BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7248_g1_i1 len=1587 path=[1565:0-1263 2829:1264-1586]

Length=1587
                                                                      Score     E

ref|XP_011086701.1|  PREDICTED: probable pectate lyase 5                691   0.0      
ref|XP_009804979.1|  PREDICTED: probable pectate lyase 5                687   0.0      
ref|XP_009586995.1|  PREDICTED: probable pectate lyase 5                685   0.0      
emb|CDP13269.1|  unnamed protein product                                674   0.0      
ref|XP_010320956.1|  PREDICTED: probable pectate lyase 5                674   0.0      
ref|XP_006341783.1|  PREDICTED: probable pectate lyase 5-like           672   0.0      
ref|XP_011029589.1|  PREDICTED: probable pectate lyase 5                667   0.0      
gb|KHN34377.1|  Putative pectate lyase 22                               667   0.0      
gb|EYU30593.1|  hypothetical protein MIMGU_mgv1a007569mg                667   0.0      
ref|XP_003549832.1|  PREDICTED: probable pectate lyase 18 isoform 1     666   0.0      
ref|XP_008340139.1|  PREDICTED: probable pectate lyase 5                664   0.0      
ref|XP_007155507.1|  hypothetical protein PHAVU_003G207400g             663   0.0      
ref|NP_001242543.1|  uncharacterized protein LOC100779940 precursor     662   0.0      
ref|XP_010250930.1|  PREDICTED: probable pectate lyase 5                662   0.0      
ref|XP_008221954.1|  PREDICTED: probable pectate lyase 5                659   0.0      
ref|XP_010100325.1|  hypothetical protein L484_027633                   659   0.0      
ref|XP_010102919.1|  hypothetical protein L484_018936                   659   0.0      
ref|XP_009359258.1|  PREDICTED: probable pectate lyase 5                658   0.0      
ref|XP_002285340.1|  PREDICTED: probable pectate lyase 5                658   0.0      Vitis vinifera
ref|XP_008389758.1|  PREDICTED: probable pectate lyase 5                657   0.0      
ref|XP_010023435.1|  PREDICTED: probable pectate lyase 5                657   0.0      
ref|XP_007222794.1|  hypothetical protein PRUPE_ppa006665mg             656   0.0      
ref|XP_010663062.1|  PREDICTED: probable pectate lyase 5                656   0.0      
dbj|BAB59066.1|  pectate lyase                                          656   0.0      Salix gilgiana
ref|XP_004515847.1|  PREDICTED: probable pectate lyase 22-like          655   0.0      
ref|XP_008350945.1|  PREDICTED: probable pectate lyase 5                655   0.0      
ref|XP_003608909.1|  Pectate lyase                                      655   0.0      
ref|XP_004501839.1|  PREDICTED: probable pectate lyase 5-like           655   0.0      
emb|CAN76500.1|  hypothetical protein VITISV_004734                     654   0.0      Vitis vinifera
gb|KHG22755.1|  hypothetical protein F383_29653                         654   0.0      
gb|AFK44189.1|  unknown                                                 652   0.0      
gb|KHG22990.1|  hypothetical protein F383_28754                         650   0.0      
ref|XP_011086987.1|  PREDICTED: probable pectate lyase 22               650   0.0      
ref|XP_011005597.1|  PREDICTED: probable pectate lyase 18               650   0.0      
ref|XP_008351757.1|  PREDICTED: probable pectate lyase 18               650   0.0      
gb|KCW83228.1|  hypothetical protein EUGRSUZ_B00168                     653   0.0      
ref|XP_010248740.1|  PREDICTED: probable pectate lyase 18               649   0.0      
ref|XP_007037815.1|  Pectin lyase-like superfamily protein isoform 1    649   0.0      
ref|XP_004299169.1|  PREDICTED: probable pectate lyase 18-like          649   0.0      
ref|XP_004310004.1|  PREDICTED: probable pectate lyase 5-like           648   0.0      
ref|XP_010026892.1|  PREDICTED: probable pectate lyase 18               648   0.0      
ref|XP_004152502.1|  PREDICTED: probable pectate lyase 22-like          647   0.0      
gb|AEN70965.1|  pectate lyase                                           646   0.0      
emb|CDX92652.1|  BnaC07g39100D                                          645   0.0      
emb|CDY11033.1|  BnaA03g46920D                                          645   0.0      
ref|XP_007044917.1|  Pectate lyase family protein                       645   0.0      
ref|XP_009359518.1|  PREDICTED: probable pectate lyase 18               645   0.0      
ref|XP_002322215.1|  pectate lyase 22 precursor family protein          645   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO69407.1|  hypothetical protein CISIN_1g015569mg                   645   0.0      
emb|CDY03419.1|  BnaC01g16630D                                          644   0.0      
ref|XP_004157771.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    644   0.0      
ref|XP_006439991.1|  hypothetical protein CICLE_v10020423mg             644   0.0      
ref|XP_008439105.1|  PREDICTED: probable pectate lyase 22               644   0.0      
ref|NP_001280201.1|  probable pectate lyase 18 precursor                644   0.0      
ref|XP_009105097.1|  PREDICTED: probable pectate lyase 5                643   0.0      
gb|ADB90475.1|  pectate lyase                                           644   0.0      Gossypium herbaceum [Arabian cotton]
ref|XP_003523121.1|  PREDICTED: probable pectate lyase 18-like          643   0.0      
gb|KHG19997.1|  hypothetical protein F383_02891                         643   0.0      
gb|ADB90477.1|  pectate lyase                                           643   0.0      Gossypium hirsutum [American cotton]
