|XP_010112064.1|  PHD finger protein                                 251   2e-71    
ref|XP_011013353.1|  PREDICTED: PHD finger protein At1g33420            250   2e-71    
ref|XP_007131323.1|  hypothetical protein PHAVU_011G004000g             250   2e-71    
gb|EPS71344.1|  hypothetical protein M569_03413                         248   1e-70    
emb|CBI16978.3|  unnamed protein product                                246   2e-69    
ref|XP_002265123.1|  PREDICTED: PHD finger protein At1g33420            245   2e-69    Vitis vinifera
ref|XP_003540842.1|  PREDICTED: PHD finger protein At1g33420-like       244   6e-69    
gb|KCW70986.1|  hypothetical protein EUGRSUZ_F04095                     243   1e-68    
ref|XP_010063730.1|  PREDICTED: PHD finger protein At1g33420            243   2e-68    
ref|XP_010499890.1|  PREDICTED: PHD finger protein At1g33420-like       239   1e-67    
ref|XP_010538899.1|  PREDICTED: PHD finger protein At1g33420-like       239   3e-67    
ref|XP_002893768.1|  PHD finger family protein                          238   8e-67    
ref|XP_006415087.1|  hypothetical protein EUTSA_v10006958mg             236   2e-66    
ref|XP_010478770.1|  PREDICTED: PHD finger protein At1g33420            236   3e-66    
ref|XP_002519951.1|  DNA binding protein, putative                      236   5e-66    Ricinus communis
ref|XP_010461171.1|  PREDICTED: PHD finger protein At1g33420-like       235   7e-66    
ref|XP_010910248.1|  PREDICTED: PHD finger protein At1g33420-like       234   1e-65    
ref|XP_008803796.1|  PREDICTED: PHD finger protein At1g33420-like       233   4e-65    
ref|XP_010930553.1|  PREDICTED: PHD finger protein At1g33420-like       231   2e-64    
gb|KHN11645.1|  PHD finger protein                                      231   2e-64    
ref|XP_003534422.1|  PREDICTED: PHD finger protein At1g33420-like       231   2e-64    
gb|KDP37798.1|  hypothetical protein JCGZ_06700                         231   3e-64    
gb|EAY76692.1|  hypothetical protein OsI_04645                          230   7e-64    Oryza sativa Indica Group [Indian rice]
ref|NP_001044975.1|  Os01g0877500                                       229   2e-63    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645112.1|  PREDICTED: PHD finger protein At1g33420-like       228   3e-63    
ref|XP_004970770.1|  PREDICTED: PHD finger protein At1g33420-like       227   8e-63    
ref|XP_008786465.1|  PREDICTED: PHD finger protein At1g33420-like       225   2e-62    
ref|XP_010927813.1|  PREDICTED: PHD finger protein At1g33420-like       224   6e-62    
ref|XP_009393484.1|  PREDICTED: PHD finger protein At1g33420-like       224   8e-62    
ref|XP_010232639.1|  PREDICTED: PHD finger protein At1g33420            222   5e-61    
ref|XP_002456731.1|  hypothetical protein SORBIDRAFT_03g041550          221   1e-60    Sorghum bicolor [broomcorn]
ref|XP_008657002.1|  PREDICTED: PHD finger protein At1g33420            220   2e-60    
ref|XP_010237811.1|  PREDICTED: PHD finger protein At1g33420-like       218   1e-59    
gb|EMT08696.1|  PHD finger protein                                      215   8e-59    
ref|XP_008802928.1|  PREDICTED: PHD finger protein At1g33420-like       214   3e-58    
emb|CDM85226.1|  unnamed protein product                                214   3e-58    
ref|XP_003605664.1|  PHD finger protein                                 211   5e-57    
gb|AES87861.2|  PHD finger plant-like protein                           211   6e-57    
ref|XP_008677470.1|  PREDICTED: hypothetical protein isoform X4         206   9e-57    
ref|NP_001159230.1|  hypothetical protein                               207   2e-56    Zea mays [maize]
ref|XP_008677465.1|  PREDICTED: hypothetical protein isoform X3         207   3e-56    
ref|XP_008677464.1|  PREDICTED: hypothetical protein isoform X2         207   8e-56    
ref|XP_006663315.1|  PREDICTED: PHD finger protein At1g33420-like       202   1e-54    
gb|EAZ17917.1|  hypothetical protein OsJ_33464                          203   2e-54    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067563.1|  Os11g0234200                                       203   3e-54    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004980335.1|  PREDICTED: PHD finger protein At1g33420-like       199   6e-53    
dbj|BAK04913.1|  predicted protein                                      197   3e-52    
ref|XP_009421161.1|  PREDICTED: PHD finger protein At1g33420-like...    196   1e-51    
ref|XP_009421159.1|  PREDICTED: PHD finger protein At1g33420-like...    196   1e-51    
ref|XP_006836898.1|  hypothetical protein AMTR_s00099p00124180          187   7e-49    
ref|XP_002449306.1|  hypothetical protein SORBIDRAFT_05g007460          178   2e-48    Sorghum bicolor [broomcorn]
gb|EAY80449.1|  hypothetical protein OsI_35630                          164   8e-41    Oryza sativa Indica Group [Indian rice]
ref|XP_001417810.1|  predicted protein                                  152   4e-36    Ostreococcus lucimarinus CCE9901
ref|XP_001780078.1|  predicted protein                                  139   2e-32    
ref|XP_001781922.1|  predicted protein                                  137   9e-32    
ref|XP_006826580.1|  hypothetical protein AMTR_s00138p00033180          138   1e-31    
ref|XP_007514134.1|  predicted protein                                  137   6e-31    
ref|XP_009405163.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    134   9e-31    
ref|XP_010034488.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    134   2e-30    
ref|XP_006826579.1|  hypothetical protein AMTR_s00138p00031220          132   8e-30    
ref|XP_006293073.1|  hypothetical protein CARUB_v10019360mg             130   3e-29    
ref|XP_003079461.1|  putative male sterility 1 protein (ISS)            129   2e-28    
gb|KDO58759.1|  hypothetical protein CISIN_1g041853mg                   126   3e-28    
ref|XP_002875094.1|  PHD finger family protein                          126   8e-28    
ref|XP_010068687.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    125   2e-27    
ref|XP_010554390.1|  PREDICTED: PHD finger protein At2g01810            125   2e-27    
ref|XP_010513908.1|  PREDICTED: PHD finger protein At2g01810-like       124   3e-27    
ref|XP_010043916.1|  PREDICTED: PHD finger protein MALE STERILITY 1     124   3e-27    
ref|XP_002533478.1|  DNA binding protein, putative                      124   5e-27    Ricinus communis
ref|XP_010278619.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    122   6e-27    
ref|XP_009592040.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    123   8e-27    
ref|XP_010502170.1|  PREDICTED: PHD finger protein At2g01810-like       123   8e-27    
ref|XP_007216520.1|  hypothetical protein PRUPE_ppa024280mg             122   1e-26    
ref|XP_002967734.1|  hypothetical protein SELMODRAFT_31178              122   1e-26    
ref|XP_002964302.1|  hypothetical protein SELMODRAFT_31177              122   2e-26    
ref|XP_010278538.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    122   2e-26    
ref|XP_006448127.1|  hypothetical protein CICLE_v10017749mg             122   2e-26    
ref|XP_006469331.1|  PREDICTED: PHD finger protein At2g01810-like       122   2e-26    
ref|XP_008244388.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    121   3e-26    
gb|EMS67490.1|  PHD finger protein MALE MEIOCYTE DEATH 1                120   3e-26    
ref|XP_010424952.1|  PREDICTED: PHD finger protein At2g01810-like       121   3e-26    
ref|XP_009101316.1|  PREDICTED: PHD finger protein At2g01810            121   4e-26    
emb|CDY17644.1|  BnaA06g34630D                                          121   4e-26    
emb|CDY36263.1|  BnaC07g21170D                                          121   4e-26    
ref|XP_011021716.1|  PREDICTED: PHD finger protein MALE STERILITY 1     120   5e-26    
ref|XP_006372523.1|  hypothetical protein POPTR_0017s02450g             120   6e-26    
ref|XP_009414350.1|  PREDICTED: PHD finger protein MALE STERILITY 1     118   6e-26    
ref|XP_004288593.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    120   6e-26    
ref|NP_001170504.1|  uncharacterized protein LOC100384509               118   8e-26    Zea mays [maize]
ref|XP_002460302.1|  hypothetical protein SORBIDRAFT_02g026200          120   8e-26    Sorghum bicolor [broomcorn]
ref|XP_004986276.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    120   1e-25    
ref|XP_006395850.1|  hypothetical protein EUTSA_v10003728mg             120   1e-25    
gb|EYU30865.1|  hypothetical protein MIMGU_mgv1a002061mg                120   1e-25    
ref|XP_006651751.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    118   1e-25    
ref|XP_002521912.1|  DNA binding protein, putative                      119   1e-25    Ricinus communis
ref|XP_008381356.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    119   2e-25    
ref|XP_006391351.1|  hypothetical protein EUTSA_v10018197mg             119   2e-25    
ref|XP_011099936.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    119   3e-25    
ref|XP_011038253.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    118   3e-25    
ref|XP_006494663.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    117   3e-25    
ref|XP_002315838.1|  hypothetical protein POPTR_0010s11170g             118   3e-25    Populus trichocarpa [western balsam poplar]
gb|AAG51303.1|AC026480_10  PHD-finger protein, putative                 118   4e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002281717.1|  PREDICTED: PHD finger protein MALE STERILITY 1     118   4e-25    Vitis vinifera
gb|KDO60815.1|  hypothetical protein CISIN_1g041583mg                   117   4e-25    
gb|EAZ28373.1|  hypothetical protein OsJ_12353                          117   5e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008644163.1|  PREDICTED: uncharacterized protein LOC100384...    118   5e-25    
ref|NP_176791.2|  PHD finger protein MALE MEIOCYTE DEATH 1              118   5e-25    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789304.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    117   5e-25    
gb|AAL58226.1|AC090882_29  putative collagen                            117   6e-25    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006494662.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    117   6e-25    
ref|XP_010528997.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    117   7e-25    
ref|XP_009370077.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    117   8e-25    
ref|NP_178290.1|  RING/FYVE/PHD zinc finger superfamily protein         117   1e-24    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003056829.1|  predicted protein                                  113   1e-24    
ref|XP_006851141.1|  hypothetical protein AMTR_s00043p00045130          113   1e-24    
gb|KDP25820.1|  hypothetical protein JCGZ_22542                         116   2e-24    
ref|XP_010229496.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    116   2e-24    
emb|CDP01658.1|  unnamed protein product                                116   2e-24    
ref|XP_002463991.1|  hypothetical protein SORBIDRAFT_01g010120          116   2e-24    Sorghum bicolor [broomcorn]
ref|XP_009770533.1|  PREDICTED: PHD finger protein At2g01810-like       116   2e-24    
ref|XP_010312719.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    116   2e-24    
ref|XP_004490840.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    115   3e-24    
gb|KDO41051.1|  hypothetical protein CISIN_1g046513mg                   115   3e-24    
ref|XP_010689687.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    115   3e-24    
ref|XP_002527531.1|  DNA binding protein, putative                      115   3e-24    Ricinus communis
ref|XP_006492305.1|  PREDICTED: PHD finger protein MALE STERILITY...    115   3e-24    
ref|XP_009620363.1|  PREDICTED: PHD finger protein At2g01810-like       115   4e-24    
dbj|BAK03548.1|  predicted protein                                      115   4e-24    
ref|XP_008343056.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    110   5e-24    
ref|XP_004956970.1|  PREDICTED: PHD finger protein MALE STERILITY...    114   6e-24    
ref|XP_006851139.1|  hypothetical protein AMTR_s00043p00044190          107   8e-24    
emb|CDY68248.1|  BnaC02g47750D                                          112   1e-23    
gb|KDP38178.1|  hypothetical protein JCGZ_04821                         114   1e-23    
ref|XP_010470485.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    114   1e-23    
gb|AES99203.2|  PHD finger protein MALE meiocyte DEATH protein          113   1e-23    
ref|NP_001063319.2|  Os09g0449000                                       113   1e-23    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006352479.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    110   2e-23    
emb|CDY50318.1|  BnaCnng19010D                                          113   2e-23    
ref|XP_003616245.1|  PHD finger protein                                 113   2e-23    
gb|EAZ09313.1|  hypothetical protein OsI_31586                          113   2e-23    Oryza sativa Indica Group [Indian rice]
gb|KDP38152.1|  hypothetical protein JCGZ_04795                         113   2e-23    
gb|KDO40585.1|  hypothetical protein CISIN_1g040083mg                   113   2e-23    
ref|XP_005646272.1|  hypothetical protein COCSUDRAFT_47922              113   2e-23    
ref|XP_010511544.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    112   2e-23    
ref|XP_006421081.1|  hypothetical protein CICLE_v10007029mg             112   2e-23    
ref|XP_006448066.1|  hypothetical protein CICLE_v10017892mg             112   2e-23    
ref|XP_002263205.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    112   3e-23    Vitis vinifera
gb|KGN55704.1|  hypothetical protein Csa_3G006660                       112   3e-23    
emb|CDY16433.1|  BnaA02g12370D                                          112   4e-23    
ref|XP_011024453.1|  PREDICTED: PHD finger protein At2g01810            112   4e-23    
ref|XP_010415158.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    112   4e-23    
ref|XP_007141934.1|  hypothetical protein PHAVU_008G238400g             112   4e-23    
ref|XP_006302059.1|  hypothetical protein CARUB_v10020044mg             110   6e-23    
ref|XP_002311539.2|  PHD finger family protein                          111   6e-23    Populus trichocarpa [western balsam poplar]
ref|XP_007040228.1|  RING/FYVE/PHD zinc finger superfamily protein      111   7e-23    
ref|XP_006352418.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    111   7e-23    
gb|KFK41037.1|  hypothetical protein AALP_AA2G077200                    111   8e-23    
ref|XP_008448613.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    110   9e-23    
ref|XP_008353887.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    110   9e-23    
ref|XP_006302058.1|  hypothetical protein CARUB_v10020044mg             110   1e-22    
ref|XP_008343055.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    110   1e-22    
ref|XP_009127470.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    110   2e-22    
ref|XP_008348744.1|  PREDICTED: PHD finger protein MALE STERILITY...    109   2e-22    
ref|XP_008381804.1|  PREDICTED: PHD finger protein MALE STERILITY 1     109   2e-22    
ref|XP_008777846.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    109   4e-22    
ref|XP_004146114.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    108   5e-22    
ref|XP_004164188.1|  PREDICTED: LOW QUALITY PROTEIN: PHD finger p...    108   6e-22    
ref|XP_010271105.1|  PREDICTED: PHD finger protein MALE STERILITY 1     107   1e-21    
ref|XP_008220957.1|  PREDICTED: PHD finger protein MALE STERILITY 1     107   1e-21    
ref|XP_006851143.1|  hypothetical protein AMTR_s00043p00048200          103   2e-21    
ref|XP_007019293.1|  RING/FYVE/PHD zinc finger superfamily protei...    107   2e-21    
ref|XP_004298641.1|  PREDICTED: PHD finger protein MALE STERILITY...    106   2e-21    
ref|XP_009350911.1|  PREDICTED: PHD finger protein MALE STERILITY...    106   2e-21    
ref|XP_002888484.1|  hypothetical protein ARALYDRAFT_894251             106   4e-21    
ref|XP_007226344.1|  hypothetical protein PRUPE_ppa022178mg             105   5e-21    
ref|XP_003518728.1|  PREDICTED: PHD finger protein MALE STERILITY...    105   6e-21    
ref|XP_010916807.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    105   6e-21    
dbj|BAK05033.1|  predicted protein                                      105   6e-21    
ref|XP_003518369.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    105   8e-21    
gb|EMT13329.1|  PHD finger protein                                      104   1e-20    
ref|XP_003544360.1|  PREDICTED: PHD finger protein MALE MEIOCYTE ...    104   1e-20    
gb|KHN39480.1|  PHD finger protein MALE MEIOCYTE DEATH 1                104   1e-20    
emb|CDP05466.1|  unnamed protein product                                104   1e-20    
ref|XP_009351795.1|  PREDICTED: PHD finger protein MALE STERILITY...    103   2e-20    
gb|EPS59525.1|  hypothetical protein M569_15279                         103   3e-20    
pdb|1WEE|A  Chain A, Solution Structure Of Phd Domain In Phd Fing...  94.4    4e-20    
ref|XP_006849470.1|  hypothetical protein AMTR_s00024p00102300          101   5e-20    
ref|XP_007157621.1|  hypothetical protein PHAVU_002G085000g             102   6e-20    
ref|XP_010319373.1|  PREDICTED: PHD finger protein MALE STERILITY 1     101   2e-19    
ref|XP_009775431.1|  PREDICTED: PHD finger protein MALE STERILITY 1     100   2e-19    
ref|XP_004490060.1|  PREDICTED: PHD finger protein MALE STERILITY...    100   2e-19    
ref|XP_003613773.1|  Histone-lysine N-methyltransferase MLL5            100   4e-19    
ref|XP_010536249.1|  PREDICTED: PHD finger protein MALE STERILITY 1   99.4    6e-19    
ref|XP_009604856.1|  PREDICTED: PHD finger protein MALE STERILITY 1   99.0    8e-19    
emb|CAN78037.1|  hypothetical protein VITISV_041469                   99.0    1e-18    Vitis vinifera
ref|XP_004236465.1|  PREDICTED: PHD finger protein At2g01810-like     98.6    1e-18    
gb|KGN50860.1|  hypothetical protein Csa_5G291680                     97.8    2e-18    
ref|XP_008456986.1|  PREDICTED: PHD finger protein MALE STERILITY 1   97.8    2e-18    
ref|XP_004140423.1|  PREDICTED: PHD finger protein MALE STERILITY...  97.8    2e-18    
ref|XP_010917298.1|  PREDICTED: PHD finger protein MALE STERILITY 1   97.4    3e-18    
ref|XP_010674317.1|  PREDICTED: PHD finger protein MALE STERILITY 1   96.3    7e-18    
ref|XP_010108961.1|  PHD finger protein MALE MEIOCYTE DEATH 1         96.3    8e-18    
gb|EYU30216.1|  hypothetical protein MIMGU_mgv1a002812mg              95.5    1e-17    
ref|XP_004156135.1|  PREDICTED: PHD finger protein MALE STERILITY...  95.1    2e-17    
ref|XP_006355027.1|  PREDICTED: PHD finger protein MALE STERILITY...  95.1    2e-17    
ref|XP_011070712.1|  PREDICTED: PHD finger protein MALE STERILITY 1   94.7    2e-17    
gb|KFK26332.1|  hypothetical protein AALP_AA8G234100                  93.2    6e-17    
ref|NP_001288391.1|  uncharacterized protein LOC103643406             88.2    1e-16    
ref|XP_009120674.1|  PREDICTED: PHD finger protein MALE STERILITY...  92.4    1e-16    
ref|XP_006289308.1|  hypothetical protein CARUB_v10002790mg           92.0    2e-16    
ref|XP_009120673.1|  PREDICTED: PHD finger protein MALE STERILITY...  92.0    2e-16    
ref|XP_008806642.1|  PREDICTED: PHD finger protein MALE STERILITY 1   91.7    2e-16    
ref|XP_010454488.1|  PREDICTED: PHD finger protein MALE STERILITY...  91.3    3e-16    
ref|XP_010421013.1|  PREDICTED: PHD finger protein MALE STERILITY 1   91.3    3e-16    
emb|CDY09415.1|  BnaA02g25950D                                        90.1    5e-16    
emb|CDX98585.1|  BnaC05g37900D                                        90.1    7e-16    
ref|XP_002963917.1|  hypothetical protein SELMODRAFT_69964            82.0    8e-16    
ref|NP_197618.1|  PHD finger protein MALE STERILITY 1                 89.4    1e-15    Arabidopsis thaliana [mouse-ear cress]
emb|CAC69663.1|  male sterility 1 protein                             89.4    1e-15    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873847.1|  hypothetical protein ARALYDRAFT_909771           82.4    3e-15    
ref|XP_006400732.1|  hypothetical protein EUTSA_v10012892mg           88.2    3e-15    
ref|XP_006660674.1|  PREDICTED: PHD finger protein MALE STERILITY...  87.4    5e-15    
emb|CDP05546.1|  unnamed protein product                              86.3    1e-14    
ref|XP_002891485.1|  hypothetical protein ARALYDRAFT_891770           80.9    1e-14    
ref|XP_002874056.1|  hypothetical protein ARALYDRAFT_489076           86.3    1e-14    
ref|XP_006851135.1|  hypothetical protein AMTR_s00043p00041500        79.3    1e-14    
ref|XP_010493299.1|  PREDICTED: PHD finger protein MALE STERILITY 1   85.9    2e-14    
emb|CDX92370.1|  BnaA10g14090D                                        85.5    2e-14    
ref|XP_005844680.1|  hypothetical protein CHLNCDRAFT_138585           82.4    2e-13    
ref|XP_003578202.1|  PREDICTED: PHD finger protein MALE STERILITY 1   82.4    2e-13    
gb|AHA86557.1|  PHD-typetranscription factor                          82.0    3e-13    
ref|XP_001695692.1|  hypothetical protein CHLREDRAFT_149807           82.0    4e-13    
gb|EPS66457.1|  hypothetical protein M569_08321                       81.3    6e-13    
ref|XP_002950120.1|  hypothetical protein VOLCADRAFT_49050            71.2    9e-12    
ref|XP_002883861.1|  hypothetical protein ARALYDRAFT_899705           69.7    1e-10    
ref|XP_002508791.1|  predicted protein                                64.7    1e-09    
ref|XP_006826582.1|  hypothetical protein AMTR_s00138p00035380        67.8    2e-09    
ref|XP_008864414.1|  hypothetical protein H310_02622                  69.7    2e-09    
ref|NP_001051078.2|  Os03g0716200                                     67.8    9e-09    
ref|XP_004298359.1|  PREDICTED: PHD finger protein At2g01810-like     67.4    1e-08    
ref|XP_008606485.1|  hypothetical protein SDRG_02670                  66.2    3e-08    
gb|KDO25213.1|  hypothetical protein SPRG_20791                       64.7    9e-08    
ref|XP_009844384.1|  hypothetical protein, variant 2                  63.2    3e-07    
ref|XP_009844385.1|  hypothetical protein, variant 3                  63.2    3e-07    
gb|EWC44013.1|  hypothetical protein DRE_01365                        62.8    3e-07    
ref|XP_009844383.1|  hypothetical protein, variant 1                  63.2    3e-07    
ref|XP_009844382.1|  hypothetical protein H257_17334                  63.2    3e-07    
ref|XP_010100223.1|  Ubiquitin carboxyl-terminal hydrolase 10         63.2    4e-07    
ref|XP_010908133.1|  PREDICTED: uncharacterized protein LOC105034615  62.8    4e-07    
ref|XP_008463099.1|  PREDICTED: dentin sialophosphoprotein isofor...  62.4    5e-07    
ref|XP_004309526.1|  PREDICTED: uncharacterized protein LOC101300304  62.8    5e-07    
ref|XP_008463097.1|  PREDICTED: probable GPI-anchored adhesin-lik...  62.8    5e-07    
ref|XP_008463095.1|  PREDICTED: dentin sialophosphoprotein isofor...  62.4    5e-07    
ref|XP_004170652.1|  PREDICTED: uncharacterized LOC101213020          62.4    5e-07    
ref|XP_008811871.1|  PREDICTED: uncharacterized protein LOC103722918  62.4    5e-07    
ref|XP_004138548.1|  PREDICTED: uncharacterized protein LOC101213020  62.4    5e-07    
ref|XP_010239729.1|  PREDICTED: uncharacterized protein LOC100830596  62.4    6e-07    
ref|XP_003535394.1|  PREDICTED: dentin sialophosphoprotein-like       62.4    6e-07    
ref|XP_004975348.1|  PREDICTED: dentin sialophosphoprotein-like       62.0    8e-07    
ref|XP_003555547.1|  PREDICTED: dentin sialophosphoprotein-like       62.0    8e-07    
ref|XP_010260668.1|  PREDICTED: uncharacterized protein LOC104599...  61.6    9e-07    
ref|XP_011109188.1|  hypothetical protein H072_3205                   61.6    1e-06    
ref|XP_007227386.1|  hypothetical protein PRUPE_ppb016870mg           60.8    1e-06    
ref|XP_002891011.1|  hypothetical protein ARALYDRAFT_473467           61.6    1e-06    
ref|XP_009401915.1|  PREDICTED: uncharacterized protein LOC103985...  61.6    1e-06    
ref|XP_009401917.1|  PREDICTED: uncharacterized protein LOC103985...  61.2    1e-06    
ref|XP_009401916.1|  PREDICTED: uncharacterized protein LOC103985...  61.2    1e-06    
ref|XP_001766854.1|  predicted protein                                58.5    1e-06    
ref|XP_007039355.1|  RING/FYVE/PHD zinc finger superfamily protei...  60.8    2e-06    
ref|XP_002518927.1|  hypothetical protein RCOM_1314010                60.8    2e-06    
emb|CDP12244.1|  unnamed protein product                              60.8    2e-06    
ref|XP_010529675.1|  PREDICTED: uncharacterized protein LOC104806458  60.8    2e-06    
ref|XP_007039353.1|  RING/FYVE/PHD zinc finger superfamily protei...  60.8    2e-06    
ref|XP_008239271.1|  PREDICTED: dentin sialophosphoprotein            60.8    2e-06    
ref|XP_007210419.1|  hypothetical protein PRUPE_ppa000509mg           60.8    2e-06    
ref|XP_008669585.1|  PREDICTED: probable GPI-anchored adhesin-lik...  60.8    2e-06    
gb|AAF25973.2|AC017118_10  F6N18.18                                   56.6    2e-06    
ref|XP_002874638.1|  PHD finger family protein                        58.2    2e-06    
ref|NP_001077646.1|  RING/FYVE/PHD zinc finger protein                60.1    3e-06    
ref|XP_007161587.1|  hypothetical protein PHAVU_001G082200g           60.1    3e-06    
gb|KDP25219.1|  hypothetical protein JCGZ_20375                       60.1    3e-06    
ref|XP_010436890.1|  PREDICTED: uncharacterized protein LOC104720710  57.8    3e-06    
gb|KHF99210.1|  hypothetical protein F383_17031                       60.1    3e-06    
ref|XP_006289408.1|  hypothetical protein CARUB_v10002908mg           58.2    3e-06    
gb|KHN04993.1|  PHD finger protein                                    59.7    4e-06    
ref|XP_002447555.1|  hypothetical protein SORBIDRAFT_06g003310        58.9    4e-06    
ref|XP_002317672.2|  hypothetical protein POPTR_0011s155801g          59.3    4e-06    
ref|XP_010499816.1|  PREDICTED: uncharacterized protein LOC104777...  59.7    4e-06    
ref|XP_010499815.1|  PREDICTED: uncharacterized protein LOC104777...  59.7    4e-06    
ref|XP_010499817.1|  PREDICTED: uncharacterized protein LOC104777...  59.7    4e-06    
ref|NP_001052269.2|  Os04g0221600                                     59.7    4e-06    
gb|EEC76812.1|  hypothetical protein OsI_14941                        59.3    5e-06    
ref|XP_010260669.1|  PREDICTED: uncharacterized protein LOC104599...  59.3    5e-06    
ref|XP_011040597.1|  PREDICTED: uncharacterized protein LOC105136808  59.3    5e-06    
ref|XP_010260670.1|  PREDICTED: uncharacterized protein LOC104599...  59.3    5e-06    
ref|XP_011037994.1|  PREDICTED: uncharacterized protein LOC105135023  59.3    6e-06    
ref|XP_002960720.1|  hypothetical protein SELMODRAFT_73068            55.1    6e-06    
gb|AAD03428.1|  contains similarity to PHD-fingers (Pfam:PF00628,...  56.6    6e-06    
ref|XP_010421973.1|  PREDICTED: uncharacterized protein LOC104707344  57.0    6e-06    
gb|EEE60542.1|  hypothetical protein OsJ_13883                        58.9    7e-06    
emb|CAD39984.3|  OSJNBb0045P24.2                                      58.9    7e-06    
ref|XP_006439203.1|  hypothetical protein CICLE_v100185871mg          58.9    7e-06    
ref|XP_002272230.1|  PREDICTED: uncharacterized protein LOC100244469  58.9    7e-06    
ref|XP_006476271.1|  PREDICTED: uncharacterized protein LOC102628...  58.9    7e-06    
ref|XP_006439202.1|  hypothetical protein CICLE_v100185871mg          58.9    8e-06    
ref|XP_010478702.1|  PREDICTED: uncharacterized protein LOC104757...  58.9    8e-06    
ref|XP_010478701.1|  PREDICTED: uncharacterized protein LOC104757...  58.9    8e-06    
ref|XP_010538863.1|  PREDICTED: uncharacterized protein LOC104813063  58.9    8e-06    
ref|XP_010053057.1|  PREDICTED: uncharacterized protein LOC104441...  58.9    8e-06    
ref|XP_010461091.1|  PREDICTED: uncharacterized protein LOC104741...  58.9    8e-06    
ref|XP_010461090.1|  PREDICTED: uncharacterized protein LOC104741...  58.9    8e-06    
gb|KFK45030.1|  hypothetical protein AALP_AA1G335000                  58.9    8e-06    
gb|KFK45031.1|  hypothetical protein AALP_AA1G335000                  58.9    8e-06    
ref|XP_010461092.1|  PREDICTED: uncharacterized protein LOC104741...  58.9    8e-06    
ref|XP_010053058.1|  PREDICTED: uncharacterized protein LOC104441...  58.9    8e-06    
ref|XP_009622828.1|  PREDICTED: uncharacterized protein LOC104114154  58.9    8e-06    
emb|CBI34604.3|  unnamed protein product                              58.5    8e-06    
ref|XP_002298965.2|  hypothetical protein POPTR_0001s45300g           58.5    8e-06    
ref|NP_192798.1|  RING/FYVE/PHD zinc finger-containing protein        56.6    8e-06    
gb|KID99448.1|  PHD-finger motif containing protein                   58.5    8e-06    
gb|KID62815.1|  PHD-finger motif containing protein                   58.5    9e-06    
gb|KID86357.1|  PHD-finger motif containing protein                   58.5    9e-06    
gb|EFZ03173.2|  PHD-finger domain-containing protein                  58.5    9e-06    
gb|EXV01157.1|  PHD-finger domain protein                             58.5    9e-06    
gb|KID74672.1|  PHD-finger motif containing protein                   58.5    9e-06    
ref|XP_006306791.1|  hypothetical protein CARUB_v10008334mg           58.5    9e-06    
ref|XP_010676928.1|  PREDICTED: uncharacterized protein LOC104892642  58.5    9e-06    
ref|XP_006415147.1|  hypothetical protein EUTSA_v10006636mg           58.5    9e-06    
gb|EYU35621.1|  hypothetical protein MIMGU_mgv1a000933mg              58.5    9e-06    
ref|XP_007816436.1|  PHD-finger motif containing protein              58.2    9e-06    
gb|KFG86613.1|  PHD-finger motif containing protein                   58.2    1e-05    
emb|CCA18791.1|  conserved hypothetical protein                       58.2    1e-05    
ref|XP_009360204.1|  PREDICTED: uncharacterized protein LOC103950...  58.5    1e-05    
ref|XP_009360203.1|  PREDICTED: uncharacterized protein LOC103950...  58.5    1e-05    
emb|CDY44653.1|  BnaA08g06870D                                        58.5    1e-05    
ref|XP_009107986.1|  PREDICTED: uncharacterized protein LOC103833...  58.2    1e-05    
ref|XP_011070397.1|  PREDICTED: uncharacterized protein LOC105156064  58.5    1e-05    
ref|XP_009107987.1|  PREDICTED: uncharacterized protein LOC103833...  58.2    1e-05    
ref|XP_008374134.1|  PREDICTED: dentin sialophosphoprotein isofor...  58.2    1e-05    
ref|XP_008374133.1|  PREDICTED: dentin sialophosphoprotein isofor...  58.2    1e-05    
emb|CDY29732.1|  BnaAnng03540D                                        58.2    1e-05    
emb|CDX84087.1|  BnaC08g07640D                                        58.2    1e-05    
ref|XP_006397031.1|  hypothetical protein EUTSA_v10029370mg           55.8    1e-05    
ref|XP_006833260.1|  hypothetical protein AMTR_s00113p00130190        58.2    1e-05    
ref|XP_008603565.1|  PHD-finger domain-containing protein             57.8    1e-05    
gb|EPS65735.1|  hypothetical protein M569_09045                       53.5    1e-05    
ref|XP_004495511.1|  PREDICTED: dentin sialophosphoprotein-like i...  57.8    1e-05    
gb|KGQ02512.1|  Nucleosome-remodeling factor subunit BPTF             57.8    1e-05    
gb|KEH42910.1|  RING/FYVE/PHD zinc finger protein, putative           57.8    1e-05    
ref|XP_004495510.1|  PREDICTED: dentin sialophosphoprotein-like i...  57.8    2e-05    
emb|CCI48086.1|  unnamed protein product                              57.4    2e-05    
ref|XP_002311554.2|  hypothetical protein POPTR_0008s13970g           55.8    3e-05    
dbj|BAC42335.1|  unknown protein                                      55.1    3e-05    
emb|CDY70642.1|  BnaAnng34480D                                        54.3    3e-05    
ref|XP_009113618.1|  PREDICTED: histone-lysine N-methyltransferas...  54.3    3e-05    
ref|XP_007810917.1|  PHD finger domain-containing protein             56.6    3e-05    
gb|KFY00853.1|  hypothetical protein O988_03057                       56.2    3e-05    
ref|XP_003174445.1|  hypothetical protein MGYG_04618                  56.6    4e-05    
ref|XP_007790206.1|  putative phd finger domain protein               56.2    4e-05    
emb|CDX99553.1|  BnaC09g24390D                                        53.9    4e-05    
ref|XP_010325318.1|  PREDICTED: uncharacterized protein LOC101260...  56.2    4e-05    
gb|KFY31648.1|  hypothetical protein V493_00929                       56.2    4e-05    
ref|XP_009531961.1|  hypothetical protein PHYSODRAFT_461463           55.8    4e-05    
ref|XP_006343768.1|  PREDICTED: microtubule-associated protein fu...  56.2    4e-05    
ref|XP_011121535.1|  hypothetical protein AOL_s00076g681              56.2    4e-05    
gb|KEY64966.1|  hypothetical protein S7711_08207                      56.2    4e-05    
gb|KFY97584.1|  hypothetical protein V500_02000                       56.6    5e-05    
ref|XP_010325314.1|  PREDICTED: uncharacterized protein LOC101260...  56.2    5e-05    
gb|KFA51807.1|  hypothetical protein S40293_05858                     56.2    5e-05    
gb|KFY69108.1|  hypothetical protein V496_00487                       56.2    5e-05    
gb|KFA79658.1|  hypothetical protein S40288_04060                     55.8    5e-05    
gb|KFY55729.1|  hypothetical protein V497_06757                       56.2    5e-05    
gb|KFY98595.1|  hypothetical protein V498_01385                       55.8    5e-05    
ref|XP_009778932.1|  PREDICTED: uncharacterized protein LOC104228...  55.8    6e-05    
gb|KDB12644.1|  PHD finger domain-containing protein                  55.5    7e-05    
gb|EQK97995.1|  PHD-finger motif containing protein                   54.7    8e-05    
gb|KFY42215.1|  hypothetical protein V494_02514                       55.1    8e-05    
gb|KFY72574.1|  hypothetical protein V499_07287                       55.1    9e-05    
gb|KFZ11475.1|  hypothetical protein V501_04760                       55.1    1e-04    
gb|ELR06158.1|  hypothetical protein GMDG_07813                       54.7    1e-04    
gb|ESZ93637.1|  hypothetical protein SBOR_5986                        54.7    1e-04    
gb|KFA60001.1|  hypothetical protein S40285_08559                     54.7    1e-04    
ref|NP_001044976.1|  Os01g0877600                                     51.6    2e-04    
ref|XP_009169106.1|  hypothetical protein T265_05762                  53.9    2e-04    
ref|XP_003010078.1|  hypothetical protein ARB_03692                   54.3    2e-04    
ref|XP_002585137.1|  predicted protein                                54.3    2e-04    
gb|EIF48383.1|  defining member of the set3 histone deacetylase c...  53.9    2e-04    
ref|XP_002848521.1|  conserved hypothetical protein                   54.3    2e-04    
ref|XP_002900691.1|  conserved hypothetical protein                   53.5    2e-04    
gb|KHJ36382.1|  putative phd finger domain protein                    53.9    2e-04    
emb|CEJ90206.1|  hypothetical protein VHEMI06005                      53.9    2e-04    
emb|CEJ90207.1|  hypothetical protein VHEMI06005                      53.9    2e-04    
dbj|GAA57028.1|  HORMA domain-containing protein 2                    53.9    3e-04    
gb|EGT42058.1|  hypothetical protein CAEBREN_00592                    53.5    3e-04    
ref|XP_006671883.1|  PHD finger domain protein                        53.1    4e-04    
gb|EGD99871.1|  PHD finger domain-containing protein                  53.1    4e-04    
gb|EZF29458.1|  hypothetical protein H101_06865                       53.1    4e-04    
gb|KDB20622.1|  hypothetical protein H109_07421                       53.1    5e-04    
gb|EGE08548.1|  PHD finger domain-containing protein                  53.1    5e-04    
ref|XP_009649454.1|  hypothetical protein VDAG_08842                  52.8    5e-04    
ref|XP_001558386.1|  hypothetical protein BC1G_03235                  52.8    5e-04    
ref|XP_003054061.1|  hypothetical protein NECHADRAFT_74403            52.8    6e-04    
gb|EZF67316.1|  hypothetical protein H104_00909                       52.8    6e-04    
ref|XP_003231733.1|  hypothetical protein TERG_08031                  52.8    6e-04    
gb|KIH90428.1|  hypothetical protein SPBR_00420                       52.4    6e-04    
dbj|GAA95541.1|  hypothetical protein E5Q_02196                       52.8    6e-04    
ref|XP_001544649.1|  predicted protein                                52.4    6e-04    
ref|XP_003023282.1|  hypothetical protein TRV_02616                   52.8    6e-04    
emb|CCD34606.1|  hypothetical protein BofuT4_P102050.1                52.4    6e-04    
ref|XP_002491094.1|  Subunit of COMPASS (Set1C), a complex which ...  52.0    6e-04    
gb|EER39682.1|  PHD finger domain-containing protein                  52.4    7e-04    
gb|KEZ41817.1|  PHD-finger domain-containing protein                  52.4    8e-04    
gb|ETK86253.1|  hypothetical protein L915_09105                       52.4    8e-04    
gb|ETM46098.1|  hypothetical protein L914_08971                       52.0    8e-04    
gb|ETO74990.1|  hypothetical protein F444_09371                       52.0    8e-04    
ref|XP_008906195.1|  hypothetical protein PPTG_12234                  52.0    8e-04    
gb|ETP16105.1|  hypothetical protein F441_09245                       52.0    8e-04    
gb|ETL39676.1|  hypothetical protein L916_09017                       52.0    8e-04    
gb|ETI46294.1|  hypothetical protein F443_09286                       52.0    8e-04    
ref|XP_007293840.1|  PHD-finger domain-containing protein             52.0    9e-04    
gb|EHK16366.1|  hypothetical protein TRIVIDRAFT_173895                51.6    0.001    



>ref|XP_009783934.1| PREDICTED: PHD finger protein At1g33420 [Nicotiana sylvestris]
Length=712

 Score =   385 bits (989),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 182/281 (65%), Positives = 225/281 (80%), Gaps = 3/281 (1%)
 Frame = +3

Query  168   VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
             ++ +LE G+  VNVNT G+     PN PS+EHL RDLKYLYECML+PQTM NH+ + K++
Sbjct  434   MEYKLERGNPMVNVNTNGNRLPCTPNFPSEEHLRRDLKYLYECMLNPQTMLNHIPLTKRE  493

Query  348   VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             + ++SA  ++DCK+FMKEYQPE+F+P     +IQLLCE+D+ ++S+  S NPPPEL++L 
Sbjct  494   LAVRSARIVLDCKQFMKEYQPERFLPIPKSDSIQLLCEVDIMEHSDVHSRNPPPELMILP  553

Query  528   SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             S+ATISDLK EA+R FQDVYLMFRRFQ +ELVGY+G+ ++T +KLLLGSAEFV VRG+ L
Sbjct  554   SDATISDLKAEATRTFQDVYLMFRRFQADELVGYSGLKEATQVKLLLGSAEFVTVRGKFL  613

Query  708   GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             GKNALSR+RMERG+E WTVDC CGAKDDDGERMLACD CG+WQHTRCAGIPDLD+VPARF
Sbjct  614   GKNALSRYRMERGVERWTVDCFCGAKDDDGERMLACDVCGVWQHTRCAGIPDLDAVPARF  673

Query  888   VCLRCSCVIGQAKTIGQMKDEFVGSAAYCVGKGLGKSMTSA  1010
             +CLRC CV     T G  KDE V   A     GLGKS+T+A
Sbjct  674   ICLRCRCVSQTTNTSGNCKDESVAGGAR---GGLGKSLTNA  711



>ref|XP_009587240.1| PREDICTED: PHD finger protein At1g33420 [Nicotiana tomentosiformis]
Length=712

 Score =   383 bits (983),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 223/281 (79%), Gaps = 3/281 (1%)
 Frame = +3

Query  168   VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
             ++ +LE G+  VNVNT  +     PN PS+EHL RDLKYLYECML+PQTM NH+ + K++
Sbjct  434   MEYKLERGNPMVNVNTNENRLPCAPNFPSEEHLRRDLKYLYECMLNPQTMLNHIPLTKRE  493

Query  348   VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             V ++SA  ++DCK+FMKEYQPE+F+P     AIQLLCE+D+ + S+  S NPPPEL++L 
Sbjct  494   VAVRSARIVLDCKQFMKEYQPERFLPIPKSDAIQLLCEVDIMEQSDVHSRNPPPELMILP  553

Query  528   SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             S+ATISDLK EA+R FQDVYLMFRRFQ +ELVGY+G+ ++T +KLLLGSAEFV VRG+ L
Sbjct  554   SDATISDLKAEATRTFQDVYLMFRRFQADELVGYSGLKEATQVKLLLGSAEFVTVRGKFL  613

Query  708   GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             GKNALSR+RMERG+E WTVDC CGAKDDDGERMLACD CG+WQHTRCAGIPDLD+VPARF
Sbjct  614   GKNALSRYRMERGVERWTVDCFCGAKDDDGERMLACDVCGVWQHTRCAGIPDLDAVPARF  673

Query  888   VCLRCSCVIGQAKTIGQMKDEFVGSAAYCVGKGLGKSMTSA  1010
             +CLRC CV     T G  KDE V   A     GLGKS+T+A
Sbjct  674   ICLRCRCVSQTTNTSGNCKDESVAGGAR---GGLGKSLTNA  711



>ref|XP_004236973.1| PREDICTED: PHD finger protein At1g33420 [Solanum lycopersicum]
Length=703

 Score =   367 bits (941),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 174/281 (62%), Positives = 217/281 (77%), Gaps = 6/281 (2%)
 Frame = +3

Query  168   VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
             ++ ++E  +  VNVNT  +     PNLPS+EHL RDLKYLY+CML+P TM+NH+ + K++
Sbjct  428   MEYKIERCNPMVNVNTNENRLPCTPNLPSEEHLRRDLKYLYDCMLNPSTMSNHVPLIKRE  487

Query  348   VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             + + SATT++DCK+F+K YQPEKF+P L   AIQ+LCE+D+ + S+  S NPPPELL+L 
Sbjct  488   IAVDSATTVLDCKQFLKVYQPEKFLPILKSDAIQVLCEVDIIEQSDVHSRNPPPELLILP  547

Query  528   SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             S+ATISDLK EASR FQDVYLMF+RFQ +ELVGY GV +ST +KLLLGSAEFV VRG+ L
Sbjct  548   SDATISDLKAEASRMFQDVYLMFKRFQADELVGYGGVNESTQIKLLLGSAEFVTVRGKFL  607

Query  708   GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             GKN LS++RMERG+E WTVDC CGAKDDDGERMLACD C +WQHTRCAGIPDLD+VPARF
Sbjct  608   GKNGLSKYRMERGMERWTVDCFCGAKDDDGERMLACDVCSVWQHTRCAGIPDLDAVPARF  667

Query  888   VCLRCSCVIGQAKTIGQMKDEFVGSAAYCVGKGLGKSMTSA  1010
             +CL+C C+       G  KDE V       G G GK++  A
Sbjct  668   ICLKCRCLHKTTNPSGNCKDESVA------GVGFGKNLAHA  702



>ref|XP_006360454.1| PREDICTED: PHD finger protein At1g33420-like [Solanum tuberosum]
Length=705

 Score =   365 bits (938),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 175/278 (63%), Positives = 217/278 (78%), Gaps = 6/278 (2%)
 Frame = +3

Query  168   VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
             ++ ++E  ++ VNVNT  +     PNLPS+EHL RDLKYLY+CML+P TM+NH+ + K+ 
Sbjct  430   MEYKIERCNSMVNVNTKENGLPCTPNLPSEEHLRRDLKYLYDCMLNPSTMSNHVPLIKRV  489

Query  348   VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             V + SATT++DCK+F+K YQPE+F+P     AIQ+LCE+D+ + S+  S NPPPELL+L 
Sbjct  490   VAVDSATTVLDCKQFLKVYQPERFLPIPKSDAIQVLCEVDIMEQSDVHSRNPPPELLILP  549

Query  528   SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             S+ATISDLK EASR FQDVYLMFRRFQ +ELVGY GV +ST +KLLLGSAEFV VRG+ L
Sbjct  550   SDATISDLKAEASRTFQDVYLMFRRFQADELVGYGGVNESTQVKLLLGSAEFVTVRGKFL  609

Query  708   GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             GKN LS++RMERG+E WTVDC CGAKDDDGERMLACD C +WQHTRCAGIPDLD+VPA+F
Sbjct  610   GKNGLSKYRMERGMERWTVDCFCGAKDDDGERMLACDVCSVWQHTRCAGIPDLDAVPAKF  669

Query  888   VCLRCSCVIGQAKTIGQMKDEFVGSAAYCVGKGLGKSM  1001
             +CLRC C+     T G  KDE V       G GLGK++
Sbjct  670   ICLRCRCLSKTMNTSGNCKDESVA------GVGLGKNL  701



>ref|XP_011083217.1| PREDICTED: PHD finger protein At1g33420 [Sesamum indicum]
Length=710

 Score =   347 bits (891),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 168/268 (63%), Positives = 203/268 (76%), Gaps = 2/268 (1%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEPGSA+V  NT+  N +   + PS+E LLRDLKY YECMLHP+TM  H+   K++
Sbjct  428  MEYRLEPGSASVQANTSM-NGFPMASYPSEERLLRDLKYFYECMLHPETMVFHVPPAKRN  486

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
            + + SAT ++DCK+F+K+YQPE+ +      A+QLLCE+DL +  E C  NPPPELLVLS
Sbjct  487  LAVSSATKILDCKQFVKDYQPERLLSTSKENAVQLLCEVDLMEQPEECCHNPPPELLVLS  546

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             +ATI+DLK+EA RAFQDVYLMFRRFQ +ELVGY GV +ST +KLLLGS EFVRVRGR L
Sbjct  547  PDATIADLKLEAMRAFQDVYLMFRRFQADELVGYGGVDESTQIKLLLGSTEFVRVRGRFL  606

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
            GKN L RFRMERG+E W VDC CGAKDDDGERMLACD C IWQHTRC+GIPD + VPA+F
Sbjct  607  GKNGLGRFRMERGIERWIVDCLCGAKDDDGERMLACDVCSIWQHTRCSGIPDSEGVPAKF  666

Query  888  VCLRCSCVIGQAKTIGQ-MKDEFVGSAA  968
             C RC  V    K+ GQ M+D     AA
Sbjct  667  FCHRCRRVAQTGKSNGQCMEDSANNVAA  694



>emb|CDP21393.1| unnamed protein product [Coffea canephora]
Length=716

 Score =   344 bits (882),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/259 (63%), Positives = 205/259 (79%), Gaps = 1/259 (0%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLE G+  + VN    N +   N PS+EHLLRDL+YLYE MLHPQTMA+++   K+D
Sbjct  436  MEFRLEHGNIPLTVNKTL-NCFPASNYPSEEHLLRDLRYLYEAMLHPQTMASYVPQAKRD  494

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
            V   SA TL+DCK+F+K+YQPEKF+ A  P AIQLLCE+DL ++S+  + NPPPELL+LS
Sbjct  495  VAYDSARTLLDCKQFVKDYQPEKFLLASKPYAIQLLCEVDLMEHSDEHAKNPPPELLILS  554

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            S+ATISDLK+EAS+ FQDVYL+F+R+Q EELVGY GV DST +KLLLG AEFVRVRG+  
Sbjct  555  SDATISDLKLEASKVFQDVYLLFKRYQAEELVGYGGVVDSTQVKLLLGPAEFVRVRGKCF  614

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
            GK++LS++RMERG+E WTVDC+CGAKDDDGERMLACDSC +WQHTRC GI D ++VP ++
Sbjct  615  GKSSLSKYRMERGVERWTVDCNCGAKDDDGERMLACDSCSVWQHTRCTGIQDSEAVPLKY  674

Query  888  VCLRCSCVIGQAKTIGQMK  944
            VCLRC       KT G  K
Sbjct  675  VCLRCRYASQAMKTTGPCK  693



>ref|XP_002267837.1| PREDICTED: PHD finger protein At1g33420 [Vitis vinifera]
 emb|CBI27702.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   313 bits (803),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 152/245 (62%), Positives = 186/245 (76%), Gaps = 1/245 (0%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            V+ RL+PGS   N   A   ++   N  S++HLL+DL++LYE +L+PQTM ++     +D
Sbjct  425  VEYRLDPGSIPSN-GIAACTDFNLSNCRSEQHLLQDLRFLYEAILNPQTMPSYGPQATRD  483

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
            + + SA  L+DCK+F+K+Y+PEK +   NP  + L C ++L + SE     PPPEL+VLS
Sbjct  484  LAVSSAAKLLDCKQFVKDYRPEKGLSITNPFGVHLSCLVELMELSEEGDTKPPPELIVLS  543

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NATISDLK+EASRAFQDVYLMF+RF+ EELVGYAGV +ST LKLLLGS E V VRGR L
Sbjct  544  PNATISDLKLEASRAFQDVYLMFKRFKAEELVGYAGVDESTQLKLLLGSIETVEVRGRCL  603

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
            GKN LSRFRMERG E WTVDC CGAKDDDGERMLACD CG+WQHTRCA IPD  +VPARF
Sbjct  604  GKNGLSRFRMERGQERWTVDCSCGAKDDDGERMLACDGCGVWQHTRCAEIPDSAAVPARF  663

Query  888  VCLRC  902
            +C RC
Sbjct  664  ICWRC  668



>gb|EYU31209.1| hypothetical protein MIMGU_mgv1a026000mg, partial [Erythranthe 
guttata]
Length=685

 Score =   312 bits (800),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/274 (58%), Positives = 194/274 (71%), Gaps = 14/274 (5%)
 Frame = +3

Query  159  VMCVQC---------RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQ  311
            V+C +C         RLE GSAT   N    NN+     PS+E LLRDLKY Y+CML P+
Sbjct  416  VVCARCASDSGAMEYRLELGSATTQSNNYL-NNFPLAIYPSEERLLRDLKYFYDCMLRPE  474

Query  312  TMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYS-ER  488
            T+  H+   K+++ + SA  ++DCK+F+K+Y P  F+      A+Q+LCE+DL ++  + 
Sbjct  475  TLVFHVAPAKRNLAVSSAMQILDCKQFVKDYHPGHFLSVPKENAVQVLCEIDLLEHHPDE  534

Query  489  CSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLL  668
             S NPPPELLVLS +ATI+DLK EA RAFQDVYLMFRRFQV+E+VGY GV +ST +KLLL
Sbjct  535  HSHNPPPELLVLSPDATIADLKQEAMRAFQDVYLMFRRFQVDEIVGYGGVDESTQIKLLL  594

Query  669  GSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRC  848
            GS EFVR+RG+ LGKN LSR+RMERG E W VDC CGAKDDDGERMLACD C IWQHTRC
Sbjct  595  GSMEFVRIRGQFLGKNGLSRYRMERGNERWIVDCLCGAKDDDGERMLACDVCSIWQHTRC  654

Query  849  AGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDE  950
             GIPD + VPARF C RC       K  GQ +DE
Sbjct  655  CGIPDSEGVPARFFCQRCRPT---TKMNGQCRDE  685



>ref|XP_007048632.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOX92789.1| RING/FYVE/PHD zinc finger superfamily protein isoform 2 [Theobroma 
cacao]
Length=491

 Score =   301 bits (771),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 199/281 (71%), Gaps = 7/281 (2%)
 Frame = +3

Query  168   VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
             ++ RLEPG  TV+V T G++  +    PS+E L RDLK+LYE +LHPQTM ++      +
Sbjct  216   LEFRLEPG--TVSVTTTGNDFRVANCPPSEEVLKRDLKFLYESILHPQTMLSYGPDLTGN  273

Query  348   VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +   SA  L+DCK+F+K Y+ EK     N   + L C+L+L D SE    +PP EL+VL 
Sbjct  274   LATSSAEKLLDCKQFVKVYKHEKLSSG-NDVVVCLSCQLELVDQSEEIGPDPPAELVVLP  332

Query  528   SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
              NAT+SDLK+EAS+AFQ+VYL FRRFQ EEL+GY GV DST +K LLGS E VRVRGR L
Sbjct  333   LNATVSDLKMEASKAFQEVYLAFRRFQAEELLGYGGVEDSTQVKHLLGSTESVRVRGRCL  392

Query  708   GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             GKN LS+FR ERG+E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GI D ++VPA+F
Sbjct  393   GKNGLSKFRAERGIERWTVDCICGAKDDDGERMLACDVCGVWQHTRCSGIKDSEAVPAKF  452

Query  888   VCLRCSCVIGQAKTIGQMKDEFVGSAAYCVGKG-LGKSMTS  1007
             VC RC   +   +T GQ KDE V S     G G  G+S+T+
Sbjct  453   VCYRCRESLYMTRTGGQCKDETVSSLG---GTGSYGESLTT  490



>ref|XP_006426400.1| hypothetical protein CICLE_v10025026mg [Citrus clementina]
 gb|ESR39640.1| hypothetical protein CICLE_v10025026mg [Citrus clementina]
Length=709

 Score =   305 bits (781),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 195/274 (71%), Gaps = 4/274 (1%)
 Frame = +3

Query  177  RLEPGSATVN-VNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVI  353
            RLE  + + N V +  D+  ++   PS E LLRDLK  +E +LHPQTM N+     +D+ 
Sbjct  432  RLEAANESFNGVTSCNDSPVVKH--PSQEILLRDLKLFFESLLHPQTMLNYGPEAIRDLA  489

Query  354  IQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSN  533
            I SAT LIDCK+FMK+Y+PEK     +   I+L C+L+L D SE    +PP E++VL  N
Sbjct  490  ISSATKLIDCKQFMKDYKPEKTSSINDSYTIRLSCQLELMDPSEDNVPDPPSEIIVLPRN  549

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
            AT+SDLK EAS AFQDVYL+FRRFQ +EL+GY+GV DST +KLLLG+AE VRVRGR LGK
Sbjct  550  ATVSDLKTEASSAFQDVYLVFRRFQADELLGYSGVDDSTQVKLLLGAAESVRVRGRCLGK  609

Query  714  NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            N LS++RMERG+E WTVDC CGAKDDDGERM ACD CG+WQHTRC+GI D D+VPARFVC
Sbjct  610  NGLSKYRMERGIERWTVDCICGAKDDDGERMFACDVCGVWQHTRCSGIHDSDAVPARFVC  669

Query  894  LRCSCVIGQAKTIGQMKDEFVGS-AAYCVGKGLG  992
             RC      +K  G  KDE   +  + C GK + 
Sbjct  670  CRCRGTEKMSKPSGFCKDENTSTDDSSCFGKSVA  703



>ref|XP_004144350.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus]
Length=668

 Score =   303 bits (775),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 192/265 (72%), Gaps = 1/265 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPGSA++N  +    + +  + PS+E+LL DL++LY+ MLHP +M N+     ++  +
Sbjct  403  RLEPGSASLNTGSDSTESSIS-SYPSEENLLLDLRFLYDAMLHPNSMVNYGPQATREAAV  461

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  LIDCK+F+K+Y+PEK    LNP +I LLCE+++ + S+  S  PPPEL++L SNA
Sbjct  462  SSALKLIDCKQFVKDYEPEKLSTKLNPFSICLLCEVEVVEDSKDNSSRPPPELVILPSNA  521

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK+EAS+AFQDVYLMFRRFQ EE+V + GV DST +KLL G  E VRVRGR   K 
Sbjct  522  TMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQVKLLFGQTESVRVRGRCQVKT  581

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
            AL+RFRMERG+E WTVDC CGAKDDDGERMLACD CG+W+HTRC+GI D D VP +FVC 
Sbjct  582  ALNRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGVWRHTRCSGIQDSDDVPGKFVCY  641

Query  897  RCSCVIGQAKTIGQMKDEFVGSAAY  971
            +C   I    T G+ + + +    Y
Sbjct  642  KCRSSIVAMNTNGETEADTLFRLGY  666



>ref|XP_004165011.1| PREDICTED: PHD finger protein At1g33420-like [Cucumis sativus]
Length=668

 Score =   303 bits (775),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 192/265 (72%), Gaps = 1/265 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPGSA++N  +    + +  + PS+E+LL DL++LY+ MLHP +M N+     ++  +
Sbjct  403  RLEPGSASLNTGSDSTESSIS-SYPSEENLLLDLRFLYDAMLHPNSMVNYGPQATREAAV  461

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  LIDCK+F+K+Y+PEK    LNP +I LLCE+++ + S+  S  PPPEL++L SNA
Sbjct  462  SSALKLIDCKQFVKDYEPEKLSTKLNPFSICLLCEVEVVEDSKDNSSRPPPELVILPSNA  521

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK+EAS+AFQDVYLMFRRFQ EE+V + GV DST +KLL G  E VRVRGR   K 
Sbjct  522  TMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQVKLLFGQTESVRVRGRCQVKT  581

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
            AL+RFRMERG+E WTVDC CGAKDDDGERMLACD CG+W+HTRC+GI D D VP +FVC 
Sbjct  582  ALNRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGVWRHTRCSGIQDSDDVPGKFVCY  641

Query  897  RCSCVIGQAKTIGQMKDEFVGSAAY  971
            +C   I    T G+ + + +    Y
Sbjct  642  KCRSSIVAMNTNGETEADTLFRLGY  666



>ref|XP_006466218.1| PREDICTED: PHD finger protein At1g33420-like [Citrus sinensis]
Length=709

 Score =   303 bits (777),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 193/274 (70%), Gaps = 4/274 (1%)
 Frame = +3

Query  177  RLEPGSATVN-VNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVI  353
            RLE  + + N V +  D+  ++   PS E LLRDLK  +E +LHPQTM N+     +D+ 
Sbjct  432  RLEAANESFNGVTSCNDSPVVKH--PSQEILLRDLKLFFESLLHPQTMLNYGPEAIRDLA  489

Query  354  IQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSN  533
            I SAT LIDCK+FMK+Y+PEK     +   I+L C+L+L D SE    +PP E++VL  N
Sbjct  490  ISSATKLIDCKQFMKDYKPEKTSSINDSYTIRLSCQLELMDPSEDNVPDPPSEIIVLPRN  549

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
            AT+SDLK EAS AFQDVYL+FRRFQ EEL+GY+GV DST +KLLLG+AE VRVRGR  GK
Sbjct  550  ATVSDLKTEASSAFQDVYLVFRRFQAEELLGYSGVDDSTQVKLLLGAAESVRVRGRCPGK  609

Query  714  NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            N LS++RMERG+E WTVDC CGAKDDDGERM ACD CG+WQHTRC+GI D D+VPARFVC
Sbjct  610  NGLSKYRMERGIERWTVDCICGAKDDDGERMFACDVCGVWQHTRCSGIHDSDAVPARFVC  669

Query  894  LRCSCVIGQAKTIGQMKDEFVGS-AAYCVGKGLG  992
             RC      +K  G  KDE   +    C GK L 
Sbjct  670  CRCRGTEQMSKPSGFCKDENTSTDDNSCFGKSLA  703



>gb|KGN54749.1| hypothetical protein Csa_4G443130 [Cucumis sativus]
Length=705

 Score =   303 bits (775),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 192/265 (72%), Gaps = 1/265 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPGSA++N  +    + +  + PS+E+LL DL++LY+ MLHP +M N+     ++  +
Sbjct  440  RLEPGSASLNTGSDSTESSIS-SYPSEENLLLDLRFLYDAMLHPNSMVNYGPQATREAAV  498

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  LIDCK+F+K+Y+PEK    LNP +I LLCE+++ + S+  S  PPPEL++L SNA
Sbjct  499  SSALKLIDCKQFVKDYEPEKLSTKLNPFSICLLCEVEVVEDSKDNSSRPPPELVILPSNA  558

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK+EAS+AFQDVYLMFRRFQ EE+V + GV DST +KLL G  E VRVRGR   K 
Sbjct  559  TMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQVKLLFGQTESVRVRGRCQVKT  618

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
            AL+RFRMERG+E WTVDC CGAKDDDGERMLACD CG+W+HTRC+GI D D VP +FVC 
Sbjct  619  ALNRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGVWRHTRCSGIQDSDDVPGKFVCY  678

Query  897  RCSCVIGQAKTIGQMKDEFVGSAAY  971
            +C   I    T G+ + + +    Y
Sbjct  679  KCRSSIVAMNTNGETEADTLFRLGY  703



>ref|XP_008449753.1| PREDICTED: PHD finger protein At1g33420 [Cucumis melo]
Length=702

 Score =   302 bits (773),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 190/265 (72%), Gaps = 1/265 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPGSA +N       + +  + PS+E+LL DL++LY+ MLHP +M N+     ++  +
Sbjct  437  RLEPGSALLNTGLDSTESSI-SSYPSEENLLLDLRFLYDAMLHPNSMVNYGPQATREAAV  495

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  LIDCK+F+K+Y+PEK    LNP +I LLCE+++ + S+  S  PPPEL++L SNA
Sbjct  496  SSALKLIDCKQFVKDYKPEKLSTMLNPFSICLLCEVEVVEDSKDNSSRPPPELVILPSNA  555

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK+EAS+AFQDVYLMFRRFQ EE+V + GV DST +KLL G  E VR+RG+   K 
Sbjct  556  TMSDLKLEASKAFQDVYLMFRRFQAEEIVDHGGVDDSTQVKLLFGQTESVRIRGKCQVKT  615

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
            AL+RFRMERG+E WTVDC CGAKDDDGERMLACD CG+W+HTRC+GI D D VP +FVC 
Sbjct  616  ALNRFRMERGVERWTVDCSCGAKDDDGERMLACDLCGVWRHTRCSGIQDSDDVPGKFVCY  675

Query  897  RCSCVIGQAKTIGQMKDEFVGSAAY  971
            +C   I    T G+ + + +    Y
Sbjct  676  KCRSSIVSMNTNGETEADTLFRLGY  700



>gb|KDP24219.1| hypothetical protein JCGZ_25876 [Jatropha curcas]
Length=677

 Score =   300 bits (768),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 146/258 (57%), Positives = 189/258 (73%), Gaps = 11/258 (4%)
 Frame = +3

Query  177  RLEPGSA-----TVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCK  341
            RLEPG+      T+ + ++G         PS+E L++DLK+LYEC+LHP+ M ++     
Sbjct  426  RLEPGNPPSSGLTIGIGSSG------ITCPSEEKLMQDLKFLYECLLHPRDMVSYGTEAT  479

Query  342  KDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLV  521
            + + I SA  L+DCK+F+KEY  EK     NP  + LLC++++ D +E  + + PPEL+V
Sbjct  480  RALAIGSAERLLDCKQFVKEYAAEKMSSITNPPVMCLLCDVEIMDLTEENATSHPPELIV  539

Query  522  LSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR  701
            L  NAT+ DLK+EAS+AFQ+VYLMF+RFQ EEL+GY GV DST +KLLLGS EFV+VRGR
Sbjct  540  LPQNATVYDLKLEASKAFQEVYLMFKRFQAEELLGYRGVDDSTQVKLLLGSTEFVKVRGR  599

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              GKNALS+FRMERG+E WTVDC CGAKDDDGERMLACD CG+WQHTRC+ IPD++SVPA
Sbjct  600  CHGKNALSKFRMERGIERWTVDCICGAKDDDGERMLACDVCGVWQHTRCSHIPDVESVPA  659

Query  882  RFVCLRCSCVIGQAKTIG  935
            +FVC RC       K+ G
Sbjct  660  KFVCRRCRVAGEVTKSTG  677



>ref|XP_007048631.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOX92788.1| RING/FYVE/PHD zinc finger superfamily protein isoform 1 [Theobroma 
cacao]
Length=700

 Score =   300 bits (768),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 159/281 (57%), Positives = 199/281 (71%), Gaps = 7/281 (2%)
 Frame = +3

Query  168   VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
             ++ RLEPG  TV+V T G++  +    PS+E L RDLK+LYE +LHPQTM ++      +
Sbjct  425   LEFRLEPG--TVSVTTTGNDFRVANCPPSEEVLKRDLKFLYESILHPQTMLSYGPDLTGN  482

Query  348   VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +   SA  L+DCK+F+K Y+ EK     N   + L C+L+L D SE    +PP EL+VL 
Sbjct  483   LATSSAEKLLDCKQFVKVYKHEKLSSG-NDVVVCLSCQLELVDQSEEIGPDPPAELVVLP  541

Query  528   SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
              NAT+SDLK+EAS+AFQ+VYL FRRFQ EEL+GY GV DST +K LLGS E VRVRGR L
Sbjct  542   LNATVSDLKMEASKAFQEVYLAFRRFQAEELLGYGGVEDSTQVKHLLGSTESVRVRGRCL  601

Query  708   GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             GKN LS+FR ERG+E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GI D ++VPA+F
Sbjct  602   GKNGLSKFRAERGIERWTVDCICGAKDDDGERMLACDVCGVWQHTRCSGIKDSEAVPAKF  661

Query  888   VCLRCSCVIGQAKTIGQMKDEFVGSAAYCVGKG-LGKSMTS  1007
             VC RC   +   +T GQ KDE V S     G G  G+S+T+
Sbjct  662   VCYRCRESLYMTRTGGQCKDETVSSLG---GTGSYGESLTT  699



>ref|XP_010096402.1| PHD finger protein [Morus notabilis]
 gb|EXB64073.1| PHD finger protein [Morus notabilis]
Length=645

 Score =   295 bits (756),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 153/291 (53%), Positives = 198/291 (68%), Gaps = 15/291 (5%)
 Frame = +3

Query  162  MCVQCRLEPGSATVN-------VNTAGDNNYMRPNLPS---DEHLLRDLKYLYECMLHPQ  311
            M V  RL P +           V+  G  + +  ++ S   +E LL+DLKYLYEC+LHP+
Sbjct  350  MVVSARLNPDTGAFEYRLELGRVSMKGSADCIGVSVSSTRAEERLLQDLKYLYECLLHPR  409

Query  312  TMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERC  491
            TM +++    +D+ I SA  L+DCK+F+KEY+ EK +   +P    L C+++L D  E  
Sbjct  410  TMIDYIPQATRDLAISSAEKLLDCKQFVKEYETEK-ISNTSPSFTLLSCQVELVDEIEEI  468

Query  492  SVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLG  671
            S  PPPEL++LS+NAT+SDLK+EAS+AFQDVYLMF+RF  +EL+ Y+GV +ST +K LLG
Sbjct  469  STIPPPELVILSANATVSDLKLEASKAFQDVYLMFKRFHADELLDYSGVDESTQVKCLLG  528

Query  672  SAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCA  851
            S  FVR+RGR   K+ LSRFRMERG+E WTVDC CGAKDDDGERMLACD+CG+WQHTRC+
Sbjct  529  STGFVRLRGRCHVKHGLSRFRMERGVERWTVDCSCGAKDDDGERMLACDACGVWQHTRCS  588

Query  852  GIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDEFV----GSAAYCVGKGLG  992
            GI D + VPARFVC RC   +   KT    KD        SA+ CV KGL 
Sbjct  589  GISDSELVPARFVCRRCRSALLTPKTGAFCKDAVTTKVGNSASSCVDKGLA  639



>ref|XP_011005581.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Populus 
euphratica]
Length=570

 Score =   293 bits (749),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 178/242 (74%), Gaps = 1/242 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPG+ T+N + A   + +  N PS+E+L++DL++LYE ML PQTM +  H    D  I
Sbjct  325  RLEPGNPTLNSSAAAIGSSV-INCPSEENLIQDLRFLYENMLLPQTMLSFGHEVTSDARI  383

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  L+DCK+FMK+Y   +      P +I L CE+ + D  E    N PPE +VL S+A
Sbjct  384  ISARKLLDCKQFMKDYNKCETTVVSVPNSISLSCEVVIVDRLEENVPNLPPETVVLPSSA  443

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+ DLK EASRAFQDVYLMFRRF  EEL+GY+GV DST +KLL+GS E V++RGR LGKN
Sbjct  444  TVFDLKREASRAFQDVYLMFRRFHAEELLGYSGVDDSTQVKLLIGSTESVQLRGRCLGKN  503

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
             L +FRMERG E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GIPD DSVP +FVCL
Sbjct  504  GLGKFRMERGTEGWTVDCCCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDSVPTKFVCL  563

Query  897  RC  902
            RC
Sbjct  564  RC  565



>ref|XP_002305350.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa]
 gb|EEE85861.1| hypothetical protein POPTR_0004s14230g [Populus trichocarpa]
Length=688

 Score =   295 bits (756),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 149/242 (62%), Positives = 178/242 (74%), Gaps = 1/242 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPG+ ++N +TA          PS+E+L++DL++LYE ML PQTM +  H    D  I
Sbjct  443  RLEPGNPSLN-STAAAIGSTVITCPSEENLIQDLRFLYENMLLPQTMLSFGHEVTSDAGI  501

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  L+DCK+FMK+Y   +   A  P  I L CE+++ D  E    N PPE +VL SNA
Sbjct  502  ISARKLLDCKQFMKDYNKCETTVASVPNTIFLSCEVEIVDQLEENVPNLPPETVVLPSNA  561

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+ DLK EASRAFQDVYLMFRRF  EEL+GY+GV DST +KLL+GSAE V+ RGR LGKN
Sbjct  562  TVFDLKREASRAFQDVYLMFRRFHAEELLGYSGVDDSTQVKLLIGSAESVQFRGRCLGKN  621

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
             L +FRMERG E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GIPD DSVPA+FVCL
Sbjct  622  GLGKFRMERGTEGWTVDCCCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDSVPAKFVCL  681

Query  897  RC  902
            RC
Sbjct  682  RC  683



>ref|XP_002518819.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43744.1| DNA binding protein, putative [Ricinus communis]
Length=677

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 179/242 (74%), Gaps = 2/242 (1%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPG+   N       + +  + PS+E LL+DL++LYEC+LHP+TM +++    KD   
Sbjct  426  RLEPGNPPSNCTIGIGTSAI--SCPSEESLLQDLRFLYECLLHPKTMVSYVTEATKDFAS  483

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  L+DCK+F+KEY  E   P  NP  + L C +++ D  E  S N PPEL+VL  NA
Sbjct  484  GSAEKLLDCKQFVKEYMAENIPPTTNPSVLCLSCNVEIMDEMEENSPNHPPELIVLPPNA  543

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK+EASRAFQ+VYLMF+RF+ EEL+GY+GV DST +KLLL S E V VRGR LGKN
Sbjct  544  TVSDLKLEASRAFQEVYLMFKRFRGEELLGYSGVDDSTQVKLLLESVECVVVRGRCLGKN  603

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
             L ++RMERG+E WT+DC CGAK+DDGERMLACD CG+WQHTRC+GI D DSVPA+F+C 
Sbjct  604  GLGKYRMERGIERWTIDCSCGAKNDDGERMLACDVCGVWQHTRCSGILDSDSVPAKFICR  663

Query  897  RC  902
            RC
Sbjct  664  RC  665



>ref|XP_011005579.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Populus 
euphratica]
Length=676

 Score =   293 bits (749),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 178/242 (74%), Gaps = 1/242 (0%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPG+ T+N + A   + +  N PS+E+L++DL++LYE ML PQTM +  H    D  I
Sbjct  431  RLEPGNPTLNSSAAAIGSSV-INCPSEENLIQDLRFLYENMLLPQTMLSFGHEVTSDARI  489

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             SA  L+DCK+FMK+Y   +      P +I L CE+ + D  E    N PPE +VL S+A
Sbjct  490  ISARKLLDCKQFMKDYNKCETTVVSVPNSISLSCEVVIVDRLEENVPNLPPETVVLPSSA  549

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+ DLK EASRAFQDVYLMFRRF  EEL+GY+GV DST +KLL+GS E V++RGR LGKN
Sbjct  550  TVFDLKREASRAFQDVYLMFRRFHAEELLGYSGVDDSTQVKLLIGSTESVQLRGRCLGKN  609

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
             L +FRMERG E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GIPD DSVP +FVCL
Sbjct  610  GLGKFRMERGTEGWTVDCCCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDSVPTKFVCL  669

Query  897  RC  902
            RC
Sbjct  670  RC  671



>ref|XP_007143927.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
 gb|ESW15921.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
Length=499

 Score =   286 bits (731),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 184/258 (71%), Gaps = 4/258 (2%)
 Frame = +3

Query  219  GDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
             +NN      PS+++LL+ L+YLY+ +LHPQ M N++    + + + S   L DCK+F+K
Sbjct  234  ANNNSSASKYPSEDNLLQCLRYLYDSLLHPQMMVNYVEAGTRTLAMSSVQKLFDCKQFVK  293

Query  399  EYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQ  578
            +Y PE  +P  +   +++ C+++L D SE   V  PPEL+VL  NAT+++LK +A+ AFQ
Sbjct  294  DYSPE-LLPLSDLHKLRISCQVELVDESEDPEVIAPPELIVLPMNATVAELKSQAANAFQ  352

Query  579  DVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESW  758
            DVYLMFRRFQV+EL GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE W
Sbjct  353  DVYLMFRRFQVDELEGYSGVEDSTLVKLLLGSKDVVCVRGRCIGKNGLSKFRMERGLERW  412

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQ  938
            TVDC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVCL+C     + K+ G 
Sbjct  413  TVDCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCLKCQTSESKLKSGGH  472

Query  939  MKDEF---VGSAAYCVGK  983
             KDE    V ++  C GK
Sbjct  473  CKDETVTNVSTSTSCFGK  490



>ref|XP_010999680.1| PREDICTED: PHD finger protein At1g33420-like [Populus euphratica]
Length=692

 Score =   288 bits (737),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 144/246 (59%), Positives = 180/246 (73%), Gaps = 4/246 (2%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPG+ ++N      ++ +    PS+ +L++DL++LY+ MLHPQTM ++      D I 
Sbjct  439  RLEPGNPSLNSPATTGSSVI--TCPSEGNLIQDLRFLYDNMLHPQTMMSYGPEATSDAI-  495

Query  357  QSATTLIDCKKFMKEYQP-EKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSN  533
             SA  L+DCK+FMK+Y   E    A NP  I L CE+++ D  E    + PPE++VL SN
Sbjct  496  SSARKLLDCKQFMKDYNKCETTASASNPPTICLSCEVEIVDQLEENVPDLPPEIIVLPSN  555

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
            AT+ DLK+EASRAFQDVYLMFRRF  EEL+GY+GV DST +KLL+GS E VRV+GR LGK
Sbjct  556  ATVFDLKLEASRAFQDVYLMFRRFHAEELLGYSGVDDSTQVKLLIGSTESVRVKGRCLGK  615

Query  714  NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            N L +FRMERG E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GIPD D VPA+FVC
Sbjct  616  NGLGKFRMERGTERWTVDCRCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDPVPAKFVC  675

Query  894  LRCSCV  911
            + C  V
Sbjct  676  VGCRGV  681



>gb|KEH42842.1| PHD finger plant-like protein [Medicago truncatula]
Length=537

 Score =   281 bits (719),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 185/267 (69%), Gaps = 7/267 (3%)
 Frame = +3

Query  204   NVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDC  383
             N N++G         PS+E+LL+ L+YLY+ +LHP+ M N++    + + + SA  L+DC
Sbjct  272   NHNSSGSKR------PSEENLLQCLRYLYDSLLHPRMMLNYVDEETRTLAMSSAQKLLDC  325

Query  384   KKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEA  563
             K+ +K+Y  E  +P  +   +++ C+++L D SE      PPE++VL  NAT+SDLK+EA
Sbjct  326   KQLVKDYCSE-MLPVSDLYKLRISCQVELVDQSEDTEAKIPPEIIVLPMNATVSDLKIEA  384

Query  564   SRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMER  743
             ++AFQ+VYLMFR+FQV+ELVGY GV DST +K LLGS E V VRG+  GKN LS+FRMER
Sbjct  385   AKAFQEVYLMFRKFQVDELVGYGGVEDSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMER  444

Query  744   GLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQA  923
             GLE WTV+C CGAKDDDGERM+ACD CG+W+HTRC GIPD   VPARFVC RC     + 
Sbjct  445   GLERWTVECSCGAKDDDGERMMACDMCGVWRHTRCFGIPDTAPVPARFVCSRCQNCDSKL  504

Query  924   KTIGQMKDEFVGSAAYCVGKGLGKSMT  1004
             K+ G  KDE V S     G  +G S +
Sbjct  505   KSGGHCKDETVASVTTTSGSYMGNSFS  531



>ref|XP_007143926.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
 gb|ESW15920.1| hypothetical protein PHAVU_007G114100g [Phaseolus vulgaris]
Length=712

 Score =   285 bits (728),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 140/258 (54%), Positives = 184/258 (71%), Gaps = 4/258 (2%)
 Frame = +3

Query  219  GDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
             +NN      PS+++LL+ L+YLY+ +LHPQ M N++    + + + S   L DCK+F+K
Sbjct  447  ANNNSSASKYPSEDNLLQCLRYLYDSLLHPQMMVNYVEAGTRTLAMSSVQKLFDCKQFVK  506

Query  399  EYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQ  578
            +Y PE  +P  +   +++ C+++L D SE   V  PPEL+VL  NAT+++LK +A+ AFQ
Sbjct  507  DYSPE-LLPLSDLHKLRISCQVELVDESEDPEVIAPPELIVLPMNATVAELKSQAANAFQ  565

Query  579  DVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESW  758
            DVYLMFRRFQV+EL GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE W
Sbjct  566  DVYLMFRRFQVDELEGYSGVEDSTLVKLLLGSKDVVCVRGRCIGKNGLSKFRMERGLERW  625

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQ  938
            TVDC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVCL+C     + K+ G 
Sbjct  626  TVDCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCLKCQTSESKLKSGGH  685

Query  939  MKDEF---VGSAAYCVGK  983
             KDE    V ++  C GK
Sbjct  686  CKDETVTNVSTSTSCFGK  703



>gb|KEH42841.1| PHD finger plant-like protein [Medicago truncatula]
Length=565

 Score =   280 bits (717),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 180/252 (71%), Gaps = 1/252 (0%)
 Frame = +3

Query  249   PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
             PS+E+LL+ L+YLY+ +LHP+ M N++    + + + SA  L+DCK+ +K+Y  E  +P 
Sbjct  309   PSEENLLQCLRYLYDSLLHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSE-MLPV  367

Query  429   LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
              +   +++ C+++L D SE      PPE++VL  NAT+SDLK+EA++AFQ+VYLMFR+FQ
Sbjct  368   SDLYKLRISCQVELVDQSEDTEAKIPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQ  427

Query  609   VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
             V+ELVGY GV DST +K LLGS E V VRG+  GKN LS+FRMERGLE WTV+C CGAKD
Sbjct  428   VDELVGYGGVEDSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKD  487

Query  789   DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDEFVGSAA  968
             DDGERM+ACD CG+W+HTRC GIPD   VPARFVC RC     + K+ G  KDE V S  
Sbjct  488   DDGERMMACDMCGVWRHTRCFGIPDTAPVPARFVCSRCQNCDSKLKSGGHCKDETVASVT  547

Query  969   YCVGKGLGKSMT  1004
                G  +G S +
Sbjct  548   TTSGSYMGNSFS  559



>ref|XP_002325292.2| hypothetical protein POPTR_0019s00330g [Populus trichocarpa]
 gb|EEE99673.2| hypothetical protein POPTR_0019s00330g [Populus trichocarpa]
Length=683

 Score =   283 bits (723),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 142/246 (58%), Positives = 178/246 (72%), Gaps = 4/246 (2%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEPG+ ++N      ++ +    PS+ +L++DL++LY+ MLHPQTM +       D I 
Sbjct  430  RLEPGNPSLNSPATTGSSVI--TCPSEGNLIQDLRFLYDNMLHPQTMMSSGPEATSDAI-  486

Query  357  QSATTLIDCKKFMKEYQP-EKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSN  533
             SA  L+DCK+FMK+Y   E      NP  I L C++++ D  E    + PPE++VL SN
Sbjct  487  SSARKLLDCKQFMKDYNKCETTSSPSNPPTICLSCQVEIVDQLEENVPDLPPEIIVLPSN  546

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
            AT+ DLK+EASRAFQDVYLMFRRF  EEL+GY+GV DST +KLL+GS E VRV+GR LGK
Sbjct  547  ATVFDLKLEASRAFQDVYLMFRRFHAEELLGYSGVDDSTQVKLLIGSTESVRVQGRCLGK  606

Query  714  NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            N L +FRMERG E WTVDC CGAKDDDGERMLACD CG+WQHTRC+GIPD D VPA+FVC
Sbjct  607  NGLGKFRMERGTERWTVDCRCGAKDDDGERMLACDVCGVWQHTRCSGIPDSDPVPAKFVC  666

Query  894  LRCSCV  911
            + C  V
Sbjct  667  VGCRGV  672



>ref|XP_006589256.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Glycine 
max]
Length=566

 Score =   279 bits (713),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 181/259 (70%), Gaps = 4/259 (2%)
 Frame = +3

Query  219  GDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
             +NN      PS+E+LL+ L+YLY+ +LHPQ M N+     + +++ SA  L DCK+F+K
Sbjct  303  ANNNSSGSKYPSEENLLQCLRYLYDSLLHPQMMVNY-EAGTRTLVMSSAQKLFDCKQFVK  361

Query  399  EYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQ  578
            +Y PE  +P  + +  +L C ++L D  E      PPEL+VL  NAT+++LK +A+ AFQ
Sbjct  362  DYNPE-MLPLSDSQMFRLSCHVELVDEFEDSEAITPPELIVLPLNATVAELKNQAANAFQ  420

Query  579  DVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESW  758
            DVYLMFRRFQV+EL GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE W
Sbjct  421  DVYLMFRRFQVDELHGYSGVDDSTLVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERW  480

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQ  938
            TVDC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVC +C     + K+ G 
Sbjct  481  TVDCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCQKCQHSESKLKSSGH  540

Query  939  MKDEFVG--SAAYCVGKGL  989
             KDE V   S + C   GL
Sbjct  541  CKDETVTNVSGSSCFRNGL  559



>gb|KHN30528.1| PHD finger protein [Glycine soja]
Length=589

 Score =   279 bits (713),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 181/259 (70%), Gaps = 4/259 (2%)
 Frame = +3

Query  219  GDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
             +NN      PS+E+LL+ L+YLY+ +LHPQ M N+     + +++ SA  L DCK+F+K
Sbjct  326  ANNNSSGSKYPSEENLLQCLRYLYDSLLHPQMMVNY-EAGTRTLVMSSAQKLFDCKQFVK  384

Query  399  EYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQ  578
            +Y PE  +P  + +  +L C ++L D  E      PPEL+VL  NAT+++LK +A+ AFQ
Sbjct  385  DYNPE-MLPLSDSQMFRLSCHVELVDEFEDSEAITPPELIVLPLNATVAELKNQAANAFQ  443

Query  579  DVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESW  758
            DVYLMFRRFQV+EL GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE W
Sbjct  444  DVYLMFRRFQVDELHGYSGVDDSTLVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERW  503

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQ  938
            TVDC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVC +C     + K+ G 
Sbjct  504  TVDCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCQKCQHSESKLKSSGH  563

Query  939  MKDEFVG--SAAYCVGKGL  989
             KDE V   S + C   GL
Sbjct  564  CKDETVTNVSGSSCFRNGL  582



>ref|XP_008227667.1| PREDICTED: PHD finger protein At1g33420-like [Prunus mume]
Length=712

 Score =   281 bits (720),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 192/277 (69%), Gaps = 4/277 (1%)
 Frame = +3

Query  177   RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
             RLE GSA+   +TA   + +   L S+E +L D++ LYE ML PQTM  ++    +D+ I
Sbjct  433   RLEAGSASSKGSTACTGSSISSRL-SEETILLDMRCLYEAMLQPQTMMKNVPQVTRDLTI  491

Query  357   QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSER-CSVNPPPELLVLSSN  533
              SA  L+ CK+F+K+Y+PEK +   +P    +LC ++ TD SE   S+NPPPEL+VLS N
Sbjct  492   SSAEKLLYCKQFVKDYKPEK-MSTNDPSVTCVLCRVEFTDESEEYASINPPPELIVLS-N  549

Query  534   ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
             AT+SDLK+ AS+AFQDVYL+ +RF+ EEL+ Y GV +ST +K LLGS E VRVRGR   K
Sbjct  550   ATVSDLKIAASKAFQDVYLILKRFKAEELLDYGGVDESTQIKHLLGSTESVRVRGRCNAK  609

Query  714   NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
             +  S++ MERG+E WTVDC CGAKDDDGERM  CD CG+W+HT+C+GIPD DSVPA+FVC
Sbjct  610   SVWSKYMMERGIERWTVDCSCGAKDDDGERMFTCDVCGVWRHTKCSGIPDSDSVPAKFVC  669

Query  894   LRCSCVIGQAKTIGQMKDEFVGSAAYCVGKGLGKSMT  1004
              RC   I  AK+ G  KDE V + A       G S+T
Sbjct  670   DRCKSSIFVAKSGGPCKDEIVANVAGDSCSRAGNSLT  706



>ref|XP_003622362.1| PHD finger protein [Medicago truncatula]
Length=655

 Score =   280 bits (716),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 136/252 (54%), Positives = 180/252 (71%), Gaps = 1/252 (0%)
 Frame = +3

Query  249   PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
             PS+E+LL+ L+YLY+ +LHP+ M N++    + + + SA  L+DCK+ +K+Y  E  +P 
Sbjct  399   PSEENLLQCLRYLYDSLLHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYCSE-MLPV  457

Query  429   LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
              +   +++ C+++L D SE      PPE++VL  NAT+SDLK+EA++AFQ+VYLMFR+FQ
Sbjct  458   SDLYKLRISCQVELVDQSEDTEAKIPPEIIVLPMNATVSDLKIEAAKAFQEVYLMFRKFQ  517

Query  609   VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
             V+ELVGY GV DST +K LLGS E V VRG+  GKN LS+FRMERGLE WTV+C CGAKD
Sbjct  518   VDELVGYGGVEDSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMERGLERWTVECSCGAKD  577

Query  789   DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDEFVGSAA  968
             DDGERM+ACD CG+W+HTRC GIPD   VPARFVC RC     + K+ G  KDE V S  
Sbjct  578   DDGERMMACDMCGVWRHTRCFGIPDTAPVPARFVCSRCQNCDSKLKSGGHCKDETVASVT  637

Query  969   YCVGKGLGKSMT  1004
                G  +G S +
Sbjct  638   TTSGSYMGNSFS  649



>gb|KEH42843.1| PHD finger plant-like protein [Medicago truncatula]
Length=707

 Score =   280 bits (715),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 185/267 (69%), Gaps = 7/267 (3%)
 Frame = +3

Query  204   NVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDC  383
             N N++G         PS+E+LL+ L+YLY+ +LHP+ M N++    + + + SA  L+DC
Sbjct  442   NHNSSGSKR------PSEENLLQCLRYLYDSLLHPRMMLNYVDEETRTLAMSSAQKLLDC  495

Query  384   KKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEA  563
             K+ +K+Y  E  +P  +   +++ C+++L D SE      PPE++VL  NAT+SDLK+EA
Sbjct  496   KQLVKDYCSE-MLPVSDLYKLRISCQVELVDQSEDTEAKIPPEIIVLPMNATVSDLKIEA  554

Query  564   SRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMER  743
             ++AFQ+VYLMFR+FQV+ELVGY GV DST +K LLGS E V VRG+  GKN LS+FRMER
Sbjct  555   AKAFQEVYLMFRKFQVDELVGYGGVEDSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMER  614

Query  744   GLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQA  923
             GLE WTV+C CGAKDDDGERM+ACD CG+W+HTRC GIPD   VPARFVC RC     + 
Sbjct  615   GLERWTVECSCGAKDDDGERMMACDMCGVWRHTRCFGIPDTAPVPARFVCSRCQNCDSKL  674

Query  924   KTIGQMKDEFVGSAAYCVGKGLGKSMT  1004
             K+ G  KDE V S     G  +G S +
Sbjct  675   KSGGHCKDETVASVTTTSGSYMGNSFS  701



>ref|XP_003536185.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Glycine 
max]
Length=707

 Score =   278 bits (711),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 141/259 (54%), Positives = 181/259 (70%), Gaps = 4/259 (2%)
 Frame = +3

Query  219  GDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
             +NN      PS+E+LL+ L+YLY+ +LHPQ M N+     + +++ SA  L DCK+F+K
Sbjct  444  ANNNSSGSKYPSEENLLQCLRYLYDSLLHPQMMVNY-EAGTRTLVMSSAQKLFDCKQFVK  502

Query  399  EYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQ  578
            +Y PE  +P  + +  +L C ++L D  E      PPEL+VL  NAT+++LK +A+ AFQ
Sbjct  503  DYNPE-MLPLSDSQMFRLSCHVELVDEFEDSEAITPPELIVLPLNATVAELKNQAANAFQ  561

Query  579  DVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESW  758
            DVYLMFRRFQV+EL GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE W
Sbjct  562  DVYLMFRRFQVDELHGYSGVDDSTLVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERW  621

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQ  938
            TVDC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVC +C     + K+ G 
Sbjct  622  TVDCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCQKCQHSESKLKSSGH  681

Query  939  MKDEFVG--SAAYCVGKGL  989
             KDE V   S + C   GL
Sbjct  682  CKDETVTNVSGSSCFRNGL  700



>ref|XP_003622361.1| PHD finger protein [Medicago truncatula]
Length=797

 Score =   280 bits (715),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 139/267 (52%), Positives = 185/267 (69%), Gaps = 7/267 (3%)
 Frame = +3

Query  204   NVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDC  383
             N N++G         PS+E+LL+ L+YLY+ +LHP+ M N++    + + + SA  L+DC
Sbjct  532   NHNSSGSKR------PSEENLLQCLRYLYDSLLHPRMMLNYVDEETRTLAMSSAQKLLDC  585

Query  384   KKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEA  563
             K+ +K+Y  E  +P  +   +++ C+++L D SE      PPE++VL  NAT+SDLK+EA
Sbjct  586   KQLVKDYCSE-MLPVSDLYKLRISCQVELVDQSEDTEAKIPPEIIVLPMNATVSDLKIEA  644

Query  564   SRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMER  743
             ++AFQ+VYLMFR+FQV+ELVGY GV DST +K LLGS E V VRG+  GKN LS+FRMER
Sbjct  645   AKAFQEVYLMFRKFQVDELVGYGGVEDSTQVKQLLGSNEVVCVRGKYSGKNGLSKFRMER  704

Query  744   GLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQA  923
             GLE WTV+C CGAKDDDGERM+ACD CG+W+HTRC GIPD   VPARFVC RC     + 
Sbjct  705   GLERWTVECSCGAKDDDGERMMACDMCGVWRHTRCFGIPDTAPVPARFVCSRCQNCDSKL  764

Query  924   KTIGQMKDEFVGSAAYCVGKGLGKSMT  1004
             K+ G  KDE V S     G  +G S +
Sbjct  765   KSGGHCKDETVASVTTTSGSYMGNSFS  791



>ref|XP_010252344.1| PREDICTED: PHD finger protein At1g33420 [Nelumbo nucifera]
Length=718

 Score =   277 bits (708),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 134/248 (54%), Positives = 178/248 (72%), Gaps = 4/248 (2%)
 Frame = +3

Query  168  VQCRLEPGSATVN---VNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVC  338
            V+ +LE  S   N   V     +     N  S++HLLRDL++LYE +LHP TM ++    
Sbjct  429  VEFKLESASCRTNDDGVAGVSSDELANSNCLSEDHLLRDLRFLYESLLHPHTMTSYRPQS  488

Query  339  KKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELL  518
             +++ I SA  L+DCK+F+K+Y+P       NP AI+L C ++L D  +  +  PPPEL+
Sbjct  489  TRELAISSAAKLLDCKQFVKDYEPIHKALVNNPFAIRLSCLVELVDQPKDYTA-PPPELI  547

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            VL  NAT++DLK EA++AFQ+VY+MF+RFQ EE++ Y  V DST +K L+G +  VRVRG
Sbjct  548  VLPLNATVADLKDEAAKAFQEVYVMFKRFQAEEVLDYGFVDDSTHVKFLIGVSGLVRVRG  607

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
            R LGK+ L+RFRMERG ESWTVDC CGA+DDDGERMLACD+CG+WQHTRCAGI D ++VP
Sbjct  608  RCLGKHGLNRFRMERGTESWTVDCTCGARDDDGERMLACDTCGVWQHTRCAGIDDFEAVP  667

Query  879  ARFVCLRC  902
            ARF+C RC
Sbjct  668  ARFICGRC  675



>ref|XP_004288656.1| PREDICTED: PHD finger protein At1g33420-like [Fragaria vesca 
subsp. vesca]
Length=700

 Score =   275 bits (704),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 140/267 (52%), Positives = 186/267 (70%), Gaps = 11/267 (4%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLE GSA+ + +T+           S+E+L+ D+++LYE MLHPQTM   +    +D+ +
Sbjct  431  RLEAGSASDDSSTS--------RSLSEENLVLDIRFLYESMLHPQTMMKDVPQETRDLAV  482

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCS-VNPPPELLVLSSN  533
              A  L+DCK+F+K+Y+PE+ +   +P    +LC ++ TD SE  S ++PPPEL+VL+ N
Sbjct  483  SCAEKLLDCKQFVKDYKPER-MSTKDPSLTCVLCRVEFTDESEEYSTLDPPPELIVLT-N  540

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
            AT+SDLKV AS+AFQDVYL+ +RFQ EELV Y GV +ST +K LLGS E+VRVRGR   K
Sbjct  541  ATVSDLKVAASKAFQDVYLVLKRFQAEELVDYGGVDESTQVKKLLGSGEYVRVRGRCNAK  600

Query  714  NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            +  S+F MERG+E WTV+C CGAKDDDGERM+ACD CG+W+HTRC+GIPD DSVPA FVC
Sbjct  601  SGWSKFSMERGMERWTVECSCGAKDDDGERMMACDLCGVWRHTRCSGIPDSDSVPASFVC  660

Query  894  LRCSCVIGQAKTIGQMKDEFVGSAAYC  974
              C   +   +  G  KDE V     C
Sbjct  661  QGCKNSVPVTQNAGPCKDEVVAKVESC  687



>ref|XP_007212930.1| hypothetical protein PRUPE_ppa021865mg, partial [Prunus persica]
 gb|EMJ14129.1| hypothetical protein PRUPE_ppa021865mg, partial [Prunus persica]
Length=534

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 177/243 (73%), Gaps = 4/243 (2%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLE GSA+   +TA   + +   L S+E +L D++ LYE ML PQTM  ++    +D+ I
Sbjct  290  RLEAGSASSKGSTACTGSSISSRL-SEETILLDMRCLYEAMLQPQTMMKNVPQVTRDLTI  348

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSER-CSVNPPPELLVLSSN  533
             SA  L+ CK+F+K+Y+PEK +   +P    +LC ++ TD SE   ++NPPPEL+VLS N
Sbjct  349  SSAEKLLYCKQFVKDYKPEK-MSTNDPSVTCVLCRVEFTDESEEYATINPPPELIVLS-N  406

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK  713
            AT+SDLK+ AS+AFQDVYL+ +RF+ EEL+ Y GV +ST +K LLGS E VRVRGR   K
Sbjct  407  ATVSDLKIAASKAFQDVYLILKRFKAEELLDYGGVDESTQIKHLLGSTESVRVRGRCNAK  466

Query  714  NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            +  S++ MERG+E WTVDC CGAKDDDGERM  CD CG+W+HT+C+GIPD DSVPA+FVC
Sbjct  467  SVWSKYMMERGIERWTVDCSCGAKDDDGERMFTCDVCGVWRHTKCSGIPDFDSVPAKFVC  526

Query  894  LRC  902
             RC
Sbjct  527  DRC  529



>ref|XP_006606403.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Glycine 
max]
Length=566

 Score =   271 bits (694),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 177/257 (69%), Gaps = 4/257 (2%)
 Frame = +3

Query  225  NNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY  404
            NN +    PS+E+LL+ L+YLY+ +LHPQ M N+     + + + SA  L DCK+F+K+Y
Sbjct  305  NNSLGSKYPSEENLLQCLRYLYDSLLHPQMMVNY-EAGTRTLAMNSAQKLFDCKQFVKDY  363

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
             PE + P  + +  +L C ++L D  E      PPEL+VL  NAT+++LK +A+ AFQDV
Sbjct  364  NPEMW-PLSDSQMFRLSCHVELVDEFEDSEAITPPELVVLPLNATVAELKNQAANAFQDV  422

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTV  764
            YL FRR QV+ L GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE WTV
Sbjct  423  YLRFRRLQVDGLHGYSGVDDSTQVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTV  482

Query  765  DCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMK  944
            DC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVCL+C     + K  G  K
Sbjct  483  DCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCLKCQNCESKLKCSGHCK  542

Query  945  DEFVG--SAAYCVGKGL  989
            DE V   S + C   GL
Sbjct  543  DETVTNVSGSSCFRNGL  559



>ref|XP_010674289.1| PREDICTED: PHD finger protein At1g33420 [Beta vulgaris subsp. 
vulgaris]
Length=712

 Score =   273 bits (697),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/246 (53%), Positives = 174/246 (71%), Gaps = 2/246 (1%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ R+EPG  ++  N+ G  N M  N PS E +LRD++ LYEC+LHPQTM       +++
Sbjct  427  LEFRVEPGIFSLQGNS-GCANPMFLNFPSREQILRDMRVLYECLLHPQTMVKFGPEGRRE  485

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDL-TDYSERCSVNPPPELLVL  524
              + +A+ L+DCK+F+K Y+PE     +N  AI L C+++     SE   + PPPEL+  
Sbjct  486  CALSAASKLLDCKQFVKNYKPETTSSLVNSSAIYLFCQVEFPVHLSEEQVMRPPPELIAF  545

Query  525  SSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRS  704
            SSNATISDLK E S+ FQ+VY+M + FQ EELV Y GV DST +KLL  S   VR++GR 
Sbjct  546  SSNATISDLKAEVSKVFQEVYIMLKGFQAEELVDYRGVEDSTQVKLLFPSLVTVRIQGRC  605

Query  705  LGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
              KN L RFR+ERG+E WTV+C CGA+DDDGERMLACD CG+WQHTRCAGI D ++VPA+
Sbjct  606  PLKNGLGRFRLERGVERWTVECSCGARDDDGERMLACDVCGVWQHTRCAGILDFEAVPAK  665

Query  885  FVCLRC  902
            F+C+RC
Sbjct  666  FLCIRC  671



>ref|XP_008394231.1| PREDICTED: PHD finger protein At1g33420-like [Malus domestica]
Length=710

 Score =   272 bits (696),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 140/249 (56%), Positives = 176/249 (71%), Gaps = 6/249 (2%)
 Frame = +3

Query  255  DEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALN  434
            +E L+ DL++LYE ML PQTM   +    +D+ I SA  L+DCK+F+K+Y+PEK + A +
Sbjct  457  EETLVLDLRFLYEYMLQPQTMMKDVPQVTRDLAISSAEKLLDCKQFVKDYKPEK-MSAND  515

Query  435  PRAIQLLCELDLTDYSERCS-VNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
            P    +LC ++  D SE CS +NPPPEL+VLS NA +SDLK+ AS+AFQDVYL+ +RFQ 
Sbjct  516  PSVTCVLCSVEFIDESEECSFINPPPELIVLS-NAAVSDLKLAASKAFQDVYLILKRFQA  574

Query  612  EELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDD  791
            EEL+    V +ST +K LLGSAE VRVRGR   K+  S+FRMERG E WTVDC CGAKDD
Sbjct  575  EELLDCGDVDESTQVKHLLGSAEHVRVRGRCNAKSVWSKFRMERGTERWTVDCTCGAKDD  634

Query  792  DGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDEFVGSA--  965
            DGERMLACD CG+W+HTRC GIPD DSVPA+F+C RC       K+ G  KDE V +   
Sbjct  635  DGERMLACDCCGVWRHTRCTGIPDSDSVPAKFLCERCKXSAFVEKSGGPCKDEVVANVDG  694

Query  966  -AYCVGKGL  989
             + C G  L
Sbjct  695  DSRCTGSSL  703



>ref|XP_004495439.1| PREDICTED: PHD finger protein At1g33420-like [Cicer arietinum]
Length=718

 Score =   271 bits (693),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 134/258 (52%), Positives = 181/258 (70%), Gaps = 7/258 (3%)
 Frame = +3

Query  249   PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
             PS E++L+ L+YLYE +LHP+ M N++    + + + SA  L+DCK+ +K+Y  E  +P 
Sbjct  456   PSKENILQCLRYLYESLLHPRMMLNYVDEETRTLAMSSAQKLLDCKQLVKDYSLE-MLPV  514

Query  429   LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
              +   I++ C+++L D  E  +   PPE++VL SNAT+SDLK+EA+  FQDVYLMFRRFQ
Sbjct  515   SDLYKIRISCQVELVDQPEDSAARTPPEIIVLPSNATLSDLKIEATNVFQDVYLMFRRFQ  574

Query  609   VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
             V+EL+GY+ V D+T +KLLLGS + V VRGR +GKN LS+FRMERGLE WTV+C CG KD
Sbjct  575   VDELLGYSSVNDNTQVKLLLGSNDAVCVRGRCIGKNGLSKFRMERGLERWTVECSCGTKD  634

Query  789   DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDE------  950
             DDGERM+ACD CG+W+HTRC+GI D   VPARFVC RC     + K+    KDE      
Sbjct  635   DDGERMMACDICGVWRHTRCSGIHDTAPVPARFVCSRCQNCDSRPKSSVHCKDETVTSVS  694

Query  951   FVGSAAYCVGKGLGKSMT  1004
                +++ C GKG GK + 
Sbjct  695   TTSTSSSCFGKGKGKGLA  712



>ref|XP_007019721.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 ref|XP_007019722.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 ref|XP_007019723.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 ref|XP_007019724.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16946.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16947.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16948.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
 gb|EOY16949.1| DNA binding protein, putative isoform 3 [Theobroma cacao]
Length=474

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 181/254 (71%), Gaps = 11/254 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RL+P S+  N ++      +  N PS+EH+  DLK+L++ +LHP+TM  +     ++
Sbjct  196  IEFRLQPLSSVPNESS------LYSNCPSEEHIKGDLKFLFDSLLHPETMLTYRPQATRE  249

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +I SAT L+DCK+F+K+Y+P     A NP AI + C L+L+D  +   V PPPEL+VL 
Sbjct  250  CVIDSATKLLDCKQFVKDYKPY----AYNPFAICVWCHLELSDQPKDDPV-PPPELIVLP  304

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NATI DLK EA+ AF+DVY MF+RFQVE L+ Y  V D+  LKLL+G+   ++V+GR  
Sbjct  305  LNATIGDLKSEATNAFEDVYAMFKRFQVEHLLDYGSVEDNITLKLLVGTTGSIQVKGRCP  364

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K+ L+R+R+ERG ++WTVDC CGAKDDDGERMLACD CG+WQHTRCAGI + D++PA+F
Sbjct  365  SKHGLNRYRLERGTDNWTVDCTCGAKDDDGERMLACDICGVWQHTRCAGIDNADAIPAKF  424

Query  888  VCLRCSCVIGQAKT  929
            +C+RC+  + +  T
Sbjct  425  ICMRCANSLHKKST  438



>ref|XP_006606402.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Glycine 
max]
Length=707

 Score =   270 bits (691),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 177/257 (69%), Gaps = 4/257 (2%)
 Frame = +3

Query  225  NNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY  404
            NN +    PS+E+LL+ L+YLY+ +LHPQ M N+     + + + SA  L DCK+F+K+Y
Sbjct  446  NNSLGSKYPSEENLLQCLRYLYDSLLHPQMMVNY-EAGTRTLAMNSAQKLFDCKQFVKDY  504

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
             PE + P  + +  +L C ++L D  E      PPEL+VL  NAT+++LK +A+ AFQDV
Sbjct  505  NPEMW-PLSDSQMFRLSCHVELVDEFEDSEAITPPELVVLPLNATVAELKNQAANAFQDV  563

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTV  764
            YL FRR QV+ L GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE WTV
Sbjct  564  YLRFRRLQVDGLHGYSGVDDSTQVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTV  623

Query  765  DCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMK  944
            DC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVCL+C     + K  G  K
Sbjct  624  DCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCLKCQNCESKLKCSGHCK  683

Query  945  DEFVG--SAAYCVGKGL  989
            DE V   S + C   GL
Sbjct  684  DETVTNVSGSSCFRNGL  700



>gb|KHN05025.1| PHD finger protein [Glycine soja]
Length=870

 Score =   271 bits (693),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 177/257 (69%), Gaps = 4/257 (2%)
 Frame = +3

Query  225  NNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY  404
            NN +    PS+E+LL+ L+YLY+ +LHPQ M N+     + + + SA  L DCK+F+K+Y
Sbjct  609  NNSLGSKYPSEENLLQCLRYLYDSLLHPQMMVNY-EAGTRTLAMNSAQKLFDCKQFVKDY  667

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
             PE + P  + +  +L C ++L D  E      PPEL+VL  NAT+++LK +A+ AFQDV
Sbjct  668  NPEMW-PLSDSQMFRLSCHVELVDEFEDSEAITPPELVVLPLNATVAELKNQAANAFQDV  726

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTV  764
            YL FRR QV+ L GY+GV DST +KLLLGS + V VRGR +GKN LS+FRMERGLE WTV
Sbjct  727  YLRFRRLQVDGLHGYSGVDDSTQVKLLLGSRDVVCVRGRCIGKNGLSKFRMERGLERWTV  786

Query  765  DCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMK  944
            DC CGAKDDDGERMLACD CG+W+HTRC+ I D D VPARFVCL+C     + K  G  K
Sbjct  787  DCSCGAKDDDGERMLACDICGVWRHTRCSDIHDTDPVPARFVCLKCQNCESKLKCSGHCK  846

Query  945  DEFVG--SAAYCVGKGL  989
            DE V   S + C   GL
Sbjct  847  DETVTNVSGSSCFRNGL  863



>ref|XP_007019720.1| DNA binding protein, putative isoform 2, partial [Theobroma cacao]
 gb|EOY16945.1| DNA binding protein, putative isoform 2, partial [Theobroma cacao]
Length=564

 Score =   264 bits (675),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 181/254 (71%), Gaps = 11/254 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RL+P S+  N ++      +  N PS+EH+  DLK+L++ +LHP+TM  +     ++
Sbjct  286  IEFRLQPLSSVPNESS------LYSNCPSEEHIKGDLKFLFDSLLHPETMLTYRPQATRE  339

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +I SAT L+DCK+F+K+Y+P     A NP AI + C L+L+D  +   V PPPEL+VL 
Sbjct  340  CVIDSATKLLDCKQFVKDYKPY----AYNPFAICVWCHLELSDQPKDDPV-PPPELIVLP  394

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NATI DLK EA+ AF+DVY MF+RFQVE L+ Y  V D+  LKLL+G+   ++V+GR  
Sbjct  395  LNATIGDLKSEATNAFEDVYAMFKRFQVEHLLDYGSVEDNITLKLLVGTTGSIQVKGRCP  454

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K+ L+R+R+ERG ++WTVDC CGAKDDDGERMLACD CG+WQHTRCAGI + D++PA+F
Sbjct  455  SKHGLNRYRLERGTDNWTVDCTCGAKDDDGERMLACDICGVWQHTRCAGIDNADAIPAKF  514

Query  888  VCLRCSCVIGQAKT  929
            +C+RC+  + +  T
Sbjct  515  ICMRCANSLHKKST  528



>ref|XP_008391867.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein At1g33420-like 
[Malus domestica]
Length=465

 Score =   260 bits (664),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 130/251 (52%), Positives = 174/251 (69%), Gaps = 7/251 (3%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAG----DNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHL  329
            M V+    P S  +   ++     D + +  N PS+E +L DLK+LY+ +LHP TM ++ 
Sbjct  189  MVVKAXCSPTSVDIEYRSSSVQNVDGSELDLNFPSEEXILCDLKFLYDSILHPDTMLSYT  248

Query  330  HVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP  509
                K+ II++AT L+DCK+F+K+Y+P K         I L C ++L+D SE   V PP 
Sbjct  249  PQSMKERIIETATKLLDCKQFIKDYRPYKMAKE-GSFVIHLWCHVELSDESEDDFVMPP-  306

Query  510  ELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVR  689
            ELLVL  NAT++DLK EA++AF +VY MF+RF+VEEL+GY  + DS  +KLLLGS   +R
Sbjct  307  ELLVLPLNATVADLKKEATKAFXEVYAMFKRFEVEELLGYGSIKDSFTVKLLLGSCGSIR  366

Query  690  VRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLD  869
            ++GR L K+ L+RFR ERGLESWTVDC CGAKDDDGERM ACD+CG+WQHTRCAGI   D
Sbjct  367  LKGRCLAKHGLNRFRKERGLESWTVDCTCGAKDDDGERMFACDTCGVWQHTRCAGIHSSD  426

Query  870  SVPARFVCLRC  902
             +PA+  C+RC
Sbjct  427  EIPAK-XCMRC  436



>ref|XP_009366883.1| PREDICTED: PHD finger protein At1g33420 [Pyrus x bretschneideri]
Length=665

 Score =   264 bits (675),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 132/253 (52%), Positives = 174/253 (69%), Gaps = 8/253 (3%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAG------DNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMAN  323
            M V+ R  P S  V            D +    N PS+E +L DLK+LY+ +LHP TM +
Sbjct  406  MVVKARFSPASVDVEYRLESSSVQNVDGSESDLNFPSEEQILCDLKFLYDSILHPDTMLS  465

Query  324  HLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNP  503
            H     ++ II +AT L+DCK+F+K+Y+P K     +   I L C + L+D S+   V  
Sbjct  466  HTPQVMRERIIDAATKLLDCKQFVKDYKPYKMAEE-SSFGIHLWCHVALSDESKDDFV-L  523

Query  504  PPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF  683
            PPEL+VL  +AT++DLK EA+ AFQ+VY MF+RF+VEEL+GY  + DS  +KLLLGS   
Sbjct  524  PPELIVLPLSATVADLKREATTAFQEVYAMFKRFEVEELLGYGSIKDSFTVKLLLGSCGS  583

Query  684  VRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPD  863
            + ++GR L K+ L+RFRMERG+ESWTVDC CGAKDDDGERMLACD+CG+WQHTRCAGI  
Sbjct  584  IPLKGRCLAKHGLNRFRMERGIESWTVDCTCGAKDDDGERMLACDTCGVWQHTRCAGIHS  643

Query  864  LDSVPARFVCLRC  902
             D +PA+FVC+RC
Sbjct  644  SDEMPAKFVCMRC  656



>ref|XP_010542547.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein At1g33420 
[Tarenaya hassleriana]
Length=701

 Score =   265 bits (677),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/218 (55%), Positives = 163/218 (75%), Gaps = 5/218 (2%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
            PS+EH+ RD++YLY+ +LHPQTMA       +D ++ +AT ++DCK FMK+Y P      
Sbjct  442  PSEEHVKRDIRYLYDFLLHPQTMAKFRSQVTRDKMMDAATKILDCKHFMKDYLPS----G  497

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
             NP AI L C ++L+D S+ C    PPELLVL  NAT+SDLK+EA++AFQ+VY MF+RF+
Sbjct  498  ANPFAINLWCHVELSDQSKECPA-LPPELLVLPMNATVSDLKIEAAKAFQEVYAMFKRFE  556

Query  609  VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
            VEEL+GY  + DS  LK L+G++  VR++GR   K+ L R+RMERG+E+W VDC CG KD
Sbjct  557  VEELLGYGSLEDSITLKFLVGTSGMVRIKGRCSSKHGLLRYRMERGVENWKVDCICGTKD  616

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            DDGERML+CD+CG+W HTRCAGI + D++P++F C RC
Sbjct  617  DDGERMLSCDACGVWHHTRCAGIENSDALPSKFHCFRC  654



>ref|XP_007019719.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
 gb|EOY16944.1| DNA binding protein, putative isoform 1 [Theobroma cacao]
Length=703

 Score =   264 bits (675),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/254 (50%), Positives = 181/254 (71%), Gaps = 11/254 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RL+P S+  N ++      +  N PS+EH+  DLK+L++ +LHP+TM  +     ++
Sbjct  425  IEFRLQPLSSVPNESS------LYSNCPSEEHIKGDLKFLFDSLLHPETMLTYRPQATRE  478

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +I SAT L+DCK+F+K+Y+P     A NP AI + C L+L+D  +   V PPPEL+VL 
Sbjct  479  CVIDSATKLLDCKQFVKDYKPY----AYNPFAICVWCHLELSDQPKDDPV-PPPELIVLP  533

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NATI DLK EA+ AF+DVY MF+RFQVE L+ Y  V D+  LKLL+G+   ++V+GR  
Sbjct  534  LNATIGDLKSEATNAFEDVYAMFKRFQVEHLLDYGSVEDNITLKLLVGTTGSIQVKGRCP  593

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K+ L+R+R+ERG ++WTVDC CGAKDDDGERMLACD CG+WQHTRCAGI + D++PA+F
Sbjct  594  SKHGLNRYRLERGTDNWTVDCTCGAKDDDGERMLACDICGVWQHTRCAGIDNADAIPAKF  653

Query  888  VCLRCSCVIGQAKT  929
            +C+RC+  + +  T
Sbjct  654  ICMRCANSLHKKST  667



>ref|XP_010027490.1| PREDICTED: PHD finger protein At1g33420-like [Eucalyptus grandis]
 gb|KCW54032.1| hypothetical protein EUGRSUZ_I00019 [Eucalyptus grandis]
Length=710

 Score =   264 bits (674),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 176/241 (73%), Gaps = 6/241 (2%)
 Frame = +3

Query  171  QCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANH-LHVCKKD  347
            + RLEPG     VNT+G  +    + PS+++L+RDL+YLY+ +LHP+TM N   H     
Sbjct  430  EYRLEPGGTASTVNTSGKKSSF-ISRPSEDNLIRDLRYLYDSILHPRTMLNEGTHATD--  486

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
              +++A  L+DCK+FMK+Y+ E+     NP +I LLC++++ D++   ++ PP E++ LS
Sbjct  487  -YVEAAQRLLDCKQFMKDYRAEEAPSTANPFSISLLCQVEVADHAMSSTICPP-EIINLS  544

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             +AT+SDLK E SRAF+DVYLM+RRFQ ++L+ + GV DST +K L G    VRVRGR  
Sbjct  545  PDATVSDLKHEVSRAFRDVYLMYRRFQADDLLDHRGVDDSTLVKHLTGVTNLVRVRGRCF  604

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             KN +S++RMERGLE+WTVDC CGAKDDDGERMLACD CG+WQHTRC+GI D +SVPA F
Sbjct  605  VKNGVSKYRMERGLENWTVDCKCGAKDDDGERMLACDVCGVWQHTRCSGIDDSESVPASF  664

Query  888  V  890
            +
Sbjct  665  I  665



>ref|XP_007199715.1| hypothetical protein PRUPE_ppa002124mg [Prunus persica]
 gb|EMJ00914.1| hypothetical protein PRUPE_ppa002124mg [Prunus persica]
Length=713

 Score =   262 bits (669),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/245 (53%), Positives = 178/245 (73%), Gaps = 8/245 (3%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            V+ RLEP     NV+ + D NY     PS+E +L DLK+LY+ ++HP TM ++     ++
Sbjct  425  VEYRLEP-LIIGNVDGSEDLNY-----PSEEQILCDLKFLYDSIIHPDTMLSYTPQAMRE  478

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +I +AT L+DCK+F+K+Y P+K   A +   I L C ++L+D   +  +  PPEL+VL 
Sbjct  479  RVIDAATKLLDCKQFVKDYMPDKMA-AESSCGIHLWCHVELSD-EPKDDLVLPPELIVLP  536

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NAT++DLK EA+ AFQ+VY MF+RF+VEEL+ Y  + DS  +KLL+G+   +R++GR  
Sbjct  537  LNATVADLKREATMAFQEVYAMFKRFEVEELLEYGSINDSFTVKLLVGTCGSIRLKGRCP  596

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K+ L+RFRMERGLESWTVDC CGAKDDDGERMLACD+CG+WQHTRCAGI   D++PARF
Sbjct  597  AKHGLNRFRMERGLESWTVDCTCGAKDDDGERMLACDTCGVWQHTRCAGIHSSDAIPARF  656

Query  888  VCLRC  902
            VC+RC
Sbjct  657  VCMRC  661



>ref|XP_008237816.1| PREDICTED: PHD finger protein At1g33420 [Prunus mume]
Length=712

 Score =   261 bits (668),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/260 (51%), Positives = 183/260 (70%), Gaps = 10/260 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            V+ RLEP     NV+ + D NY     PS++ +L DLK+LY+ ++HP TM ++     ++
Sbjct  424  VEYRLEP-LIIGNVDGSEDLNY-----PSEQQILCDLKFLYDSIIHPDTMLSYTPQVMRE  477

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +I +AT L+DCK+F+K+Y P+K   A +   I L C ++L+D   +  +  PPEL+VL 
Sbjct  478  RVIDAATKLLDCKQFVKDYMPDKMA-AESSLGIHLWCHVELSD-EPKDDLVLPPELIVLP  535

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NAT++DLK EA+ AFQ+VY MF+RF+VEEL+ Y  + DS  +KLL+G+   +R++GR  
Sbjct  536  LNATVADLKREATIAFQEVYAMFKRFEVEELLEYGSINDSFTVKLLVGTCGSIRLKGRCP  595

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K+ L+RFRMERGLESWTVDC CGAKDDDGERMLACD+CG+WQHTRCAGI   D++PARF
Sbjct  596  AKHGLNRFRMERGLESWTVDCTCGAKDDDGERMLACDTCGVWQHTRCAGIHSSDAIPARF  655

Query  888  VCLRCSCVIGQAKTIGQMKD  947
            VC+R  CVI   K    + D
Sbjct  656  VCMR--CVISYRKKSQNIND  673



>ref|XP_006304773.1| hypothetical protein CARUB_v10012280mg [Capsella rubella]
 gb|EOA37671.1| hypothetical protein CARUB_v10012280mg [Capsella rubella]
Length=704

 Score =   254 bits (649),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 129/257 (50%), Positives = 171/257 (67%), Gaps = 13/257 (5%)
 Frame = +3

Query  147  DLIRVMCVQCRLEPGSATVNVNTAGDNNYMR-----PNLPSDEHLLRDLKYLYECMLHPQ  311
            D  RV+C +C   PGS          NN  R      N  S EH+ RDL+YLYE +LHPQ
Sbjct  409  DGSRVVCSRC--NPGSNDFEYRLEPVNNVHRLSNQDVNYASVEHVKRDLRYLYENLLHPQ  466

Query  312  TMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERC  491
            TMA       +D +I +AT ++DCK F+K+Y        +NP AI + C ++L+D S+ C
Sbjct  467  TMAKFRFQATRDKMIDAATKILDCKHFIKDY----LSSTVNPFAINIWCCVELSDESKDC  522

Query  492  SVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLG  671
              +PP ELLVL  NAT+SDLK+EA++AFQ+VY MF+RF+VEE +GY  + DS  LK L+G
Sbjct  523  P-SPPSELLVLPLNATVSDLKIEAAKAFQEVYAMFKRFEVEEFLGYGSIDDSITLKFLVG  581

Query  672  SAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCA  851
            +   V+++GR   K+ L R+RMERG+++W VDC CG KDDDGERMLACD CG+W HTRCA
Sbjct  582  TNAAVQIKGRCY-KHGLLRYRMERGVDNWKVDCKCGTKDDDGERMLACDVCGVWCHTRCA  640

Query  852  GIPDLDSVPARFVCLRC  902
            GI + D +P+ F C RC
Sbjct  641  GIKNADELPSTFHCFRC  657



>ref|NP_564424.1| PHD finger protein [Arabidopsis thaliana]
 sp|Q9C810.1|Y1342_ARATH RecName: Full=PHD finger protein At1g33420 [Arabidopsis thaliana]
 gb|AAG51204.1|AC051630_1 hypothetical protein; 47104-44821 [Arabidopsis thaliana]
 gb|AAK59559.1| unknown protein [Arabidopsis thaliana]
 gb|AAK93738.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31592.1| PHD finger protein [Arabidopsis thaliana]
Length=697

 Score =   252 bits (644),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 167/250 (67%), Gaps = 11/250 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMR-----PNLPSDEHLLRDLKYLYECMLHPQTMANHLH  332
            V  R  PGS          NN  R      N  S EH+ +DL+YLYE +LHPQTMA    
Sbjct  407  VSSRCNPGSNDFEYRLESVNNVHRLSNQDVNNASVEHVKQDLRYLYETLLHPQTMAEFRS  466

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPE  512
               ++ +I +AT ++DCK F+K+Y        +NP AI L C ++L+D  +  S  PPPE
Sbjct  467  RATREKMIDAATKILDCKHFIKDY----LSSTVNPVAINLWCCVELSDELKE-SPAPPPE  521

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRV  692
             LVL  NAT+SDLK+EA++AFQ+VY MF+RF+VEEL+GY  + DS  LK L+G+   +R+
Sbjct  522  RLVLPLNATVSDLKIEAAKAFQEVYAMFKRFEVEELLGYGSIDDSITLKFLVGTNGVIRI  581

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            +GR   K+ L R+RMERG+++W VDC CG KDDDGERMLACD CG+W HTRC GI + D+
Sbjct  582  KGR-CSKHGLLRYRMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADA  640

Query  873  VPARFVCLRC  902
            +P++F+C RC
Sbjct  641  LPSKFLCFRC  650



>gb|EPS70707.1| hypothetical protein M569_04052 [Genlisea aurea]
Length=669

 Score =   251 bits (642),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 157/219 (72%), Gaps = 12/219 (5%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPAL  431
            S+E LL DLKY YECMLHP T A+       + +  +A  ++DCK+F+K+Y+P     + 
Sbjct  447  SEERLLCDLKYFYECMLHPDTAAS------SNPLAVAARKILDCKQFVKDYRPSD---SK  497

Query  432  NPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
               A+ +LCE+DLT+  E    NPPPE L+LS +AT+ DLK EA+RAFQDVYLMFRRF  
Sbjct  498  GNAAVGVLCEVDLTESGE-VGCNPPPEQLILSPDATVGDLKREATRAFQDVYLMFRRFDA  556

Query  612  EELVGYAGVGDSTGLKLLLG-SAEFVRVRGRSLGKNA-LSRFRMERGLESWTVDCHCGAK  785
             E+VGY GV +ST L+LLLG S  +VR+RGR  GKN+ L R+RMERG+E W VDC CGAK
Sbjct  557  GEVVGYGGVDESTQLRLLLGPSGGYVRIRGRFAGKNSGLGRYRMERGVERWVVDCLCGAK  616

Query  786  DDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            DDDGERMLACD CG W HTRC+G+PD   VP  F+C RC
Sbjct  617  DDDGERMLACDGCGTWLHTRCSGVPDSGGVPGEFLCRRC  655



>ref|XP_006376093.1| PHD finger family protein [Populus trichocarpa]
 gb|ERP53890.1| PHD finger family protein [Populus trichocarpa]
Length=698

 Score =   252 bits (643),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 125/248 (50%), Positives = 172/248 (69%), Gaps = 13/248 (5%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEP S   N       N +  N PS EH++ DLK+L++ ++HP+TM N+  +  ++
Sbjct  422  IEFRLEPPSFKHN------GNGLDSNQPSKEHIIGDLKFLFDSLVHPETMVNYRPLVTRE  475

Query  348  VIIQSATTLIDCKKFMKEY-QPEKFVPALNPRAIQLLCELDLTDYSERCSVNP--PPELL  518
             +I SAT L+DCK+F+K+Y +P+K +   NP AIQL C     ++SE    +P  PPEL+
Sbjct  476  DVIDSATKLLDCKQFVKDYCRPDKRM-VDNPFAIQLWC---YVEFSEHLKEDPTIPPELI  531

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            VL SNAT++DLK EA++AFQ VY M +RF+  ELV Y  + DS  +K L+G +  VR++G
Sbjct  532  VLPSNATVADLKTEATKAFQQVYAMLKRFEARELVDYGPLEDSITIKFLVGQSGTVRIKG  591

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
                K ALS FRME+G E+W VDC CGAKDDDGERMLACD+CG+WQHTRCAGI + D +P
Sbjct  592  TCPSKYALSHFRMEKGQENWIVDCMCGAKDDDGERMLACDTCGVWQHTRCAGIDNCDEIP  651

Query  879  ARFVCLRC  902
             +F C+RC
Sbjct  652  EKFECMRC  659



>ref|XP_004512621.1| PREDICTED: PHD finger protein At1g33420-like [Cicer arietinum]
Length=706

 Score =   252 bits (643),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 182/278 (65%), Gaps = 9/278 (3%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNY-MRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKK  344
            ++ RLE  + + +  T+  NNY +    PS E LL DLKYLY  +L+   M N +    +
Sbjct  427  LEYRLEAANNSCDGKTS--NNYSLGSKRPSKESLLYDLKYLYGYLLNSPMMQNCVPEGIQ  484

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVL  524
              ++ SA  L++CK+ +K+Y+PE  +P  +   I+  C ++L D SE  ++  P EL+VL
Sbjct  485  IPVMSSAQKLLNCKQLVKDYRPE-MLPMKDFYKIRFSCHVELIDESENPTI--PAELVVL  541

Query  525  SSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRS  704
              NATISDLK EA  AF+DVYLMFRRF V+ L+GY  V DST +KLLLGSAE V +RGR 
Sbjct  542  PINATISDLKNEAVNAFEDVYLMFRRFVVDGLLGYNDVDDSTQIKLLLGSAEVVCIRGRC  601

Query  705  LGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
            + KN LS+F+MERGLE WTVDC CGAKDDDGERMLACD CG+WQHT C+ I D   VP  
Sbjct  602  ISKNGLSKFKMERGLERWTVDCSCGAKDDDGERMLACDKCGVWQHTICSNIHDSQPVPTH  661

Query  885  FVCLRCSCVIGQAKTIGQMKDEF---VGSAAYCVGKGL  989
            F C +C     + K+IG  KDE    +  ++ C GKGL
Sbjct  662  FTCPKCRNPNLKPKSIGNCKDETLANISGSSSCFGKGL  699



>ref|XP_004292411.1| PREDICTED: PHD finger protein At1g33420-like [Fragaria vesca 
subsp. vesca]
Length=698

 Score =   251 bits (641),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 173/250 (69%), Gaps = 5/250 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNT---AGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLH  332
            M V+ R  P S  V       A   +  +PN PS++ +L DLK+LY+ +LHP TM  +  
Sbjct  400  MVVETRCNPDSTGVEYRLEPFAIGRSEFKPNFPSEQQILGDLKFLYDSILHPDTMLCYAP  459

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPE  512
               +D +I +AT L+DCK+F+K+Y+P+  + A +   I L C++ L+D+ +   V  PPE
Sbjct  460  QEMRDNVIDAATKLLDCKQFIKDYKPDT-IEAAHLSRIHLWCDVQLSDHLKDDFV-LPPE  517

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRV  692
            L+VL  NAT++DLK EA++AFQ+VY MF+RF+VEEL+    + DS   KLL G++  V +
Sbjct  518  LVVLPLNATLADLKSEATKAFQEVYAMFKRFEVEELLECGSINDSITAKLLFGTSGTVHL  577

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            +G+   K+ L+RFRMERG+ESW VDC CG KDDDGERM+ACD+CG+WQHTRCAGI   D 
Sbjct  578  KGKCPAKHGLNRFRMERGIESWIVDCTCGTKDDDGERMMACDTCGVWQHTRCAGIRCSDE  637

Query  873  VPARFVCLRC  902
            +PA+FVCLRC
Sbjct  638  IPAKFVCLRC  647



>ref|XP_010112064.1| PHD finger protein [Morus notabilis]
 gb|EXC32483.1| PHD finger protein [Morus notabilis]
Length=732

 Score =   251 bits (641),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 124/245 (51%), Positives = 169/245 (69%), Gaps = 8/245 (3%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEP S+T   N     N++    PS+E +LRDL++LYE  LHP TM ++     +D
Sbjct  445  IEYRLEPLSST---NARSGVNFV---YPSEEQVLRDLRFLYESFLHPDTMVSYKPQRIRD  498

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +I SAT L+DCK+F+K Y  E      +P+AI L C++ L+D  +   V  PPEL+VL 
Sbjct  499  QVIDSATKLLDCKQFVKVYVSET-AAVESPQAIHLWCDVQLSDQPKGEPV-VPPELIVLP  556

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NA ++ LK   ++AF++VY MF+RFQ EELVGY  + DS  +K L+G+   VR+ G+  
Sbjct  557  LNANVAGLKSAVTQAFREVYPMFKRFQAEELVGYGSIDDSITVKFLVGTGGSVRLAGKCA  616

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K+ L+RFRMERG+ESWTV C CGAKDDDGERMLACD+CG+WQH RC GI + D +PA+F
Sbjct  617  AKHGLNRFRMERGIESWTVSCSCGAKDDDGERMLACDTCGVWQHIRCVGIANSDEIPAKF  676

Query  888  VCLRC  902
            VCL+C
Sbjct  677  VCLKC  681



>ref|XP_011013353.1| PREDICTED: PHD finger protein At1g33420 [Populus euphratica]
Length=699

 Score =   250 bits (638),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 171/248 (69%), Gaps = 13/248 (5%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEP S   N       N +  N PS EH++ DLK+L++ ++HP+TM N+  +  ++
Sbjct  424  IEFRLEPLSFKHN------GNGLDSNQPSKEHIIGDLKFLFDSLVHPETMVNYRPLVTRE  477

Query  348  VIIQSATTLIDCKKFMKEY-QPEKFVPALNPRAIQLLCELDLTDYSERCSVNP--PPELL  518
             +I SAT L+DCK+F+K+Y +P+K +   NP +IQL C     ++SE    +P  PPEL+
Sbjct  478  DVIDSATKLLDCKQFIKKYYRPDKRM-VDNPFSIQLWC---YVEFSEHLKEDPTIPPELI  533

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            VL SNAT++DLK EA++AFQ VY M +RF+  ELVGY  + DS  +K L+G    VR++G
Sbjct  534  VLPSNATVADLKTEATKAFQQVYAMLKRFEARELVGYGPLEDSITIKFLVGQRGTVRIKG  593

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
                K AL  FRME+G E+W VDC CGAKDDDGERMLACD+CG+WQHTRC+GI + D +P
Sbjct  594  TCPSKYALGHFRMEKGQENWIVDCMCGAKDDDGERMLACDTCGVWQHTRCSGIDNCDEIP  653

Query  879  ARFVCLRC  902
             +F C+RC
Sbjct  654  EKFECMRC  661



>ref|XP_007131323.1| hypothetical protein PHAVU_011G004000g [Phaseolus vulgaris]
 gb|ESW03317.1| hypothetical protein PHAVU_011G004000g [Phaseolus vulgaris]
Length=707

 Score =   250 bits (639),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 173/249 (69%), Gaps = 4/249 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLHV  335
            M V  R  P S+ +       +N +  +L  P++  L+ DLK+L++ ++HP+ M ++   
Sbjct  410  MVVCSRCNPISSAIEFRLGPRSNGLSTDLSYPTEGQLISDLKFLFDSIIHPEKMMSYRPR  469

Query  336  CKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPEL  515
              +  +  SA  L+DCK+FMK+Y+P +    L P  I+L C ++L+D  +     PPPEL
Sbjct  470  IMRKRVADSARKLLDCKQFMKDYKPYEMAIEL-PSVIRLWCHVELSDQPKE-DPCPPPEL  527

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVR  695
            +VL  NAT+++LK EA+ AFQ+VY M++RFQ EEL+GY  + DS  +KLLLG++  VR++
Sbjct  528  IVLPLNATVAELKSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTVKLLLGTSGSVRIQ  587

Query  696  GRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSV  875
            G+   K+ LSRFRMERG E+W VDC CGAKDDDGE+MLACD+CG+WQHTRCAGI + D +
Sbjct  588  GKCPAKHGLSRFRMERGTEAWKVDCTCGAKDDDGEKMLACDTCGVWQHTRCAGIDNSDGM  647

Query  876  PARFVCLRC  902
            P++FVC+RC
Sbjct  648  PSKFVCMRC  656



>gb|EPS71344.1| hypothetical protein M569_03413 [Genlisea aurea]
Length=695

 Score =   248 bits (632),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 176/248 (71%), Gaps = 5/248 (2%)
 Frame = +3

Query  165  CVQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKK  344
             ++ RLEPG  +   +T+     +  +  ++EHLLRDLKY Y  MLHP+TMA H+     
Sbjct  428  AIEYRLEPGFESPQSDTSLHAERLTTSYLTEEHLLRDLKYFYGSMLHPETMAAHVWGAVS  487

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVL  524
            D    SA  ++DCK+F+K+++PEK   +    A+++LCE+DL++ S+     P  ELL+L
Sbjct  488  DFAAASARRILDCKQFVKDFRPEK-ADSKESNAVRVLCEMDLSELSDLDPPPP--ELLLL  544

Query  525  SSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRS  704
            S +AT++DLK+EA+ AF++VYLMFRRF+  E++GY G+ DST L+LL GS+  VR+RG+ 
Sbjct  545  SPDATLADLKLEATTAFREVYLMFRRFRALEIMGYGGLDDSTQLRLLFGSSGSVRIRGKF  604

Query  705  LGKNALS--RFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
              KN+ S  R+R+ERG+E W VDC CGAKDDDGERMLACD C IW HTRCAGIPD D VP
Sbjct  605  AWKNSSSVGRYRLERGVERWVVDCSCGAKDDDGERMLACDGCSIWLHTRCAGIPDSDGVP  664

Query  879  ARFVCLRC  902
            A+F+C  C
Sbjct  665  AKFMCYVC  672



>emb|CBI16978.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   246 bits (627),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 167/245 (68%), Gaps = 3/245 (1%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            V+ R+EP S  +N +   D+     +LPS   ++ DL+YLY  +L+PQTM  +     ++
Sbjct  425  VEFRIEPQSC-INNSIRVDSLDSNSSLPSKGQVIDDLRYLYNSILNPQTMVTYRPKATRE  483

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
            + ++SA  L+DCK+F+K+Y+ E+ V   NP AI L C ++L DYS+     PPPELLVL 
Sbjct  484  LAVESAKKLLDCKQFIKDYKVER-VAVKNPFAIHLWCHVELEDYSQDYPF-PPPELLVLP  541

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            +NATI+DLK EA++AF++VY++F+RF ++EL  +  +  S  L LL GS   VR+RGR  
Sbjct  542  TNATITDLKREATKAFKEVYVVFKRFYIQELPDFGRIEGSVTLNLLFGSRGSVRIRGRCN  601

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K  L RF+ ERG E+W VDC CG KDDDGERMLACD C +WQHTRC GI + D +PA+F
Sbjct  602  AKYGLGRFQAERGTETWIVDCICGTKDDDGERMLACDKCSVWQHTRCVGIENSDEIPAKF  661

Query  888  VCLRC  902
            +C RC
Sbjct  662  LCERC  666



>ref|XP_002265123.1| PREDICTED: PHD finger protein At1g33420 [Vitis vinifera]
Length=739

 Score =   245 bits (626),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 167/245 (68%), Gaps = 3/245 (1%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            V+ R+EP S  +N +   D+     +LPS   ++ DL+YLY  +L+PQTM  +     ++
Sbjct  424  VEFRIEPQSC-INNSIRVDSLDSNSSLPSKGQVIDDLRYLYNSILNPQTMVTYRPKATRE  482

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
            + ++SA  L+DCK+F+K+Y+ E+ V   NP AI L C ++L DYS+     PPPELLVL 
Sbjct  483  LAVESAKKLLDCKQFIKDYKVER-VAVKNPFAIHLWCHVELEDYSQDYPF-PPPELLVLP  540

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            +NATI+DLK EA++AF++VY++F+RF ++EL  +  +  S  L LL GS   VR+RGR  
Sbjct  541  TNATITDLKREATKAFKEVYVVFKRFYIQELPDFGRIEGSVTLNLLFGSRGSVRIRGRCN  600

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
             K  L RF+ ERG E+W VDC CG KDDDGERMLACD C +WQHTRC GI + D +PA+F
Sbjct  601  AKYGLGRFQAERGTETWIVDCICGTKDDDGERMLACDKCSVWQHTRCVGIENSDEIPAKF  660

Query  888  VCLRC  902
            +C RC
Sbjct  661  LCERC  665



>ref|XP_003540842.1| PREDICTED: PHD finger protein At1g33420-like [Glycine max]
 gb|KHN32453.1| PHD finger protein [Glycine soja]
Length=708

 Score =   244 bits (622),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 117/246 (48%), Positives = 168/246 (68%), Gaps = 12/246 (5%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEP    ++ N+           P+D  L+ DL +L++ ++HP  M  +     + 
Sbjct  423  IEFRLEPWCNGLSTNSG---------YPTDAQLISDLTFLFDSIIHPDKMVCYRPKNMRK  473

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +  SA  L+DCK+FMK+Y+P +    L P  I+LLC ++L+D  +    +PPPEL+VL 
Sbjct  474  RVADSARKLLDCKQFMKDYKPYEMAVEL-PSVIRLLCHVELSDQPKD-DPSPPPELIVLP  531

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NAT++DLK EA+ AFQ+VY M++RFQ EEL+GY  + DS  +K LLG++  ++++GR  
Sbjct  532  LNATVADLKSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTIKFLLGTSGSIQIQGRCP  591

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP-DLDSVPAR  884
             K+ LSRFRMERG E W VDC CGAKDDDGE+MLACD+CG+WQHTRCAGI  + D +P++
Sbjct  592  AKHGLSRFRMERGTEVWKVDCICGAKDDDGEKMLACDTCGVWQHTRCAGIDNNTDGMPSK  651

Query  885  FVCLRC  902
            FVC+RC
Sbjct  652  FVCMRC  657



>gb|KCW70986.1| hypothetical protein EUGRSUZ_F04095 [Eucalyptus grandis]
Length=714

 Score =   243 bits (619),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 168/254 (66%), Gaps = 10/254 (4%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDN-NYMRPNL-----PSDEHLLRDLKYLYECMLHPQTMAN  323
            M V+ R  P ++ V       +  Y R        PS EH++RDLK+LY  ++ P+TM N
Sbjct  410  MVVRTRYNPATSAVEFRLETPSLGYDRSRFQLNHHPSREHVIRDLKFLYGSLIFPETMVN  469

Query  324  HLHVCKKDVIIQSATTLIDCKKFMKEYQP-EKFVPALNPRAIQLLCELDLTDYSERCSVN  500
            H     ++ +  SAT L+DCK+FMK+Y   EK V +  P  I L C ++L+D+S+   ++
Sbjct  470  HRPQTTRERVRDSATKLLDCKQFMKDYASDEKAVKS--PLNIHLWCHVELSDHSKD-ELH  526

Query  501  PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE  680
             P EL+VL  NAT++DLK + ++AFQDVY MF+RFQ      Y  + DS  +KLL G   
Sbjct  527  LPQELIVLPLNATVADLKAKVTKAFQDVYAMFKRFQAVGFPEYGHIEDSLSVKLLTGLNG  586

Query  681  FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
             +RV G+ L  + L+RFRMERG+E+WTVDC CGAKDDDGERMLACD+CG+WQHTRCAGI 
Sbjct  587  SIRVHGKCLSMHGLNRFRMERGIENWTVDCDCGAKDDDGERMLACDTCGVWQHTRCAGID  646

Query  861  DLDSVPARFVCLRC  902
            + DSVP ++VC RC
Sbjct  647  NSDSVPLKYVCKRC  660



>ref|XP_010063730.1| PREDICTED: PHD finger protein At1g33420 [Eucalyptus grandis]
Length=721

 Score =   243 bits (619),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/254 (49%), Positives = 168/254 (66%), Gaps = 10/254 (4%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDN-NYMRPNL-----PSDEHLLRDLKYLYECMLHPQTMAN  323
            M V+ R  P ++ V       +  Y R        PS EH++RDLK+LY  ++ P+TM N
Sbjct  417  MVVRTRYNPATSAVEFRLETPSLGYDRSRFQLNHHPSREHVIRDLKFLYGSLIFPETMVN  476

Query  324  HLHVCKKDVIIQSATTLIDCKKFMKEYQP-EKFVPALNPRAIQLLCELDLTDYSERCSVN  500
            H     ++ +  SAT L+DCK+FMK+Y   EK V +  P  I L C ++L+D+S+   ++
Sbjct  477  HRPQTTRERVRDSATKLLDCKQFMKDYASDEKAVKS--PLNIHLWCHVELSDHSKD-ELH  533

Query  501  PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE  680
             P EL+VL  NAT++DLK + ++AFQDVY MF+RFQ      Y  + DS  +KLL G   
Sbjct  534  LPQELIVLPLNATVADLKAKVTKAFQDVYAMFKRFQAVGFPEYGHIEDSLSVKLLTGLNG  593

Query  681  FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
             +RV G+ L  + L+RFRMERG+E+WTVDC CGAKDDDGERMLACD+CG+WQHTRCAGI 
Sbjct  594  SIRVHGKCLSMHGLNRFRMERGIENWTVDCDCGAKDDDGERMLACDTCGVWQHTRCAGID  653

Query  861  DLDSVPARFVCLRC  902
            + DSVP ++VC RC
Sbjct  654  NSDSVPLKYVCKRC  667



>ref|XP_010499890.1| PREDICTED: PHD finger protein At1g33420-like [Camelina sativa]
Length=702

 Score =   239 bits (611),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 167/242 (69%), Gaps = 12/242 (5%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEP S    ++    NN       S EH+ +DL+YLYE +LHPQTMA       +D +I
Sbjct  426  RLEPVSNVHRLSKQEVNNV------SAEHVKQDLRYLYETLLHPQTMAEFRSRATRDKMI  479

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             +AT ++DCK F+K++        +NP AI L C ++L+D S+ C   PP ELLVL  NA
Sbjct  480  DAATKILDCKHFIKDH----LSSTVNPFAINLWCCVELSDESKECPAPPP-ELLVLPLNA  534

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK EA++AFQ+VY MF+RF+VEEL+GY  + DS  LK L+G+   VRV+GR   K+
Sbjct  535  TVSDLKTEAAKAFQEVYAMFKRFEVEELLGYGSLDDSITLKFLVGTNGIVRVKGR-CSKH  593

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
             LSR+RMERG+++W VDC CG KDDDGERMLACD CG+W HTRCAGI + D +P++F C 
Sbjct  594  GLSRYRMERGVDNWKVDCKCGTKDDDGERMLACDVCGVWHHTRCAGIKNADELPSKFHCF  653

Query  897  RC  902
            RC
Sbjct  654  RC  655



>ref|XP_010538899.1| PREDICTED: PHD finger protein At1g33420-like [Tarenaya hassleriana]
Length=701

 Score =   239 bits (609),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 164/222 (74%), Gaps = 5/222 (2%)
 Frame = +3

Query  237  RPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEK  416
            R + PS+EH+ RDL+Y+Y+ +LHPQTM+       ++ ++ ++T ++DCK F+K+Y P  
Sbjct  438  RVDYPSEEHVKRDLRYVYDTLLHPQTMSKFRSQETREKMMDASTKILDCKHFIKDYLPVN  497

Query  417  FVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
                +NP AI L C ++L+D S+ C   PP ELLVL  NAT++DLK+EA++AFQ+VY MF
Sbjct  498  ----VNPFAINLWCHVELSDQSKECPAPPP-ELLVLPLNATVTDLKIEAAKAFQEVYAMF  552

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHC  776
            +RF+V EL+GY  + DS  LK L+G++  VR++GR   K+ L R+RMERG+E+W VDC C
Sbjct  553  KRFEVVELLGYGSLEDSMTLKFLVGTSGMVRIKGRCSSKHGLLRYRMERGVENWKVDCVC  612

Query  777  GAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            G KDDDGERML+CD CG+W HTRCAGI + D++P++F C RC
Sbjct  613  GTKDDDGERMLSCDVCGVWHHTRCAGIDNTDALPSKFHCFRC  654



>ref|XP_002893768.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70027.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=697

 Score =   238 bits (606),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 126/253 (50%), Positives = 168/253 (66%), Gaps = 13/253 (5%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMR-----PNLPSDEHLLRDLKYLYECMLHPQTMAN  323
            V+C +C   P S          +N  R      N  S EH+ RDL YLYE +LHPQTMA 
Sbjct  406  VVCSRC--NPSSNDFEYRLESVDNVHRLSNQDVNNASVEHVKRDLIYLYETLLHPQTMAE  463

Query  324  HLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNP  503
              +   +D +I +AT ++DCK F+K+Y         NP AI L C ++L+D S+ C   P
Sbjct  464  FRYRATRDKMIDAATKILDCKHFIKDYLSR----TANPFAISLWCHVELSDESKECPAPP  519

Query  504  PPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF  683
            P ELLVL  NAT+SDLK+EA++AFQ+VY MF+RF+VEEL+GY  + D   LK L+G+   
Sbjct  520  P-ELLVLPLNATVSDLKIEAAKAFQEVYAMFKRFEVEELLGYGSIDDFITLKFLVGTNGV  578

Query  684  VRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPD  863
            +R++GR   K+ L R+RMERG+++W VDC CG KDDDGERMLACD CG+W HTRCAGI +
Sbjct  579  IRIKGR-CSKHGLLRYRMERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCAGINN  637

Query  864  LDSVPARFVCLRC  902
             D++P++F C RC
Sbjct  638  SDALPSKFHCFRC  650



>ref|XP_006415087.1| hypothetical protein EUTSA_v10006958mg [Eutrema salsugineum]
 gb|ESQ33440.1| hypothetical protein EUTSA_v10006958mg [Eutrema salsugineum]
Length=705

 Score =   236 bits (603),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/257 (47%), Positives = 166/257 (65%), Gaps = 12/257 (5%)
 Frame = +3

Query  147  DLIRVMCVQCRLEPGSATVNVNTAGDNNYMR-----PNLPSDEHLLRDLKYLYECMLHPQ  311
            D  RV+C +C   PGS          NN  R      N  S+E +  DL+YLY+ +LHPQ
Sbjct  409  DGSRVVCFRC--NPGSNDFEYRLEPVNNVHRLSNQDINFASEEQIKCDLRYLYDTLLHPQ  466

Query  312  TMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERC  491
            TMA       +  +I +AT ++DCK F+KEY        +NP AI L C ++L+D ++ C
Sbjct  467  TMAEFRSQATRVKMIDAATKILDCKHFIKEY----LSSTVNPFAINLWCNVELSDEAKDC  522

Query  492  SVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLG  671
               PP  L++   +AT+SDLK EA +AFQ+VY MF+RF+VEEL+GY  + D   LK L+G
Sbjct  523  PSPPPELLVL-PLDATVSDLKSEAVKAFQEVYAMFKRFEVEELLGYGSIDDFITLKFLVG  581

Query  672  SAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCA  851
            +   +RV+GR   K+ L R+RMERG+E+W VDC CG KDDDGERMLACD CG+W HTRCA
Sbjct  582  TNGVIRVKGRCSSKHGLLRYRMERGVENWKVDCKCGTKDDDGERMLACDMCGVWHHTRCA  641

Query  852  GIPDLDSVPARFVCLRC  902
            GI + D++P++F C +C
Sbjct  642  GIQNSDALPSKFHCFKC  658



>ref|XP_010478770.1| PREDICTED: PHD finger protein At1g33420 [Camelina sativa]
Length=702

 Score =   236 bits (602),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 126/242 (52%), Positives = 166/242 (69%), Gaps = 12/242 (5%)
 Frame = +3

Query  177  RLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVII  356
            RLEP S    ++    NN       S EH+ +DL+YLYE +LHPQTMA       +D +I
Sbjct  426  RLEPVSNVHRLSKQEVNNV------SAEHVKQDLRYLYETLLHPQTMAEFRSRATRDKMI  479

Query  357  QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNA  536
             +AT ++DCK F+K++        +NP AI L C ++L+D S+ C   PP ELLVL  NA
Sbjct  480  DAATKVLDCKHFIKDH----LSSTVNPFAINLWCCVELSDESKECPAPPP-ELLVLPLNA  534

Query  537  TISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKN  716
            T+SDLK EA++AFQ+VY MF+RF+VEEL+GY  + DS  LK L+G+   VRV+GR   K+
Sbjct  535  TVSDLKTEAAKAFQEVYAMFKRFEVEELLGYGSLDDSITLKFLVGTNGIVRVKGR-CSKH  593

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
             L R+RMERG+++W VDC CG KDDDGERMLACD CG+W HTRCAGI + D +P++F C 
Sbjct  594  GLLRYRMERGVDNWKVDCKCGTKDDDGERMLACDVCGVWHHTRCAGINNADELPSKFHCF  653

Query  897  RC  902
            RC
Sbjct  654  RC  655



>ref|XP_002519951.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF42555.1| DNA binding protein, putative [Ricinus communis]
Length=705

 Score =   236 bits (601),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/256 (48%), Positives = 172/256 (67%), Gaps = 15/256 (6%)
 Frame = +3

Query  162  MCVQCRLEPGS-------ATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMA  320
            M VQ R  P +       A ++    GD   +    PS E +  DLK+L + +L  +T  
Sbjct  413  MVVQARCNPNTCDAEYRLAPLSFMHCGDR--LDKVYPSKEDIKCDLKFLLDSLLDRETTV  470

Query  321  NHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVN  500
            N+     ++ +I +AT L+DCK+F+K+Y+P+K V   NP +I ++C ++L   SE+   +
Sbjct  471  NYGPHVTRESVIDAATKLLDCKQFVKDYRPKKMV-VNNPVSINIMCHVEL---SEQPKDD  526

Query  501  P--PPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGS  674
            P  PPEL++L  NAT++DLK EAS+AFQ+VY MFRRF+ +EL  Y  + DS  LK L+G+
Sbjct  527  PAIPPELIILPLNATVADLKREASKAFQEVYAMFRRFEAQELPEYGCLEDSVTLKFLVGT  586

Query  675  AEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAG  854
            +  V+++G    K  LS FRMERG+E WTVDC CGAKDDDGE+MLACD+CG+WQHTRCAG
Sbjct  587  SGSVKIKGTCPSKQTLSHFRMERGMERWTVDCPCGAKDDDGEKMLACDTCGVWQHTRCAG  646

Query  855  IPDLDSVPARFVCLRC  902
            I + D++P+ FVCLRC
Sbjct  647  IDNSDTIPSMFVCLRC  662



>ref|XP_010461171.1| PREDICTED: PHD finger protein At1g33420-like [Camelina sativa]
Length=700

 Score =   235 bits (599),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 128/256 (50%), Positives = 170/256 (66%), Gaps = 12/256 (5%)
 Frame = +3

Query  147  DLIRVMCVQCRLEPGSATVNVNTAGDNNYMR----PNLPSDEHLLRDLKYLYECMLHPQT  314
            D  +V+C +C   PGS          +N  R     N  S EH+ +DL+YLYE +LHPQT
Sbjct  406  DGSQVVCSRC--NPGSNDFEYRLEPVSNVHRLCKQVNNVSAEHVKQDLRYLYETLLHPQT  463

Query  315  MANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCS  494
            MA       +D +I +AT ++DCK F+K++        +NP AI L C ++L+D S+ C 
Sbjct  464  MAEFRSRATRDKMIDAATKILDCKHFIKDH----LSSTVNPFAINLWCCVELSDESKECP  519

Query  495  VNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGS  674
              PP ELLVL  NAT+SDLK E ++AFQ+VY MF+RF+VEEL+GY  + DS  LK L+G+
Sbjct  520  APPP-ELLVLPLNATVSDLKTEGAKAFQEVYAMFKRFEVEELLGYGSLDDSITLKFLVGT  578

Query  675  AEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAG  854
               VRV+GR   K+ L R+RMERG+++W VDC CG KDDDGERMLACD CG+W HTRCAG
Sbjct  579  NGVVRVKGR-CSKHGLLRYRMERGVDNWKVDCKCGTKDDDGERMLACDVCGVWHHTRCAG  637

Query  855  IPDLDSVPARFVCLRC  902
            I + D +P++F C RC
Sbjct  638  IKNADELPSKFHCFRC  653



>ref|XP_010910248.1| PREDICTED: PHD finger protein At1g33420-like [Elaeis guineensis]
Length=710

 Score =   234 bits (598),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/242 (48%), Positives = 166/242 (69%), Gaps = 7/242 (3%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ--PEKFV  422
            PS + LL+DLK+LY+ +L+P TM ++     K     SA+ L+DCK+F+K Y      ++
Sbjct  449  PSADQLLQDLKFLYDALLNPATMQSYKPQATKKSAQSSASNLLDCKQFIKHYDELASNWL  508

Query  423  PALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
            P+ +   +Q+ C ++L D+ +  +  PPPELL+L   ATI+DLK +A+RAFQ++YL+FRR
Sbjct  509  PS-SQFVLQIWCHVELIDHPKDYTA-PPPELLILPIAATIADLKQQATRAFQEIYLIFRR  566

Query  603  FQVEELV-GYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNA-LSRFRMERGLESWTVDCHC  776
            FQ E+L+  +  V DS  ++ +LGS    ++RG  +G +  L +FRMERGLE+W VDC C
Sbjct  567  FQAEQLILDHVDVSDSALVRHILGSNGIAKIRGSCVGDDQRLGQFRMERGLENWIVDCDC  626

Query  777  GAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCV-IGQAKTIGQMKDEF  953
            GAKDDDGERM+ACD+CG+WQHTRCAGI D D  PA+FVC RC C+     ++ GQMK   
Sbjct  627  GAKDDDGERMMACDACGVWQHTRCAGISDYDEAPAKFVCKRCICLRKSNGRSGGQMKSNT  686

Query  954  VG  959
             G
Sbjct  687  YG  688



>ref|XP_008803796.1| PREDICTED: PHD finger protein At1g33420-like [Phoenix dactylifera]
Length=717

 Score =   233 bits (595),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 177/269 (66%), Gaps = 9/269 (3%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLH  332
            V+ V+C  E  +    +  A      +P    P  + LL DLK+LY+ +L+P TM ++  
Sbjct  422  VVAVRCNAETSAIEYRLEAAPRQTMDKPYFSRPMADQLLHDLKFLYDAILNPTTMQSYKP  481

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQP--EKFVPALNPRAIQLLCELDLTDYSERCSVNPP  506
                D    SA+ L+DCK+F+K Y      ++P+ +P  +++ C ++L D+ +  + +PP
Sbjct  482  QATNDSAHSSASKLLDCKQFIKHYDDLDSSWLPS-SPLVLRIWCHVELIDHPKDYTASPP  540

Query  507  PELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAG-VGDSTGLKLLLGSAEF  683
             ELL+L   AT++DLK +A+RAFQ+ YL+F+RFQVE+L+   G VGD T +K +LGS E 
Sbjct  541  -ELLILPIYATVADLKQQATRAFQETYLIFQRFQVEQLILDRGDVGDFTLVKHILGSNEI  599

Query  684  VRVRGRSLGK-NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
              +RGR +G    L +FRMERGLE+W VDC CGAKDDDGERM+ACD+CG+WQHTRC GI 
Sbjct  600  AIIRGRCVGDVQRLGQFRMERGLENWIVDCDCGAKDDDGERMMACDTCGVWQHTRCTGIS  659

Query  861  DLDSVPARFVCLRCSCV-IGQAKTIGQMK  944
            D D VPA+FVC +C C+   + ++ G++K
Sbjct  660  DYDEVPAKFVCKKCICIRKSKGRSSGRIK  688



>ref|XP_010930553.1| PREDICTED: PHD finger protein At1g33420-like [Elaeis guineensis]
Length=714

 Score =   231 bits (590),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 120/252 (48%), Positives = 167/252 (66%), Gaps = 13/252 (5%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
            P+  HLL D+++LY+ +L+P TM  +    K     ++A+ L+DCK+F+K Y     + A
Sbjct  452  PAAHHLLHDMRFLYDALLNPATMQPYKPQLKWQHARRAASKLLDCKRFVKHYDKMDDLGA  511

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
             NP AI + C +++ D+ +  +  PPPELLVL + AT++DLK E S+AFQ+ YL+F+ FQ
Sbjct  512  SNPFAIHVCCRIEVVDWPKDYTA-PPPELLVLPAAATVADLKSEVSKAFQETYLIFQTFQ  570

Query  609  VEEL-VGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGLESWTVDCHCGA  782
             E+L V + GV DST +K +LGS E VRV GR LG ++ L R+RMERG++ W VDC CG 
Sbjct  571  AEQLLVDHKGVNDSTQIKHILGSDESVRVGGRCLGGEDKLERYRMERGMDEWLVDCICGV  630

Query  783  KDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC----------SCVIGQAKTI  932
            KDDDGERMLACD CG+WQHT C+GI DLD VP++FVC  C          S + G   T+
Sbjct  631  KDDDGERMLACDMCGVWQHTICSGISDLDEVPSQFVCRECGSSSESAGSGSTISGDTTTL  690

Query  933  GQMKDEFVGSAA  968
            G+ ++  V SA 
Sbjct  691  GRCQNVAVSSAT  702



>gb|KHN11645.1| PHD finger protein [Glycine soja]
Length=708

 Score =   231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 165/246 (67%), Gaps = 12/246 (5%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEP    ++  ++          P++  L+ DL +L+  ++HP  M  +     + 
Sbjct  423  IEFRLEPWCNGLSTKSS---------YPTEVQLISDLTFLFNSIIHPDKMVCYRPKIMRK  473

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +  SA  L+DCK+FMK+Y+P +    L P  I+L C ++L+D   +   +PPPEL++L 
Sbjct  474  SVADSARKLLDCKQFMKDYKPYEMAVEL-PSVIRLWCHVELSD-QPKDDPSPPPELIMLP  531

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NAT++DL+ EA+ AFQ+VY M++RFQ EEL+GY  + DS  ++ LLG++  ++++G+  
Sbjct  532  LNATVADLRSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTIRFLLGTSGSIQIQGKCP  591

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP-DLDSVPAR  884
             K+ LSRFRMERG E W VDC CGAKDDDGE+MLACD+CG+WQHTRCAGI  + D +P++
Sbjct  592  AKHGLSRFRMERGTEVWKVDCTCGAKDDDGEKMLACDTCGVWQHTRCAGIDNNTDGMPSK  651

Query  885  FVCLRC  902
            FVC+ C
Sbjct  652  FVCMGC  657



>ref|XP_003534422.1| PREDICTED: PHD finger protein At1g33420-like [Glycine max]
Length=708

 Score =   231 bits (589),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/246 (44%), Positives = 165/246 (67%), Gaps = 12/246 (5%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLEP    ++  ++          P++  L+ DL +L+  ++HP  M  +     + 
Sbjct  423  IEFRLEPWCNGLSTKSS---------YPTEVQLISDLTFLFNSIIHPDKMVCYRPKIMRK  473

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
             +  SA  L+DCK+FMK+Y+P +    L P  I+L C ++L+D   +   +PPPEL++L 
Sbjct  474  SVADSARKLLDCKQFMKDYKPYEMAVEL-PSVIRLWCHVELSD-QPKDDPSPPPELIMLP  531

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
             NAT++DL+ EA+ AFQ+VY M++RFQ EEL+GY  + DS  ++ LLG++  ++++G+  
Sbjct  532  LNATVADLRSEATSAFQEVYAMYKRFQAEELLGYGSISDSLTIRFLLGTSGSIQIQGKCP  591

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP-DLDSVPAR  884
             K+ LSRFRMERG E W VDC CGAKDDDGE+MLACD+CG+WQHTRCAGI  + D +P++
Sbjct  592  AKHGLSRFRMERGTEVWKVDCTCGAKDDDGEKMLACDTCGVWQHTRCAGIDNNTDGMPSK  651

Query  885  FVCLRC  902
            FVC+ C
Sbjct  652  FVCMGC  657



>gb|KDP37798.1| hypothetical protein JCGZ_06700 [Jatropha curcas]
Length=709

 Score =   231 bits (588),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/215 (50%), Positives = 153/215 (71%), Gaps = 3/215 (1%)
 Frame = +3

Query  258  EHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNP  437
            E + RDLK++ + +L P+T+ N+     ++ +  +ATT++DCK+FMK+Y P+K + ++ P
Sbjct  455  EVIKRDLKFILDSLLDPKTIVNYGPQVTRESVTDAATTILDCKQFMKDYLPDKMIRSI-P  513

Query  438  RAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEE  617
             AI L C ++L+D  +      PPEL+VL  NAT++DLK EA++ FQ+VY MF++F+  E
Sbjct  514  SAIHLFCHIELSDQPKDDPSIIPPELIVLPLNATVADLKNEATKVFQEVYAMFKKFEAHE  573

Query  618  LVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDG  797
            L  Y  + DS  LK LLG++  V+++G    K+ALS FRMERG E WTVDC CGAKDDDG
Sbjct  574  LSEYGSLEDSITLKFLLGTSGSVKIKGTCPSKHALSHFRMERGTERWTVDCPCGAKDDDG  633

Query  798  ERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            E+MLACD+CG+WQHTRCAGI   D V   F+C+RC
Sbjct  634  EKMLACDTCGVWQHTRCAGIDSADKVT--FICIRC  666



>gb|EAY76692.1| hypothetical protein OsI_04645 [Oryza sativa Indica Group]
Length=716

 Score =   230 bits (586),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 112/224 (50%), Positives = 158/224 (71%), Gaps = 10/224 (4%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS----ATTLIDCKKFMKEYQPEK  416
            PS +HLL DLK+LY  +L+P+TM       + +VI  S    A  ++DCK+F+K Y    
Sbjct  450  PSVDHLLHDLKFLYNALLNPETML----ASQPEVIGASSHSAAAKILDCKQFIKHYDQHT  505

Query  417  FVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
                LNP  + + C ++L D+ +  +  PP EL++L ++AT+++LK++A+RAFQ+ YLMF
Sbjct  506  PRAPLNPFLLSVRCSIELLDHPKDYTA-PPVELVLLPASATLAELKIQATRAFQETYLMF  564

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNA-LSRFRMERGLESWTVDCH  773
            + FQVE+L  +    D+T +K +LGS++ VRVRGR  G N  + +FRMERGLE+WTVDC 
Sbjct  565  QSFQVEQLPDFPNFSDTTLVKHVLGSSQLVRVRGRCTGDNRRIVQFRMERGLENWTVDCT  624

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            CGAKDDDGERMLACD CG+WQHTRC+GI D D VP +F+C +C+
Sbjct  625  CGAKDDDGERMLACDVCGVWQHTRCSGISDFDDVPEKFICRKCA  668



>ref|NP_001044975.1| Os01g0877500 [Oryza sativa Japonica Group]
 dbj|BAC07324.1| putative male sterility 1 protein [Oryza sativa Japonica Group]
 dbj|BAF06889.1| Os01g0877500 [Oryza sativa Japonica Group]
 gb|EAZ14357.1| hypothetical protein OsJ_04277 [Oryza sativa Japonica Group]
 dbj|BAG94898.1| unnamed protein product [Oryza sativa Japonica Group]
Length=716

 Score =   229 bits (583),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 158/224 (71%), Gaps = 10/224 (4%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS----ATTLIDCKKFMKEYQPEK  416
            PS +HLL DLK+LY  +L+P+TM       + +VI  S    A  ++DCK+F+K Y    
Sbjct  450  PSVDHLLHDLKFLYNALLNPETML----ASQPEVIGASSHSAAAKILDCKQFIKHYDQHT  505

Query  417  FVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
                LNP  + + C ++L D+ +  +  PP EL++L ++AT+++LK++A+RAFQ+ YLMF
Sbjct  506  PRAPLNPFLLSVRCSIELLDHPKDYTA-PPVELVLLPASATLAELKIQATRAFQETYLMF  564

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNA-LSRFRMERGLESWTVDCH  773
            + +QVE+L  +    D+T +K +LGS++ VRVRGR  G N  + +FRMERGLE+WTVDC 
Sbjct  565  QSYQVEQLPDFPNFSDTTLVKHVLGSSQLVRVRGRCTGDNRRIVQFRMERGLENWTVDCT  624

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            CGAKDDDGERMLACD CG+WQHTRC+GI D D VP +F+C +C+
Sbjct  625  CGAKDDDGERMLACDVCGVWQHTRCSGISDFDDVPEKFICRKCA  668



>ref|XP_006645112.1| PREDICTED: PHD finger protein At1g33420-like [Oryza brachyantha]
Length=716

 Score =   228 bits (581),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 164/247 (66%), Gaps = 9/247 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLE  S+   VNT           PS +HLL DLK+LY  +L+P+ M +        
Sbjct  430  IEYRLEDYSSQSPVNTTVFG-------PSVDHLLHDLKFLYNALLNPEIMLSSQPEVIAA  482

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
                +A  ++DCK+F+K Y        LNP  + + C ++L D+ +  +  PP EL++L 
Sbjct  483  SSHSAAAKILDCKQFIKHYDEHTPRAPLNPFLLSVRCSIELLDHPKDYTA-PPVELVLLP  541

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            ++AT+++LK++A+RAFQ+ YLMF+ FQVE+L  +    D+T +K +LGS + VRVRGR  
Sbjct  542  ASATLAELKIQATRAFQETYLMFQSFQVEQLPDFPNFSDTTLVKHVLGSNQLVRVRGRCT  601

Query  708  GKNA-LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
            G N  + +FRMERGLE+WTVDC CGAKDDDGERM+ACD CG+WQHTRC+GI DLD VP +
Sbjct  602  GDNRRIVQFRMERGLENWTVDCTCGAKDDDGERMMACDVCGVWQHTRCSGISDLDDVPEK  661

Query  885  FVCLRCS  905
            F+C +C+
Sbjct  662  FICRKCA  668



>ref|XP_004970770.1| PREDICTED: PHD finger protein At1g33420-like [Setaria italica]
Length=713

 Score =   227 bits (578),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 160/247 (65%), Gaps = 9/247 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLE  S    VN A          PS EHLL DL++LY+ +L+P++M +        
Sbjct  427  IEYRLESSSIRSPVNAATFE-------PSVEHLLHDLRFLYDALLNPESMLSSQPEVVGS  479

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
                +A  ++DCK+F+K Y         NP  + + C ++L D+ +  +  PP EL++L 
Sbjct  480  SAHSAAAKILDCKQFIKHYDKHALRTPSNPFLLSVRCSIELLDHPKDYTA-PPEELVLLP  538

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            ++AT+++LKV+ASRAFQ+ YLMF+ FQ E+L  +    D+T +K +LGS + VR+RGR  
Sbjct  539  ASATLAELKVQASRAFQETYLMFQSFQAEQLPDFPNFSDTTPVKHVLGSGQLVRLRGRCT  598

Query  708  GK-NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
            G    + +FRMERGLE+WTVDC CGAKDDDGERMLACD CG+WQHTRC+GI D + VP  
Sbjct  599  GDYRRIVQFRMERGLENWTVDCSCGAKDDDGERMLACDVCGVWQHTRCSGISDFEEVPEN  658

Query  885  FVCLRCS  905
            F+C +C+
Sbjct  659  FICRKCA  665



>ref|XP_008786465.1| PREDICTED: PHD finger protein At1g33420-like [Phoenix dactylifera]
Length=674

 Score =   225 bits (574),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/223 (52%), Positives = 155/223 (70%), Gaps = 5/223 (2%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
            PS  HLL D+K+LY+ +L+P TM       K +    +A+ L+DCK+F+K Y     + A
Sbjct  420  PSAYHLLHDMKFLYDALLNPTTMQPCKPQLKWEHTRNAASKLLDCKQFIKHYDKMDDLGA  479

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
             NP A+++ C ++L D  +  +  PPPELLVL + AT++DLK E ++AFQ+ YL+F+ FQ
Sbjct  480  SNPFAVRICCRVELVDRPKDYTA-PPPELLVLPTAATVADLKSEVTKAFQETYLIFKNFQ  538

Query  609  VEE-LVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG--KNALSRFRMERGLESWTVDCHCG  779
             E+ LV + GVGD+T +K +L S E VRVRGR L   ++ L  FRMERG++ W VDC CG
Sbjct  539  AEQVLVDHRGVGDATRIKHILRSNEIVRVRGRCLAGDEDRLEHFRMERGMDEWIVDCICG  598

Query  780  AKDDDGERMLACDSCGIWQHTRCAGIPDLD-SVPARFVCLRCS  905
            AKDDDGERMLACD CG+WQHTRC+GI DLD  VPA+FVC  C 
Sbjct  599  AKDDDGERMLACDMCGVWQHTRCSGISDLDEEVPAQFVCRLCG  641



>ref|XP_010927813.1| PREDICTED: PHD finger protein At1g33420-like [Elaeis guineensis]
Length=717

 Score =   224 bits (572),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 111/256 (43%), Positives = 170/256 (66%), Gaps = 6/256 (2%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLH  332
            ++ V+C  E  +    +  A +       L  P+ + LL DLK+LY+ +L+P TM ++  
Sbjct  422  MVAVRCNAETSAMEYRLEEASNQMQSTQYLSRPTADQLLHDLKFLYDAILNPTTMQSYKP  481

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQ-PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP  509
                D +  SA+ L+DCK+F+K Y  P     +  P  +++ C ++L D+ +  + +PP 
Sbjct  482  QATNDSVRSSASKLLDCKQFIKHYDDPASGWLSSGPFVLRIWCHVELIDHPKDYTASPP-  540

Query  510  ELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAG-VGDSTGLKLLLGSAEFV  686
            ELL+L  +AT++DLK + +RAFQ+ YL+F+RFQVE+L+   G +G+ T +K + G  E  
Sbjct  541  ELLILPMSATVADLKQQVARAFQETYLVFQRFQVEQLILDRGDIGELTLVKHIFGPNEIA  600

Query  687  RVRGRSLGKNA-LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPD  863
             +RG+ +G +  L +FRMERGLE+W VDC+CGAKDDDGERM+ACD+CG+WQHTRC GI D
Sbjct  601  MIRGKCVGDDRRLGQFRMERGLENWIVDCYCGAKDDDGERMMACDTCGVWQHTRCIGISD  660

Query  864  LDSVPARFVCLRCSCV  911
             + VPA+FVC +C+C+
Sbjct  661  YEEVPAKFVCKKCNCM  676



>ref|XP_009393484.1| PREDICTED: PHD finger protein At1g33420-like [Musa acuminata 
subsp. malaccensis]
Length=717

 Score =   224 bits (571),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 115/258 (45%), Positives = 169/258 (66%), Gaps = 15/258 (6%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-QPEKFVP  425
            PS +HL+ DLK+LY+ +L+P +M  +     ++  + SA  L+DCK+F++ Y +   ++ 
Sbjct  457  PSADHLIHDLKFLYDALLNPASMQPYKPSALRESALSSAVKLLDCKQFIRHYDESVSYLS  516

Query  426  ALNPR-AIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
              NP  A  L C + L D+ E  +  PPPELL+LS+ ATI+DLK++ ++ FQ+ YL+F+R
Sbjct  517  PPNPSSATALWCHVKLVDHPEDYTA-PPPELLILSAGATIADLKLQVTKTFQETYLVFQR  575

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGLESWTVDCHCG  779
            FQ E+L+ +    D T +K L GS    R+RGR LG   +L  FR ERG+++W VDC CG
Sbjct  576  FQAEQLLDHEEASDVTPVKSLFGSYGVARLRGRFLGIDQSLGLFRKERGVDNWIVDCVCG  635

Query  780  AKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCV-------IGQAKT---  929
            AKDDDGERM+ACD+CG+WQHTRCAG+ D + VPA+FVC +C  +       +G+ K    
Sbjct  636  AKDDDGERMMACDACGVWQHTRCAGVDDFEEVPAKFVCKKCVGIRKYRGRGVGRPKNDRP  695

Query  930  IGQMKDEFVGSAAYCVGK  983
             G+ KDE +G +   VG+
Sbjct  696  NGRCKDE-IGPSLTSVGR  712



>ref|XP_010232639.1| PREDICTED: PHD finger protein At1g33420 [Brachypodium distachyon]
Length=717

 Score =   222 bits (566),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 165/251 (66%), Gaps = 4/251 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLHV  335
            + V+C  E  +    + T  + + +   +  PS EHL+ DL++LY+ +L+P+TM +    
Sbjct  419  IAVRCNAETSAIEYRLETYSNQSTVNATVFGPSVEHLVHDLRFLYDALLNPETMLSSQPE  478

Query  336  CKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPEL  515
                    +A  ++DCK+F+K Y         NP  + + C ++L D+ +  +  PP EL
Sbjct  479  VVGASSHSAAAKILDCKQFIKHYDECDPQTPSNPFLLSVKCTIELLDHPKDYTA-PPVEL  537

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVR  695
            ++L ++AT+++LK++A+RAFQ+ YLMF+ FQ E+L  +    DST +K +LGS++ VRVR
Sbjct  538  VLLPASATLAELKIQAARAFQETYLMFQSFQAEQLPDFLNFSDSTPVKHVLGSSQLVRVR  597

Query  696  GRSLGKNA-LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            GR  G +  + +FRMERGLE+WTVDC CGAKDDDGERM+ACD CG+WQHTRC+GI D + 
Sbjct  598  GRCTGDHRRIVQFRMERGLENWTVDCTCGAKDDDGERMMACDVCGVWQHTRCSGISDFEE  657

Query  873  VPARFVCLRCS  905
            VP +F C +C+
Sbjct  658  VPEKFTCRKCA  668



>ref|XP_002456731.1| hypothetical protein SORBIDRAFT_03g041550 [Sorghum bicolor]
 gb|EES01851.1| hypothetical protein SORBIDRAFT_03g041550 [Sorghum bicolor]
Length=710

 Score =   221 bits (562),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/247 (45%), Positives = 156/247 (63%), Gaps = 9/247 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLE  S     N A          PS E LL DL++LY+ +L+P++M +        
Sbjct  425  IEYRLESSSTRSPANAATFG-------PSVEQLLHDLRFLYDALLNPESMLSSQPEVVGA  477

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
                +A  +IDCK+F+K Y         NP  + + C ++L D+ +  +  PP EL++L 
Sbjct  478  SAHSAAAKIIDCKQFIKHYDEHALRTPSNPYLLCVRCSIELLDHPKDYTT-PPEELVLLP  536

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            ++AT+ DLKV+AS+AFQ+ YLMF+ FQ E+L  +    D+T +  +LGS + +RVRGR  
Sbjct  537  ASATLGDLKVQASKAFQETYLMFQSFQTEQLPDFPNFSDTTPVNHVLGSGQLLRVRGRCT  596

Query  708  GK-NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
            G    + +FRMERGLE+WTVDC CGAKDDDGERMLACD CG+WQHTRC+GI D + VP  
Sbjct  597  GDYRRIVQFRMERGLENWTVDCSCGAKDDDGERMLACDICGVWQHTRCSGISDFEEVPEN  656

Query  885  FVCLRCS  905
            F+C +C+
Sbjct  657  FICRKCA  663



>ref|XP_008657002.1| PREDICTED: PHD finger protein At1g33420 [Zea mays]
Length=713

 Score =   220 bits (561),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/253 (43%), Positives = 159/253 (63%), Gaps = 6/253 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMRPNL----PSDEHLLRDLKYLYECMLHPQTMANHL  329
            +CV  R   G++ +       +     N     PS + LL DL++LY+ +L+P++M +  
Sbjct  414  LCVAVRCNAGTSAIEYRLESSSVRSPANAATFGPSVDQLLHDLRFLYDALLNPESMLSSQ  473

Query  330  HVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP  509
                      +A  +IDCK+F+K Y         NP  + + C ++L D+ +  +  PP 
Sbjct  474  PEVVGASAHSAAAKIIDCKQFIKHYDEHALRTPSNPFLLCVRCSIELLDHPKDYT-TPPE  532

Query  510  ELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVR  689
            EL++L ++AT+ DLKV+AS+AFQ+ YLMF+ FQ E+L  +    D+T +K +LGS + +R
Sbjct  533  ELVLLPASATLGDLKVQASKAFQETYLMFQSFQTEQLPDFPNFSDTTPVKHVLGSGQLLR  592

Query  690  VRGRSLGK-NALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDL  866
            VRGR  G    + +FRMERGLE+WTVDC CGAKDDDGERMLACD CG+WQHTRC+GI D 
Sbjct  593  VRGRCTGDYRRIVQFRMERGLENWTVDCSCGAKDDDGERMLACDICGVWQHTRCSGISDF  652

Query  867  DSVPARFVCLRCS  905
            + VP  F+C +C+
Sbjct  653  EEVPENFICRKCA  665



>ref|XP_010237811.1| PREDICTED: PHD finger protein At1g33420-like [Brachypodium distachyon]
Length=715

 Score =   218 bits (555),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/254 (46%), Positives = 158/254 (62%), Gaps = 12/254 (5%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVC  338
            V+  QC  E  S    +            +PS EHLLRD+K+LY+ +L+P TM  +    
Sbjct  431  VVVAQCNSETNSVEYRLMKEATLVPKNACVPSREHLLRDIKFLYDALLYPHTMHPYKPEQ  490

Query  339  KKDVIIQSATTLIDCKKFMKEYQ-PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP--  509
              +   +SA  L+DCK+F+K Y   E F+P  NP  + + C+++L D      V  PP  
Sbjct  491  IHEGAKKSAMILLDCKQFIKHYDLEEDFLPQ-NPSMLHIWCQVELLD-----QVTDPPCL  544

Query  510  --ELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF  683
              ELL L   AT++DLKVEA+R F+D+YLM + F V +L+  A   D+T LKLL G+   
Sbjct  545  PAELLTLPPTATVADLKVEATRTFRDMYLMLQSFVVTQLLDCASASDTTQLKLLFGANGS  604

Query  684  VRVRGRSLG-KNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
            VR++G+ +G +  ++ +RMERG+E WTV C CGAKDDDGERML+CDSC +WQHTRCAGI 
Sbjct  605  VRIQGKCVGGERRVTIYRMERGVEKWTVKCSCGAKDDDGERMLSCDSCHVWQHTRCAGIS  664

Query  861  DLDSVPARFVCLRC  902
            D D VP R+VC  C
Sbjct  665  DFDQVPKRYVCASC  678



>gb|EMT08696.1| PHD finger protein [Aegilops tauschii]
Length=647

 Score =   215 bits (547),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/256 (41%), Positives = 166/256 (65%), Gaps = 13/256 (5%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLHV  335
            + V+C  E  +    + T  + + +   +  PS EHL  DL++LY+ +L+P+TM +    
Sbjct  348  IAVRCNTETSAIEYRLETYSNQSPVDATVFGPSVEHLAHDLRFLYDALLNPETMLS----  403

Query  336  CKKDVII-----QSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVN  500
             + +V++      +A  ++DCK+F+K Y         NP  + + C ++L D+ +  +  
Sbjct  404  SQPEVVVGASAHNAAARILDCKQFIKHYDECAPESPPNPILLAVRCSIELLDHPKDYTA-  462

Query  501  PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE  680
            PP EL++L + AT+ +LK+ A+R FQ+ YLMF  FQ E+L  +  + D+T +K +LG ++
Sbjct  463  PPVELVLLPATATLGELKMLAARVFQETYLMFHSFQAEQLPEFPNLSDTTPVKHVLGPSQ  522

Query  681  FVRVRGRSLGKNA-LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGI  857
             VRVRGR  G +  + +FRMERGLE+WTVDC CGAKDDDGERM+ACD+CG+WQHTRC+GI
Sbjct  523  LVRVRGRCTGDHRRIVQFRMERGLENWTVDCTCGAKDDDGERMMACDACGVWQHTRCSGI  582

Query  858  PDLDSVPARFVCLRCS  905
             D + VP +F+C +C+
Sbjct  583  SDFEEVPEKFICRKCA  598



>ref|XP_008802928.1| PREDICTED: PHD finger protein At1g33420-like [Phoenix dactylifera]
Length=709

 Score =   214 bits (545),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/248 (45%), Positives = 159/248 (64%), Gaps = 11/248 (4%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            ++ RLE  S     N      Y+  + PS + LL+DLK+LY+ +L P TM ++     ++
Sbjct  428  IEYRLEAAS-----NQTMTTRYL--SRPSADQLLQDLKFLYDALLSPATMQSYRPQATEE  480

Query  348  VIIQSATTLIDCKKFMKEY-QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVL  524
                SA+ L+DCK+F+K Y +P           + + C ++L D+  +    PPPELL+L
Sbjct  481  AASSSASKLLDCKQFIKHYDEPASNQLPSGQSMLPIWCHVELIDHP-KGYTTPPPELLIL  539

Query  525  SSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAG-VGDSTGLKLLLGSAEFVRVRGR  701
               AT++DLK +A+RAFQ+ YL+F+RFQ E+L+   G V D   ++ +LG  E  ++RG 
Sbjct  540  PMTATVADLKQQATRAFQETYLIFQRFQAEQLILDRGDVSDFALVRHILGLNEIAKIRGT  599

Query  702  SLGKNA-LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
              G +    +FRMERGLE+W VDC CGAKDDDGERM+ACD+CG+WQHTRCAGI D D VP
Sbjct  600  CSGVDQRFGQFRMERGLENWIVDCDCGAKDDDGERMMACDACGVWQHTRCAGISDHDEVP  659

Query  879  ARFVCLRC  902
            A++VC +C
Sbjct  660  AKYVCRKC  667



>emb|CDM85226.1| unnamed protein product [Triticum aestivum]
Length=719

 Score =   214 bits (546),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/251 (41%), Positives = 160/251 (64%), Gaps = 4/251 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLHV  335
            + V+C  E  +    + T  + + +   +  PS EHL  DL++LY+ +L+P+ M +    
Sbjct  421  IAVRCNTETSAIEYRLETYSNQSPVDATVFGPSVEHLAHDLRFLYDALLNPEIMLSSQPE  480

Query  336  CKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPEL  515
                    +A  ++DCK+F+K Y         NP  + + C ++L D+ +  +  PP EL
Sbjct  481  VVGASAHNAAARILDCKQFIKHYDESAPESPPNPILLAVRCSIELLDHPKDYTA-PPVEL  539

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVR  695
            ++L + AT+ +LK+ A+R FQ+ YLMF  FQ E+L  +  + D+T +K +LG ++ VRVR
Sbjct  540  VLLPATATLGELKMLAARVFQETYLMFHSFQAEQLPEFPNLSDTTPVKHVLGPSQLVRVR  599

Query  696  GRSLGKNA-LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            GR  G +  + +FRMERGLE+WTVDC CGAKDDDGERM+ACD+CG+WQHTRC+GI D + 
Sbjct  600  GRCTGDHRRIVQFRMERGLENWTVDCTCGAKDDDGERMMACDACGVWQHTRCSGISDFEE  659

Query  873  VPARFVCLRCS  905
            VP +F+C +C+
Sbjct  660  VPEKFICRKCA  670



>ref|XP_003605664.1| PHD finger protein [Medicago truncatula]
Length=719

 Score =   211 bits (537),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 151/251 (60%), Gaps = 5/251 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMR--PNLPSDEHLLRDLKYLYECMLHPQTMANHLHV  335
            M V  R  P S+ +        N      + P+ E ++ DL +L+  ++HP+ M  +   
Sbjct  416  MVVCSRCNPTSSAIEFRLGHWPNGFSSIASYPTKEQVISDLTFLFNSIVHPEKMIKYRPK  475

Query  336  CKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPEL  515
              +  +  SA  L+DCK+FMK+Y+ E+    L P A+++ C + L+D+ +     PPPEL
Sbjct  476  INRKTVADSARKLLDCKQFMKDYKIEQMTTVL-PSALKIWCHVKLSDHPKEDHPTPPPEL  534

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGD-STGLKLLLGSAE-FVR  689
            +VL  NAT +DL  E +  FQ+VY M+++F   +L+GY    +    LK LLGS    V 
Sbjct  535  IVLPLNATNADLLNEVTSVFQEVYGMYKKFVAVKLLGYGLTREREYTLKFLLGSTYGSVE  594

Query  690  VRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLD  869
            V+G    KN L+RFRMERG E W VDC CG KDDDGERMLACD+CG+W HTRCAGI   D
Sbjct  595  VQGECPAKNGLARFRMERGTEEWKVDCICGTKDDDGERMLACDTCGVWLHTRCAGIDSAD  654

Query  870  SVPARFVCLRC  902
             +P++F+C RC
Sbjct  655  GMPSKFICKRC  665



>gb|AES87861.2| PHD finger plant-like protein [Medicago truncatula]
Length=732

 Score =   211 bits (537),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/251 (43%), Positives = 151/251 (60%), Gaps = 5/251 (2%)
 Frame = +3

Query  162  MCVQCRLEPGSATVNVNTAGDNNYMR--PNLPSDEHLLRDLKYLYECMLHPQTMANHLHV  335
            M V  R  P S+ +        N      + P+ E ++ DL +L+  ++HP+ M  +   
Sbjct  416  MVVCSRCNPTSSAIEFRLGHWPNGFSSIASYPTKEQVISDLTFLFNSIVHPEKMIKYRPK  475

Query  336  CKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPEL  515
              +  +  SA  L+DCK+FMK+Y+ E+    L P A+++ C + L+D+ +     PPPEL
Sbjct  476  INRKTVADSARKLLDCKQFMKDYKIEQMTTVL-PSALKIWCHVKLSDHPKEDHPTPPPEL  534

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGD-STGLKLLLGSAE-FVR  689
            +VL  NAT +DL  E +  FQ+VY M+++F   +L+GY    +    LK LLGS    V 
Sbjct  535  IVLPLNATNADLLNEVTSVFQEVYGMYKKFVAVKLLGYGLTREREYTLKFLLGSTYGSVE  594

Query  690  VRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLD  869
            V+G    KN L+RFRMERG E W VDC CG KDDDGERMLACD+CG+W HTRCAGI   D
Sbjct  595  VQGECPAKNGLARFRMERGTEEWKVDCICGTKDDDGERMLACDTCGVWLHTRCAGIDSAD  654

Query  870  SVPARFVCLRC  902
             +P++F+C RC
Sbjct  655  GMPSKFICKRC  665



>ref|XP_008677470.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
 gb|ACN28661.1| unknown [Zea mays]
Length=495

 Score =   206 bits (525),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 161/270 (60%), Gaps = 10/270 (4%)
 Frame = +3

Query  222   DNNYMRPN--LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
             D   + PN  +P+ +HL RD+K+L++ +LHP TM  +      +   +SA  L+DCK+F 
Sbjct  223   DEPIVLPNVSMPTQDHLRRDIKFLHDALLHPHTMHPYKPENCYEHGKRSAMVLLDCKQFT  282

Query  396   KEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNP--PPELLVLSSNATISDLKVEASR  569
             K Y  E+     NP  + L C++++ D   +    P  PPELL L   AT+SDLKVEA+R
Sbjct  283   KHYDLEQEFLPQNPSMLHLWCQVEVLD---QVGDPPCIPPELLTLPQTATVSDLKVEATR  339

Query  570   AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR-SLGKNALSRFRMERG  746
              F+ +YLM   F  + LV      +ST LKLL G+   VRV+GR + G+  +  +RMERG
Sbjct  340   TFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANGTVRVQGRCASGERRVGIYRMERG  399

Query  747   LESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAK  926
             ++ WTV C CGAKDDDGERML+CDSC +WQHTRC GI D D VP ++VC  C  ++ + K
Sbjct  400   VDKWTVRCSCGAKDDDGERMLSCDSCHVWQHTRCVGISDFDQVPKKYVCNSCK-LLNKRK  458

Query  927   TIGQMKDEFVG-SAAYCVGKGLGKSMTSAF  1013
             + G      +G S  + +G G   S    F
Sbjct  459   SRGHGPVYNIGPSKRFKIGAGGFSSRWGIF  488



>ref|NP_001159230.1| hypothetical protein [Zea mays]
 ref|XP_008677468.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008677469.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25519.1| unknown [Zea mays]
 gb|AFW60509.1| hypothetical protein ZEAMMB73_506546 [Zea mays]
Length=591

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 161/270 (60%), Gaps = 10/270 (4%)
 Frame = +3

Query  222   DNNYMRPN--LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
             D   + PN  +P+ +HL RD+K+L++ +LHP TM  +      +   +SA  L+DCK+F 
Sbjct  319   DEPIVLPNVSMPTQDHLRRDIKFLHDALLHPHTMHPYKPENCYEHGKRSAMVLLDCKQFT  378

Query  396   KEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNP--PPELLVLSSNATISDLKVEASR  569
             K Y  E+     NP  + L C++++ D   +    P  PPELL L   AT+SDLKVEA+R
Sbjct  379   KHYDLEQEFLPQNPSMLHLWCQVEVLD---QVGDPPCIPPELLTLPQTATVSDLKVEATR  435

Query  570   AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR-SLGKNALSRFRMERG  746
              F+ +YLM   F  + LV      +ST LKLL G+   VRV+GR + G+  +  +RMERG
Sbjct  436   TFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANGTVRVQGRCASGERRVGIYRMERG  495

Query  747   LESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAK  926
             ++ WTV C CGAKDDDGERML+CDSC +WQHTRC GI D D VP ++VC  C  ++ + K
Sbjct  496   VDKWTVRCSCGAKDDDGERMLSCDSCHVWQHTRCVGISDFDQVPKKYVCNSCK-LLNKRK  554

Query  927   TIGQMKDEFVG-SAAYCVGKGLGKSMTSAF  1013
             + G      +G S  + +G G   S    F
Sbjct  555   SRGHGPVYNIGPSKRFKIGAGGFSSRWGIF  584



>ref|XP_008677465.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008677466.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 ref|XP_008677467.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=619

 Score =   207 bits (528),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/271 (43%), Positives = 164/271 (61%), Gaps = 12/271 (4%)
 Frame = +3

Query  222   DNNYMRPN--LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
             D   + PN  +P+ +HL RD+K+L++ +LHP TM  +      +   +SA  L+DCK+F 
Sbjct  347   DEPIVLPNVSMPTQDHLRRDIKFLHDALLHPHTMHPYKPENCYEHGKRSAMVLLDCKQFT  406

Query  396   KEYQPEK-FVPALNPRAIQLLCELDLTDYSERCSVNP--PPELLVLSSNATISDLKVEAS  566
             K Y  E+ F+P  NP  + L C++++ D   +    P  PPELL L   AT+SDLKVEA+
Sbjct  407   KHYDLEQEFLPQ-NPSMLHLWCQVEVLD---QVGDPPCIPPELLTLPQTATVSDLKVEAT  462

Query  567   RAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR-SLGKNALSRFRMER  743
             R F+ +YLM   F  + LV      +ST LKLL G+   VRV+GR + G+  +  +RMER
Sbjct  463   RTFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANGTVRVQGRCASGERRVGIYRMER  522

Query  744   GLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQA  923
             G++ WTV C CGAKDDDGERML+CDSC +WQHTRC GI D D VP ++VC  C  ++ + 
Sbjct  523   GVDKWTVRCSCGAKDDDGERMLSCDSCHVWQHTRCVGISDFDQVPKKYVCNSCK-LLNKR  581

Query  924   KTIGQMKDEFVG-SAAYCVGKGLGKSMTSAF  1013
             K+ G      +G S  + +G G   S    F
Sbjct  582   KSRGHGPVYNIGPSKRFKIGAGGFSSRWGIF  612



>ref|XP_008677464.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
 gb|AFW60510.1| hypothetical protein ZEAMMB73_506546 [Zea mays]
Length=697

 Score =   207 bits (528),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 115/270 (43%), Positives = 161/270 (60%), Gaps = 10/270 (4%)
 Frame = +3

Query  222   DNNYMRPN--LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
             D   + PN  +P+ +HL RD+K+L++ +LHP TM  +      +   +SA  L+DCK+F 
Sbjct  425   DEPIVLPNVSMPTQDHLRRDIKFLHDALLHPHTMHPYKPENCYEHGKRSAMVLLDCKQFT  484

Query  396   KEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNP--PPELLVLSSNATISDLKVEASR  569
             K Y  E+     NP  + L C++++ D   +    P  PPELL L   AT+SDLKVEA+R
Sbjct  485   KHYDLEQEFLPQNPSMLHLWCQVEVLD---QVGDPPCIPPELLTLPQTATVSDLKVEATR  541

Query  570   AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR-SLGKNALSRFRMERG  746
              F+ +YLM   F  + LV      +ST LKLL G+   VRV+GR + G+  +  +RMERG
Sbjct  542   TFRGIYLMLHSFVADRLVDCGTASESTQLKLLFGANGTVRVQGRCASGERRVGIYRMERG  601

Query  747   LESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAK  926
             ++ WTV C CGAKDDDGERML+CDSC +WQHTRC GI D D VP ++VC  C  ++ + K
Sbjct  602   VDKWTVRCSCGAKDDDGERMLSCDSCHVWQHTRCVGISDFDQVPKKYVCNSCK-LLNKRK  660

Query  927   TIGQMKDEFVG-SAAYCVGKGLGKSMTSAF  1013
             + G      +G S  + +G G   S    F
Sbjct  661   SRGHGPVYNIGPSKRFKIGAGGFSSRWGIF  690



>ref|XP_006663315.1| PREDICTED: PHD finger protein At1g33420-like, partial [Oryza 
brachyantha]
Length=613

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/227 (46%), Positives = 146/227 (64%), Gaps = 20/227 (9%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQ----SATTLIDCKKFMKEYQ-PEK  416
            + +HL RD+K+LY+ +L+P TM    H C+ +   +    SA  L+DCK+F+K Y   E 
Sbjct  353  TQDHLSRDIKFLYDALLYPYTM----HPCRPEENYEQTRRSAMILLDCKQFIKHYDLEED  408

Query  417  FVPALNPRAIQLLCELDLTDYSERCSVNPPP----ELLVLSSNATISDLKVEASRAFQDV  584
            F+P  NP  + + C+++L +      V+ PP    ELL L   AT+ DLK EA RAF+D+
Sbjct  409  FLPQ-NPSQLHIWCQVELAE-----QVDDPPCIPVELLTLPQTATVGDLKAEAVRAFRDI  462

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGLESWT  761
            YLMF+ F  ++L+  A   ++T + LL GS   V ++GR +G +   + +RMERG++ WT
Sbjct  463  YLMFQSFVADQLLDCATASETTQINLLFGSKGVVHIKGRCIGGERRFAVYRMERGVDKWT  522

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            V C CGAKDDDGERML+CDSC +W HTRCAGI D D VP R+VC  C
Sbjct  523  VICPCGAKDDDGERMLSCDSCHVWMHTRCAGISDFDRVPKRYVCTSC  569



>gb|EAZ17917.1| hypothetical protein OsJ_33464 [Oryza sativa Japonica Group]
Length=682

 Score =   203 bits (517),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 145/223 (65%), Gaps = 12/223 (5%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ-PEKFVPA  428
            + +HL RD+K+LY+ +L+P TM  ++         +SA  L+DCK+F+K Y   E F+P 
Sbjct  423  TQDHLFRDIKFLYDALLYPYTMHPYMPEENYQHAKRSAMILLDCKQFIKHYDLEEDFLPQ  482

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPP----ELLVLSSNATISDLKVEASRAFQDVYLMF  596
             NP  + + C+++L D      V+ PP    EL+ L   ATI+DLK EA+RAF+D+YLM 
Sbjct  483  -NPSQLHIWCQVELAD-----QVDDPPCIPAELITLPQAATIADLKGEAARAFRDIYLML  536

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGLESWTVDCH  773
            + F  ++L+  A   D+T +KLL G+   V ++GR +G +   + +RMERG++ WTV C 
Sbjct  537  QSFVADQLLDCATASDTTQIKLLFGAKGAVHIKGRCIGGERRFAIYRMERGVDKWTVKCS  596

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            CGA DDDGERML+CD+C +W HTRCAGI D D VP R+VC  C
Sbjct  597  CGATDDDGERMLSCDTCHMWMHTRCAGISDFDRVPKRYVCKSC  639



>ref|NP_001067563.1| Os11g0234200 [Oryza sativa Japonica Group]
 gb|AAX94898.1| PHD-finger, putative [Oryza sativa Japonica Group]
 gb|AAX96648.1| PHD-finger, putative [Oryza sativa Japonica Group]
 gb|ABA92270.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF27926.1| Os11g0234200 [Oryza sativa Japonica Group]
 dbj|BAG97251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=715

 Score =   203 bits (516),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/223 (45%), Positives = 145/223 (65%), Gaps = 12/223 (5%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ-PEKFVPA  428
            + +HL RD+K+LY+ +L+P TM  ++         +SA  L+DCK+F+K Y   E F+P 
Sbjct  456  TQDHLFRDIKFLYDALLYPYTMHPYMPEENYQHAKRSAMILLDCKQFIKHYDLEEDFLPQ  515

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPP----ELLVLSSNATISDLKVEASRAFQDVYLMF  596
             NP  + + C+++L D      V+ PP    EL+ L   ATI+DLK EA+RAF+D+YLM 
Sbjct  516  -NPSQLHIWCQVELAD-----QVDDPPCIPAELITLPQAATIADLKGEAARAFRDIYLML  569

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGLESWTVDCH  773
            + F  ++L+  A   D+T +KLL G+   V ++GR +G +   + +RMERG++ WTV C 
Sbjct  570  QSFVADQLLDCATASDTTQIKLLFGAKGAVHIKGRCIGGERRFAIYRMERGVDKWTVKCS  629

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            CGA DDDGERML+CD+C +W HTRCAGI D D VP R+VC  C
Sbjct  630  CGATDDDGERMLSCDTCHMWMHTRCAGISDFDRVPKRYVCKSC  672



>ref|XP_004980335.1| PREDICTED: PHD finger protein At1g33420-like [Setaria italica]
Length=691

 Score =   199 bits (506),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 101/231 (44%), Positives = 145/231 (63%), Gaps = 6/231 (3%)
 Frame = +3

Query  222  DNNYMRPN--LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
            D   + PN  +P+ +HL RD+K+L++ +LHP TM  +      +   +SA  L+DCK+  
Sbjct  422  DETVLLPNVSMPTRDHLRRDIKFLHDVLLHPHTMNPYKPEKDYEHAKRSAMILLDCKQLT  481

Query  396  KEYQPEKFVPALNPRAIQLLCELDLTD-YSERCSVNPPPELLVLSSNATISDLKVEASRA  572
            K Y  E+     NP  + + C ++L D   +  S+  P ELL L   AT++DLK+EA++ 
Sbjct  482  KHYDLEQEFLPQNPSMLHIWCHVELLDQVGDLPSI--PQELLTLPQTATVADLKLEATKT  539

Query  573  FQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGL  749
            F+D+YLM + F   +L+      +ST LKLL G+   VRV+G+ +G +  +  +RMERG+
Sbjct  540  FRDIYLMLQTFVANQLLDCGTASESTQLKLLFGANGNVRVQGKCIGGERRVGIYRMERGV  599

Query  750  ESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            + WTV C CGA DDDGERML+CDSC +WQHTRCAGI D   VP R+VC  C
Sbjct  600  DKWTVSCSCGATDDDGERMLSCDSCHVWQHTRCAGISDFHQVPKRYVCKSC  650



>dbj|BAK04913.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=654

 Score =   197 bits (500),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/225 (44%), Positives = 144/225 (64%), Gaps = 4/225 (2%)
 Frame = +3

Query  243  NLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ-PEKF  419
            ++P+ EHL RD+K+LY+ +L   TM  +      +   + AT L+DCK+F+K Y   E F
Sbjct  400  SMPTREHLRRDIKFLYDALLFRHTMQPYKPEQIHEHAKRHATILLDCKQFIKHYDLEEDF  459

Query  420  VPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFR  599
            +P  N   + + C+++L D +     + P ELL L   AT+ DLK+EA+R F+ +YLM +
Sbjct  460  LPQ-NNSVLHIWCQVELLDQAGD-PPSLPAELLTLPQTATVGDLKMEATRTFRSIYLMLQ  517

Query  600  RFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KNALSRFRMERGLESWTVDCHC  776
             F   +L+  +   D+T +KLL G    V ++G+ +G +  ++ +RMERG++ WTVDC C
Sbjct  518  SFVANQLLDCSTADDTTQVKLLFGEKGSVSIQGKCVGGERRVAIYRMERGVDKWTVDCSC  577

Query  777  GAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCV  911
            GAKDDDGERML+CDSC +WQHTRC GI D D VP R+VC  C  V
Sbjct  578  GAKDDDGERMLSCDSCHVWQHTRCIGISDFDQVPKRYVCASCKLV  622



>ref|XP_009421161.1| PREDICTED: PHD finger protein At1g33420-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=697

 Score =   196 bits (497),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 154/252 (61%), Gaps = 5/252 (2%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLH  332
            V+ V+C  E  S    +  A D       L  PS E LL DL+ LY+ +L+P TM  +  
Sbjct  406  VVAVKCNAESNSVEYRLERASDERSSARRLCRPSKECLLHDLRVLYDALLNPATMQPYEP  465

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPE  512
                +    S+  ++DCK+F+K Y   K +   +P  +++ C ++L D  +     PP E
Sbjct  466  RSVWEASRSSSAKILDCKQFIKHYDKNKDLVDPHPFTLRVWCRMELADKPKNYLAPPP-E  524

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEE-LVGYAGVGDSTGLKLLLGSAEFVR  689
            LL+L  +AT++DLK EA++AFQ+ YL+ + FQ E+ LV      D+T +  LLG  + V+
Sbjct  525  LLLLPLHATVADLKSEATKAFQETYLILQSFQAEQVLVNGEYADDATQISFLLGPDDSVQ  584

Query  690  VRGRSLGKN-ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDL  866
            VRGR LG    L + RMERG ESWTVDC CG KDDDGERML CD CG+W+HTRC+GI DL
Sbjct  585  VRGRCLGGGCKLEQLRMERGTESWTVDCTCGTKDDDGERMLTCDRCGVWKHTRCSGIDDL  644

Query  867  DSVPARFVCLRC  902
            D VPA+FVC  C
Sbjct  645  DEVPAKFVCGSC  656



>ref|XP_009421159.1| PREDICTED: PHD finger protein At1g33420-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=701

 Score =   196 bits (497),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 114/252 (45%), Positives = 156/252 (62%), Gaps = 5/252 (2%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNL--PSDEHLLRDLKYLYECMLHPQTMANHLH  332
            V+ V+C  E  S    +  A D       L  PS E LL DL+ LY+ +L+P TM  +  
Sbjct  410  VVAVKCNAESNSVEYRLERASDERSSARRLCRPSKECLLHDLRVLYDALLNPATMQPYEP  469

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPE  512
                +    S+  ++DCK+F+K Y   K +   +P  +++ C ++L D   +  + PPPE
Sbjct  470  RSVWEASRSSSAKILDCKQFIKHYDKNKDLVDPHPFTLRVWCRMELAD-KPKNYLAPPPE  528

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEE-LVGYAGVGDSTGLKLLLGSAEFVR  689
            LL+L  +AT++DLK EA++AFQ+ YL+ + FQ E+ LV      D+T +  LLG  + V+
Sbjct  529  LLLLPLHATVADLKSEATKAFQETYLILQSFQAEQVLVNGEYADDATQISFLLGPDDSVQ  588

Query  690  VRGRSLGKN-ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDL  866
            VRGR LG    L + RMERG ESWTVDC CG KDDDGERML CD CG+W+HTRC+GI DL
Sbjct  589  VRGRCLGGGCKLEQLRMERGTESWTVDCTCGTKDDDGERMLTCDRCGVWKHTRCSGIDDL  648

Query  867  DSVPARFVCLRC  902
            D VPA+FVC  C
Sbjct  649  DEVPAKFVCGSC  660



>ref|XP_006836898.1| hypothetical protein AMTR_s00099p00124180 [Amborella trichopoda]
 gb|ERM99751.1| hypothetical protein AMTR_s00099p00124180 [Amborella trichopoda]
Length=681

 Score =   187 bits (476),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 100/229 (44%), Positives = 140/229 (61%), Gaps = 25/229 (11%)
 Frame = +3

Query  246  LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPE--KF  419
            LP D+ LL DL  +Y    HP+TM +       +    +A  ++DCK F+K+YQ +  K 
Sbjct  422  LPKDQ-LLNDLCLIYRS-FHPETMPS------TEPYKSAAIKILDCKHFIKDYQAQVPKL  473

Query  420  VPALNPRAIQLLCELDLTDYSERCSVN-------PPPELLVLSSNATISDLKVEASRAFQ  578
             P L P   Q+   +       RC +N       PPPEL+ L    T++DLK+EA++ FQ
Sbjct  474  APLLAPSKNQVTLWV-------RCQINDTKTYPLPPPELVSLPPTGTVADLKLEAAKIFQ  526

Query  579  DVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGK-NALSRFRMERGLES  755
            +VY+ F+RFQ E+++   GV D T + LL+G    V V GR LG  + +SRFR+E+G+++
Sbjct  527  EVYIFFKRFQPEDILDLWGVKDDTQVNLLVGPNASVTVIGRVLGGVSGISRFRLEKGIDT  586

Query  756  WTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            W V+C CGA+DDDGERMLACD CG+WQHTRC G+ D    P  F+C RC
Sbjct  587  WVVECSCGARDDDGERMLACDGCGVWQHTRCVGLEDSQPEPDWFLCKRC  635



>ref|XP_002449306.1| hypothetical protein SORBIDRAFT_05g007460 [Sorghum bicolor]
 gb|EES08294.1| hypothetical protein SORBIDRAFT_05g007460 [Sorghum bicolor]
Length=289

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/274 (38%), Positives = 150/274 (55%), Gaps = 38/274 (14%)
 Frame = +3

Query  222   DNNYMRPN--LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
             D   + PN  +P+ +HL RD+K+L++ +L+P TM  +      +   +SA  L+DCK+F 
Sbjct  45    DEPIILPNVSMPTQDHLHRDIKFLHDALLYPHTMHPYKPENCYEQAKRSAMILLDCKQFT  104

Query  396   KEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAF  575
             K Y  E+     NP  + + C+++L D +                 AT++DLKVE +R F
Sbjct  105   KHYDLEQEFLPQNPSMLHMWCQVELLDQT-----------------ATVADLKVEVTRTF  147

Query  576   QDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR-SLGKNALSRFRMERGLE  752
              D+YLM + F   +L+      + T           VRV+GR + G+  +  +RMERG++
Sbjct  148   HDIYLMLQSFVANQLLDCGTATNGT-----------VRVQGRCAGGERRVGIYRMERGVD  196

Query  753   SWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
              WTV+C CGAKDDDGERML+CDSC +WQHTRCAGI D D VP R+VC  C  ++ + K+ 
Sbjct  197   KWTVNCSCGAKDDDGERMLSCDSCHVWQHTRCAGISDFDQVPKRYVCNSCK-LLHKHKSS  255

Query  933   GQMKDEFVGSAAYCVGKGLGKSMTSAF*SVLLGF  1034
             G       G +  C      K  T AF  V  GF
Sbjct  256   GPRPVYNSGPSKRC------KIGTGAFSHVGGGF  283



>gb|EAY80449.1| hypothetical protein OsI_35630 [Oryza sativa Indica Group]
Length=684

 Score =   164 bits (415),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 85/182 (47%), Positives = 118/182 (65%), Gaps = 13/182 (7%)
 Frame = +3

Query  378  DCKKFM-KEYQ-PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP----ELLVLSSNAT  539
            D K F+ K Y   E F+P  NP  + + C+++L +      V+ PP    EL+ L   AT
Sbjct  466  DIKFFIIKHYDLEEDFLPQ-NPSQLHIWCQVELAE-----QVDDPPCIPAELITLPQAAT  519

Query  540  ISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG-KN  716
            I+DLK EA+RAF+D+YLM + F  ++L+  A   D+T +KLL G+   V ++GR +G + 
Sbjct  520  IADLKGEAARAFRDIYLMLQSFVADQLLDCATASDTTQIKLLFGAKGAVHIKGRCIGGER  579

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
              + +RMERG++ WTV C CGA DDDGERML+CD+C +W HTRCAGI D D VP R+VC 
Sbjct  580  RFAIYRMERGVDKWTVKCSCGATDDDGERMLSCDTCHMWMHTRCAGISDFDRVPKRYVCK  639

Query  897  RC  902
             C
Sbjct  640  SC  641



>ref|XP_001417810.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96103.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=795

 Score =   152 bits (383),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 96/248 (39%), Positives = 126/248 (51%), Gaps = 38/248 (15%)
 Frame = +3

Query  270  RDLKYLYECMLHP------QTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQP-------  410
            RDL  LY  +L        Q  A      K   +I++A TL+D K+F+K Y P       
Sbjct  527  RDLLTLYHDVLESYKPARLQKNAGQRVTVKGAPLIEAARTLLDTKQFVKIYTPVEDLLDS  586

Query  411  ---EKFV-PALNP-RAIQ--------------LLCELDLTDYSERCSVN----PPPELLV  521
                K V PA N  +AI+              LL  L   +   R  +     PPPE++ 
Sbjct  587  TPASKLVKPAPNAQKAIRIIVTAVIDTRNQGPLLSGLGANNGKSRQRIGTITRPPPEMVW  646

Query  522  LSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR  701
            L S+ T+ DLK  AS+AF+D+Y++   F+V  + GY GV D T L        FV V G 
Sbjct  647  LPSDPTLGDLKRVASKAFRDLYVVLSDFKVTRVKGYEGVSDKTRLGWRKMHGAFVEVHGE  706

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              G +  S FR + GLE WTV C CG  DDDGERM+ACD CGIW HTRC GI D    P+
Sbjct  707  --GADLESEFRYQGGLEQWTVKCMCGTGDDDGERMIACDECGIWMHTRCVGIKDSAKAPS  764

Query  882  RFVCLRCS  905
             ++C +C+
Sbjct  765  NWICPKCA  772



>ref|XP_001780078.1| predicted protein [Physcomitrella patens]
 gb|EDQ55087.1| predicted protein [Physcomitrella patens]
Length=663

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 93/228 (41%), Positives = 134/228 (59%), Gaps = 22/228 (10%)
 Frame = +3

Query  264  LLRDLKYLYECMLH---PQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALN  434
            +L+D+ Y+Y+ +L    P   +   H+     I  +A  ++D K+F+K+Y+ E    + N
Sbjct  434  VLKDIVYIYKNVLENYKPARTSGIKHMLT--AIPTAARIILDTKQFIKDYRGELTRKSAN  491

Query  435  -------PRAIQLLCELDLTDYSE-RCSVNPPPELLVLSSNATISDLKVEASRAFQDVYL  590
                      ++++C + L D    R   +PPPEL+VL  +AT+ DLK+EA RAF++ Y 
Sbjct  492  NDWNMDDDELLRVMCTVVLNDDDPMRNRPSPPPELVVLPPHATVRDLKLEAQRAFRETYY  551

Query  591  MFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWT  761
            +   F VE +     VGD     LL G+ E    VR+ G  +G +    +R E G+ESWT
Sbjct  552  IMHSFCVESIPDL--VGDDE--DLLFGAIESGSHVRIDG--IGIHTRHDWRYEGGIESWT  605

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            VDC CG KDDDGERM+ACD C +WQHTRC GI D+D +P RF+C RCS
Sbjct  606  VDCPCGTKDDDGERMIACDVCEVWQHTRCGGISDMDVIPQRFLCHRCS  653



>ref|XP_001781922.1| predicted protein [Physcomitrella patens]
 gb|EDQ53287.1| predicted protein [Physcomitrella patens]
Length=663

 Score =   137 bits (346),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 91/223 (41%), Positives = 128/223 (57%), Gaps = 12/223 (5%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLI-DCKKFMKEYQPEKFVPALN--  434
            +L+D+ Y+Y+ +L     A    +      I +AT +I D K+F+K+Y+ E    + N  
Sbjct  434  VLKDIVYIYKNVLENYKPARTSGIKHMLTAIPTATRIILDTKQFIKDYRGELTRKSANND  493

Query  435  -----PRAIQLLCELDLTDYSE-RCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
                    ++++C + L D    R   +PPPEL+VL  +AT+ DLK+EA RAF++ Y + 
Sbjct  494  WNMDDDELLRVMCTVVLNDEDPVRNRPSPPPELVVLPPHATVRDLKLEAQRAFRETYFIM  553

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHC  776
              F VE +       D   L   + S   VRV G   G +    +R E G+ESWTVDC C
Sbjct  554  HSFCVESIPDLV-CDDEDLLFGTIESGSHVRVEGS--GIHTCHDWRYEGGMESWTVDCPC  610

Query  777  GAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            G KDDDGERM+ACD C +WQHTRC GI D+D +P RF+C RCS
Sbjct  611  GTKDDDGERMIACDVCEVWQHTRCGGISDMDVIPQRFLCHRCS  653



>ref|XP_006826580.1| hypothetical protein AMTR_s00138p00033180 [Amborella trichopoda]
 gb|ERM93817.1| hypothetical protein AMTR_s00138p00033180 [Amborella trichopoda]
Length=699

 Score =   138 bits (347),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 121/238 (51%), Gaps = 20/238 (8%)
 Frame = +3

Query  216  AGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFM  395
            +GD+   +  +     + RDL+Y+Y  +L               V+  +   ++D K F 
Sbjct  464  SGDHPQNQLQVGRRSEIERDLEYVYRRVLEGGLGGK--------VVEAARRVVLDTKHFT  515

Query  396  KEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAF  575
            KE+        L      ++ E +   +S      PPPEL+V+  +AT+ DL+ EA  AF
Sbjct  516  KEWPIRDADEQLRFMVSVVVAEDEAGMFSRAI---PPPELVVVPLHATVGDLRAEAEHAF  572

Query  576  QDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE-----FVRVRGRSLGKNALSRFRME  740
            +D Y +   F  E+L+   G   S   +LL G AE     +VR RG   G+    R R E
Sbjct  573  RDTYCIMEGFAAEDLIWPHGQEISES-ELLFGVAESGMGVWVRGRGAERGEE---RLRYE  628

Query  741  RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVI  914
             G E W V+C CGA+DDDGERM+ACD C +WQHTRC GI D ++VP  F C RC   +
Sbjct  629  GGAEEWRVECECGARDDDGERMVACDVCEVWQHTRCLGIADAEAVPQLFFCARCGSAL  686



>ref|XP_007514134.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15571.1| predicted protein [Bathycoccus prasinos]
Length=1020

 Score =   137 bits (344),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 114/226 (50%), Gaps = 29/226 (13%)
 Frame = +3

Query  315  MANHLHV-CKKDVIIQSATTLIDCKKFMKEYQP-----EKFVPA----LNPRAIQLLCEL  464
            + N + V CK   +  +A  L+D K+F+K Y          VPA    L P  + +   +
Sbjct  773  IGNKIRVTCKGAHLTNAARVLLDTKQFVKTYIDIDDLLHLSVPANVKNLKPTRVLVTAII  832

Query  465  DLTDYSERCS-----------------VNPPPELLVLSSNATISDLKVEASRAFQDVYLM  593
            D ++   + S                   PPPE+++L    T+ +LK EA++AF D+Y++
Sbjct  833  DRSNSGPKVSGLGGAIMGKNRRKLGVESKPPPEIVLLPVPCTLGELKKEATKAFADLYVI  892

Query  594  FRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCH  773
              +F+V  + GY  + DST  +L   S ++        G +  S +R + GL+ W V+CH
Sbjct  893  LSKFKVTAIKGYENLPDST--RLNKNSLQYAHAEVMGEGADLESEYRYQGGLDQWVVNCH  950

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCV  911
            CG  DDDGERM+ACD C IW HTRC GI D    P RF C  C  +
Sbjct  951  CGTNDDDGERMIACDRCEIWMHTRCVGIEDEAKTPKRFTCHECEGI  996



>ref|XP_009405163.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Musa 
acuminata subsp. malaccensis]
Length=652

 Score =   134 bits (338),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 85/238 (36%), Positives = 124/238 (52%), Gaps = 27/238 (11%)
 Frame = +3

Query  237  RPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEK  416
            RP  P    + RDL  +Y  ML  Q               ++A  ++D K ++K++  + 
Sbjct  439  RPAWPGALQVERDLLTVYRSMLAAQP--------------EAAGKVLDAKHWVKQWGLQD  484

Query  417  FVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
             V   +     ++   +  +  E     PPPE++V+ + A++ +L+ EA RA +D Y + 
Sbjct  485  DVD--DRLRFLVMWVPNQEELEELTRALPPPEVVVVEATASVGELRAEAERAMRDTYCVM  542

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWTVD  767
              F+VEE+ G  G        +LLG AE    V VRG   G +  S  R E G ++W+V 
Sbjct  543  EGFRVEEMEGVEG---KDWEPVLLGGAESGALVWVRGD--GTDMDSVLRYEGGADTWSVG  597

Query  768  CHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQM  941
            C CGA+DDDGERM+ACD+C +W HTRCAGI D + VP  F C RC   +  A   GQM
Sbjct  598  CACGAQDDDGERMVACDACDMWHHTRCAGIGDGEPVPPLFFCARCGRSVMAA---GQM  652



>ref|XP_010034488.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Eucalyptus 
grandis]
 gb|KCW52193.1| hypothetical protein EUGRSUZ_J01622 [Eucalyptus grandis]
Length=694

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/233 (35%), Positives = 121/233 (52%), Gaps = 15/233 (6%)
 Frame = +3

Query  234  MRPNLPSDEHLLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ  407
            + P+L     + +D+  +Y  +   HP +          D +  +A  L+D K FMKE+ 
Sbjct  439  LSPSLAVGHDVYKDMARVYSAVFLNHPTS----------DCVGSAAQVLLDSKHFMKEWP  488

Query  408  PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVY  587
             +     L      L+  +D  +   R  V PP E++++  +AT+ DLK  A  AF++ Y
Sbjct  489  FQDEEDQLLTFICNLIPSIDRLETLPRKKV-PPGEIIMVPLHATVGDLKAAAESAFRETY  547

Query  588  LMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVD  767
              F    V ++       D+  L  ++ S + V VRG   G +  S+ R E G E+W V 
Sbjct  548  CAFEHLVVTDIEAVKETEDTEVLFGIMESGQEVWVRG--TGMDVDSQLRYEGGSENWEVR  605

Query  768  CHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAK  926
            C CGA+DDDGERM+ACD C +WQHTRC GI D D+VP  FVC  C   + Q++
Sbjct  606  CMCGAEDDDGERMVACDLCEVWQHTRCCGIDDTDNVPPLFVCSACCKSLAQSR  658



>ref|XP_006826579.1| hypothetical protein AMTR_s00138p00031220 [Amborella trichopoda]
 gb|ERM93816.1| hypothetical protein AMTR_s00138p00031220 [Amborella trichopoda]
Length=697

 Score =   132 bits (332),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 88/144 (61%), Gaps = 9/144 (6%)
 Frame = +3

Query  498  NPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSA  677
             PPPEL+V+  +AT+ DL  EA RAF+D Y +   F  E+L+   G   S   +LL G A
Sbjct  545  TPPPELVVVPLHATVGDLCAEAERAFRDTYCVMEGFAAEDLIWPHGQEVSES-ELLFGVA  603

Query  678  E-----FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHT  842
            E     +VR RG   G+   +R R E G+E W V+C CGA+DDDGERM+ACD C +WQHT
Sbjct  604  ESGMGVWVRGRGAERGE---ARLRYEGGVEEWRVECECGARDDDGERMVACDVCEVWQHT  660

Query  843  RCAGIPDLDSVPARFVCLRCSCVI  914
            RC GI D + VP  F C RC   +
Sbjct  661  RCLGIADAEVVPQLFFCARCGSAL  684



>ref|XP_006293073.1| hypothetical protein CARUB_v10019360mg [Capsella rubella]
 gb|EOA25971.1| hypothetical protein CARUB_v10019360mg [Capsella rubella]
Length=696

 Score =   130 bits (328),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/214 (37%), Positives = 119/214 (56%), Gaps = 15/214 (7%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY+ +L       +LH    D+  +++  +++CK F+KE+  ++  P      +  
Sbjct  486  DILYLYQNLL-----LTYLH---PDIYSEASQVILNCKSFVKEWSYKEQNPLTVSCQVLP  537

Query  453  LCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYA  632
              E  L D++    + PP EL+V+  NATI +LK  A +A +D Y +   F+V E+    
Sbjct  538  NHEEILRDFTR---LLPPGELVVVPGNATIRELKSAAEKALRDTYCIMETFEVLEIRNRY  594

Query  633  GVGDSTGLKL-LLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERML  809
                   L+L  LG  EF+ V+G   G +  +  R E G + WTVDC CGA DDDGERM+
Sbjct  595  LEKLEDDLRLESLGKTEFL-VKG--FGLDICTELRYEGGFDDWTVDCKCGAMDDDGERMV  651

Query  810  ACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCV  911
            ACD C +W HT C  I D ++VP+ F+C RCS V
Sbjct  652  ACDVCKVWHHTLCYSIEDDEAVPSVFLCYRCSGV  685



>ref|XP_003079461.1| putative male sterility 1 protein (ISS) [Ostreococcus tauri]
 emb|CAL54119.1| Zinc finger, PHD-finger [Ostreococcus tauri]
Length=996

 Score =   129 bits (323),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 116/247 (47%), Gaps = 38/247 (15%)
 Frame = +3

Query  270  RDLKYLYECMLH------PQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ--------  407
            RDL  LY  +L        Q         K   ++ +A  L+D K+F+K Y         
Sbjct  728  RDLLALYHDVLENYKPARAQQKDGQRVTVKGAPLVDAARILLDTKQFVKIYTAVDDLLDT  787

Query  408  -PEKFV--PALNP-RAIQLLCELDLTDYSERCS------------------VNPPPELLV  521
             P   +  PA N  +AI+++    +   S+  +                    PPPEL+ 
Sbjct  788  TPASKLTKPAANAQKAIRIIATAVIHTRSQGPAPSGLGPNVAKSRQKIGTITRPPPELVF  847

Query  522  LSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR  701
            L S  T+ DLK   S+AF+D+Y++   F+V  + G+ G  D T L         V V+G 
Sbjct  848  LPSEPTLGDLKRVTSKAFRDLYVVLSDFKVTRVKGHEGQSDKTRLGWRKMHGASVEVQGD  907

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              G +  S  R + G E WTV C CG  DDDGERM+ACD CG+W HTRC GI D  + P+
Sbjct  908  --GADVASELRYQGGFEQWTVQCMCGTGDDDGERMIACDKCGVWMHTRCVGIKDNKNAPS  965

Query  882  RFVCLRC  902
             ++C  C
Sbjct  966  HWICPNC  972



>gb|KDO58759.1| hypothetical protein CISIN_1g041853mg, partial [Citrus sinensis]
Length=568

 Score =   126 bits (317),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/141 (50%), Positives = 93/141 (66%), Gaps = 3/141 (2%)
 Frame = +3

Query  171  QCRLEPGSATVN-VNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            + RLE  + + N V +  D+  ++   PS E LLRDLK  +E +LHPQTM N+     +D
Sbjct  430  EYRLEAANESFNGVTSCNDSPVVKH--PSQEILLRDLKLFFESLLHPQTMLNYGPEAIRD  487

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLS  527
            + I SAT LIDCK+FMK+Y+PEK     +   I+L C+L+L D SE    +PP E++VL 
Sbjct  488  LAISSATKLIDCKQFMKDYKPEKTSSINDSYTIRLSCQLELMDPSEDNVPDPPSEIIVLP  547

Query  528  SNATISDLKVEASRAFQDVYL  590
             NAT+SDLK EAS AFQDVYL
Sbjct  548  RNATVSDLKTEASSAFQDVYL  568



>ref|XP_002875094.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51353.1| PHD finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=699

 Score =   126 bits (317),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 75/211 (36%), Positives = 112/211 (53%), Gaps = 15/211 (7%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY+ +L       HL     D   +++  +++CK F+KE+  ++  P      +  
Sbjct  488  DILYLYQNIL-----LTHL---DSDTYSEASQIILNCKSFIKEWSYQEQNPLTVSCQVLP  539

Query  453  LCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVG-Y  629
              E  L D++    + PP EL+V+  NATI +LK  A +A +D Y +   F+V E+   Y
Sbjct  540  NHEELLRDFTR---LLPPGELVVVPENATIKELKFAAEKALRDTYFITETFEVLEIRNRY  596

Query  630  AGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERML  809
                D     L L S        +  G +  +  R E G + WTVDC CGA+DDDGERM+
Sbjct  597  LEKLDDN---LALKSQRITEFLVKGFGLDIGTELRYEGGFDDWTVDCKCGARDDDGERMV  653

Query  810  ACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            ACD+C +W HT C  I D ++VP+ F+C RC
Sbjct  654  ACDACKVWHHTLCNSIEDDEAVPSVFLCNRC  684



>ref|XP_010068687.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Eucalyptus 
grandis]
 gb|KCW64468.1| hypothetical protein EUGRSUZ_G02081 [Eucalyptus grandis]
Length=692

 Score =   125 bits (314),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 86/245 (35%), Positives = 129/245 (53%), Gaps = 35/245 (14%)
 Frame = +3

Query  222  DNNYMR---PNLPSDEHLLRDLKYLYECML------HPQTMANHLHVCKKDVIIQSATTL  374
            D N +R   P +  +  +  DL  LYE +L      HP ++A  +              +
Sbjct  463  DRNSLRLCSPVVEQEFDIYEDLLCLYENILFGYPDSHPVSLATQV--------------I  508

Query  375  IDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCS----VNPPPELLVLSSNATI  542
            +D K F+KE+   K+  A + +  ++ C + +  Y+E  S      PP EL+V+    T 
Sbjct  509  LDSKHFVKEW---KYANAKDEKFTRITCRV-MPTYAELVSHLTRPLPPGELIVVPQCVTT  564

Query  543  SDLKVEASRAFQDVYLMFRRFQVEELVG-YAGVGDSTGLK-LLLGSAEFVRVRGRSLGKN  716
             +LK+   RA +D Y++  +F V E+      V D   ++  +L S   V VRG+ L  +
Sbjct  565  GELKLVVQRALRDTYIIMDQFIVREMKACEMQVRDDQQVQHRVLESQMEVLVRGQGL--D  622

Query  717  ALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCL  896
              S  R E G ++W VDC CGA+DDDGERM+ACD C +WQHT CAGI D + VP+ F+C 
Sbjct  623  LESELRYEGGTDNWMVDCVCGARDDDGERMVACDVCQVWQHTLCAGIEDDEEVPSMFICG  682

Query  897  RCSCV  911
            RC+ V
Sbjct  683  RCNAV  687



>ref|XP_010554390.1| PREDICTED: PHD finger protein At2g01810 [Tarenaya hassleriana]
Length=680

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 117/219 (53%), Gaps = 19/219 (9%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            + +D+ +LYE +L        L     D++ Q++  +++CK F KE+         N R 
Sbjct  463  VYKDVSFLYENLL--------LDYPDSDILGQASEVVMNCKSFAKEFHLLPSSDHHNNRL  514

Query  444  I---QLLCELD--LTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
                Q++   D  L D++      P  EL+VL  N+T+ +LK E  +A +D Y +   F+
Sbjct  515  TVQCQVIPNHDELLADFTRPL---PQGELVVLPQNSTVRELKSETEKALRDTYCVMETFE  571

Query  609  VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
            V E+          G +++    E V VRG   G +  +  R E G + WTV+C CGA+D
Sbjct  572  VLEIRNRELEKIDEG-EVVGSETEVVMVRG--FGLDRCTELRYEGGFDDWTVECRCGARD  628

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            DDGERM+ACDSC +W HT C  I D ++VP+ F+C +CS
Sbjct  629  DDGERMVACDSCRVWHHTLCNSIEDDEAVPSVFLCSKCS  667



>ref|XP_010513908.1| PREDICTED: PHD finger protein At2g01810-like [Camelina sativa]
Length=691

 Score =   124 bits (312),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 116/212 (55%), Gaps = 16/212 (8%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY+ +L        L     D   +++  +++CK F+KE+  ++  P+    + Q+
Sbjct  479  DILYLYQNLL--------LAYPDSDTYSEASQVILNCKSFVKEWSYQEQNPS-TVVSCQV  529

Query  453  LCELD--LTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVG  626
            + + +  L D++    + PP EL+V+  NATI +LK  A +A +D Y +   F+V E+  
Sbjct  530  MPDHEDLLRDFTR---LLPPGELVVVPENATIRELKSAAEKALRDTYCIMETFEVLEIRN  586

Query  627  YAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERM  806
                 +     L+LGS        +  G +  +  R E G + WTV C CGA+DDDGERM
Sbjct  587  R--YLEKLHDDLILGSQGKTEFLVKGFGLDMCTELRYEGGFDDWTVACECGARDDDGERM  644

Query  807  LACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +ACD C +WQHT C  I D ++VP+ F+C RC
Sbjct  645  VACDDCKVWQHTLCNSIDDDEAVPSEFLCNRC  676



>ref|XP_010043916.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Eucalyptus grandis]
 gb|KCW85943.1| hypothetical protein EUGRSUZ_B02649 [Eucalyptus grandis]
Length=652

 Score =   124 bits (311),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/245 (31%), Positives = 125/245 (51%), Gaps = 17/245 (7%)
 Frame = +3

Query  210  NTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKK  389
            + A  +N    +  +   L++D+  +Y+       + +H H+   D +   A  ++D + 
Sbjct  408  SVASSSNLRTGSKITRAQLMKDMFCVYKHTFKEHELGSHTHI--SDNVSLMARIILDSRY  465

Query  390  FMKEYQ---PEKFVPALNPRAIQLLCELDLTDYSE---RCSVNPPPELLVLSSNATISDL  551
             +KEY    P K    L  +  +L C + L DY     +  + PP E +VL  NAT+++L
Sbjct  466  LIKEYNGDLPSKLELGLGGK-FKLFCTVLLRDYVRCEWKTKLMPPYECIVLKENATVNEL  524

Query  552  KVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVR---VRGRSLGKNAL  722
            KV+  R F+++Y   + F  E +V      +++GL+ + G  E  R   + G    + + 
Sbjct  525  KVKVERNFRELYWGLKSFVAESIVNL----NTSGLETVFGLVEVGRRLVLEGSVRDQGST  580

Query  723  SRFRMERGLESW-TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLR  899
            +R   E G +    VDC CG K+DDGERM+AC  C +WQHT C  IP+ + VP  F+C R
Sbjct  581  ARDVYECGADGGRVVDCACGTKEDDGERMIACAVCEVWQHTWCVQIPNSEEVPGIFICKR  640

Query  900  CSCVI  914
            C  VI
Sbjct  641  CEQVI  645



>ref|XP_002533478.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28910.1| DNA binding protein, putative [Ricinus communis]
Length=698

 Score =   124 bits (310),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 81/225 (36%), Positives = 116/225 (52%), Gaps = 35/225 (16%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK-------EYQPEKFV  422
            L  DL YLY  +L        L+  + ++   +  T++D K F+K       E +  +F+
Sbjct  457  LYADLGYLYLKVL--------LNYPESELAELATQTILDSKHFVKVWPFKDEEDELLRFI  508

Query  423  PALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
              + P  I L  EL            PP E++VL  ++T+++LK  A  A +D Y +   
Sbjct  509  CQVMPNIIHLEVELK--------KELPPGEIVVLPLHSTVAELKQAAENALRDTYCIMEN  560

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAE-----FVRVRGRSLGKNALSRFRMERGLESWTVD  767
            F+V E+     + D    +LL GS E     F+R  G  L     +  R E G ++W V 
Sbjct  561  FEVTEINQMEELMDE---ELLFGSVESGAELFMRGNGMDLN----TELRYESGPDNWKVR  613

Query  768  CHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            C CGA+DDDGERM+ACD C +WQHTRC GI D ++VP  FVC RC
Sbjct  614  CQCGAEDDDGERMVACDICEVWQHTRCNGIEDSEAVPLLFVCTRC  658



>ref|XP_010278619.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X2 [Nelumbo nucifera]
Length=563

 Score =   122 bits (307),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 106/188 (56%), Gaps = 17/188 (9%)
 Frame = +3

Query  360  SATTLIDCKKFMKEY-----QPE--KFVPALNPRAIQLLCELDLTDYSERCSVNPPPELL  518
            ++  ++D K FMKE+     Q E  +FV    P   ++  EL            PP E++
Sbjct  363  ASRVVLDGKHFMKEWPFKDEQDELLRFVCRFMPSVGEVESEL--------TRPLPPGEVV  414

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            V+   AT+ +LKV A +A +D Y M   F  +E+ G  G+ D   L   L S   + V G
Sbjct  415  VVPPYATVGELKVAAEKALRDTYGMLEWFVAKEVEGVGGMEDEEVLFGALESGAHIWVEG  474

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
               G +  +  R E G ++WTVDC CGA+DDDGERM+ACD C +WQHTRCAGI D ++VP
Sbjct  475  S--GVDLRTDLRYEGGADNWTVDCRCGARDDDGERMVACDVCEVWQHTRCAGIVDDEAVP  532

Query  879  ARFVCLRC  902
            A FVC RC
Sbjct  533  ALFVCERC  540



>ref|XP_009592040.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Nicotiana 
tomentosiformis]
Length=701

 Score =   123 bits (309),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 74/200 (37%), Positives = 108/200 (54%), Gaps = 18/200 (9%)
 Frame = +3

Query  327  LHVCKKDVIIQSATTLIDCKKFMKEY----QPE----KFVPALNPRAIQLLCELDLTDYS  482
            L   + DV+  +  T++D K F+KE+     P+    +F+  + P +  L   L      
Sbjct  463  LSFAESDVLKLAVRTVLDSKHFVKEWPFRDDPDDILLRFICCILPSSSGLEAVLR-----  517

Query  483  ERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKL  662
                  PP EL+ +  ++TI DLK+    A +D Y +   F V ++VG   +GD   L  
Sbjct  518  ---KGYPPGELVDVPLHSTIGDLKIAIESAMRDTYCIMDNFMVTDIVGMERMGDCEVLFG  574

Query  663  LLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHT  842
            ++ S   + VRG   G +  S  + E G ++WTV+C CGA+DDDGERM++CD C IWQHT
Sbjct  575  IVESGSELWVRG--FGLDLESELKNEGGADNWTVNCRCGARDDDGERMVSCDICEIWQHT  632

Query  843  RCAGIPDLDSVPARFVCLRC  902
            RC GI D + VP  FVC  C
Sbjct  633  RCCGIEDSEVVPPLFVCEAC  652



>ref|XP_010502170.1| PREDICTED: PHD finger protein At2g01810-like [Camelina sativa]
Length=691

 Score =   123 bits (309),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 77/220 (35%), Positives = 120/220 (55%), Gaps = 17/220 (8%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY+ +L        L     D   +++  +++CK F+KE+  ++  P      +  
Sbjct  480  DIFYLYQNLL--------LAYPDSDSYSEASQVILNCKSFVKEWSYQEQNPLTVSCQVLP  531

Query  453  LCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEEL--VG  626
              E  L D++    + PP EL+V+  NATI +LK  A +A +D Y +   F++ E+  + 
Sbjct  532  NHEDLLRDFTR---LLPPGELVVVPENATIRELKSAAEKALRDTYCIMETFEMLEIRNMY  588

Query  627  YAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERM  806
               + D   L+   G  EF+ V+G   G +  +  R E G + WTV C CGA+DDDGERM
Sbjct  589  LEKLHDDLSLESQ-GKTEFL-VKG--FGLDTGTELRYEGGFDDWTVACECGARDDDGERM  644

Query  807  LACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAK  926
            +ACD C +WQHT C  I D ++VP+ F+C RCS    ++K
Sbjct  645  VACDVCKVWQHTLCNSIEDDEAVPSVFLCNRCSADSSRSK  684



>ref|XP_007216520.1| hypothetical protein PRUPE_ppa024280mg [Prunus persica]
 gb|EMJ17719.1| hypothetical protein PRUPE_ppa024280mg [Prunus persica]
Length=697

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 83/232 (36%), Positives = 120/232 (52%), Gaps = 16/232 (7%)
 Frame = +3

Query  222  DNNYMRPNLPSDE-----HLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCK  386
            +N  +  +LPS        +  D+ YLYE +L        L   + +++  +   ++D K
Sbjct  434  ENEVLPQSLPSASLVPGVDVYNDVLYLYEHVL--------LGYPESELVELATRAILDTK  485

Query  387  KFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEAS  566
             F+KE         L     QLL  L   D   +  + PP E++V+  +ATI +LK+ A 
Sbjct  486  HFVKECSFRDEEEQLLTFICQLLPSLMDMDIEFKREL-PPGEIVVMPLHATIGELKLAAE  544

Query  567  RAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERG  746
             A +D Y +  RF V+ + G   + D   L  ++ S   V VRG   G +  +  R E G
Sbjct  545  TALRDTYCITERFVVKGIEGLDEMEDMEVLFGVVQSGAEVGVRGT--GIDLDTPLRYEGG  602

Query  747  LESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D D+VP  FVC  C
Sbjct  603  SDTWMVRCECGARDDDGERMVACDICEVWQHTRCCGIEDADTVPPLFVCSAC  654



>ref|XP_002967734.1| hypothetical protein SELMODRAFT_31178, partial [Selaginella moellendorffii]
 gb|EFJ31081.1| hypothetical protein SELMODRAFT_31178, partial [Selaginella moellendorffii]
Length=648

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 9/128 (7%)
 Frame = +3

Query  531  NATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGR  701
            +ATI DLK+EA R F+D Y + R F+V+ +    G  +     LL G+ E    + V+G 
Sbjct  522  HATIGDLKLEAQRGFRDTYHIMRGFRVDTIPELEGDNED----LLFGAIESGSTLIVQGS  577

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              G +  + +R E G +SW VDC CGAKDDDGERM+ACD C +WQHTRC GI D D +PA
Sbjct  578  --GVDVYNEWRYEGGNDSWIVDCPCGAKDDDGERMIACDVCEVWQHTRCGGIADPDPIPA  635

Query  882  RFVCLRCS  905
            RF+C RC 
Sbjct  636  RFLCARCG  643



>ref|XP_002964302.1| hypothetical protein SELMODRAFT_31177, partial [Selaginella moellendorffii]
 gb|EFJ34635.1| hypothetical protein SELMODRAFT_31177, partial [Selaginella moellendorffii]
Length=648

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 82/128 (64%), Gaps = 9/128 (7%)
 Frame = +3

Query  531  NATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGR  701
            +ATI DLK+EA R F+D Y + R F+V+ +    G  +     LL G+ E    + V+G 
Sbjct  522  HATIGDLKLEAQRGFRDTYHIMRGFRVDTIPELEGDNED----LLFGAIESGSTLIVQGS  577

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              G +  + +R E G +SW VDC CGAKDDDGERM+ACD C +WQHTRC GI D D +PA
Sbjct  578  --GVDVYNEWRYEGGNDSWIVDCPCGAKDDDGERMIACDVCEVWQHTRCGGIADPDPIPA  635

Query  882  RFVCLRCS  905
            RF+C RC 
Sbjct  636  RFLCARCG  643



>ref|XP_010278538.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X1 [Nelumbo nucifera]
Length=674

 Score =   122 bits (306),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 78/188 (41%), Positives = 106/188 (56%), Gaps = 17/188 (9%)
 Frame = +3

Query  360  SATTLIDCKKFMKEY-----QPE--KFVPALNPRAIQLLCELDLTDYSERCSVNPPPELL  518
            ++  ++D K FMKE+     Q E  +FV    P   ++  EL            PP E++
Sbjct  474  ASRVVLDGKHFMKEWPFKDEQDELLRFVCRFMPSVGEVESEL--------TRPLPPGEVV  525

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            V+   AT+ +LKV A +A +D Y M   F  +E+ G  G+ D   L   L S   + V G
Sbjct  526  VVPPYATVGELKVAAEKALRDTYGMLEWFVAKEVEGVGGMEDEEVLFGALESGAHIWVEG  585

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
               G +  +  R E G ++WTVDC CGA+DDDGERM+ACD C +WQHTRCAGI D ++VP
Sbjct  586  S--GVDLRTDLRYEGGADNWTVDCRCGARDDDGERMVACDVCEVWQHTRCAGIVDDEAVP  643

Query  879  ARFVCLRC  902
            A FVC RC
Sbjct  644  ALFVCERC  651



>ref|XP_006448127.1| hypothetical protein CICLE_v10017749mg [Citrus clementina]
 gb|ESR61367.1| hypothetical protein CICLE_v10017749mg [Citrus clementina]
Length=646

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/243 (33%), Positives = 122/243 (50%), Gaps = 30/243 (12%)
 Frame = +3

Query  207  VNTAGDNNYMRPNLPSDEHLLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLID  380
            + T  +  Y  P L   + +  D+  LY+ +L  +P++    L          +A  ++D
Sbjct  421  IQTRTEPEYHIPTLMPGQDVYADVLTLYKNVLLGYPESHTVSL----------AARAILD  470

Query  381  CKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVN----PPPELLVLSSNATISD  548
            CK F KE+Q   F  + +   ++L C +  + Y+E  +      PP EL+V   + T+ +
Sbjct  471  CKNFAKEWQ---FKESEDDNLMRLKCRVSPS-YNELATQLTRPLPPAELIVAPKDVTVDE  526

Query  549  LKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSR  728
            LK+    + +D Y M  +  V+E+          G   +   A  V VRG  L  +  + 
Sbjct  527  LKLIVECSLRDTYYMMEKVVVKEI--------KMGQNQVFWGAGDVWVRGWGLDLD--TE  576

Query  729  FRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSC  908
             R E G + WTVDC CGAKDDDGERM+ACD C +WQHTRC  I D ++VP+ F C  C+ 
Sbjct  577  LRFEGGADDWTVDCVCGAKDDDGERMVACDICQVWQHTRCNSIADNEAVPSVFKCRACTA  636

Query  909  VIG  917
             + 
Sbjct  637  AVA  639



>ref|XP_006469331.1| PREDICTED: PHD finger protein At2g01810-like [Citrus sinensis]
Length=646

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 79/243 (33%), Positives = 123/243 (51%), Gaps = 30/243 (12%)
 Frame = +3

Query  207  VNTAGDNNYMRPNLPSDEHLLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLID  380
            + T  +  Y  P L   + +  D+  LY+ +L  +P++    L          +A  ++D
Sbjct  421  IQTRTEPEYHIPTLMPGQDVYADVLTLYKNVLLGYPESHTVSL----------AARAILD  470

Query  381  CKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVN----PPPELLVLSSNATISD  548
            CK F KE+Q   F  + +   ++L C +  + Y+E  +      PP EL+V   + T+ +
Sbjct  471  CKNFAKEWQ---FKESEDDNLMRLKCRVSPS-YNELATQLTRPLPPAELIVAPKDVTVDE  526

Query  549  LKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSR  728
            LK+    + +D Y M  +  V+E+          G   +   A  V VRG  L  +  ++
Sbjct  527  LKLIVECSLRDTYCMMEKVVVKEI--------KMGQNQVFWGAGDVWVRGWGLDLD--TQ  576

Query  729  FRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSC  908
             R E G + WTVDC CGAKDDDGERM+ACD C +WQHTRC  I D ++VP+ F C  C+ 
Sbjct  577  LRFEGGADDWTVDCVCGAKDDDGERMVACDICQVWQHTRCNSIADNEAVPSVFKCRACTA  636

Query  909  VIG  917
             + 
Sbjct  637  AVA  639



>ref|XP_008244388.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Prunus mume]
Length=680

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 81/239 (34%), Positives = 128/239 (54%), Gaps = 30/239 (13%)
 Frame = +3

Query  222  DNNYMRPNLPSDE-----HLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCK  386
            +N  +  +LPS        +  D+ YLYE +L        L   + +++  +   ++D K
Sbjct  433  ENEILPQSLPSASLVPGVDVYNDVLYLYEHVL--------LGYPESELVELATRAILDTK  484

Query  387  KFMKE--YQPEK-----FVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATIS  545
             F+KE  ++ E+     F+  L P ++ +       D+  +  + PP E++V++ +ATI 
Sbjct  485  HFVKECSFRDEEEQLLTFICQLLPSSMDM-------DFEFKREL-PPGEIVVMALHATIG  536

Query  546  DLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALS  725
            +LK+ A  A +D Y +  RF V+ + G   + D   L  ++ S   V VRG   G +  +
Sbjct  537  ELKLAAETALRDTYCITERFVVKGIEGLDEMDDMEVLFGVVQSGAEVGVRG--TGIDLDT  594

Query  726  RFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              R E G ++W V C CGA+DDDGERM++CD C +WQHTRC GI D D+VP  FVC  C
Sbjct  595  PLRYEGGSDTWMVRCECGARDDDGERMVSCDICEVWQHTRCCGIEDADTVPPLFVCSAC  653



>gb|EMS67490.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Triticum urartu]
Length=527

 Score =   120 bits (301),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 83/262 (32%), Positives = 124/262 (47%), Gaps = 31/262 (12%)
 Frame = +3

Query  180  LEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQ  359
            LE     V ++    N       PS   + RDL+ +Y  M+              + +  
Sbjct  286  LEEWGEPVQMDVEVQNTRPAAPWPSTVDVERDLRAVYRAMV--------------EALSG  331

Query  360  SATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP--ELLVLSSN  533
            +A  ++DCK ++K +     +   +   ++ L E     +       P P  E++V+  +
Sbjct  332  AAQAVLDCKHWVKCWG----LGDESDDQLRFLVEWRPQPWEAAELTRPLPSGEIVVVPIH  387

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRS  704
             +I +L +EA RA +D Y  F  FQ E L G  G        ++LG AE    + V G  
Sbjct  388  TSIGELIIEAERALRDTYCFFEEFQAETLDGITG---EKWDPVVLGGAESGDTIGVHGH-  443

Query  705  LGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
             G +  +  R E GL+ W V C CGA+DDDGERM+ACD+C +W HTRC GI D D+VP  
Sbjct  444  -GADMETGLRCEGGLDMWEVRCVCGARDDDGERMVACDACDVWHHTRCVGIADSDAVPPL  502

Query  885  FVCLRCSCVIGQAKTIGQMKDE  950
            F+C+ C    G     G M +E
Sbjct  503  FLCILCG---GALLAAGPMLEE  521



>ref|XP_010424952.1| PREDICTED: PHD finger protein At2g01810-like [Camelina sativa]
Length=691

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 116/219 (53%), Gaps = 15/219 (7%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY+ +L        L     D   +++  ++ CK F+KE+  ++  P      +  
Sbjct  480  DIFYLYQNLL--------LAYPDSDSYSEASQVILSCKSFVKEWAYQEQNPLTVSCQVLP  531

Query  453  LCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVG-Y  629
              E  L D++    + PP EL+V+  NATI +LK  A +A +D Y +   F+V E+   Y
Sbjct  532  NHEDLLRDFTR---LLPPGELVVVPENATIRELKSAAEKALRDTYCIMDTFEVLEIRNMY  588

Query  630  AGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERML  809
                     +   G  EF+ V+G   G +  +  R E G + WTV C CGA+DDDGERM+
Sbjct  589  LEKLHDDLSRESQGKTEFL-VKG--FGLDTGTELRYEGGFDDWTVACECGARDDDGERMV  645

Query  810  ACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAK  926
            ACD C +WQHT C  I D ++VP+ F+C RCS    ++K
Sbjct  646  ACDVCKVWQHTLCNSIEDDEAVPSVFLCNRCSADSSRSK  684



>ref|XP_009101316.1| PREDICTED: PHD finger protein At2g01810 [Brassica rapa]
Length=706

 Score =   121 bits (304),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 72/217 (33%), Positives = 114/217 (53%), Gaps = 20/217 (9%)
 Frame = +3

Query  273  DLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ-PEKFVPALNPRA  443
            D+ YLY+ +   +P T          +V   ++  +++CK F+KE+  P          +
Sbjct  488  DILYLYQNLFLTYPDT----------EVYSDASEVILNCKGFVKEWPLPSHQEQDTLTVS  537

Query  444  IQLL--CELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEE  617
             Q+L   E  L D++ +    PP EL+++  NATI +LK  A +A +D Y +   F+V E
Sbjct  538  CQVLPNHEEVLRDFTRKL---PPGELVMVPQNATIRELKSAAEKALRDTYFVMENFEVLE  594

Query  618  LV--GYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDD  791
            +       + ++TG+K                G +  +  R E G + WTV+C CGA+DD
Sbjct  595  IKKKDLEKIDETTGVKSDGNKIMMTEFLVTGFGLDTGTELRYEGGFDDWTVECRCGARDD  654

Query  792  DGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            DGERM+ACD+C +W HT+C  I D ++VP  F+C RC
Sbjct  655  DGERMVACDACKVWHHTKCHSIEDDEAVPKVFLCNRC  691



>emb|CDY17644.1| BnaA06g34630D [Brassica napus]
Length=656

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 70/221 (32%), Positives = 117/221 (53%), Gaps = 28/221 (13%)
 Frame = +3

Query  273  DLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPR-A  443
            D+ YLY+ +   +P T          +V   ++  +++CK F+KE+     +P+   +  
Sbjct  438  DILYLYQNLFLTYPDT----------EVYSDASEVILNCKGFVKEWP----LPSHQEQDT  483

Query  444  IQLLCEL------DLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRF  605
            + + C++       L D++ +    PP EL+++  NATI +LK  A +A +D Y +   F
Sbjct  484  LTVSCQVLPNHEEVLRDFTRKL---PPGELVMVPQNATIRELKSAAEKALRDTYFVMENF  540

Query  606  QVEELV--GYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCG  779
            +V E+       + ++TG+K                G +  +  R E G + WTV+C CG
Sbjct  541  EVLEIKKKDLEKIDETTGVKSDGNKIMMTEFLVTGFGLDTGTELRYEGGFDDWTVECRCG  600

Query  780  AKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            A+DDDGERM+ACD+C +W HT+C  I D ++VP  F+C RC
Sbjct  601  ARDDDGERMVACDACKVWHHTKCHSIEDDEAVPKVFLCNRC  641



>emb|CDY36263.1| BnaC07g21170D [Brassica napus]
Length=707

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 75/224 (33%), Positives = 121/224 (54%), Gaps = 34/224 (15%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY+ +L        L     +V   ++  +++CK F+KE+     +      ++ +
Sbjct  489  DILYLYQNLL--------LSYHDTEVYSDASEVILNCKGFVKEW---PLLSHQEKNSLTV  537

Query  453  LCEL------DLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV-  611
             C++       L D++ +    PP EL+++  NATI +LK  A +A +D Y +   F+V 
Sbjct  538  SCQVLPNHKEVLRDFTRKL---PPGELVMVPQNATIRELKSAAEKALRDTYFVMENFEVL  594

Query  612  -------EELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDC  770
                   E++   +GV  S G K+++   EF+ V G   G +  +  R E G + WTV+C
Sbjct  595  EIRKKDLEKIDETSGVK-SDGNKIMM--TEFL-VTG--FGLDTGTELRYEGGFDDWTVEC  648

Query  771  HCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             CGA+DDDGERM+ACD+C +W HT+C  I D + VP  F+C RC
Sbjct  649  RCGARDDDGERMVACDACKVWHHTKCHSIEDDEVVPQVFLCNRC  692



>ref|XP_011021716.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Populus euphratica]
Length=647

 Score =   120 bits (302),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 81/250 (32%), Positives = 123/250 (49%), Gaps = 20/250 (8%)
 Frame = +3

Query  183  EPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            + G  T N    G     RP       L++D+ YLY C+L  Q  A +  +      I +
Sbjct  397  QQGLVTNNSKMKGRYRMTRP------QLMKDMLYLYRCILKDQKPAMNQGILSA---IPA  447

Query  363  ATTLI-DCKKFMKEYQ---PEKFVPALNPRA--IQLLCELDLTDYSERCSVN----PPPE  512
            AT +I D K  +KEY    P K     +  A  + L C + L D  E   V     PP E
Sbjct  448  ATRIILDTKYLVKEYNGELPWKIHHTGHEEAGKMTLYCTVFLIDKQESNEVMKKEMPPLE  507

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRV  692
             + L +NAT ++LK+E  R F+++Y   + F VE ++    V  +  +  L+   + + +
Sbjct  508  CITLKNNATFNELKLEVERKFRELYWGLKSFVVESIMN-LNVKGTDLVSELVEVGQRIVL  566

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
             G +     ++    E G  +  VDC CGA +DDGERM++CD C +WQH+RC  IP+   
Sbjct  567  EGSNAKSGTINELIYECGANNRVVDCACGANEDDGERMISCDICEVWQHSRCVQIPNNQE  626

Query  873  VPARFVCLRC  902
            +P  F+C RC
Sbjct  627  MPPIFLCSRC  636



>ref|XP_006372523.1| hypothetical protein POPTR_0017s02450g, partial [Populus trichocarpa]
 gb|ERP50320.1| hypothetical protein POPTR_0017s02450g, partial [Populus trichocarpa]
Length=687

 Score =   120 bits (302),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 132/261 (51%), Gaps = 33/261 (13%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            +  + EP S TV           +P LP  + +  D+ ++YE +L         +  + +
Sbjct  424  IPVKSEPESETVPA---------QPLLPGAD-VNADVVFVYENVL--------FNYPESE  465

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL-----DLTDYSERCSVNPPPE  512
            ++  +   ++D K F+KE+         N + +  +C++     DL     R +  PP E
Sbjct  466  LVEVATQAILDSKHFVKEWP----FRVENDQLLSFICQVMPTWNDLEAKFHRKA--PPGE  519

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRV  692
            ++VL  +A++ +LK EA  A +D Y M  RF V E+     + D   L   + S   + V
Sbjct  520  IIVLPLHASVLELKQEAESALRDTYCMLERFVVIEIEHMENLDDKDLLCKFVESGAEIFV  579

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            +G  +  N  S+ R E G ++W V C CGA DDDGERM+ CD C +WQHTRC GI D D+
Sbjct  580  KGYGMDIN--SQLRYEGGSDNWKVRCECGACDDDGERMVECDICEVWQHTRCNGIDDADT  637

Query  873  VPARFVCLRC--SCVIGQAKT  929
            VP  F+C  C  S + G+ +T
Sbjct  638  VPQLFICSGCCDSLLPGKTET  658



>ref|XP_009414350.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Musa acuminata 
subsp. malaccensis]
Length=463

 Score =   118 bits (296),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 83/245 (34%), Positives = 124/245 (51%), Gaps = 21/245 (9%)
 Frame = +3

Query  204  NVNTAGDN----NYMRPNLP---SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            NV T  DN    N+ +  +    +   L+RD+ YLY+ +L   + A    +   D I  +
Sbjct  217  NVFTGHDNLASGNHSKSRIRLQLTRTQLMRDMFYLYKNILKEPSSAAATGML--DAIPVA  274

Query  363  ATTLIDCKKFMKEYQ----PEKFVPALNPRAIQLLCELDLTDYS-ERCSVNPPPELLVLS  527
               ++D K+ +KEYQ    PEK   +     ++L C + +     ER    PP E +++ 
Sbjct  275  VRMVMDTKQLVKEYQQGPPPEKAEGSHG--YLKLSCSIRMNGADVER---TPPHETVIVP  329

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
            ++ATI +LK E  R F+ VY   + F  + +VG     DS  +  L+ S   + V GR  
Sbjct  330  AHATIGELKREVGRHFRAVYWGLKSFVADSIVGVR-CRDSDLVHELMQSGSSIVVEGRME  388

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
            G +    +    G     VDC CG K++DGE M+ CD C +WQHTRC GIPD D +P  F
Sbjct  389  GDDGEEIYEGGNGGNK-IVDCLCGGKEEDGEPMIFCDICEVWQHTRCVGIPDKDDIPPVF  447

Query  888  VCLRC  902
            +C RC
Sbjct  448  LCGRC  452



>ref|XP_004288593.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Fragaria 
vesca subsp. vesca]
Length=682

 Score =   120 bits (302),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 112/222 (50%), Gaps = 17/222 (8%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLYE +L        L   +  ++  +   ++D K F+KE      V     + + L
Sbjct  457  DVLYLYEHVL--------LGYPESGLVELATQAVLDSKHFVKECS----VRDDTEKLLTL  504

Query  453  LCEL--DLTDYSERCSVN-PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELV  623
             C++    TD       + PP E++V+  NAT+ +LK EA  A +D Y M  +F V E+ 
Sbjct  505  FCQILPSFTDKEIDFKRDLPPGEIVVMPLNATVGELKQEAENALRDTYCMTEQFVVTEIK  564

Query  624  GYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGER  803
            G     D   L   + S   V VRG   G +  +  R + G ++W V C CGA DDDGER
Sbjct  565  GLEESDDMDVLAGTVQSGTEVGVRGS--GIDLDTPLRYQGGSDTWMVRCECGATDDDGER  622

Query  804  MLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKT  929
            M+ACD C +WQHTRC G+ D D VP  F+C  C   +   KT
Sbjct  623  MVACDICEVWQHTRCCGMEDADEVPRLFICSTCYVSLVPPKT  664



>ref|NP_001170504.1| uncharacterized protein LOC100384509 [Zea mays]
 gb|ACR33888.1| unknown [Zea mays]
Length=478

 Score =   118 bits (296),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 75/238 (32%), Positives = 116/238 (49%), Gaps = 38/238 (16%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPE-----  413
            P+     RDL+ +Y  M+  ++              ++A  ++DCK ++K +        
Sbjct  267  PNAAEAERDLRAVYRAMVGARS--------------EAAQAVLDCKHWVKWWGLRDESDD  312

Query  414  --KFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVY  587
              +F+    P+  +          +E     PP +++V+  +A+I +L VEA  A +D Y
Sbjct  313  QLRFLVEWRPQPWE---------ATELTRPMPPGDIVVVPLHASIGELLVEAEHALRDTY  363

Query  588  LMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESW  758
              F  FQ E L G  G        ++LG AE    + V G   G +  +  R + G ++W
Sbjct  364  CFFENFQAESLDGITG---DKWDPVMLGGAESGDTIGVHGH--GADMETGLRCQGGADAW  418

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
             V C CGA+DDDGERM+ACD+C +W HTRC GI D   VP  F+C+ CS  +  A  I
Sbjct  419  EVQCVCGAQDDDGERMVACDACNVWHHTRCVGIADGAPVPPLFLCISCSGALMAAGPI  476



>ref|XP_002460302.1| hypothetical protein SORBIDRAFT_02g026200 [Sorghum bicolor]
 gb|EER96823.1| hypothetical protein SORBIDRAFT_02g026200 [Sorghum bicolor]
Length=668

 Score =   120 bits (300),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 120/247 (49%), Gaps = 20/247 (8%)
 Frame = +3

Query  207  VNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCK  386
            V   G    +R  L +   L+RDL +LY  +L   + A  L       I  +A  ++D K
Sbjct  415  VGGGGGKMRVRFQL-TRAQLMRDLTHLYRHVLREPSQA--LTTGAFGAIPVAARMVLDTK  471

Query  387  KFMKEYQPEKFVPALNPRA----IQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLK  554
             F+K+Y  E F P  +  A    + L C L + + S    V PP E + L ++AT+ +LK
Sbjct  472  HFVKDYH-EGFAPINSVGAGHVHMNLCCTLLVRNGSPEL-VAPPYETVTLPAHATVGELK  529

Query  555  VEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFR  734
             E  R F+++YL  R F  E + G     D+  +  L+     V + G  + +  L+   
Sbjct  530  WEVQRLFREMYLGLRTFTAESVAGVGVSKDACPVLGLIDVGSAVVIEGTVVEQQQLADEG  589

Query  735  MERGLESWTV-----------DCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
            ++ G E+  V           DC CGA D+DGERM  CD C  WQHTRCAGI D D  P 
Sbjct  590  VQPGNEAAAVSEGGGDSERIVDCACGADDEDGERMACCDICEAWQHTRCAGIKDTDDAPH  649

Query  882  RFVCLRC  902
             FVC RC
Sbjct  650  VFVCNRC  656



>ref|XP_004986276.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Setaria 
italica]
Length=710

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 117/238 (49%), Gaps = 38/238 (16%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------Q  407
            PS     RDL+ +Y  M+  ++              ++A  ++DCK ++K +        
Sbjct  490  PSTSEAERDLRAVYRAMVEARS--------------EAAQAVLDCKHWVKWWGLGDESDD  535

Query  408  PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVY  587
              +F+    PR  +          +E     PP +++V+  +A+I +L VEA  A +D Y
Sbjct  536  QLRFLVEWRPRPWE---------ANELTRPMPPGDIVVVPLHASIGELLVEAEHALRDTY  586

Query  588  LMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESW  758
              F  F+ E L G AG        ++LG AE    + V G   G +  +  R + G+++W
Sbjct  587  CFFDGFKAESLDGIAG---EKWDPVMLGGAESGDTISVHGH--GVDMETGLRCQGGVDAW  641

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
             V C CGA+DDDGERM+ACD+C +W HTRC GI D   VP  F+C+ C   +  A  I
Sbjct  642  EVQCVCGAQDDDGERMVACDACNVWHHTRCVGIADGVPVPPLFLCMSCGGALMAAGPI  699



>ref|XP_006395850.1| hypothetical protein EUTSA_v10003728mg [Eutrema salsugineum]
 gb|ESQ33136.1| hypothetical protein EUTSA_v10003728mg [Eutrema salsugineum]
Length=708

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/218 (32%), Positives = 114/218 (52%), Gaps = 23/218 (11%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPR-AIQ  449
            D+ YLY+ +L        L     D+   ++  +++CK F+KE+     +P+   + ++ 
Sbjct  491  DIFYLYKNLL--------LTYPDSDIYSDASEDILNCKSFVKEWP----LPSYQEQNSLT  538

Query  450  LLCELD------LTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
            + C++       L D++ +    PP EL+++  NATI +LK  A +A +D Y +  RF+V
Sbjct  539  VSCQVLPNHQELLRDFTRQL---PPGELVIVPKNATIRELKSAAEKALRDTYCIMERFEV  595

Query  612  EELVGYA-GVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
             E+        D T      G            G +  +  R E G + W V+C CGA+D
Sbjct  596  WEIKSKELEKMDETSCLKTEGDKSKTEFLVTGFGLDTGTELRYEAGFDDWIVNCKCGARD  655

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            DDGERM+ACD+C +W HT+C  I D ++VP+ F+C RC
Sbjct  656  DDGERMVACDACKVWHHTKCNSIEDDEAVPSVFLCNRC  693



>gb|EYU30865.1| hypothetical protein MIMGU_mgv1a002061mg [Erythranthe guttata]
Length=720

 Score =   120 bits (300),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 103/194 (53%), Gaps = 10/194 (5%)
 Frame = +3

Query  360  SATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSER----CSVNPPPELLVLS  527
            +  T++  K F+KE+         +  + + +C L ++ + E     C      E +V+ 
Sbjct  500  AVQTVLHSKHFVKEWPFRD----EDDDSFRFICRLTMSSFDENDSDLCCDLLHRECVVVP  555

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSL  707
              AT+ DL++    A +D Y +    +V E++   GV +   L  ++ S   +RVRG  L
Sbjct  556  LYATLGDLRLAVENAMRDTYCVMENLKVTEILEMEGVQEDEVLFGVIESGGEIRVRGGGL  615

Query  708  GKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARF  887
              +  +  R E G E+WTV C CGA DDDGERM+ACD C IWQHTRC GI D D+VP  F
Sbjct  616  --DLETELRYEGGNENWTVRCRCGAHDDDGERMVACDICEIWQHTRCGGIEDSDAVPRLF  673

Query  888  VCLRCSCVIGQAKT  929
            VC  C   +  A+T
Sbjct  674  VCDACCTALAPAQT  687



>ref|XP_006651751.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Oryza 
brachyantha]
Length=545

 Score =   118 bits (296),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/238 (32%), Positives = 117/238 (49%), Gaps = 38/238 (16%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------Q  407
            PS   + RDL+ +Y  M+              +   ++A +++DCK ++K +        
Sbjct  334  PSILEVERDLRAVYRAMV--------------EACSEAAQSVLDCKHWVKWWGLGDESDD  379

Query  408  PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVY  587
              +F     P+  +          +E     PP E++V+  +A++ +L VE+  A +D Y
Sbjct  380  QLRFFVEWQPKPWEA---------AELTRPMPPGEIVVVPLHASMGELLVESEHALRDTY  430

Query  588  LMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESW  758
              F  FQ E L G AG        ++LG AE    + V G   G +  +  R + GL+ W
Sbjct  431  CFFEEFQAEVLHGIAG---EKWDPVMLGGAESGDTISVYGN--GADMETGLRCQGGLDLW  485

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
             V C CGA+DDDGERM+ACD+C +W HTRC GI D + VP  F+C+ C   +  A  I
Sbjct  486  EVRCVCGARDDDGERMVACDACDVWHHTRCVGIADSEQVPPLFLCVLCGGALMAAGQI  543



>ref|XP_002521912.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF40548.1| DNA binding protein, putative [Ricinus communis]
Length=652

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/227 (32%), Positives = 115/227 (51%), Gaps = 17/227 (7%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQ---PEKFV  422
            +   ++RD+ Y Y+ +L  Q    +L +     I  +A  ++D K   K+Y    P +  
Sbjct  422  TKSQVIRDIYYFYKYILKDQKQTLNLGIFT--AIQAAARIILDTKFLAKDYHIELPSRID  479

Query  423  PALNPRAIQLLCELDLTDYSERC-SVN---PPPELLVLSSNATISDLKVEASRAFQDVYL  590
              L  + ++L C + L +  E    +N   PP E + + +NAT  +LK E  + F ++Y 
Sbjct  480  LGLGGK-LKLYCTVVLRNDEETSEGINKAMPPFERITMKANATFDELKQEVEKHFSELYW  538

Query  591  MFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRGRSLGKNALSRFRMERGLESWT  761
              R F  E ++      ++ G  L+ G  E    + V G +  +  +++   E GL S  
Sbjct  539  GLRSFIAESILNL----NTNGSDLVFGQVEMGQKIVVEGSNNERGMINQLIYESGLNSKI  594

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             DC CG KDDDGERM++CD C +WQHTRC  IP+   +P  F+C RC
Sbjct  595  FDCPCGTKDDDGERMVSCDICEVWQHTRCVRIPNHQEIPHIFLCSRC  641



>ref|XP_008381356.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Malus domestica]
Length=678

 Score =   119 bits (298),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/248 (33%), Positives = 125/248 (50%), Gaps = 33/248 (13%)
 Frame = +3

Query  183  EPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            EPG   V        ++    L     +  D+ YLYE +L        L   + +++  +
Sbjct  429  EPGKEIVA------QSFQSATLFPGVDVYNDVLYLYEHVL--------LGYPESELVDLA  474

Query  363  ATTLIDCKKFMKE--YQPEKFVPALNPRAIQLLCELDLTDYSERCSVN---PPPELLVLS  527
               ++D K F+KE  ++ ++       + +   C+L  +   +        PP E++V+ 
Sbjct  475  TRAVLDAKHFVKECPFRDDE------EQWLTFFCQLLPSSTDKEIEFKRGLPPGEVVVMP  528

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRG  698
             +ATI +LK  A  A +D Y +  RF V   +G  G+ +   +++L G AE    V VRG
Sbjct  529  LHATIGELKRAAESALRDTYCITERFVV---MGIEGLDEMDDMEVLFGVAESGAEVGVRG  585

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
               G +  +  R E G ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D D+VP
Sbjct  586  S--GIDLDTPLRYEGGSDTWMVRCECGARDDDGERMVACDICEVWQHTRCCGIEDADTVP  643

Query  879  ARFVCLRC  902
              FVC  C
Sbjct  644  PLFVCSAC  651



>ref|XP_006391351.1| hypothetical protein EUTSA_v10018197mg [Eutrema salsugineum]
 gb|ESQ28637.1| hypothetical protein EUTSA_v10018197mg [Eutrema salsugineum]
Length=714

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 78/208 (38%), Positives = 112/208 (54%), Gaps = 16/208 (8%)
 Frame = +3

Query  354  IQSAT-TLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD--LTDY-SERCSVNPPPELLV  521
            ++SAT  ++D K F+KE+     +   N +  + +C +D  L D  +E+ +  PP EL+ 
Sbjct  476  VRSATQAILDSKHFVKEWP----LWDNNDKIFRFVCRIDPSLIDLRTEQITELPPGELVT  531

Query  522  LSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRV  692
            +S  AT+ DLK      F+D Y +   F V E+      GD    K+L G  E    + V
Sbjct  532  VSLQATVFDLKQAIEDTFRDTYCILTNFVVNEIDELKEDGDDR--KVLFGRLESCSALTV  589

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            RG   G +  S  + + G E+W V C C A+DDDGERM++CD C +WQHTRC GI D D+
Sbjct  590  RG--FGIDMESELKFQGGCETWMVKCVCRARDDDGERMISCDVCEVWQHTRCCGIDDSDT  647

Query  873  VPARFVCLR-CSCVIGQAKTIGQMKDEF  953
            +P  +VC   C     Q K + Q K EF
Sbjct  648  LPPLYVCSNCCEDFADQQKKVLQPKYEF  675



>ref|XP_011099936.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Sesamum 
indicum]
Length=702

 Score =   119 bits (297),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/227 (33%), Positives = 117/227 (52%), Gaps = 20/227 (9%)
 Frame = +3

Query  264  LLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNP  437
            +  D+ YLY  +   +P++          D +  +   ++  K F+KE+         + 
Sbjct  460  VFDDMAYLYTNVFLGYPES---------SDSMKLAVQMILYSKHFVKEWP----FRDEDD  506

Query  438  RAIQLLCELDLT--DYSERCSVN-PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
             +++ +C L ++  D +   S + PP E +V+   ATI DLKV    A ++ Y +  +  
Sbjct  507  DSLRFICRLTMSSIDLNSNSSCDFPPREYIVVPLYATIGDLKVAIQNAMRETYCVMEKLL  566

Query  609  VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
            V +++   G+ D   L  ++ S   + VRG   G +  +  R E G E WTV C CGA+D
Sbjct  567  VTDILDMEGLQDEEVLFGIIESGRELWVRG--FGLDLENDLRYEGGTEKWTVRCKCGARD  624

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKT  929
            DDGERM+ACD C  WQHTRC+GI D ++VP  FVC  C   +   +T
Sbjct  625  DDGERMVACDICETWQHTRCSGIEDTEAVPRLFVCDACCSSLAPVQT  671



>ref|XP_011038253.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Populus 
euphratica]
Length=688

 Score =   118 bits (296),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 83/261 (32%), Positives = 131/261 (50%), Gaps = 33/261 (13%)
 Frame = +3

Query  168  VQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKD  347
            +  + EP S TV           +P LP  + +  D+ ++YE +L         +  + +
Sbjct  424  IPVKSEPESETVPA---------QPLLPGAD-VNADVVFVYENVL--------FNYPESE  465

Query  348  VIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL-----DLTDYSERCSVNPPPE  512
            ++  +   ++D K F+KE+         N + +  +C++     DL     R +  PP E
Sbjct  466  LVEVATQAILDSKHFVKEWP----FRVENDQLLSFICQVMPTWNDLEAKFHRKA--PPGE  519

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRV  692
            ++VL  +A++ +LK EA  A +D Y M   F V E+     + D   L   + S   + V
Sbjct  520  IIVLPLHASVLELKQEAESALRDTYCMLESFVVIEIEHMENLDDKDLLCKFVKSGAEIFV  579

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
            +G  +  N  S+ R E G ++W V C CGA DDDGERM+ CD C +WQHTRC GI D D+
Sbjct  580  KGYGMDIN--SQLRYEGGSDNWKVRCECGACDDDGERMVECDICEVWQHTRCNGIDDADT  637

Query  873  VPARFVCLRC--SCVIGQAKT  929
            VP  F+C  C  S + G+ +T
Sbjct  638  VPQLFICSGCCDSLLPGKTET  658



>ref|XP_006494663.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X2 [Citrus sinensis]
Length=553

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 126/247 (51%), Gaps = 29/247 (12%)
 Frame = +3

Query  246  LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------  404
            L +   +  ++ YLY  +L        L+  + +++  +   ++D K F+KE+       
Sbjct  302  LETGSDVYSEVVYLYMNVL--------LNYPESELVALATQAVLDSKHFVKEWPFRDEDD  353

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
            Q  +F   + P  +    E DLT      +  PP EL+++  ++T+ +LK  A  A +D 
Sbjct  354  QFLRFKCQVMPSFVD--SETDLT------AKLPPGELVMIPLHSTVLELKEAAESALRDT  405

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF-VRVRGRSLGKNALSRFRMERGLESWT  761
            Y +     V ++V    + D    +LL G+ E   +V  +  G ++ S+ R E G + W 
Sbjct  406  YCIMENLGVTDVVNMQKLDDG---ELLFGAVESGSQVWIQGYGIDSDSKLRYEGGNDKWI  462

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQM  941
            V C CGA+DDDGERM+ACD C +WQHTRC GI D  +VP  FVC RC      ++T    
Sbjct  463  VKCECGAQDDDGERMVACDICEVWQHTRCHGIEDSGTVPPLFVCPRCCSSFAPSRTESSF  522

Query  942  KDEFVGS  962
            +  F+GS
Sbjct  523  R--FLGS  527



>ref|XP_002315838.1| hypothetical protein POPTR_0010s11170g [Populus trichocarpa]
 gb|EEF02009.1| hypothetical protein POPTR_0010s11170g [Populus trichocarpa]
Length=647

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 79/250 (32%), Positives = 123/250 (49%), Gaps = 20/250 (8%)
 Frame = +3

Query  183  EPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            + G    N    G     RP       L++D+ YLY C+L  Q    +  +      I +
Sbjct  397  QQGLVINNSKMKGRYRMTRP------QLMKDMLYLYRCILKDQKPTMNQGILSA---IPA  447

Query  363  ATTLI-DCKKFMKEYQ---PEKFVPALNPRA--IQLLCELDLTDYSERCSVN----PPPE  512
            AT +I D K  +KEY    P K     +  A  + L C + L D  E   V     PP E
Sbjct  448  ATRIILDTKYLVKEYNGELPWKIHHTGHEEAGKMTLYCTVFLRDKQESNEVMKKAMPPLE  507

Query  513  LLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRV  692
             + L +NAT ++LK+E  R F+++Y   + F VE ++    V  +  +  ++   + + +
Sbjct  508  CITLKNNATFNELKLEVERKFRELYWGLKSFVVESIMN-LNVKGTDLVSEVVEVGQKIVL  566

Query  693  RGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
             G +     ++    E G+ +  VDC CGAK+DDGERM++CD C +WQH+RC  IP+   
Sbjct  567  EGSNAESGTINELIYECGVNNRVVDCACGAKEDDGERMISCDICEVWQHSRCVQIPNNQE  626

Query  873  VPARFVCLRC  902
            +P  F+C RC
Sbjct  627  MPPIFLCSRC  636



>gb|AAG51303.1|AC026480_10 PHD-finger protein, putative [Arabidopsis thaliana]
Length=653

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 112/209 (54%), Gaps = 17/209 (8%)
 Frame = +3

Query  351  IIQSAT-TLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD--LTDY-SERCSVNPPPELL  518
            +++SAT  ++D K F+KE+     +   N   +Q LC ++  L D  SE+ +  PP EL+
Sbjct  427  LVRSATQAILDSKHFIKEWP----IWDNNDTVLQFLCRINPSLVDVRSEQTTELPPGELV  482

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
             +   AT+ DLK      F+D Y +   F V E      + +      L+GS   + VRG
Sbjct  483  TVPLQATVYDLKQAIEETFRDTYCILSNFVVTE------IDEVEEDMSLIGSCSALTVRG  536

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
               G +  S+ + + G ++W V C C A+DDDGERM++CD C +WQHTRC GI D D++P
Sbjct  537  H--GIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLP  594

Query  879  ARFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
              FVC   C     Q + + Q K EF  S
Sbjct  595  PLFVCSNCCEEFAEQQRKVLQPKYEFPSS  623



>ref|XP_002281717.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Vitis vinifera]
 emb|CBI26773.3| unnamed protein product [Vitis vinifera]
Length=646

 Score =   118 bits (295),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 76/219 (35%), Positives = 116/219 (53%), Gaps = 13/219 (6%)
 Frame = +3

Query  264  LLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY---QPEKFVPA  428
            L++D+ YLY+ +L    QT+A  +       I  +A  ++D K  +KEY   QP +    
Sbjct  424  LMKDMFYLYKNILKEQKQTVATGIF----STIPVAARVILDTKYLIKEYCGGQPSEVKVG  479

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
            L      +    D  D     ++ PP E ++   N+T+++LK+E  R F+++Y   R F 
Sbjct  480  LKLYCTVVSRNNDEDDDGIEKAL-PPFECIIFKDNSTVNELKLEVERNFREIYWGLRSFC  538

Query  609  VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRS-LGKNALSRFRMERGLESWTVDCHCGAK  785
            VE +V     G      L+   +E +     S +G N    +  E G  + TVDC CGAK
Sbjct  539  VESIVNLNAKGSDLVFGLVEAGSELLFEGNDSKVGINNEGIY--ESGHNNCTVDCPCGAK  596

Query  786  DDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            DDDGERM++CD C +WQHTRCA IP+ + +P  F+C +C
Sbjct  597  DDDGERMISCDICEVWQHTRCAQIPNNEEIPHIFLCNQC  635



>gb|KDO60815.1| hypothetical protein CISIN_1g041583mg, partial [Citrus sinensis]
Length=586

 Score =   117 bits (293),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 78/243 (32%), Positives = 119/243 (49%), Gaps = 30/243 (12%)
 Frame = +3

Query  207  VNTAGDNNYMRPNLPSDEHLLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLID  380
            + T  +  Y    L   + +  D+  LY+ +L  +P++    L          +A  ++D
Sbjct  368  IQTRTEPEYHTSTLMPGQDVYADVLTLYKNVLLGYPESHTVSL----------AARAILD  417

Query  381  CKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVN----PPPELLVLSSNATISD  548
            CK F KE+Q   F  + +   ++L C +    Y+E  +      PP EL+V   + T+ +
Sbjct  418  CKNFAKEWQ---FKESEDDNLMRLKCRVS-PSYNELATQLTRPLPPAELIVAPKDVTVDE  473

Query  549  LKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSR  728
            LK+    + +D Y M  +  V+E+          G   +   A  V VRG  L  +  + 
Sbjct  474  LKLIVECSLRDTYCMMEKVVVKEI--------KMGQNQVFWGAGDVWVRGWGLDLD--TE  523

Query  729  FRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSC  908
             R E G + WTVDC CGAKDDDGERM+ACD C +WQHTRC  I D + VP+ F C  C+ 
Sbjct  524  LRFEGGADDWTVDCVCGAKDDDGERMVACDICQVWQHTRCNSIADNEVVPSVFKCRACTA  583

Query  909  VIG  917
             + 
Sbjct  584  AVA  586



>gb|EAZ28373.1| hypothetical protein OsJ_12353 [Oryza sativa Japonica Group]
Length=639

 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 116/233 (50%), Gaps = 28/233 (12%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
            PS   + RDL+ +Y  M+              +V  ++A  ++DCK ++K +     +  
Sbjct  428  PSTVEVERDLRAVYRAMV--------------EVRSEAAQAVLDCKHWVKWWG----LGD  469

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPP--ELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
             +   ++   E     +     + P P  E++V+  +A++ +L VE+  A +D Y  F  
Sbjct  470  ESDDQLRFFVEWQPQPWEAAELIRPMPLGEIVVVPLHASMGELLVESEHALRDTYYFFEE  529

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWTVDCH  773
            FQ E L G AG        ++LG AE    + V G   G +  +  R   GL+ W V C 
Sbjct  530  FQAEGLHGIAG---EKWDPVMLGGAENGDTISVYGN--GADMETELRCHGGLDLWEVRCV  584

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
            CGA+DDDGERM+ACD+C +W HTRC GI D + VP  F+C+ C   +  A  I
Sbjct  585  CGAQDDDGERMIACDACDVWHHTRCVGIADSEPVPPLFLCVLCGGALMAAGPI  637



>ref|XP_008644163.1| PREDICTED: uncharacterized protein LOC100384509 isoform X1 [Zea 
mays]
 gb|AFW67807.1| hypothetical protein ZEAMMB73_623721 [Zea mays]
 gb|AIB04710.1| PHD transcription factor, partial [Zea mays]
Length=689

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 75/238 (32%), Positives = 116/238 (49%), Gaps = 38/238 (16%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPE-----  413
            P+     RDL+ +Y  M+  ++              ++A  ++DCK ++K +        
Sbjct  478  PNAAEAERDLRAVYRAMVGARS--------------EAAQAVLDCKHWVKWWGLRDESDD  523

Query  414  --KFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVY  587
              +F+    P+  +          +E     PP +++V+  +A+I +L VEA  A +D Y
Sbjct  524  QLRFLVEWRPQPWEA---------TELTRPMPPGDIVVVPLHASIGELLVEAEHALRDTY  574

Query  588  LMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESW  758
              F  FQ E L G  G        ++LG AE    + V G   G +  +  R + G ++W
Sbjct  575  CFFENFQAESLDGITG---DKWDPVMLGGAESGDTIGVHGH--GADMETGLRCQGGADAW  629

Query  759  TVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
             V C CGA+DDDGERM+ACD+C +W HTRC GI D   VP  F+C+ CS  +  A  I
Sbjct  630  EVQCVCGAQDDDGERMVACDACNVWHHTRCVGIADGAPVPPLFLCISCSGALMAAGPI  687



>ref|NP_176791.2| PHD finger protein MALE MEIOCYTE DEATH 1 [Arabidopsis thaliana]
 sp|Q7X6Y7.1|MMD1_ARATH RecName: Full=PHD finger protein MALE MEIOCYTE DEATH 1 [Arabidopsis 
thaliana]
 gb|AAO16873.1| male meiotic MMD1 [Arabidopsis thaliana]
 gb|AAP69944.1| male meiotic chromosome organization protein [Arabidopsis thaliana]
 gb|AEE34471.1| male meiotic MMD1 PHD-finger protein [Arabidopsis thaliana]
Length=704

 Score =   118 bits (295),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 76/209 (36%), Positives = 112/209 (54%), Gaps = 17/209 (8%)
 Frame = +3

Query  351  IIQSAT-TLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD--LTDY-SERCSVNPPPELL  518
            +++SAT  ++D K F+KE+     +   N   +Q LC ++  L D  SE+ +  PP EL+
Sbjct  478  LVRSATQAILDSKHFIKEWP----IWDNNDTVLQFLCRINPSLVDVRSEQTTELPPGELV  533

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
             +   AT+ DLK      F+D Y +   F V E      + +      L+GS   + VRG
Sbjct  534  TVPLQATVYDLKQAIEETFRDTYCILSNFVVTE------IDEVEEDMSLIGSCSALTVRG  587

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
               G +  S+ + + G ++W V C C A+DDDGERM++CD C +WQHTRC GI D D++P
Sbjct  588  H--GIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLP  645

Query  879  ARFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
              FVC   C     Q + + Q K EF  S
Sbjct  646  PLFVCSNCCEEFAEQQRKVLQPKYEFPSS  674



>ref|XP_009789304.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Nicotiana 
sylvestris]
Length=688

 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 106/200 (53%), Gaps = 18/200 (9%)
 Frame = +3

Query  327  LHVCKKDVIIQSATTLIDCKKFMKEY----QPE----KFVPALNPRAIQLLCELDLTDYS  482
            L   + +V+  +  T++D K F+KE+     P+    +F+  + P +  L   L      
Sbjct  464  LSFAESNVLKLAVRTVLDSKHFVKEWPFRDDPDDILLRFICCILPSSSGLEAVLR-----  518

Query  483  ERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKL  662
                  PP E++ +  ++TI DLK     A +D Y +   F V ++VG   + D   L  
Sbjct  519  ---KGYPPGEMVEVPLHSTIGDLKTAIESAMRDTYCIMDNFMVTDIVGMETMEDCEVLFG  575

Query  663  LLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHT  842
            ++ S   + VRG   G +  S  + E G ++WTV+C CGA+DDDGERM++CD C IWQHT
Sbjct  576  IIESGSELWVRG--FGLDLESELKNEGGADNWTVNCRCGARDDDGERMVSCDICEIWQHT  633

Query  843  RCAGIPDLDSVPARFVCLRC  902
            RC GI D + VP  FVC  C
Sbjct  634  RCCGIEDSEVVPPLFVCEAC  653



>gb|AAL58226.1|AC090882_29 putative collagen [Oryza sativa Japonica Group]
 gb|ABF98555.1| PHD-finger family protein, expressed [Oryza sativa Japonica Group]
 gb|EAY91653.1| hypothetical protein OsI_13292 [Oryza sativa Indica Group]
Length=697

 Score =   117 bits (294),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 116/233 (50%), Gaps = 28/233 (12%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPA  428
            PS   + RDL+ +Y  M+              +V  ++A  ++DCK ++K +     +  
Sbjct  486  PSTVEVERDLRAVYRAMV--------------EVRSEAAQAVLDCKHWVKWWG----LGD  527

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPP--ELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
             +   ++   E     +     + P P  E++V+  +A++ +L VE+  A +D Y  F  
Sbjct  528  ESDDQLRFFVEWQPQPWEAAELIRPMPLGEIVVVPLHASMGELLVESEHALRDTYYFFEE  587

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWTVDCH  773
            FQ E L G AG        ++LG AE    + V G   G +  +  R   GL+ W V C 
Sbjct  588  FQAEGLHGIAG---EKWDPVMLGGAENGDTISVYGN--GADMETELRCHGGLDLWEVRCV  642

Query  774  CGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
            CGA+DDDGERM+ACD+C +W HTRC GI D + VP  F+C+ C   +  A  I
Sbjct  643  CGAQDDDGERMIACDACDVWHHTRCVGIADSEPVPPLFLCVLCGGALMAAGPI  695



>ref|XP_006494662.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like isoform 
X1 [Citrus sinensis]
Length=691

 Score =   117 bits (294),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/247 (32%), Positives = 126/247 (51%), Gaps = 29/247 (12%)
 Frame = +3

Query  246  LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------  404
            L +   +  ++ YLY  +L        L+  + +++  +   ++D K F+KE+       
Sbjct  440  LETGSDVYSEVVYLYMNVL--------LNYPESELVALATQAVLDSKHFVKEWPFRDEDD  491

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
            Q  +F   + P  +    E DLT      +  PP EL+++  ++T+ +LK  A  A +D 
Sbjct  492  QFLRFKCQVMPSFVD--SETDLT------AKLPPGELVMIPLHSTVLELKEAAESALRDT  543

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF-VRVRGRSLGKNALSRFRMERGLESWT  761
            Y +     V ++V    + D    +LL G+ E   +V  +  G ++ S+ R E G + W 
Sbjct  544  YCIMENLGVTDVVNMQKLDDG---ELLFGAVESGSQVWIQGYGIDSDSKLRYEGGNDKWI  600

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQM  941
            V C CGA+DDDGERM+ACD C +WQHTRC GI D  +VP  FVC RC      ++T    
Sbjct  601  VKCECGAQDDDGERMVACDICEVWQHTRCHGIEDSGTVPPLFVCPRCCSSFAPSRTESSF  660

Query  942  KDEFVGS  962
            +  F+GS
Sbjct  661  R--FLGS  665



>ref|XP_010528997.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Tarenaya 
hassleriana]
Length=722

 Score =   117 bits (294),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 122/242 (50%), Gaps = 27/242 (11%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKE---YQPEKFVPAL-  431
            + RDL +LY  +L        ++  + + +  ++  ++D K F+KE   +   + V    
Sbjct  460  IYRDLFFLYTNVL--------MNYPESESVNSASQAVLDSKHFVKECALWDDREHVFVFC  511

Query  432  ---NPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
               NP  + L  EL +T+        PP E++ +   AT+SDLK      F+D Y +   
Sbjct  512  CRVNPSLVDLRSEL-ITEL-------PPGEMVTVPLQATVSDLKQAIEDNFRDTYCVLAN  563

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAE-FVRVRGRSLGKNALSRFRMERGLESWTVDCHCG  779
            F V E+       D+   +LL G  E +  +  R  G +  S+ + + G ++W V C CG
Sbjct  564  FVVTEIEELGE--DTEDEELLFGRIEPYSALTVRGFGIDTGSKLKCQGGSDTWMVRCPCG  621

Query  780  AKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLR-CSCVIGQAKTIGQMKDEFV  956
            A DDDGERM+ACD C +WQHTRC GI D +++P  FVC R C     Q + + Q K EF 
Sbjct  622  AHDDDGERMVACDICEVWQHTRCCGIEDSETLPPLFVCTRCCDSFADQQRKLLQPKFEFP  681

Query  957  GS  962
             S
Sbjct  682  SS  683



>ref|XP_009370077.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Pyrus x 
bretschneideri]
Length=672

 Score =   117 bits (293),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 123/246 (50%), Gaps = 29/246 (12%)
 Frame = +3

Query  183  EPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            EPG   V        ++    L     +  D+ YLYE +L        L   + +++  +
Sbjct  423  EPGKEIVA------QSFQSATLFPGVDVYNDVLYLYEHVL--------LGYPESELVDLA  468

Query  363  ATTLIDCKKFMKE--YQPEKFVPALNPRAIQLLCELDLTDYSERCSVN---PPPELLVLS  527
               ++D K F+KE  ++ ++       + +   C+L  +   +        PP E++V+ 
Sbjct  469  TRAVLDAKHFVKECPFRDDE------EQWLTFFCQLLPSSTDKEIEFKRGMPPGEVVVMP  522

Query  528  SNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF-VRVRGRS  704
             +ATI +LK  A  A +D Y +  +F V   +G  G+ +   +++L G AE    V  R 
Sbjct  523  LHATIGELKRAAESALRDTYCITEQFVV---MGIEGLEEMDDMEVLFGVAESGAEVGVRG  579

Query  705  LGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPAR  884
             G +  +  R E G ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D D+VP  
Sbjct  580  SGIDLDTPLRYEGGSDTWMVRCECGARDDDGERMVACDICEVWQHTRCCGIEDADTVPPL  639

Query  885  FVCLRC  902
            FVC  C
Sbjct  640  FVCSAC  645



>ref|NP_178290.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
 sp|Q9ZUA9.1|Y2181_ARATH RecName: Full=PHD finger protein At2g01810 [Arabidopsis thaliana]
 gb|AAD12714.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC05502.1| RING/FYVE/PHD zinc finger superfamily protein [Arabidopsis thaliana]
Length=697

 Score =   117 bits (292),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/217 (34%), Positives = 115/217 (53%), Gaps = 27/217 (12%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKE--YQPEKFVPA---LNP  437
            D+ YLY+ +L        L     D+  +++  ++ CK F+KE  YQ +  +     + P
Sbjct  486  DILYLYQNLL--------LTYPDSDLYSEASQVILKCKSFVKEWSYQEQNHLTVSCQVLP  537

Query  438  RAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEE  617
               +LL +           + PP +L+ +  NATI +LK  A +  +D Y +   F+V E
Sbjct  538  NHEELLRDF--------TRLLPPGDLVAVPENATIRELKSAAEKVLRDTYCITETFEVLE  589

Query  618  LVG--YAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDD  791
            +       + D+  LK   G+ EF+ V+G   G +  +  R E G + WTVDC CGA+DD
Sbjct  590  IRNRYLEKLDDNVSLKSQ-GNTEFM-VKG--FGLDIGTELRYEGGFDDWTVDCKCGARDD  645

Query  792  DGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            DGERM+ACD+C +W HT C  I D ++VP+ F+C  C
Sbjct  646  DGERMVACDACKVWHHTLCNSIEDDEAVPSVFLCNMC  682



>ref|XP_003056829.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58474.1| predicted protein [Micromonas pusilla CCMP1545]
Length=361

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/265 (28%), Positives = 116/265 (44%), Gaps = 52/265 (20%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQ-------------TMANHLHVCKKDVIIQSATTLIDCKKF  392
            + E +  D+K +Y+ +L                T       C    +I +A  L+D K+F
Sbjct  57   TKEKISNDVKVVYKNLLESYKPARARPGRPLKGTAPGEPKKCHGSDLIHAARVLLDTKQF  116

Query  393  MKEYQPEKFVPALNPRA------------------IQLLCELDLTDYSERCS--------  494
            +K Y     + AL P A                  + +   +D  +   + S        
Sbjct  117  VKTYCSTSDMLALRPPASATAGKSGRPPMVSKGVRVMVTAVIDSRNKGPKVSGLSIKEKK  176

Query  495  -------VNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTG  653
                     PPPE+++L     + DLK   ++ F D+Y++  +++V  ++G+    +ST 
Sbjct  177  KLKYGIETKPPPEVILLPPEPMLCDLKNAVNKVFSDLYVVLAKYRVRHVIGF----ESTQ  232

Query  654  LKLLLGSAEFVRVRGRSLGKNA--LSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCG  827
             K  L + +        LG  A   S FR + GL+ W V C CG  DDDGERM+ACD C 
Sbjct  233  EKARLNAKKIAGASLEVLGDGADLESDFRYQGGLDQWIVRCVCGTCDDDGERMIACDVCE  292

Query  828  IWQHTRCAGIPDLDSVPARFVCLRC  902
            +W HTRC GI D ++ P R+ C  C
Sbjct  293  VWMHTRCVGISDSENTPRRWTCKEC  317



>ref|XP_006851141.1| hypothetical protein AMTR_s00043p00045130 [Amborella trichopoda]
 gb|ERN12722.1| hypothetical protein AMTR_s00043p00045130 [Amborella trichopoda]
Length=361

 Score =   113 bits (283),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 73/223 (33%), Positives = 115/223 (52%), Gaps = 22/223 (10%)
 Frame = +3

Query  270  RDLKYLYECMLHPQTMANHLHVCKKDVIIQSAT-TLIDCKKFMKEYQPEKFVPALNPRAI  446
            RDL+Y+Y+ +L               +++++A   ++D K   K +        L     
Sbjct  140  RDLEYVYKRVLKGGLGG---------MVVEAARHVVLDTKHLAKVWPIRDDDGKLWFMVS  190

Query  447  QLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVG  626
             +L E +   +S    V  PPEL+V+  +A++ DL+  A R  ++ Y +   F  ++L+ 
Sbjct  191  MVLSEEEAGMFS---YVTTPPELVVIPLHASVGDLRAVAERTLRNTYCVMEGFVAQDLIW  247

Query  627  YAGVGDSTGLKLL-------LGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAK  785
              G+ + + ++LL       +G    V VRG+   + A S  R E G E W V+C CGA+
Sbjct  248  PHGL-EVSEMELLFRVAQSGMGMGMGVWVRGKGAERGAES-LRYEGGAEEWRVECECGAR  305

Query  786  DDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVI  914
            DDDGERM+ACD C +WQ+TRC GIPD + V   F C RC   +
Sbjct  306  DDDGERMVACDLCEVWQYTRCLGIPDAEEVAHLFFCDRCGSAL  348



>gb|KDP25820.1| hypothetical protein JCGZ_22542 [Jatropha curcas]
Length=682

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/244 (30%), Positives = 127/244 (52%), Gaps = 19/244 (8%)
 Frame = +3

Query  240  PNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKF  419
            P+L     L  D+ YLY  +L        ++  + +++  +   ++D K F+KE+  E  
Sbjct  438  PSLVPGADLYGDMGYLYMKVL--------MNYPESELVETATQAILDSKHFVKEWPFENE  489

Query  420  VPALNPRAIQLLCEL--DLTDYSERCSVN-PPPELLVLSSNATISDLKVEASRAFQDVYL  590
               L    ++ +C++  ++ +   + +   PP E+++L  +AT+++LK  A  A +D Y 
Sbjct  490  EDQL----LRYICQVMPNIIEAGTKFTRELPPGEIIMLPLHATVAELKRAAENALKDTYY  545

Query  591  MFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDC  770
            +   F V E+     + D   L  ++ S   + ++G  +  N  +  R E G ++W V C
Sbjct  546  ILENFVVTEIELMEELEDWEVLFGVVESGSELFMKGNGVDLN--TELRYEAGPDNWKVRC  603

Query  771  HCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDE  950
             CGA+DDDGERM+ACD C +W+HTRC GI D  +VP  F+C  C   +   K   +++ E
Sbjct  604  ECGAQDDDGERMVACDICEVWEHTRCNGIDDSKTVPPLFICTECCNSV--VKPTNELQVE  661

Query  951  FVGS  962
            F  S
Sbjct  662  FENS  665



>ref|XP_010229496.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Brachypodium 
distachyon]
Length=653

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 113/231 (49%), Gaps = 38/231 (16%)
 Frame = +3

Query  270  RDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPE-------KFVPA  428
            RD++ +Y  M+              D + ++A  ++D K ++K +  +       +F+  
Sbjct  442  RDMRAVYRAMV--------------DALSEAAQAVLDSKHWVKCWGLDDESDDQLRFLVE  487

Query  429  LNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
              P+           + +E     PP E++V+  + +I +L VEA  A  D Y  F  FQ
Sbjct  488  WRPQP---------REAAELTRPMPPGEIVVVPLHTSIGELLVEAEHALSDTYCFFEEFQ  538

Query  609  VEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWTVDCHCG  779
             E L G +G        ++LG AE    + V G   G +  +  R + GL+ W V C CG
Sbjct  539  AEALDGISG---EKWDPVVLGGAESGDTIGVHGH--GADMETLLRCQGGLDMWEVGCVCG  593

Query  780  AKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTI  932
            AKDDDGERM+ACD+C +W HTRC GI D  SVP  F+C+ C   +  A  I
Sbjct  594  AKDDDGERMVACDACDVWHHTRCVGIADDQSVPPLFLCILCGGALMAAVPI  644



>emb|CDP01658.1| unnamed protein product [Coffea canephora]
Length=702

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 71/189 (38%), Positives = 107/189 (57%), Gaps = 9/189 (5%)
 Frame = +3

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL--DLTDY-SERCSVNPPPEL  515
            D++  +A T+++ K F+KE+ P +    L   A++  C L   LT+  +E     P  E 
Sbjct  469  DMVRLAAGTVLNSKYFVKEW-PFRDEQDL---ALRFTCRLMPSLTEMETELTRELPRGEY  524

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVR  695
            +V+  ++TI DLK+    A +D Y + +   V +++   G+ D   L  +L S   + VR
Sbjct  525  IVVPLHSTIGDLKIAIQSAMRDTYCIMKHLLVTDIIETEGMSDGEVLFGILESGTELWVR  584

Query  696  GRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSV  875
            G  L  +  +  R E G ++W V C CGA+DDDGERM++CD C IWQHTRC GI D ++V
Sbjct  585  GTGL--DLETDLRYEGGADNWKVSCKCGAQDDDGERMVSCDVCEIWQHTRCCGIEDSEAV  642

Query  876  PARFVCLRC  902
            P  FVC  C
Sbjct  643  PPVFVCDAC  651



>ref|XP_002463991.1| hypothetical protein SORBIDRAFT_01g010120 [Sorghum bicolor]
 gb|EER90989.1| hypothetical protein SORBIDRAFT_01g010120 [Sorghum bicolor]
Length=697

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/202 (34%), Positives = 104/202 (51%), Gaps = 24/202 (12%)
 Frame = +3

Query  357  QSATTLIDCKKFMKEYQPE-------KFVPALNPRAIQLLCELDLTDYSERCSVNPPPEL  515
            ++A  ++DCK ++K +          +F+    P+  +          +E     PP ++
Sbjct  508  EAAQAVLDCKHWVKWWGLRDESDDQLRFLVEWRPQPWEA---------TELTKPMPPGDI  558

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FV  686
            +V+  + +I +L VEA  A +D Y  F  FQ E L G AG        ++LG AE    +
Sbjct  559  VVVPLHTSIGELLVEAEHALRDTYCFFEDFQAESLDGIAG---DKWDPVMLGGAESGDTI  615

Query  687  RVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDL  866
             V G   G +  +  R + G ++W V C CGA+DDDGERM+ACD+C +W HTRC GI D 
Sbjct  616  GVHGH--GADMETGLRCQGGADAWEVQCVCGAQDDDGERMVACDACNVWHHTRCVGIADG  673

Query  867  DSVPARFVCLRCSCVIGQAKTI  932
              VP  F+C+ CS  +  A  I
Sbjct  674  APVPPLFLCISCSGALMAAGPI  695



>ref|XP_009770533.1| PREDICTED: PHD finger protein At2g01810-like [Nicotiana sylvestris]
Length=738

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 113/220 (51%), Gaps = 11/220 (5%)
 Frame = +3

Query  243  NLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFV  422
            N+  D ++ +DL+YLYE +L        L     D +  +   ++D KKF+K+++ E   
Sbjct  525  NIELDFNIDQDLEYLYETVL--------LSYPGSDSVSLATRVVLDSKKFVKKWKLENQE  576

Query  423  PALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
              +     ++L   D  + SE      P  ++ +    TI +LK  A  A +D Y + + 
Sbjct  577  SQIMALTCKVLPSFDELE-SELTRPLSPGVVVYVPPWITIRELKGVAQFALRDTYCIMQN  635

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGA  782
            F V ++ G  G+ D   L   +G    V VRGR L  +  +  R E G     VDC CGA
Sbjct  636  FVVTQIGGLKGIEDKRMLSCAVGRDAHVWVRGRGLDLD--TELRYEGGPIKLKVDCICGA  693

Query  783  KDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +DDDGERM+ CD+C +W HT C+GI D + VPA F+C  C
Sbjct  694  RDDDGERMVNCDACQVWFHTMCSGIDDHEEVPAVFLCESC  733



>ref|XP_010312719.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein MALE MEIOCYTE 
DEATH 1-like [Solanum lycopersicum]
Length=761

 Score =   116 bits (290),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 113/220 (51%), Gaps = 8/220 (4%)
 Frame = +3

Query  327  LHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLC-ELDLTDYSERCSVN-  500
            L   + D +  +   ++D K+F+KE+    F    N   ++ +C  L  ++  E      
Sbjct  535  LSFAESDELSLAVRIVLDSKQFLKEW---PFSDDPNDSLLRFICCILPNSNGLEAVFTKG  591

Query  501  -PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSA  677
             PP E++ +  ++TI DLK+    A +D Y +     + ++VG   + D   L  ++ S 
Sbjct  592  YPPGEVVEVPLHSTIGDLKIAVESAMRDTYCIMDNLMITDIVGMEQLEDYEVLFGIVQSG  651

Query  678  EFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGI  857
              + VRG   G +  S  + E G ++WTV+C CGA+DDDGERM++CD C IWQHTRC GI
Sbjct  652  SELWVRG--FGLDLDSELKNEGGSDNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGI  709

Query  858  PDLDSVPARFVCLRCSCVIGQAKTIGQMKDEFVGSAAYCV  977
             D + VP  FVC  C   +   +     +    G+AA  V
Sbjct  710  EDSEVVPPLFVCEACCTSLAPPRAQNSFEFGHYGTAAALV  749



>ref|XP_004490840.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Cicer 
arietinum]
Length=707

 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 103/188 (55%), Gaps = 8/188 (4%)
 Frame = +3

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP--ELL  518
            +V+  +  T++DC+ F+KE++    +     + +  +C L       +  +  P   E++
Sbjct  488  EVVELAVQTILDCRHFVKEWKLRDEME----QVLTFICHLKPNFVENKSELKGPSCGEIV  543

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            ++  +AT+ DLK  A    +D Y +  R  V ++    GV D   L  L+ S   + VRG
Sbjct  544  IVPLHATVRDLKQAAEATLRDTYCIAERLIVTDIKELLGVSDEEVLFGLIQSGVKLCVRG  603

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
              +G +  +  + + G ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D ++VP
Sbjct  604  --IGIDLCTPLKYQGGSDNWKVRCECGAQDDDGERMVACDICEVWQHTRCCGIDDSETVP  661

Query  879  ARFVCLRC  902
              FVC  C
Sbjct  662  PLFVCSGC  669



>gb|KDO41051.1| hypothetical protein CISIN_1g046513mg, partial [Citrus sinensis]
Length=660

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 120/236 (51%), Gaps = 27/236 (11%)
 Frame = +3

Query  246  LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------  404
            L +   +  ++ YLY  +L        L+  + +++  +   ++D K F+KE+       
Sbjct  440  LETGSDVYSEVVYLYMNVL--------LNYPESELVALATQAVLDSKHFVKEWPFRDEDD  491

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
            Q  +F   + P  +    E DLT         PP EL+++  ++T+ +LK  A  A +D 
Sbjct  492  QFLRFKCQVMPSFVD--SETDLT------GKLPPGELVMIPLHSTVLELKEAAESALRDT  543

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF-VRVRGRSLGKNALSRFRMERGLESWT  761
            Y +     V ++V    + D    +LL G+ E   +V  +  G ++ S+ R E G + W 
Sbjct  544  YCIMENLGVTDVVNMQKLDDG---ELLFGAVESGSQVWIQGYGIDSDSKLRYEGGNDKWI  600

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKT  929
            V C CGA+DDDGERM+ACD C +WQHTRC GI D  +VP  FVC RC      ++T
Sbjct  601  VKCECGAQDDDGERMVACDICEVWQHTRCHGIEDSGTVPPLFVCPRCCSSFAPSRT  656



>ref|XP_010689687.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Beta vulgaris 
subsp. vulgaris]
Length=699

 Score =   115 bits (289),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 122/236 (52%), Gaps = 26/236 (11%)
 Frame = +3

Query  270  RDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQ  449
            RD+  LY      QT+   L   + D++  S   ++D K  +KE+    F    N + ++
Sbjct  461  RDVSILYN-----QTI---LGRPESDILGLSVRVILDSKHLVKEW---PFKDDENDQLLR  509

Query  450  LLC-------ELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
             +C       ELD+ + S   S   P +++VL  +A+  DL+V A  A +D Y +  R+ 
Sbjct  510  FICHVLPTSSELDM-ELSRNLS---PGDMIVLPLHASFGDLRVAAQHALRDTYCIMDRYV  565

Query  609  VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
            V ++       D+  +   + S   + +RG   G +  +  R E G ++WTV C CGA D
Sbjct  566  VTDIDSMENFVDAEVVFGAVESGSELWIRGS--GIDIKTDLRYEGGPDNWTVRCSCGATD  623

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC--SCVIGQAKTIGQMKDE  950
            DDGERM++CD C  WQHTRC GI D ++VP  FVC RC  S +  + +TI    +E
Sbjct  624  DDGERMVSCDICEAWQHTRCTGIEDTEAVPPLFVCQRCCASLMPPRVETISYFDNE  679



>ref|XP_002527531.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF34840.1| DNA binding protein, putative [Ricinus communis]
Length=679

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 122/237 (51%), Gaps = 23/237 (10%)
 Frame = +3

Query  270  RDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            +DL +LY+ +L  +P   A          +  +A  ++DCK F KE+Q   +  +     
Sbjct  448  KDLLFLYKNVLLGYPDYHA----------VAIAARVILDCKHFFKEWQ---YKSSNEDAL  494

Query  444  IQLLCELDLTDYSERCSVN----PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
            + L+C++  + Y E  +      PP E ++    AT+ +LK+    A +D Y +   F V
Sbjct  495  LTLICQVRPS-YDELANELTWPLPPGEPVMAPECATVFELKLTVQCALRDTYCVMDNFVV  553

Query  612  EELVGYAGVGDSTGLKLLL-GSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKD  788
             ++     V    G  LL  G  + ++V  R  G +  ++ R + G   WTVDC CGAKD
Sbjct  554  NDIEIGGLVAREEGQDLLKCGLEDGMKVWVRGSGLDLDTKLRYQGGDNDWTVDCKCGAKD  613

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQ--AKTIGQMKDEF  953
            DDGERM+ACD+C +WQHTRC  I D  S P  F+C  C+C + +  A+ I   K+ F
Sbjct  614  DDGERMVACDACHVWQHTRCNSIKDDASPPTLFLCRMCNCRMKKSSARCISAEKNRF  670



>ref|XP_006492305.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Citrus sinensis]
Length=650

 Score =   115 bits (288),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 74/225 (33%), Positives = 117/225 (52%), Gaps = 18/225 (8%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKE---YQPEKFVPALN  434
            L++D++ LY+ +LH Q  A    +     I  ++  ++D K F+KE    Q     P L+
Sbjct  421  LMKDVRILYKLILHDQKPATSSGIFSG--ISVASRIILDTKYFVKECCRDQVSSTKPGLD  478

Query  435  PRA-IQLLCELDLTDY-----SERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
                ++L C + L D          S   P E + + +NAT  +LK+E  R F+++Y   
Sbjct  479  LEGKLKLYCTVILRDSENPNGGRNNSAMQPYECVTIKNNATFDELKLEVQRNFRELYWGL  538

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVR---VRGRSLGKNALSRFRMERGLESWTVD  767
            R F +E +V      ++TG  L+ G  E  R     G +  +  +     E G+ +  V+
Sbjct  539  RSFVIESIVNV----NATGTDLVCGFVEVGRRIVFEGSNSERGIVYGQIYENGMVNCVVE  594

Query  768  CHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            C CGA +DDGERM++CD C +WQHTRCA IP+ + +P  F+C RC
Sbjct  595  CACGADEDDGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRC  639



>ref|XP_009620363.1| PREDICTED: PHD finger protein At2g01810-like [Nicotiana tomentosiformis]
Length=736

 Score =   115 bits (288),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/220 (34%), Positives = 112/220 (51%), Gaps = 11/220 (5%)
 Frame = +3

Query  243  NLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFV  422
            N+  D ++ +DL+YLYE +L        L     D +  +   ++D KKF+K+++ E   
Sbjct  525  NIELDFNIDQDLEYLYETVL--------LSYPGSDSVSLATRVVLDSKKFVKKWKLENQE  576

Query  423  PALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
              +     ++L   D  + SE      P  ++ +    TI +LK  A  A +D Y + + 
Sbjct  577  SQIMALTCKVLPSFDELE-SELTRPLSPGVVVFVPPWITIRELKGVAQFALRDTYCIMQN  635

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGA  782
            F V ++ G  G+ D   L   +G    V VRGR L  +  +  R E G     VDC CGA
Sbjct  636  FVVTQIGGLKGIEDKRMLSCAVGRDAHVWVRGRGLDLD--TELRYEGGPIKLKVDCICGA  693

Query  783  KDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +DDDGERM+ CD+C +W HT C GI D + VPA F+C  C
Sbjct  694  RDDDGERMVNCDACQVWFHTVCTGIDDHEEVPAIFLCESC  733



>dbj|BAK03548.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=683

 Score =   115 bits (287),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/249 (30%), Positives = 120/249 (48%), Gaps = 28/249 (11%)
 Frame = +3

Query  201  VNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLID  380
            V ++    N       PS   + RDL+ +Y  M+              + +  +A  ++D
Sbjct  449  VQMDVEVQNTRPAAQWPSAVDVERDLRAVYRAMV--------------EALSDAAQAVLD  494

Query  381  CKKFMKEYQPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPP--ELLVLSSNATISDLK  554
            CK ++K +     +   +   ++ L E     +       P P  E++V+  + +I +L 
Sbjct  495  CKHWVKCWG----LGDESDDQLRFLVEWRPQPWEAAELTRPLPSGEIIVVPVHTSIGELI  550

Query  555  VEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE---FVRVRGRSLGKNALS  725
            ++A  A +D Y  F  FQ E L G  G        ++LG AE    + V G   G +  +
Sbjct  551  IQAEHALRDTYCFFEEFQAETLDGITG---EKWDPVVLGGAESGDTIGVHGH--GADMET  605

Query  726  RFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
              R + GL++W V C CGA+DDDGERM+ACD+C +W HTRC GI D ++VP  F+C+ C 
Sbjct  606  GLRCQGGLDTWEVRCVCGAQDDDGERMVACDACDVWHHTRCVGIADSEAVPPLFLCILCG  665

Query  906  CVIGQAKTI  932
              +  A  I
Sbjct  666  GALLAAGPI  674



>ref|XP_008343056.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Malus 
domestica]
Length=288

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 77/215 (36%), Positives = 108/215 (50%), Gaps = 18/215 (8%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            +  D+ YLYE +L        L   + + ++ +   L+  K F+KE            ++
Sbjct  79   VYNDVLYLYEHVL--------LEYPESEQMVLATQRLLGAKHFVKECSHRDD----EEQS  126

Query  444  IQLLCELDLTDYSERCSVN-PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEEL  620
            + + C+L LTD         PP E++VL  +AT+ +LK  A  A +D Y +  RF+V  +
Sbjct  127  LTIFCQL-LTDMEFVFKRELPPGEVVVLPLHATVRELKRAAESALRDTYFITERFEVMAI  185

Query  621  VGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNAL-SRFRMERGLESWTVDCHCGAKDDDG  797
             G   + D    + L G AE   V G       L +  R E G + W V C CGA DDDG
Sbjct  186  EGLXEMEDX---EPLFGVAESGVVVGVRGSGIDLDTPLRYEGGSDIWIVSCDCGATDDDG  242

Query  798  ERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            ERM+ACD C +WQHTRC GI D D+VP  F C  C
Sbjct  243  ERMVACDLCEVWQHTRCRGIEDADTVPPVFFCSAC  277



>ref|XP_004956970.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Setaria 
italica]
Length=665

 Score =   114 bits (286),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 111/232 (48%), Gaps = 25/232 (11%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L+RDL +LY  +L   + A  L       I  +   ++D K F+K+Y  E F P  +  A
Sbjct  429  LMRDLAHLYRHVLKEPSQA--LTAGALGAIPVAVRMVLDTKHFVKDYH-EGFAPVSSVGA  485

Query  444  ----IQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
                I L C L + D +    +  P E + L ++AT+ +LK E  R F+++YL  R F  
Sbjct  486  GHVHISLCCTLLVRDGTP--ELVAPYETVTLPAHATVGELKWEVQRLFREMYLGLRTFTA  543

Query  612  EELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGL--------------  749
            E +VG     D+  +  L+     V V G  +G+        + G+              
Sbjct  544  ESVVGVGVSQDACPVLGLIDVGSAVVVEG-YVGEQQQQLAAADEGVLPGNEVAAVSEGGC  602

Query  750  -ESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
                 VDC CGA DDDGERM  CD C  WQHTRCAGI D D VP  FVC RC
Sbjct  603  DGERVVDCVCGADDDDGERMACCDICEAWQHTRCAGIKDTDDVPHVFVCSRC  654



>ref|XP_006851139.1| hypothetical protein AMTR_s00043p00044190 [Amborella trichopoda]
 gb|ERN12720.1| hypothetical protein AMTR_s00043p00044190 [Amborella trichopoda]
Length=168

 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 86/148 (58%), Gaps = 7/148 (5%)
 Frame = +3

Query  492  SVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLL--  665
            S   PPEL+VL  +A++ DL+ +A R   + Y +   F  ++L+   G+ + + ++LL  
Sbjct  19   SATTPPELVVLPLHASVGDLRAKAERILCNTYYLMEGFVEQDLIWPQGL-EVSEVELLFH  77

Query  666  ---LGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQ  836
               LG    V VRG+  G++  +  R E G E W ++C CGA+DDDGERM+A D C +WQ
Sbjct  78   VAQLGMGMGVWVRGKR-GESGAASLRYEGGAEEWRMECECGARDDDGERMVASDLCEVWQ  136

Query  837  HTRCAGIPDLDSVPARFVCLRCSCVIGQ  920
            HT C GIPD + V     C RC+  + Q
Sbjct  137  HTWCLGIPDAEEVAHLCFCDRCASALLQ  164



>emb|CDY68248.1| BnaC02g47750D [Brassica napus]
Length=435

 Score =   112 bits (279),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 73/212 (34%), Positives = 105/212 (50%), Gaps = 40/212 (19%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLY  +L        L     +V   ++  +++CK F K+ Q       + P   +L
Sbjct  243  DILYLYRNLL--------LTYPDSEVYSDASEIILNCKSFFKDCQ-------VLPNHEEL  287

Query  453  LCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVG--  626
            L +L            PP EL+ +S NATI  LK    +A +D Y +   F+V E+    
Sbjct  288  LRDL--------TRKLPPGELVTVSRNATIRVLKSAVEKALRDTYCVMESFEVLEIRNKD  339

Query  627  YAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERM  806
               +G+++GL+              S G N + R   E G ++WTVDC CGA DDDGERM
Sbjct  340  LEKIGENSGLE--------------SEGGNKI-RTEYEGGFDNWTVDCKCGAIDDDGERM  384

Query  807  LACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +ACD+C +W HT+   I D D VP+ F C RC
Sbjct  385  VACDACKVWHHTKFHSIEDGDDVPSAFSCYRC  416



>gb|KDP38178.1| hypothetical protein JCGZ_04821 [Jatropha curcas]
Length=678

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 76/249 (31%), Positives = 124/249 (50%), Gaps = 19/249 (8%)
 Frame = +3

Query  186  PGSATVNVNTAGDNNYMRPNLPSDE-HLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            P   ++N+N    N+ ++         +++D+ Y Y+ ++  Q    ++ +      IQ+
Sbjct  428  PAQESININ----NSKVKARYKITRCQVMKDMYYFYKYVVKDQKQTVNMGILTA---IQA  480

Query  363  ATTLI-DCKKFMKEYQPE---KFVPALNPRAIQLLCELDLTDYSERCS--VN---PPPEL  515
            A+ +I D K   K+Y  E   +    L  + ++L C + L +  E  +  +N   PP E 
Sbjct  481  ASRIILDTKFLAKDYYTEFPCRVELGLEGK-LKLYCTVFLRNNEEIANEGINKAMPPFEC  539

Query  516  LVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVR  695
            + L SNAT  +LK +  R F+++Y  FR F VE ++     G      L+    + V   
Sbjct  540  ITLKSNATFDELKQQVERNFKELYWGFRGFAVESILNLNAKGSDLVFGLVEVGQKMV-FE  598

Query  696  GRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSV  875
            G +  +  ++    E G  +  VDC CG KDDDGERM++CD C +WQHTRC  IP    +
Sbjct  599  GSNRERGMINELIYESGNNNRVVDCPCGTKDDDGERMVSCDICEVWQHTRCVRIPYHQEI  658

Query  876  PARFVCLRC  902
            P  F+C RC
Sbjct  659  PHIFLCSRC  667



>ref|XP_010470485.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Camelina 
sativa]
Length=702

 Score =   114 bits (284),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/251 (34%), Positives = 124/251 (49%), Gaps = 38/251 (15%)
 Frame = +3

Query  240  PNLPSDEHLLRDLKYLYECML-HPQTMANHLHVCKKDVIIQSAT-TLIDCKKFMKEYQPE  413
            P+ P  + + RDL  LY  +  +P++            +++SAT  ++D K F+KE+   
Sbjct  450  PSKPGAD-VYRDLLLLYTVLFTYPESE-----------LVRSATQAILDSKHFVKEWPIW  497

Query  414  -------KFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRA  572
                   +FV  +NP  I L         SE+ +  PP EL+ +   ATI DLK      
Sbjct  498  DNSETVLQFVCRINPSLIGL--------RSEQITELPPGELVTVPLQATIFDLKQAIEET  549

Query  573  FQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLE  752
            F+D Y +   F V E      + + T    L  S   + VRG   G +  S+ + + G +
Sbjct  550  FRDTYCILANFVVSE------IEEVTEDMSLTESCSALTVRG--YGIDLESKLKCQGGCD  601

Query  753  SWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLR-CSCVIGQAKT  929
            +W V C C A+DDDGERM++CD C +WQHTRC GI D D++P  FVC   C     Q + 
Sbjct  602  TWMVKCICRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLPPLFVCSNCCEEFAEQQRK  661

Query  930  IGQMKDEFVGS  962
            + Q K EF  S
Sbjct  662  VVQPKYEFPSS  672



>gb|AES99203.2| PHD finger protein MALE meiocyte DEATH protein [Medicago truncatula]
Length=715

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 113/215 (53%), Gaps = 22/215 (10%)
 Frame = +3

Query  273  DLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAI  446
            D+ YLY+ +L  +P + A  L V           T++DC+ F+KE++    +     + +
Sbjct  480  DVVYLYKNVLLGYPDSEAVELAV----------QTILDCRHFVKEWKLRDEME----QVL  525

Query  447  QLLCELDLTDYSERCSVNPPP--ELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEEL  620
              +C L       +  +  P   E++ +  +AT+ DLK  A  A +D Y +  R  V ++
Sbjct  526  TFICHLKPNFVENKSDLKGPSCGEIVTVPLHATVRDLKQTAEAALRDTYCIAERLIVTDI  585

Query  621  VGYAGVGDSTGLKLLLGSAEF-VRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDG  797
                 V D    +++ G  E  V++  R +G +  +  + + G ++W V C CGA+DDDG
Sbjct  586  KELMDVEDE---EVIFGQIESGVKLSVRGIGIDLCTPLKYQGGSDNWKVRCECGAQDDDG  642

Query  798  ERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            ERM+ACD C +WQHTRC GI D ++VP  FVC  C
Sbjct  643  ERMVACDICEVWQHTRCCGIDDSETVPPLFVCSGC  677



>ref|NP_001063319.2| Os09g0449000 [Oryza sativa Japonica Group]
 dbj|BAD37958.1| putative male sterility 1 protein [Oryza sativa Japonica Group]
 gb|EAZ44935.1| hypothetical protein OsJ_29577 [Oryza sativa Japonica Group]
 dbj|BAF25233.2| Os09g0449000 [Oryza sativa Japonica Group]
 gb|ADD91695.1| PHD domain protein [Oryza sativa Japonica Group]
Length=679

 Score =   113 bits (283),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 118/236 (50%), Gaps = 33/236 (14%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L+RDL +LY  +L   + A  L       I  +   ++D K F+K+Y   +   + N   
Sbjct  442  LMRDLVHLYRHVLKEPSQA--LTGGAFGAIPVAVRMVLDIKHFVKDYHEGQAAASSNGGG  499

Query  444  ------IQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRF  605
                  I L C L +++ S   +  PP E + L ++AT+ +LK EA R F ++YL  R F
Sbjct  500  GFGHPHINLCCTLLVSNGSPELA--PPYETVTLPAHATVGELKWEAQRVFSEMYLGLRSF  557

Query  606  QVEELVGYAGVGDSTGLKLL----LGSAEFVRVRGRSLGKNALSRFRMER----------  743
              + +VG     D  GL +L    +GSA  V V+G S+G+  ++    ER          
Sbjct  558  AADSVVGVGA--DQEGLPVLGLVDVGSA--VVVQG-SVGEQ-INGEDHERKEEAAAAAVC  611

Query  744  ---GLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
               G     VDC CGA DDDGERM  CD C  WQHTRCAGI D +  P  F+C RC
Sbjct  612  EGSGGGERVVDCACGAVDDDGERMACCDICEAWQHTRCAGIADTEDAPHVFLCSRC  667



>ref|XP_006352479.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Solanum 
tuberosum]
Length=333

 Score =   110 bits (274),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 86/159 (54%), Gaps = 2/159 (1%)
 Frame = +3

Query  501  PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE  680
            PP E++ +  ++TI DLK+    A +  Y +     + ++ G   + D   L  ++ S  
Sbjct  152  PPGEVVEVPLHSTIGDLKIAVESAMRGTYCIIDNLMITDIAGMEQLEDYEVLFGIVQSGS  211

Query  681  FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
             + VRG   G +  S  + E G ++WTV+C CGA+DDDGERM++CD C IWQHTRC GI 
Sbjct  212  ELWVRG--FGLDLDSELKNEGGSDNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGIE  269

Query  861  DLDSVPARFVCLRCSCVIGQAKTIGQMKDEFVGSAAYCV  977
            D + VP  FVC  C   +   +     +    G+AA  V
Sbjct  270  DSEVVPPLFVCEACCTSLAPPRAQNSFEFGHYGTAAALV  308



>emb|CDY50318.1| BnaCnng19010D [Brassica napus]
Length=625

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 78/220 (35%), Positives = 113/220 (51%), Gaps = 25/220 (11%)
 Frame = +3

Query  339  KKDVIIQS-----ATTLIDCKKFMKEY-------QPEKFVPALN-PRAIQLLCELDLTDY  479
            KKD +I++     A  ++D K F+KE+       +  +FV  +N P  I L         
Sbjct  375  KKDAVIEASVRSAAQVVLDSKHFVKEWPLWDNDDKIFRFVCRINNPSLIDL--------R  426

Query  480  SERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLK  659
            +E+ +  PP EL+ +S  AT+ DLK      F+D Y +   F+V E+       D + L 
Sbjct  427  TEQVTELPPGELVKVSLQATVFDLKQAIEETFRDTYCILTNFEVNEIDELKEDDDDSNLL  486

Query  660  L-LLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQ  836
               L S   + VRG   G +  S  + + G ++W V C C A+DDDGERM++CD C +WQ
Sbjct  487  FGKLESCSALTVRGG--GIDLESTLKFQGGSDTWMVKCVCRARDDDGERMISCDVCEVWQ  544

Query  837  HTRCAGIPDLDSVPARFVCLRCSCVIG-QAKTIGQMKDEF  953
            HTRC GI D D++P  +VC  C      Q K + Q K EF
Sbjct  545  HTRCCGIDDSDTLPPLYVCSSCCDEFAEQQKRVLQPKYEF  584



>ref|XP_003616245.1| PHD finger protein [Medicago truncatula]
Length=739

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 70/215 (33%), Positives = 113/215 (53%), Gaps = 22/215 (10%)
 Frame = +3

Query  273  DLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAI  446
            D+ YLY+ +L  +P + A  L V           T++DC+ F+KE++    +     + +
Sbjct  504  DVVYLYKNVLLGYPDSEAVELAV----------QTILDCRHFVKEWKLRDEME----QVL  549

Query  447  QLLCELDLTDYSERCSVNPPP--ELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEEL  620
              +C L       +  +  P   E++ +  +AT+ DLK  A  A +D Y +  R  V ++
Sbjct  550  TFICHLKPNFVENKSDLKGPSCGEIVTVPLHATVRDLKQTAEAALRDTYCIAERLIVTDI  609

Query  621  VGYAGVGDSTGLKLLLGSAEF-VRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDG  797
                 V D    +++ G  E  V++  R +G +  +  + + G ++W V C CGA+DDDG
Sbjct  610  KELMDVEDE---EVIFGQIESGVKLSVRGIGIDLCTPLKYQGGSDNWKVRCECGAQDDDG  666

Query  798  ERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            ERM+ACD C +WQHTRC GI D ++VP  FVC  C
Sbjct  667  ERMVACDICEVWQHTRCCGIDDSETVPPLFVCSGC  701



>gb|EAZ09313.1| hypothetical protein OsI_31586 [Oryza sativa Indica Group]
Length=683

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 85/236 (36%), Positives = 118/236 (50%), Gaps = 33/236 (14%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L+RDL +LY  +L   + A  L       I  +   ++D K F+K+Y   +   + N   
Sbjct  446  LMRDLVHLYRHVLKEPSQA--LTGGAFGAIPVAVRMVLDIKHFVKDYHEGQAAASSNGGG  503

Query  444  ------IQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRF  605
                  I L C L +++ S   +  PP E + L ++AT+ +LK EA R F ++YL  R F
Sbjct  504  GFGHPHINLCCTLLVSNGSPELA--PPYETVTLPAHATVGELKWEAQRVFSEMYLGLRSF  561

Query  606  QVEELVGYAGVGDSTGLKLL----LGSAEFVRVRGRSLGKNALSRFRMER----------  743
              + +VG     D  GL +L    +GSA  V V+G S+G+  ++    ER          
Sbjct  562  AADSVVGVGA--DQEGLPVLGLVDVGSA--VVVQG-SVGEQ-INGEDHERKEEAAAAAVC  615

Query  744  ---GLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
               G     VDC CGA DDDGERM  CD C  WQHTRCAGI D +  P  F+C RC
Sbjct  616  EGSGGGERVVDCACGAVDDDGERMACCDICEAWQHTRCAGIADTEDAPHVFLCSRC  671



>gb|KDP38152.1| hypothetical protein JCGZ_04795 [Jatropha curcas]
Length=668

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 121/236 (51%), Gaps = 28/236 (12%)
 Frame = +3

Query  225  NNYMRPNLPSDEHLLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
            NN + P    D  + +DL YLY+ +L  +P+  A  +          +A  ++D K F+K
Sbjct  431  NNTLAPQPGLD--VYKDLLYLYKNVLMGYPEYHAVSI----------AAKVILDSKHFVK  478

Query  399  EYQPEKFVPALNPRAIQLLCELDLTDYSERCSVN------PPPELLVLSSNATISDLKVE  560
            E Q   F  +     ++L+C++    Y E   VN      PP E++      T+ +LK+ 
Sbjct  479  ERQ---FKSSNEDMLLRLICQVR-PSYDEL--VNDLTRPLPPGEIVTAQERTTVCELKMI  532

Query  561  ASRAFQDVYLMFRRFQVEEL-VGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRM  737
               A +D Y +   F V+++ +G     +   L +  G  + ++V  R  G +  ++ R 
Sbjct  533  VQYALRDTYCIMENFVVKDIQIGELVTKEDQDL-VKCGVEQGMQVWVRGHGLDLGTKMRY  591

Query  738  ERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            + G   WTVDC CGAKDDDGERM+ACD C +WQHTRC  I D D+ P+ F C  CS
Sbjct  592  QGGDNDWTVDCRCGAKDDDGERMVACDVCHVWQHTRCNNIKDGDAPPSLFQCRLCS  647



>gb|KDO40585.1| hypothetical protein CISIN_1g040083mg, partial [Citrus sinensis]
Length=635

 Score =   113 bits (282),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/229 (33%), Positives = 118/229 (52%), Gaps = 18/229 (8%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKE---YQPEKFV  422
            S   L++D++ LY+ +LH Q  A    +     I  ++  ++D K F+KE    Q     
Sbjct  402  SVAQLMKDVRILYKLILHDQKPATSSGIFSG--ISVASRIILDTKYFVKECCRDQVCSTK  459

Query  423  PALNPRA-IQLLCELDLTDY-----SERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
            P L+    ++L C + L D          S   P E + + +NAT  +LK+E  R F+++
Sbjct  460  PGLDLEGKLKLYCTVILRDGENPNGGRSNSAMQPYECVTIKNNATFDELKLEVQRNFREL  519

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVR---VRGRSLGKNALSRFRMERGLES  755
            Y   R F +E +V      ++TG  L+ G  E  R     G +  +  +     E G+ +
Sbjct  520  YWGLRSFVIESIVNV----NATGTDLVCGFVEVGRRIVFEGSNSERGIVYGQIYENGMVN  575

Query  756  WTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              V+C CGA +DDGERM++CD C +WQHTRCA IP+ + +P  F+C RC
Sbjct  576  CVVECACGADEDDGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRC  624



>ref|XP_005646272.1| hypothetical protein COCSUDRAFT_47922 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21728.1| hypothetical protein COCSUDRAFT_47922 [Coccomyxa subellipsoidea 
C-169]
Length=1167

 Score =   113 bits (283),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 79/142 (56%), Gaps = 4/142 (3%)
 Frame = +3

Query  483  ERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKL  662
            +R    PPPELL+LS  ATI  L+   + A +D Y MF   +VE + G   VGD    +L
Sbjct  785  KRAMAGPPPELLLLSRKATIPQLRKAVAAALRDTYRMFNHIEVEGVEGLE-VGDQQRGRL  843

Query  663  -LLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQH  839
             ++     V V G  +  + L  +R   G+E W V C CG +DDDGERM+ACD C  W H
Sbjct  844  AVVADGTQVTVHGSGIDVDPL--WRHAGGVEEWQVACSCGTRDDDGERMIACDGCCEWSH  901

Query  840  TRCAGIPDLDSVPARFVCLRCS  905
            TRCAG  D    P  F+C RC+
Sbjct  902  TRCAGFADALPSPDHFLCPRCA  923



>ref|XP_010511544.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Camelina 
sativa]
Length=705

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/217 (35%), Positives = 112/217 (52%), Gaps = 25/217 (12%)
 Frame = +3

Query  339  KKDVIIQSAT-TLIDCKKFMKEYQPE-------KFVPALNPRAIQLLCELDLTDYSERCS  494
            + +++++SAT  ++D K F+KE+          +FV  +NP  I L         SE+ +
Sbjct  475  ESELLVRSATQAILDSKHFVKEWPIWDNSETVLQFVCRINPSLIGL--------RSEQMT  526

Query  495  VNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGS  674
              PP EL+ +   AT+ DLK      F+D Y +   F V E      + + T    L  S
Sbjct  527  ELPPGELVTVPLQATVFDLKQAIEETFRDTYCILANFVVSE------IEEVTEDMSLTES  580

Query  675  AEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAG  854
               + VRG   G +  S+ + + G ++W V C C A+DDDGERM++CD C +WQHTRC G
Sbjct  581  CSALTVRG--YGIDLESKLKCQGGCDTWMVRCICRARDDDGERMISCDVCEVWQHTRCCG  638

Query  855  IPDLDSVPARFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
            I D D++P  FVC   C     Q + + Q K EF  S
Sbjct  639  IDDSDTLPPLFVCSNCCEEFAEQQRKVLQPKYEFPSS  675



>ref|XP_006421081.1| hypothetical protein CICLE_v10007029mg, partial [Citrus clementina]
 gb|ESR34321.1| hypothetical protein CICLE_v10007029mg, partial [Citrus clementina]
Length=660

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 75/236 (32%), Positives = 119/236 (50%), Gaps = 27/236 (11%)
 Frame = +3

Query  246  LPSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------  404
            L +   +  ++ YLY  +L        L+  + +++  +   ++D K F+KE+       
Sbjct  440  LETGSDVYSEVVYLYMNVL--------LNYPESELVALATQAVLDSKHFVKEWPFRDEDD  491

Query  405  QPEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
            Q  +F   + P  +    E DLT         PP EL+++  ++T+ +LK  A  A +D 
Sbjct  492  QFLRFKCQVMPSFVD--SETDLT------GKLPPGELVMIPLHSTVLELKEAAESALRDT  543

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF-VRVRGRSLGKNALSRFRMERGLESWT  761
            Y +     V ++     + D    +LL G+ E   +V  +  G ++ S+ R E G + W 
Sbjct  544  YCIMENLVVTDVGNMQKLDDG---ELLFGAVESGSQVWIQGYGIDSDSKLRYEGGNDKWI  600

Query  762  VDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKT  929
            V C CGA+DDDGERM+ACD C +WQHTRC GI D  +VP  FVC RC      ++T
Sbjct  601  VKCECGAQDDDGERMVACDICEVWQHTRCLGIEDSGTVPPLFVCPRCCSSFAPSRT  656



>ref|XP_006448066.1| hypothetical protein CICLE_v10017892mg, partial [Citrus clementina]
 gb|ESR61306.1| hypothetical protein CICLE_v10017892mg, partial [Citrus clementina]
Length=644

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 118/229 (52%), Gaps = 18/229 (8%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKE---YQPEKFV  422
            S   L++D++ LY+ +LH Q  A    +     I  ++  ++D K F+KE    Q     
Sbjct  411  SVAQLMKDVRILYKLILHDQKPATSSGIFSG--ISVASRIILDTKYFVKECCRDQVCSTK  468

Query  423  PALNPRA-IQLLCELDLTDY-----SERCSVNPPPELLVLSSNATISDLKVEASRAFQDV  584
            P L+    ++L C + L D          S   P E + + +NAT  +LK+E  R F+++
Sbjct  469  PGLDLEGKLKLYCTVTLRDGENPNGGRNNSAMQPYECVTIKNNATFDELKLEVQRNFREL  528

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVR---VRGRSLGKNALSRFRMERGLES  755
            Y   + F +E +V      ++TG  L+ G  E  R     G +  +  +     E G+ +
Sbjct  529  YWGLKSFVIESIVNV----NATGTDLVCGFVEVGRRIVFEGSNSERGIVYGQIYENGMVN  584

Query  756  WTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              V+C CGA +DDGERM++CD C +WQHTRCA IP+ + +P  F+C RC
Sbjct  585  CVVECACGADEDDGERMVSCDICEVWQHTRCARIPNNEEIPHIFLCNRC  633



>ref|XP_002263205.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Vitis vinifera]
 emb|CAN73422.1| hypothetical protein VITISV_032904 [Vitis vinifera]
 emb|CBI33452.3| unnamed protein product [Vitis vinifera]
Length=683

 Score =   112 bits (281),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/226 (32%), Positives = 114/226 (50%), Gaps = 26/226 (12%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------QPEKFVPAL  431
            D+ YLY  +L        L+    +++  +   ++D K F+KE+       Q  +FV  +
Sbjct  455  DVIYLYRNVL--------LNYPDSELVELATRAVLDSKHFVKEWPFSDEDDQLLRFVCHM  506

Query  432  NPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
             P     L EL++          PP E +V+   AT+ +LK    R  +D Y +  +  V
Sbjct  507  MPS----LSELEIFTREL-----PPGEFIVVPPYATVGELKETVERTLRDTYCIMEQVVV  557

Query  612  EELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDD  791
             E+    G+ D   L   + S   V +RG   G +  +  + E G ++W V C CGA DD
Sbjct  558  TEIEDMEGMTDEEVLFGTIESGSEVWMRG--TGMDLEAELKYEGGSDNWRVSCECGALDD  615

Query  792  DGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKT  929
            DGERM+ACD C +WQHT C+GI D ++VP  FVC +C  ++  A++
Sbjct  616  DGERMVACDICEVWQHTVCSGIDDSETVPPLFVCPKCCALLVPARS  661



>gb|KGN55704.1| hypothetical protein Csa_3G006660 [Cucumis sativus]
Length=664

 Score =   112 bits (280),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/187 (35%), Positives = 98/187 (52%), Gaps = 4/187 (2%)
 Frame = +3

Query  372  LIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLT--DYSERCSVNPPPELLVLSSNATIS  545
            ++D K F KE+  +     L    I+L+  L  T  D   +    P  E++VL  + TI 
Sbjct  479  VLDSKHFAKEWPLQDEEEHLLTFIIKLMPRLTFTHTDLELKSDFMPSGEVVVLPLHTTIG  538

Query  546  DLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALS  725
            ++K  A +A +D Y +  +F+V  +       D   +   + S   + V+G  +G +  +
Sbjct  539  EVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAVESGAELFVKG--MGIDLDT  596

Query  726  RFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
              + + G+ +W V C CG  DDDGERM+ACD C IWQHTRC GI D D+VP  FVC  C 
Sbjct  597  PLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCGIDDADNVPLLFVCAACC  656

Query  906  CVIGQAK  926
              +GQ K
Sbjct  657  DSLGQLK  663



>emb|CDY16433.1| BnaA02g12370D [Brassica napus]
Length=626

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 79/222 (36%), Positives = 113/222 (51%), Gaps = 28/222 (13%)
 Frame = +3

Query  339  KKDVIIQS-----ATTLIDCKKFMKEY-------QPEKFVPALN-PRAIQLLCELDLTDY  479
            KKD +I++     A  ++D K F+KE+       +  +FV  +N P  I L         
Sbjct  375  KKDAVIEASVRSAAQVVLDSKHFVKEWPLWDNDDKIFRFVCRINNPSLIDL--------R  426

Query  480  SERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLK  659
            +E+ +  PP EL+ +S  AT+ DLK      F+D Y +   F+V E+       D     
Sbjct  427  TEQVTELPPGELVTVSLQATVFDLKQAIEETFRDTYCILTNFEVNEIDELKEDDDDDS-N  485

Query  660  LLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGI  830
            LL G  E    + VRG   G +  S  + + G ++W V C C A+DDDGERM++CD C +
Sbjct  486  LLFGKLEPCSALTVRGD--GIDLESTLKFQGGSDTWMVKCVCRARDDDGERMISCDVCEV  543

Query  831  WQHTRCAGIPDLDSVPARFVCLRCSCVIG-QAKTIGQMKDEF  953
            WQHTRC GI D D++P  +VC  C      Q K + Q K EF
Sbjct  544  WQHTRCCGIDDSDTLPPLYVCSSCCDEFAEQQKRVLQPKYEF  585



>ref|XP_011024453.1| PREDICTED: PHD finger protein At2g01810 [Populus euphratica]
Length=661

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 123/259 (47%), Gaps = 33/259 (13%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECML--HPQTMANHLH  332
            V+ +Q  +  G +   + +  D   + P L  +    +DL +LY  +L  +P + +    
Sbjct  418  VISLQDVVHEGKSEKKMESQADILALEPGLDVN----KDLHFLYNYVLLGYPDSHS----  469

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQPEK---------FVPALNPRAIQLLCELDLTDYSE  485
                  +  +   ++D K F K++Q +           V  L P   +L+ EL       
Sbjct  470  ------VTLAIRAILDSKHFAKQWQFKGNNDQDSFLGLVLRLRPSYNELVKEL-------  516

Query  486  RCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLL  665
                 PP ELLV+   AT+ +LK+      +D Y +  +F V+++             ++
Sbjct  517  -TRPLPPGELLVVPEYATVDELKLMVQCLLRDTYYVMDKFVVKDIQIGKIEEKEYQDGVM  575

Query  666  LGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTR  845
                + V+V  R  G +  ++ R + G + WTVDC CGAKDDDGERM+ACD C +WQHTR
Sbjct  576  CEVEQGVQVWVRGCGLDLDTKLRYQGGADDWTVDCRCGAKDDDGERMVACDVCHVWQHTR  635

Query  846  CAGIPDLDSVPARFVCLRC  902
            C  I D ++ P  FVC RC
Sbjct  636  CNSIKDNEAAPRMFVCCRC  654



>ref|XP_010415158.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Camelina 
sativa]
Length=706

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 76/213 (36%), Positives = 109/213 (51%), Gaps = 25/213 (12%)
 Frame = +3

Query  351  IIQSAT-TLIDCKKFMKEYQPE-------KFVPALNPRAIQLLCELDLTDYSERCSVNPP  506
            +++SAT  ++D K F+KE+          +FV  +NP  I L         SE+ +  PP
Sbjct  480  LVRSATQAILDSKHFVKEWPIWDNSETVLQFVCRINPSLIGL--------RSEQMTELPP  531

Query  507  PELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFV  686
             EL+ +   AT+ DLK      F+D Y +   F V E      + + T    L  S   +
Sbjct  532  GELVTVPLQATVFDLKQAIEETFRDTYCILANFVVSE------IEEVTEDMSLTESCSAL  585

Query  687  RVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDL  866
             VRG   G +  S+ + + G ++W V C C A+DDDGERM++CD C +WQHTRC GI D 
Sbjct  586  TVRG--YGIDLESKLKCQGGCDTWMVRCICKARDDDGERMISCDVCEVWQHTRCCGIDDS  643

Query  867  DSVPARFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
            D++P  FVC   C     Q + + Q K EF  S
Sbjct  644  DTLPPLFVCSNCCEEFAEQQRKVLQPKYEFPSS  676



>ref|XP_007141934.1| hypothetical protein PHAVU_008G238400g [Phaseolus vulgaris]
 gb|ESW13928.1| hypothetical protein PHAVU_008G238400g [Phaseolus vulgaris]
Length=702

 Score =   112 bits (279),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/188 (36%), Positives = 102/188 (54%), Gaps = 10/188 (5%)
 Frame = +3

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL--DLTDYSERCSVNPPPELL  518
            D+ IQ   T++D + F+KE+     V     + +  +C L  +  D        P  E++
Sbjct  486  DLAIQ---TILDSRYFVKEWAERDEV---EEQLLTFICRLQPNFVDKKYELKGLPCGEVV  539

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            V+  +AT+ DLK  +  A +D Y +  R  V ++    GV D   L  L+ S   + VRG
Sbjct  540  VVPLHATVGDLKRASEAALRDTYCIAERLIVTDIKQLMGVSDEEVLFGLIQSGVELCVRG  599

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
             ++  +  +  + + G ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D ++VP
Sbjct  600  IAI--DLCTNLKYQGGSDNWKVRCECGAQDDDGERMVACDICEVWQHTRCCGIDDSETVP  657

Query  879  ARFVCLRC  902
              FVC  C
Sbjct  658  PLFVCTGC  665



>ref|XP_006302059.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
 gb|EOA34957.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
Length=540

 Score =   110 bits (276),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 110/208 (53%), Gaps = 17/208 (8%)
 Frame = +3

Query  354  IQSAT-TLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD--LTDY-SERCSVNPPPELLV  521
            ++SAT  ++D K F+KE+     +   N   +Q +C ++  L D+ SE+ +  PP EL+ 
Sbjct  314  VRSATQAILDSKFFIKEWS----IWDNNETVLQYVCRINPSLLDFRSEQATELPPGELVT  369

Query  522  LSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR  701
            +   AT+ DLK      F+D Y +   F V E+     + +  GL     S   + VRG 
Sbjct  370  VPIQATVFDLKRAIEETFRDTYCILENFVVSEI---EEIKEGMGLT---ESCSALTVRGH  423

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              G +  S  + + G ++W V C C A+DDDGERM++CD C +WQHTRC  I D D++P 
Sbjct  424  --GIDLESNLKCQGGCDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCCEIDDSDTLPP  481

Query  882  RFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
             FVC   C     Q + + Q K EF  S
Sbjct  482  LFVCSNCCEEFAEQQRKLLQPKYEFPSS  509



>ref|XP_002311539.2| PHD finger family protein [Populus trichocarpa]
 gb|EEE88906.2| PHD finger family protein [Populus trichocarpa]
Length=662

 Score =   111 bits (278),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 79/261 (30%), Positives = 125/261 (48%), Gaps = 36/261 (14%)
 Frame = +3

Query  159  VMCVQCRLEPGSATVNVNTAGDNNYMRPNLPSDEHLLRDLKYLYECML--HPQTMANHLH  332
            V+ +Q  +  G +   + +  D   + P L  +    +DL +LY  +L  +P + +    
Sbjct  418  VISLQDVVHEGKSEKKMESHADIPALEPGLDVN----KDLHFLYNYVLLGYPDSHS----  469

Query  333  VCKKDVIIQSATTLIDCKKFMKEYQPEK----------FVPALNPRAIQLLCELDLTDYS  482
                  +  +   ++D K F K++Q +            V  L P   +L+ EL      
Sbjct  470  ------VTLAIRAILDSKHFAKQWQFKGNNDHEDSFLGLVLRLRPSYNELVKEL------  517

Query  483  ERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKL  662
                  PP ELLV+   AT+ +LK+    A +D Y +  +F V++ V    + +      
Sbjct  518  --TRPLPPGELLVVPQYATVDELKLMVQCALRDTYYVMDKFAVKD-VQIGKIEEKEYQDG  574

Query  663  LLGSAE-FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQH  839
            ++   E  V+V  R  G +  ++ R + G + WTVDC CGAKDDDGERM+ACD C +WQH
Sbjct  575  VMCEVEQGVQVWVRGCGLDLDTKLRYQGGADDWTVDCGCGAKDDDGERMVACDVCHVWQH  634

Query  840  TRCAGIPDLDSVPARFVCLRC  902
             RC  I D ++ P  FVC RC
Sbjct  635  RRCNSIKDNEAAPRMFVCCRC  655



>ref|XP_007040228.1| RING/FYVE/PHD zinc finger superfamily protein [Theobroma cacao]
 gb|EOY24729.1| RING/FYVE/PHD zinc finger superfamily protein [Theobroma cacao]
Length=659

 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 79/241 (33%), Positives = 125/241 (52%), Gaps = 21/241 (9%)
 Frame = +3

Query  222  DNNYMRPNLP-SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMK  398
            +N+ ++P    +   L++D+ +L++ +L  Q     L       I  +A  ++D K   K
Sbjct  415  NNSKVKPRCKITKAQLMKDISFLFKHILKEQKPT--LSTGIFSSIPMAARIILDTKFLAK  472

Query  399  EYQPE---KFVPALNPRAIQLLCELDLTDYSE--RCSVNP--PPELLVLSSNATISDLKV  557
            EY  E   K   +LN +  +L C + L +  E       P  P E + L   ATI+DLK+
Sbjct  473  EYSEELSMKVKSSLNGK-FKLFCTVILRNDEEIDEGLKKPMLPCECVTLQETATINDLKL  531

Query  558  EASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRGRSLGKNALSR  728
            E  + F+ VY   R F VE +V      ++ G  L+LGS E    + V G +  +  +  
Sbjct  532  EVEKNFRQVYWRLRSFVVETIVNL----NAKGSDLVLGSVEMGQTIVVVGSNDDQTGMIM  587

Query  729  FRM---ERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLR  899
              +   E GL S  V+C CGA++DDGER+++CD C +WQHTRC  IP+ + +P  F+C +
Sbjct  588  NEVMMCEWGLNSRIVECPCGAREDDGERLISCDICEVWQHTRCVRIPNNEEIPHVFLCKQ  647

Query  900  C  902
            C
Sbjct  648  C  648



>ref|XP_006352418.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Solanum 
tuberosum]
Length=685

 Score =   111 bits (277),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 86/159 (54%), Gaps = 2/159 (1%)
 Frame = +3

Query  501  PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE  680
            PP E++ +  ++TI DLK+    A +D Y +     + ++ G   + D   L  ++ S  
Sbjct  517  PPGEVVEVPLHSTIGDLKIAVESAMRDTYCIMDNLMITDIAGMEQLEDYEVLFGIVQSGS  576

Query  681  FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
             + VRG   G +  S  + E G ++WTV+C CGA+DDDGERM++CD C IWQHTRC G  
Sbjct  577  ELWVRG--FGLDLDSELKNEGGSDNWTVNCRCGARDDDGERMVSCDICEIWQHTRCCGFE  634

Query  861  DLDSVPARFVCLRCSCVIGQAKTIGQMKDEFVGSAAYCV  977
            D + VP  FVC  C   +   +     +    G+AA  V
Sbjct  635  DSEVVPPLFVCEACCTSLAPPRAQNSFEFAHYGTAAALV  673



>gb|KFK41037.1| hypothetical protein AALP_AA2G077200 [Arabis alpina]
Length=675

 Score =   111 bits (277),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 85/155 (55%), Gaps = 6/155 (4%)
 Frame = +3

Query  501  PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE  680
            PP E++ +S  AT+ DLK      F+D Y +   F+V E+       +    KL+ G  E
Sbjct  491  PPGEIVTVSVQATVFDLKQAIEETFRDTYCILTNFEVNEIDELREDMEDGDRKLVFGRIE  550

Query  681  ---FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCA  851
                + VRG  +G    S+ + + G ++W V C C A+DDDGERM+ACD C +WQHTRC 
Sbjct  551  SGCAITVRG--IGIELESKLKFQGGCDTWMVKCVCRARDDDGERMVACDVCEVWQHTRCC  608

Query  852  GIPDLDSVPARFVCLR-CSCVIGQAKTIGQMKDEF  953
            GI D D++P  FVC   C     Q + + Q K EF
Sbjct  609  GIEDSDTLPPLFVCSNCCDEFAEQQRKVLQPKYEF  643



>ref|XP_008448613.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Cucumis 
melo]
Length=664

 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 101/192 (53%), Gaps = 14/192 (7%)
 Frame = +3

Query  372  LIDCKKFMKEY--QPEK-----FVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSS  530
            ++D K F KE+  Q E+     F+  L PR      +L+L     +    P  E++VL  
Sbjct  479  VLDSKHFAKEWPLQDEEEHQLTFIIKLMPRLTFTHTDLEL-----KSDFLPSGEVVVLPL  533

Query  531  NATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLG  710
            + TI ++K  A +A +D Y +  +F+V  +       D   +   + S   + V+G  +G
Sbjct  534  HTTIGEVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAVESGAELFVKG--MG  591

Query  711  KNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFV  890
             +  +  + + G+ +W V C CG  DDDGERM+ACD C IWQHTRC GI D D+VP  FV
Sbjct  592  IDLDTPLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCGIDDADNVPLLFV  651

Query  891  CLRCSCVIGQAK  926
            C  C   +GQ K
Sbjct  652  CAACCDSLGQLK  663



>ref|XP_008353887.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Malus 
domestica]
Length=648

 Score =   110 bits (276),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 107/212 (50%), Gaps = 18/212 (8%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLYE +L        L   + + ++ +   L+  K F+KE            +++ +
Sbjct  442  DVLYLYEHVL--------LEYPESEQMVLATQRLLGAKHFVKECSHRDD----EEQSLTI  489

Query  453  LCELDLTDYSERCSVN-PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGY  629
             C+L LTD         PP E++VL  +AT+ +LK  A  A +D Y +  RF+V  + G 
Sbjct  490  FCQL-LTDMEFVFKRELPPGEVVVLPLHATVRELKRAAESALRDTYFITERFEVMAIEGL  548

Query  630  AGVGDSTGLKLLLGSAEFVRVRGRSLGKNAL-SRFRMERGLESWTVDCHCGAKDDDGERM  806
              + D    + L G AE   V G       L +  R E G + W V C CGA DDDGERM
Sbjct  549  XEMEDX---EPLFGVAESGVVVGVRGSGIDLDTPLRYEGGSDIWIVSCDCGATDDDGERM  605

Query  807  LACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +ACD C +WQHTRC GI D D+VP  F C  C
Sbjct  606  VACDLCEVWQHTRCRGIEDADTVPPVFFCSAC  637



>ref|XP_006302058.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
 gb|EOA34956.1| hypothetical protein CARUB_v10020044mg [Capsella rubella]
Length=584

 Score =   110 bits (275),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 74/208 (36%), Positives = 110/208 (53%), Gaps = 17/208 (8%)
 Frame = +3

Query  354  IQSAT-TLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD--LTDY-SERCSVNPPPELLV  521
            ++SAT  ++D K F+KE+     +   N   +Q +C ++  L D+ SE+ +  PP EL+ 
Sbjct  358  VRSATQAILDSKFFIKEWS----IWDNNETVLQYVCRINPSLLDFRSEQATELPPGELVT  413

Query  522  LSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGR  701
            +   AT+ DLK      F+D Y +   F V E+     + +  GL     S   + VRG 
Sbjct  414  VPIQATVFDLKRAIEETFRDTYCILENFVVSEI---EEIKEGMGLT---ESCSALTVRGH  467

Query  702  SLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPA  881
              G +  S  + + G ++W V C C A+DDDGERM++CD C +WQHTRC  I D D++P 
Sbjct  468  --GIDLESNLKCQGGCDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCCEIDDSDTLPP  525

Query  882  RFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
             FVC   C     Q + + Q K EF  S
Sbjct  526  LFVCSNCCEEFAEQQRKLLQPKYEFPSS  553



>ref|XP_008343055.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Malus 
domestica]
Length=654

 Score =   110 bits (276),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 77/212 (36%), Positives = 107/212 (50%), Gaps = 18/212 (8%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            D+ YLYE +L        L   + + ++ +   L+  K F+KE            +++ +
Sbjct  448  DVLYLYEHVL--------LEYPESEQMVLATQRLLGAKHFVKECSHRDD----EEQSLTI  495

Query  453  LCELDLTDYSERCSVN-PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGY  629
             C+L LTD         PP E++VL  +AT+ +LK  A  A +D Y +  RF+V  + G 
Sbjct  496  FCQL-LTDMEFVFKRELPPGEVVVLPLHATVRELKRAAESALRDTYFITERFEVMAIEGL  554

Query  630  AGVGDSTGLKLLLGSAEFVRVRGRSLGKNAL-SRFRMERGLESWTVDCHCGAKDDDGERM  806
              + D    + L G AE   V G       L +  R E G + W V C CGA DDDGERM
Sbjct  555  XEMEDX---EPLFGVAESGVVVGVRGSGIDLDTPLRYEGGSDIWIVSCDCGATDDDGERM  611

Query  807  LACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +ACD C +WQHTRC GI D D+VP  F C  C
Sbjct  612  VACDLCEVWQHTRCRGIEDADTVPPVFFCSAC  643



>ref|XP_009127470.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Brassica 
rapa]
Length=720

 Score =   110 bits (274),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 73/213 (34%), Positives = 111/213 (52%), Gaps = 15/213 (7%)
 Frame = +3

Query  339  KKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD---LTDY-SERCSVNPP  506
            K + +  +A  ++D K F+KE+     +   + +  + +C ++   L D  +E+ +  PP
Sbjct  474  KSESVRSAAQVVLDSKHFVKEWP----LRDNDDKIFRFVCRINNPSLIDLRTEQVTELPP  529

Query  507  PELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAE--  680
             EL+ +S  AT+ DLK      F+D Y +   F+V E+       D     LL G  E  
Sbjct  530  GELVTVSLQATVFDLKQAIEETFRDTYCILTNFEVNEIDELKEDDDDDS-NLLFGKLEPC  588

Query  681  -FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGI  857
              + VRG   G +  S  + + G ++W V C C A+DDDGERM++CD C +WQHTRC GI
Sbjct  589  SALTVRGD--GIDLESTLKFQGGSDTWMVKCVCRARDDDGERMISCDVCEVWQHTRCCGI  646

Query  858  PDLDSVPARFVCLR-CSCVIGQAKTIGQMKDEF  953
             D D++P  +VC   C     Q K + Q K EF
Sbjct  647  DDSDTLPPLYVCSSCCDEFAEQQKRVLQPKYEF  679



>ref|XP_008348744.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Malus domestica]
Length=701

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 115/234 (49%), Gaps = 27/234 (12%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY----QPEKFVPAL  431
            L++D+ Y+Y+ +L  Q M+N         I  +   +++ K  +K+Y     P K     
Sbjct  455  LMKDMFYMYKYILKDQKMSN---AGIFSAIPMAVRIILNSKYLVKDYCGEVVPMKVEYLS  511

Query  432  NPRAIQLLCELDLTDYSE----------RCSVNP----PPELLVLSSNATISDLKVEASR  569
                  + C + L + S+          R + N     P E + L +NAT  DLK E  R
Sbjct  512  MDGESNIYCTITLKNNSKEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVER  571

Query  570  AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRGRSLGKNALSRFRME  740
             F+++Y   R F V+ +   A + ++ G  L+ G  E    + + GRS  K    R   E
Sbjct  572  NFKEIYWGLRGFVVDSI---ANLNNAKGTDLVFGMVEVGQKIVLEGRSSKKMGGVREMYE  628

Query  741  RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             G  ++ VDC CGAK+DDGERM++CD C + QHT C  IPD + VP  F+C RC
Sbjct  629  CGAVNYVVDCPCGAKEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  682



>ref|XP_008381804.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Malus domestica]
Length=692

 Score =   109 bits (273),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/234 (32%), Positives = 115/234 (49%), Gaps = 27/234 (12%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY----QPEKFVPAL  431
            L++D+ Y+Y+ +L  Q M+N         I  +   +++ K  +K+Y     P K     
Sbjct  455  LMKDMFYMYKYILKDQKMSN---AGIFSAIPMAVRIILNSKYLVKDYCGEVVPMKVEYLS  511

Query  432  NPRAIQLLCELDLTDYSE----------RCSVNP----PPELLVLSSNATISDLKVEASR  569
                  + C + L + S+          R + N     P E + L +NAT  DLK E  R
Sbjct  512  MDGESNIYCTITLKNNSKEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVER  571

Query  570  AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRGRSLGKNALSRFRME  740
             F+++Y   R F V+ +   A + ++ G  L+ G  E    + + GRS  K    R   E
Sbjct  572  NFKEIYWGLRGFVVDSI---ANLNNAKGTDLVFGMVEVGQKIVLEGRSSKKMGGVREMYE  628

Query  741  RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             G  ++ VDC CGAK+DDGERM++CD C + QHT C  IPD + VP  F+C RC
Sbjct  629  CGAVNYVVDCPCGAKEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  682



>ref|XP_008777846.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Phoenix 
dactylifera]
Length=651

 Score =   109 bits (272),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/213 (33%), Positives = 108/213 (51%), Gaps = 27/213 (13%)
 Frame = +3

Query  306  PQTMANHLHVCKKDVII---QSATTLIDCKKFMKEYQPE-------KFVPALNPRAIQLL  455
            P+ +   L V  + V+    ++A T++DCK ++K +          +F     PR  ++ 
Sbjct  440  PKQVERDLQVIYRSVVAGRAEAARTVLDCKHWVKAWGLRDDADDRLRFFAMWQPREEEMG  499

Query  456  CELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAG  635
                LT       V       V+ ++A++ +L+ EA RA +D Y +   F+   + G  G
Sbjct  500  A---LTRPPPPPEVV------VVEAHASVGELRAEAERALRDSYYVLEGFRAAAVEGIQG  550

Query  636  VGDSTGLKLLLGSAE---FVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERM  806
                    +LLG AE    V +RG   G +   + R E G ++W+V C CGA+DDDGERM
Sbjct  551  ---EEWDPVLLGGAESGSVVWIRGE--GADMGCKLRYEGGADTWSVGCSCGARDDDGERM  605

Query  807  LACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            +ACD C +W HTRC GI D + VP  F+C RC 
Sbjct  606  VACDVCDVWHHTRCIGIADGEPVPPIFLCARCG  638



>ref|XP_004146114.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Cucumis 
sativus]
Length=671

 Score =   108 bits (271),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 66/189 (35%), Positives = 98/189 (52%), Gaps = 6/189 (3%)
 Frame = +3

Query  372  LIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLT--DYSERCSVNPPPELLVLSSNATIS  545
            ++D K F KE+  +     L    I+L+  L  T  D   +    P  E++VL  + TI 
Sbjct  479  VLDSKHFAKEWPLQDEEEHLLTFIIKLMPRLTFTHTDLELKSDFMPSGEVVVLPLHTTIG  538

Query  546  DLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALS  725
            ++K  A +A +D Y +  +F+V  +       D   +   + S   + V+G  +G +  +
Sbjct  539  EVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAVESGAELFVKG--MGIDLDT  596

Query  726  RFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC-  902
              + + G+ +W V C CG  DDDGERM+ACD C IWQHTRC GI D D+VP  FVC  C 
Sbjct  597  PLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCGIDDADNVPLLFVCAACC  656

Query  903  -SCVIGQAK  926
             S V  + K
Sbjct  657  DSLVFAKKK  665



>ref|XP_004164188.1| PREDICTED: LOW QUALITY PROTEIN: PHD finger protein MALE MEIOCYTE 
DEATH 1-like [Cucumis sativus]
Length=708

 Score =   108 bits (270),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 63/179 (35%), Positives = 94/179 (53%), Gaps = 4/179 (2%)
 Frame = +3

Query  372  LIDCKKFMKEYQPEKFVPALNPRAIQLLCELDLT--DYSERCSVNPPPELLVLSSNATIS  545
            ++D K F KE+  +     L    I+L+  L  T  D   +    P  E++VL  + TI 
Sbjct  479  VLDSKHFAKEWPLQDEEEHLLTFIIKLMPRLTFTHTDLELKSDFMPSGEVVVLPLHTTIG  538

Query  546  DLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALS  725
            ++K  A +A +D Y +  +F+V  +       D   +   + S   + V+G  +G +  +
Sbjct  539  EVKEAAEKALRDTYYVTEQFEVLAIENLENYEDREVIFGAVESGAELFVKG--MGIDLDT  596

Query  726  RFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              + + G+ +W V C CG  DDDGERM+ACD C IWQHTRC GI D D+VP  FVC  C
Sbjct  597  PLKYQGGVGTWKVRCECGTGDDDGERMVACDICEIWQHTRCCGIDDADNVPLLFVCAAC  655



>ref|XP_010271105.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Nelumbo nucifera]
Length=654

 Score =   107 bits (268),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 73/220 (33%), Positives = 107/220 (49%), Gaps = 11/220 (5%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L+ D+ YLY  +L+ Q     L       I  +   ++D K  +K Y  E   P+ N   
Sbjct  428  LMNDIAYLYRSILNEQRSV--LTSGIFTSIPLATRIILDSKGLIKNYGGE-VAPSDNVGV  484

Query  444  ---IQLLCELDLTDY----SERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
               +  LC   L +      E+    PP EL++L  +ATI +LK E  R F++ Y   R 
Sbjct  485  EGNLTFLCTALLKNKLDGEEEKIRTLPPYELIILPLDATIEELKKETERVFRETYWGLRS  544

Query  603  FQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGA  782
            F +E + G          +L+      V + GR + +        E G +   VDC CGA
Sbjct  545  FIIESISGVNAKESDMIFRLVELCCCLV-MEGRMVEEGIGIDDIYESGRDDCIVDCPCGA  603

Query  783  KDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            K+DDGERM++CD C +WQHTRC  IP+ + +P  F+C RC
Sbjct  604  KEDDGERMISCDICEVWQHTRCVRIPNGEDIPHIFLCSRC  643



>ref|XP_008220957.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Prunus mume]
Length=682

 Score =   107 bits (267),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 118/239 (49%), Gaps = 28/239 (12%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPAL  431
            S   L++D+ YLY+ +L  Q +++         I  +   +ID K  +K+Y     VP  
Sbjct  440  SKFQLMKDMFYLYKHILKDQKLSS---TGIFSAIPMAVRIIIDSKYLVKDYCGGGEVPME  496

Query  432  NPRAIQ----LLCELDLTD-----------YSERCSVN---PPPELLVLSSNATISDLKV  557
                +Q    + C + LT+           Y++  S N   PP E L L +NAT+ +LK 
Sbjct  497  VELGLQGKSNIYCTVMLTNTDQEELDHDQNYNKIISNNATLPPYECLTLKNNATVDELKK  556

Query  558  EASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLG---SAEFVRVRGRSLGKNALSR  728
            E  R F+++Y   R F VE +     + ++ G  ++ G   + + + V G +     L +
Sbjct  557  EVERNFREIYWGLRGFVVETI---GNLKNAKGTDMVFGLVEAGQKIVVEGSNKDTRGLVK  613

Query  729  FRM-ERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              M E G     VDC CGAK+DDGERM+ CD C + QHT C  IP+ + VP  F+C RC
Sbjct  614  QEMYECGRREHVVDCPCGAKEDDGERMVGCDICEVRQHTLCVRIPNNEQVPHIFLCNRC  672



>ref|XP_006851143.1| hypothetical protein AMTR_s00043p00048200 [Amborella trichopoda]
 gb|ERN12724.1| hypothetical protein AMTR_s00043p00048200 [Amborella trichopoda]
Length=301

 Score =   103 bits (257),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/220 (33%), Positives = 107/220 (49%), Gaps = 18/220 (8%)
 Frame = +3

Query  270  RDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQ  449
            RDL+Y+Y      +     L     +V+  +   ++D K   KE+        L      
Sbjct  82   RDLEYVYR-----RVREGGL---GGEVVEAARRMVLDTKHLAKEWPIRDDDGKLRFMVSV  133

Query  450  LLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGY  629
            ++ E +   +S      PPPEL+VL  +A++ DL+ +  R   D Y +   F  ++L+  
Sbjct  134  VVAEEEAGIFS---CATPPPELVVLPLHASVGDLRAKPERILCDTYCVMEGFVAQDLIWA  190

Query  630  AGVGDSTGLKLL-----LGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDD  794
             G+  S  ++LL     LG    V VRG+     A    R E G E   V+C CG +DDD
Sbjct  191  QGLKVSE-MELLFHMAQLGMGMGVWVRGKQAEWGAAC-LRYEGGAEERRVECTCGERDDD  248

Query  795  GERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVI  914
            GERM+ACD C +WQHT C GIPD++ V     C RC+  +
Sbjct  249  GERMVACDLCEVWQHTWCLGIPDVEEVAHLLFCDRCASAL  288



>ref|XP_007019293.1| RING/FYVE/PHD zinc finger superfamily protein, putative [Theobroma 
cacao]
 gb|EOY16518.1| RING/FYVE/PHD zinc finger superfamily protein, putative [Theobroma 
cacao]
Length=696

 Score =   107 bits (266),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 2/140 (1%)
 Frame = +3

Query  498  NPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSA  677
            +P  EL+ +  +AT+ DLK    +A +D Y +  +  V ++V    + D   L   L S 
Sbjct  521  SPAGELVTVPLHATVLDLKQAVEKALRDTYCIMDKLVVTDIVDLGEMDDRDVLFGALESG  580

Query  678  EFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGI  857
              + V G   G +  S  R E G ++W V C CGA+DDDGERM++CD C +WQHTRC GI
Sbjct  581  AKILVSGS--GIDLDSNLRHEGGADNWIVRCECGAQDDDGERMVSCDICEVWQHTRCCGI  638

Query  858  PDLDSVPARFVCLRCSCVIG  917
             D ++VP  FVC  C   +G
Sbjct  639  EDSEAVPPLFVCPGCCASLG  658



>ref|XP_004298641.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Fragaria 
vesca subsp. vesca]
Length=698

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 118/243 (49%), Gaps = 34/243 (14%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQP--EKFVPALNP  437
            L++D+ YLY+ +L  Q ++          I  +   ++  K  +K+Y     +    L P
Sbjct  450  LMKDMFYLYKYILKDQNLSTSATTGIFSAIPMAVRIILHSKYLVKDYSGGLPQVKLELGP  509

Query  438  RA-------IQLLCELDLTDYSERCSVN----PPPELLVLSSNATISDLKVEASRAFQDV  584
                     + +     + D+++  S N    PP E + L +NATI+DLK+E  R F+++
Sbjct  510  EGKSNIYCTVMIRNSTQVFDHNKMISSNEIALPPYECITLKNNATINDLKLEVERNFKEI  569

Query  585  YLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFR--------ME  740
            Y   + F VE +   + + ++ G   + G    V V G+ + + +    R        ++
Sbjct  570  YWGLKSFVVETIAN-SIMDNANGTDTVFG---LVEVGGKIVLEGSNKDMRGGGVGGVGLD  625

Query  741  RGLE---------SWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVC  893
            R LE         +  VDC CGAKDDDGERM+ CD C +WQHT C  IP+ + VP  F+C
Sbjct  626  RELEGPISECGSGNCIVDCPCGAKDDDGERMVCCDICEVWQHTLCVRIPNNEQVPHIFLC  685

Query  894  LRC  902
             RC
Sbjct  686  NRC  688



>ref|XP_009350911.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Pyrus x 
bretschneideri]
Length=691

 Score =   106 bits (265),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 74/234 (32%), Positives = 115/234 (49%), Gaps = 27/234 (12%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L++D+ Y+Y+ +L  Q M+N         I  +   +++ K  +K+Y  E     +   +
Sbjct  454  LMKDMFYMYKYVLKDQKMSN---AGIFSAIPMAVRIILNSKYLVKDYCSEVVPMKVEYLS  510

Query  444  I----QLLCELDLTDYSE----------RCSVNP----PPELLVLSSNATISDLKVEASR  569
            +     + C + L + SE          R + N     P E + L +NAT  DLK E  R
Sbjct  511  MDGESNIYCTISLKNNSEEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVER  570

Query  570  AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRGRSLGKNALSRFRME  740
             F+++Y   R F V+ +   A + ++ G  L+ G  E    + + GRS  +        E
Sbjct  571  NFKEIYWGLRGFVVDSI---ANLNNAKGKDLVFGMVEVGQKIVLEGRSSKRMGGVSEIYE  627

Query  741  RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             G   + VDC CGAK+DDGERM++CD C + QHT C  IPD + VP  F+C RC
Sbjct  628  CGAAYYVVDCPCGAKEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  681



>ref|XP_002888484.1| hypothetical protein ARALYDRAFT_894251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64743.1| hypothetical protein ARALYDRAFT_894251 [Arabidopsis lyrata subsp. 
lyrata]
Length=705

 Score =   106 bits (264),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 72/209 (34%), Positives = 109/209 (52%), Gaps = 16/209 (8%)
 Frame = +3

Query  351  IIQSAT-TLIDCKKFMKEYQPEKFVPALNPRAIQLLCELD--LTDY-SERCSVNPPPELL  518
            +++SAT  ++D K F+KE+         N + +Q +C ++  L D  SE+ +  PP +L+
Sbjct  478  LVRSATQAILDSKHFVKEW---PLWDDNNDKVLQFVCRINPSLIDLRSEQITELPPGDLV  534

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
             +   AT+ DLK      F+D Y +     V E+     V +   L     S   + V G
Sbjct  535  TVPLQATVFDLKQAIEDTFRDTYCILSNLVVSEI---EEVKEDMSLT---ESCSALTVTG  588

Query  699  RSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVP  878
               G +  S+ + + G ++W V C C A+DDDGERM++CD C +WQHTRC GI D D++P
Sbjct  589  H--GIDLESKLKCQGGCDTWMVKCICRARDDDGERMISCDVCEVWQHTRCCGIDDSDTLP  646

Query  879  ARFVCLR-CSCVIGQAKTIGQMKDEFVGS  962
              FVC   C     Q + + Q K EF  S
Sbjct  647  PLFVCSNCCEEFAEQQRKVLQPKYEFPSS  675



>ref|XP_007226344.1| hypothetical protein PRUPE_ppa022178mg [Prunus persica]
 gb|EMJ27543.1| hypothetical protein PRUPE_ppa022178mg [Prunus persica]
Length=691

 Score =   105 bits (263),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 119/239 (50%), Gaps = 30/239 (13%)
 Frame = +3

Query  252  SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY----QPEKF  419
            S   L++D+ YLY+ +L  Q ++  +       I  +   +ID K  +K+Y     P + 
Sbjct  451  SKFQLMKDMFYLYKHILKDQKLSTGIF----SAIPMAVRIIIDSKYLVKDYCCGEVPMEV  506

Query  420  VPALNPRAIQLLCELDLT-----------DYSERCSVN---PPPELLVLSSNATISDLKV  557
               L  ++  + C + LT           +Y++  S N   PP E L L +NAT+ +LK 
Sbjct  507  ELGLQGKS-NIYCTVVLTHPDDEEIDHDQNYNKIISNNATLPPYECLSLKNNATVDELKK  565

Query  558  EASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLG---SAEFVRVRGRSLGKNALSR  728
            E    F+++Y   R F VE +     + ++ G  ++ G   + + + V G +     L +
Sbjct  566  EVEWNFREIYWGLRGFVVEAI---GNLKNAKGTDMIFGLVEAGQKIVVEGSNKDMRGLVK  622

Query  729  FRM-ERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              M E G   + VDC CGAK+DDGERM+ CD C + QHT C  IP+ + VP  F+C RC
Sbjct  623  QEMYECGRREYVVDCPCGAKEDDGERMVGCDICEVRQHTLCVRIPNNEQVPNIFLCNRC  681



>ref|XP_003518728.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Glycine 
max]
 gb|KHN12208.1| PHD finger protein MALE STERILITY 1 [Glycine soja]
Length=656

 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/224 (32%), Positives = 115/224 (51%), Gaps = 16/224 (7%)
 Frame = +3

Query  264  LLRDLKYLYECML-HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY---QPEKFVPAL  431
            L++D+ YLY+ +L  P+ M     +     I  +A  ++D K F+K+Y    P +     
Sbjct  427  LMKDMLYLYKYILIDPKPMMGSEFL---SAIPLAARIILDTKYFIKDYFGDIPYQVELGS  483

Query  432  NPRAIQLLCELDL-----TDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMF  596
            N + + L C + L     +D     ++ PP E   L  NATI+DLK+E  R F+++Y   
Sbjct  484  NDK-LNLYCTIWLRNNVGSDEYLNKAIMPPHECFTLKRNATINDLKLEVERNFREIYWGL  542

Query  597  RRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRS--LGKNALSRFRMERGLESWTVDC  770
            R F VE     +   ++  +  L+     V + G    +G N + +   E    +  +DC
Sbjct  543  RSFVVESFRNLSVNNETEMVFGLIEVGGKVVLEGWQGDIGINMIEQI-CESDPNNGIMDC  601

Query  771  HCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             CG  +DDGERM++CD C IWQH+RC  IP+ + +P  F+C +C
Sbjct  602  TCGTIEDDGERMVSCDICEIWQHSRCVRIPNDEEIPHIFLCKKC  645



>ref|XP_010916807.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1 [Elaeis guineensis]
Length=649

 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/226 (31%), Positives = 114/226 (50%), Gaps = 32/226 (14%)
 Frame = +3

Query  249  PSDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY-------Q  407
            PS +H+  D++ +Y  ++  +               + A +++DCK+++K +        
Sbjct  436  PSPKHVEEDMQGVYRSVVAGRA--------------EVAGSVLDCKRWVKAWGLGDDADD  481

Query  408  PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVY  587
              +F+    PR  ++                PPPE++V+ ++A++ +L+VEA RA +D Y
Sbjct  482  RLRFLAMWLPREEEM---------GALTRPLPPPEVVVVEAHASVGELRVEAERALRDSY  532

Query  588  LMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVD  767
             +   F+   + G  G      L   + S   V +RG   G +   + R E G ++W V 
Sbjct  533  YVLEGFRAAAVEGIEGQERDPVLLGGVESGSVVWIRGE--GADMGCKLRYEGGPDTWAVG  590

Query  768  CHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCS  905
            C CGA+DDDGERM+ACD C +W HTRC GI D + VP  F+C RC 
Sbjct  591  CSCGARDDDGERMVACDVCDVWHHTRCIGIADGEPVPPIFLCARCG  636



>dbj|BAK05033.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=668

 Score =   105 bits (262),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 81/254 (32%), Positives = 113/254 (44%), Gaps = 19/254 (7%)
 Frame = +3

Query  186  PGSATVNVNTAGDNNYMRPNLP-SDEHLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQS  362
            P S          +  MR     +   L+RDL +LY  +L   + A  L       I  +
Sbjct  407  PASVGAGAGVPAGHGKMRVRFHLTRAQLMRDLVHLYRHVLKEPSQA--LTTGAFGAIPVA  464

Query  363  ATTLIDCKKFMKEYQ---PEKFVPALNPRAIQLLCELDLTDYSERCSVNPPPELLVLSSN  533
               ++D K F+K+Y           +    I L C L + + S    + PP E + + ++
Sbjct  465  VRMILDIKHFVKDYHEGMTGTNSGVVGHVYISLCCTLIVRNGSS--ELVPPYETVTVPAH  522

Query  534  ATISDLKVEASRAFQDVYLMFRRFQVEELVGY-AGVGDSTGLKLLLGSAEFVRVRGRS--  704
            AT+ +LK E  R F+D+YL  R F  E +VG  AG+  S  L L+   +  V        
Sbjct  523  ATVGELKWEVQRLFRDMYLGLRTFTAECVVGIGAGLDASPALGLIGVGSTVVVEGVVGEQ  582

Query  705  --------LGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIP  860
                      K A +       +    VDC CGA DDDGERM  CD C  WQHTRCAG+ 
Sbjct  583  QEPAEEGDQRKKAAAVCEGGGDVGERVVDCVCGADDDDGERMACCDICEAWQHTRCAGVA  642

Query  861  DLDSVPARFVCLRC  902
            D + VP  F+C RC
Sbjct  643  DTEDVPHVFLCSRC  656



>ref|XP_003518369.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Glycine 
max]
 gb|KHN41052.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Glycine soja]
Length=707

 Score =   105 bits (261),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 64/190 (34%), Positives = 99/190 (52%), Gaps = 9/190 (5%)
 Frame = +3

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL--DLTDYSERCSVNPPPELL  518
            + +  +  T++D + F+KE+        +  + +  +C L  +  D           E++
Sbjct  483  EAVDTAVQTILDSRYFVKEWPVRD---EIKEQVLTFICRLQPNFVDKKHELKGVACGEIV  539

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            V+  +AT+ DLK  +  A +D Y +     V ++     V D   L  L+ S   + VRG
Sbjct  540  VVPLHATVGDLKRASEAALRDTYCIAESLIVTDIKELMDVSDEEVLFGLIQSGVELCVRG  599

Query  699  RSLGKNALSRFRMERGLES--WTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDS  872
             ++  + L+  + E G ES  W V C CGA+DDDGERM+ACD C +WQHTRC GI D ++
Sbjct  600  IAI--DLLTPLKYEGGSESDNWKVRCECGAQDDDGERMVACDICEVWQHTRCCGIDDSET  657

Query  873  VPARFVCLRC  902
            VP  FVC  C
Sbjct  658  VPPLFVCTGC  667



>gb|EMT13329.1| PHD finger protein [Aegilops tauschii]
Length=573

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 110/229 (48%), Gaps = 22/229 (10%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L+RDL +LY  +L   + A  L       I  +   ++D K F+K+Y   + + A N   
Sbjct  339  LMRDLVHLYRHVLKEPSQA--LTTGAFGAIPVAVRMILDIKHFVKDYH--EGMTATNSGV  394

Query  444  -----IQLLCELDLTDYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
                 I L C L + + S    + PP E + + ++AT+ +LK E  R F+D+YL  R F 
Sbjct  395  VGHVYISLCCTLIVRNGSP--ELVPPYETVTVPAHATVGELKWEVQRLFRDMYLGLRTFT  452

Query  609  VEELVGY-AGVGDSTGLKLLLGSAEFVRVRGRSLG----------KNALSRFRMERGLES  755
             E +VG  AG+  S  L L+   +  V                  K A +       +  
Sbjct  453  AECVVGIGAGLEASPALGLIGVGSTVVVEGVVGEQQEPFEEGDERKKAAAVCEGSGDVGE  512

Query  756  WTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              VDC CGA DDDGERM  CD C  WQHTRCAG+ D + VP  F+C RC
Sbjct  513  RVVDCVCGADDDDGERMACCDICEAWQHTRCAGVADTEDVPHVFLCSRC  561



>ref|XP_003544360.1| PREDICTED: PHD finger protein MALE MEIOCYTE DEATH 1-like [Glycine 
max]
Length=708

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 104/200 (52%), Gaps = 8/200 (4%)
 Frame = +3

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL--DLTDYSERCSVNPPPELL  518
            + +  +  T++D + F+KE+        +  + +  +C L  +  D           E++
Sbjct  482  EAVDTAVQTILDSRYFVKEWPVRD---EMKEQVLTFICRLQPNFVDKKHELKGLACGEVV  538

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            V+  +AT+ DLK  A  A +D Y +  R  V ++     V D   L  L+ S   + VRG
Sbjct  539  VVPLHATVGDLKRAAEAALRDTYCIAERLIVTDIKELMDVSDEEVLFGLIQSGVELCVRG  598

Query  699  RSLGKNALSRFRME-RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSV  875
             ++      +++ E    ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D ++V
Sbjct  599  IAIDLLTPLKYQGESESADNWKVRCECGAQDDDGERMVACDICEVWQHTRCYGIDDSETV  658

Query  876  PARFVCLRC--SCVIGQAKT  929
            P  FVC  C  S ++  ++T
Sbjct  659  PPLFVCTGCCDSVLVPSSRT  678



>gb|KHN39480.1| PHD finger protein MALE MEIOCYTE DEATH 1 [Glycine soja]
Length=708

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 104/200 (52%), Gaps = 8/200 (4%)
 Frame = +3

Query  345  DVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQLLCEL--DLTDYSERCSVNPPPELL  518
            + +  +  T++D + F+KE+        +  + +  +C L  +  D           E++
Sbjct  482  EAVDTAVQTILDSRYFVKEWPVRD---EMKEQVLTFICRLQPNFVDKKHELKGLACGEVV  538

Query  519  VLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEFVRVRG  698
            V+  +AT+ DLK  A  A +D Y +  R  V ++     V D   L  L+ S   + VRG
Sbjct  539  VVPLHATVGDLKRAAEAALRDTYCIAERLIVTDIKELMDVSDEEVLFGLIQSGVELCVRG  598

Query  699  RSLGKNALSRFRME-RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSV  875
             ++      +++ E    ++W V C CGA+DDDGERM+ACD C +WQHTRC GI D ++V
Sbjct  599  IAIDLLTPLKYQGESESADNWKVRCECGAQDDDGERMVACDICEVWQHTRCYGIDDSETV  658

Query  876  PARFVCLRC--SCVIGQAKT  929
            P  FVC  C  S ++  ++T
Sbjct  659  PPLFVCTGCCDSVLVPSSRT  678



>emb|CDP05466.1| unnamed protein product [Coffea canephora]
Length=657

 Score =   104 bits (259),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 109/220 (50%), Gaps = 12/220 (5%)
 Frame = +3

Query  261  HLLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPR  440
             L++DL  LY+ +L      +   +     I  ++  ++D K F+K+Y  E    ++  +
Sbjct  433  QLMKDLFRLYKLILKENNAMSSTGILASIPI--ASRIILDTKLFIKDYSEES--TSILDK  488

Query  441  AIQLLCELDLTDYSERCSVN----PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQ  608
            ++ L C + LT  ++R S N     P E  +L + AT  +LK+E  R F+D+Y   R F 
Sbjct  489  SV-LHCSIVLTTNTDRGSTNKVVITPYEFFMLRNTATFDELKLEVERKFRDLYWGMRNFV  547

Query  609  VEELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGLES--WTVDCHCGA  782
             E L      G     KL+    + V   G+  G++A     M    ES    VDC CG 
Sbjct  548  AESLANLDAKGSDLVFKLIKAGTKIV-FEGKISGESADICGMMFESFESNALVVDCICGT  606

Query  783  KDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            K DDGERM++CD C + QH RC  + +++ +P  F+C  C
Sbjct  607  KIDDGERMVSCDICEVRQHARCVHVSNIEEIPTIFLCNSC  646



>ref|XP_009351795.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Pyrus x 
bretschneideri]
Length=691

 Score =   103 bits (258),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/234 (31%), Positives = 114/234 (49%), Gaps = 27/234 (12%)
 Frame = +3

Query  264  LLRDLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRA  443
            L++D+ Y+Y+ +L  Q M+N         I  +   +++ K  +K+Y  E     +   +
Sbjct  454  LMKDMFYMYKYVLKDQKMSN---AGIFSAIPMAVRIILNSKYLVKDYCSEMVPMKVEYLS  510

Query  444  I----QLLCELDLTDYSE----------RCSVNP----PPELLVLSSNATISDLKVEASR  569
            +     + C + L + SE          R + N     P E + L +NAT  DLK E  R
Sbjct  511  MDGESNIYCTISLKNNSEEDDDDNSKSIRNNNNAIILQPYECVTLKNNATFDDLKQEVER  570

Query  570  AFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF---VRVRGRSLGKNALSRFRME  740
             F+++Y   R F V+ +   A + ++ G  L+    E    + + GRS  +        E
Sbjct  571  NFKEIYWGLRGFVVDSI---ANLNNAKGTDLVFDMVEVGQKIVLEGRSSKRMGGVSEIYE  627

Query  741  RGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
             G   + VDC CGAK+DDGERM++CD C + QHT C  IPD + VP  F+C RC
Sbjct  628  CGAVYYVVDCPCGAKEDDGERMVSCDICEVRQHTLCVRIPDSEQVPHIFLCNRC  681



>gb|EPS59525.1| hypothetical protein M569_15279, partial [Genlisea aurea]
Length=649

 Score =   103 bits (257),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 76/241 (32%), Positives = 113/241 (47%), Gaps = 28/241 (12%)
 Frame = +3

Query  273  DLKYLYECMLHPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPRAIQL  452
            DL YLY  +L        LH    D  + S   +++ K++MKE+        L    ++ 
Sbjct  423  DLDYLYRNVL--------LHHPDPDKAMAS-QIILNSKRYMKEWPFRDEDDDL----LRF  469

Query  453  LCELDLTDYSERCSVN---PPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELV  623
            +C L  + +     V    PP E + +   +T+ DLKV   +A QD Y +  + +  E++
Sbjct  470  ICRLTSSCFRFDGDVFAQVPPSEHVAVPLYSTVGDLKVAVRKALQDTYCVMEKAEAVEIL  529

Query  624  GYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSR-----------FRMERGLESWTVDC  770
            G   + +   +  +  S E + VR   L                     E G E W+V+C
Sbjct  530  GTEEMQEDEVIFGICESGEEIWVRVLGLDTTGDGGGGGGGGGGGRLLVYEAGTEKWSVEC  589

Query  771  HCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRCSCVIGQAKTIGQMKDE  950
             CGAKDDDGERM++CD C  WQHTRC+GI D + VP  FVC  C   +  A T  + +D 
Sbjct  590  RCGAKDDDGERMMSCDVCETWQHTRCSGIEDHEPVPRLFVCEACCSSLAPA-TEKRFEDG  648

Query  951  F  953
            F
Sbjct  649  F  649



>pdb|1WEE|A Chain A, Solution Structure Of Phd Domain In Phd Finger Family 
Protein
Length=72

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 47/56 (84%), Gaps = 0/56 (0%)
 Frame = +3

Query  735  MERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            MERG+++W VDC CG KDDDGERMLACD CG+W HTRC GI + D++P++F+C RC
Sbjct  8    MERGVDNWKVDCKCGTKDDDGERMLACDGCGVWHHTRCIGINNADALPSKFLCFRC  63



>ref|XP_006849470.1| hypothetical protein AMTR_s00024p00102300 [Amborella trichopoda]
 gb|ERN11051.1| hypothetical protein AMTR_s00024p00102300 [Amborella trichopoda]
Length=455

 Score =   101 bits (252),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 74/253 (29%), Positives = 119/253 (47%), Gaps = 33/253 (13%)
 Frame = +3

Query  216  AGDNNY-----MRPNLPSDEHLLRDLKYLYECMLHPQTM-----ANHLHVCKKDVIIQSA  365
            +G  NY     M  +  S   + +DL YLY+ +L          A  +H+     I ++ 
Sbjct  201  SGPENYISGVKMAHSQISRSQVAKDLAYLYKNVLRDNGRNSGFPATGIHL---PAIKEAV  257

Query  366  TTLIDCKKFMKEYQP--EKFVPALNPRAIQLLCELDLTDYSERC------------SVNP  503
              ++D K  +K+Y+   ++   +     +++LC + L +                 SV  
Sbjct  258  RAVLDAKHLVKDYEAATDRGGSSHEGAMVRVLCSVSLENGDISADGEISGARVSAESVVI  317

Query  504  PPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVEELVGYAGVGDSTGLKLLLGSAEF  683
            P E + + + A++ DLK E   AF ++Y   R   V E+VG A   D  G   ++ S   
Sbjct  318  PAEFVSIPARASVGDLKRELESAFGEIYFGLRGIFVAEVVG-ARASDPVGR--MVKSGHE  374

Query  684  VRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAGIPD  863
            V  RGR  G +     + E+G     VDC CGA+++DGERM+ CD C +WQH RC+ +  
Sbjct  375  VVARGRVPGGSVWCEGKREKG---GVVDCLCGAREEDGERMVCCDVCEVWQHARCSRVDG  431

Query  864  LDSVPARFVCLRC  902
             D +P  F+C RC
Sbjct  432  DDVIPTIFLCTRC  444



>ref|XP_007157621.1| hypothetical protein PHAVU_002G085000g [Phaseolus vulgaris]
 gb|ESW29615.1| hypothetical protein PHAVU_002G085000g [Phaseolus vulgaris]
Length=598

 Score =   102 bits (254),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 74/221 (33%), Positives = 115/221 (52%), Gaps = 15/221 (7%)
 Frame = +3

Query  261  HLLRDLKYLYECML-HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNP  437
             L++D+ YLY  +L  P+ +     +     I  +A  ++D K F+K+Y  + F   L+ 
Sbjct  375  QLIKDMLYLYNYILVDPKPIMGSEFL---SAIPLAARIILDTKYFIKDYFGD-FSYQLDL  430

Query  438  RA---IQLLCELDLTDYSERC--SVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRR  602
             +   + L C + + +  E    +  PP E + L + ATI+DLK+E  R+F+++Y   R 
Sbjct  431  GSQDKLNLYCTILMRNGDEYLNKAFMPPHECITLKTTATINDLKLEVERSFREMYWGLRS  490

Query  603  FQVEELVGYAGVGDSTGLKL-LLGSAEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCG  779
            F VE +   + V + T +   L    E V   GR    N + +   ER   S  VDC CG
Sbjct  491  FVVESIQNLS-VNNGTDMVFGLTKVGEKVVAEGRH--TNMIEQI-CERDPNSGVVDCGCG  546

Query  780  AKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
              +DDGERM++CD C I QHTRC  IP+   +P  F+C +C
Sbjct  547  TIEDDGERMVSCDICEILQHTRCVRIPNDQDIPHIFLCKKC  587



>ref|XP_010319373.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Solanum lycopersicum]
Length=678

 Score =   101 bits (251),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/234 (29%), Positives = 117/234 (50%), Gaps = 29/234 (12%)
 Frame = +3

Query  261  HLLRDLKYLYECML--HPQTMANHLHVCKKDVIIQSATTLIDCKKFMKEY----QPEKFV  422
             L++D+ +LY  +L  H   M+N+  V     I  ++  ++D K F+KEY    +P+   
Sbjct  443  QLMKDIHFLYNNILKEHKGLMSNYTGVFA--TIPTASRIILDTKYFLKEYREVSEPD---  497

Query  423  PALNPRAIQLLCELDLT---DYSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLM  593
              + P   ++ C + L     +     V  P E  ++  + T  +LK+E  +AF D+YL 
Sbjct  498  TRIEPDKSKIYCAIMLAIKDGFGVEEKVMTPFECFLMRKDVTFDELKIEVEKAFGDIYLG  557

Query  594  FRRFQ-------VEELVGYAGVGDST--GLKLLLGSAEFVRVRGRSLGKNALSRFRMERG  746
             R F        +  + G   V +    G K++LG      +   +   N ++   +  G
Sbjct  558  LRNFTTRSINNLISPISGIELVFNVVKPGSKIVLGGV----IMSNNDDINIINNGGIFEG  613

Query  747  LESWTV--DCHCGAKDDDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +++  +  DC CG KD+DGERM+ CD C +WQHTRC  IP+ +++P  F+C +C
Sbjct  614  IKNNNIIMDCICGTKDEDGERMICCDICEVWQHTRCVNIPNHEAIPDIFLCNKC  667



>ref|XP_009775431.1| PREDICTED: PHD finger protein MALE STERILITY 1 [Nicotiana sylvestris]
Length=666

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/218 (28%), Positives = 111/218 (51%), Gaps = 9/218 (4%)
 Frame = +3

Query  264  LLRDLKYLYECMLHP-QTMANHLHVCKKDVIIQSATTLIDCKKFMKEYQPEKFVPALNPR  440
            L++D+ +LY+ +L   + M+N+  +     I  ++  ++D K F+KEY+ E     +   
Sbjct  442  LMKDIYFLYKNILKELKGMSNYTSIFA--TIPTASRIILDTKYFLKEYKGEA-DSRIEVD  498

Query  441  AIQLLCELDLTD---YSERCSVNPPPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQV  611
              ++ C + L     +     V  P E  +L  + T  +LK+E  R F ++Y   R F +
Sbjct  499  KSKIYCAIMLVTKNGFGVEEKVMTPFECFILRKDVTFDELKIEVVRTFGNIYWGLRNFAI  558

Query  612  EELVGYAGVGDSTGLKLLLGSAEFVRVRGRSLGKNALSRFRMERGL-ESWTVDCHCGAKD  788
              +   + +  +  +  ++     + V G  +     +   +  G+ ++  VDC CGAKD
Sbjct  559  RSINNLSPIIGTELVFNVMKPGNKI-VLGGIMSNIDHNNIGISEGIKDNIVVDCLCGAKD  617

Query  789  DDGERMLACDSCGIWQHTRCAGIPDLDSVPARFVCLRC  902
            +DGERM+ CD C +WQHTRC  IP+ +++P  F+C  C
Sbjct  618  EDGERMVCCDICEVWQHTRCVNIPNQEAIPDIFLCSEC  655



>ref|XP_004490060.1| PREDICTED: PHD finger protein MALE STERILITY 1-like [Cicer arietinum]
Length=664

 Score =   100 bits (249),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 74/136 (54%), Gaps = 3/136 (2%)
 Frame = +3

Query  504  PPELLVLSSNATISDLKVEASRAFQDVYLMFRRFQVE---ELVGYAGVGDSTGLKLLLGS  674
            P E + L + ATI+DLK+E  R F+++Y   R F VE    L+   G     G+  + G 
Sbjct  518  PYECIALKNCATINDLKLEVERNFREIYWGLRNFVVESSGNLMNVKGNEMVFGMIEVGGK  577

Query  675  AEFVRVRGRSLGKNALSRFRMERGLESWTVDCHCGAKDDDGERMLACDSCGIWQHTRCAG  854
                   G  +G N +     ER      V+C CG K+DDGERM++CD C IWQHTRC  
Sbjct  578  LVVEGWHGSDIGINKMVEQICERDPNKGIVECTCGTKEDDGERMVSCDICEIWQHTRCVR  637

Query  855  IPDLDSVPARFVCLRC  902
            IP+ + VP  F+C RC
Sbjct  638  IPNDEQVPHIFLCKRC  653



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3572047717316