ref|XP_006476937.1|  PREDICTED: probable pectate lyase 18-like          644   0.0      
ref|XP_009150377.1|  PREDICTED: probable pectate lyase 22               643   0.0      
gb|EYU22243.1|  hypothetical protein MIMGU_mgv1a007460mg                642   0.0      
ref|XP_010459939.1|  PREDICTED: probable pectate lyase 22               642   0.0      
emb|CDY41506.1|  BnaA06g22590D                                          642   0.0      
ref|XP_010545988.1|  PREDICTED: probable pectate lyase 22               642   0.0      
ref|XP_007209185.1|  hypothetical protein PRUPE_ppa006392mg             642   0.0      
ref|XP_006484000.1|  PREDICTED: probable pectate lyase 5-like           641   0.0      
gb|AEN70981.1|  pectate lyase                                           642   0.0      
emb|CDY65626.1|  BnaC03g74840D                                          643   0.0      
gb|AEN70964.1|  pectate lyase                                           642   0.0      
gb|AEN70963.1|  pectate lyase                                           642   0.0      
gb|ADB90478.1|  pectate lyase                                           641   0.0      Gossypium hirsutum [American cotton]
ref|XP_011040439.1|  PREDICTED: probable pectate lyase 18               641   0.0      
gb|AEN70985.1|  pectate lyase                                           641   0.0      
ref|XP_007137977.1|  hypothetical protein PHAVU_009G170500g             641   0.0      
gb|KDO82120.1|  hypothetical protein CISIN_1g015702mg                   640   0.0      
ref|XP_006438176.1|  hypothetical protein CICLE_v10031429mg             643   0.0      
gb|AEN70977.1|  pectate lyase                                           640   0.0      
gb|ADB90479.1|  pectate lyase                                           640   0.0      Gossypium barbadense [Egyptian cotton]
ref|XP_010531484.1|  PREDICTED: probable pectate lyase 5                640   0.0      
ref|XP_006302330.1|  hypothetical protein CARUB_v10020387mg             640   0.0      
emb|CDP15081.1|  unnamed protein product                                640   0.0      
ref|XP_002311747.2|  pectate lyase 5 precursor family protein           640   0.0      Populus trichocarpa [western balsam poplar]
gb|AEN70968.1|  pectate lyase                                           640   0.0      
gb|ADB90476.1|  pectate lyase                                           640   0.0      Gossypium raimondii
ref|XP_006280553.1|  hypothetical protein CARUB_v10026494mg             639   0.0      
gb|AGC94753.1|  putative pectate lyase                                  639   0.0      
gb|AEN70984.1|  pectate lyase                                           639   0.0      
ref|XP_002318694.1|  pectate lyase 22 precursor family protein          639   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009628975.1|  PREDICTED: probable pectate lyase 18               639   0.0      
emb|CDY56220.1|  BnaAnng14170D                                          639   0.0      
ref|XP_002866540.1|  pectate lyase                                      639   0.0      
ref|XP_010444198.1|  PREDICTED: probable pectate lyase 22               638   0.0      
gb|KFK41187.1|  hypothetical protein AALP_AA2G097000                    637   0.0      
ref|XP_010484044.1|  PREDICTED: probable pectate lyase 22               637   0.0      
ref|XP_009105327.1|  PREDICTED: probable pectate lyase 5                636   0.0      
ref|XP_002887143.1|  pectate lyase family protein                       636   0.0      
gb|AAY85180.1|  pectate lyase                                           636   0.0      Gossypium hirsutum [American cotton]
ref|NP_001289258.1|  probable pectate lyase 18 precursor                637   0.0      
emb|CDY48132.1|  BnaCnng15740D                                          637   0.0      
gb|KDP26717.1|  hypothetical protein JCGZ_17875                         636   0.0      
ref|NP_564906.1|  putative pectate lyase 5                              636   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137472.1|  PREDICTED: probable pectate lyase 18               635   0.0      
ref|XP_009112069.1|  PREDICTED: probable pectate lyase 22               636   0.0      
ref|NP_001280839.1|  probable pectate lyase 18 precursor                636   0.0      
emb|CDY01846.1|  BnaC06g28860D                                          635   0.0      
gb|KDO69408.1|  hypothetical protein CISIN_1g015569mg                   635   0.0      
emb|CDY16732.1|  BnaA09g06500D                                          636   0.0      
ref|XP_011072008.1|  PREDICTED: probable pectate lyase 18               634   0.0      
ref|NP_568967.1|  putative pectate lyase 22                             635   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10560.1|  pectate lyase                                          634   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAM67091.1|  putative pectate lyase                                  632   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAI94495.1|  pectate lyase                                          632   0.0      
gb|KHN05801.1|  Putative pectate lyase 22                               632   0.0      
gb|KFK28033.1|  hypothetical protein AALP_AA8G463100                    631   0.0      
gb|KDP30994.1|  hypothetical protein JCGZ_11370                         631   0.0      
ref|XP_002515037.1|  Pectate lyase precursor, putative                  630   0.0      Ricinus communis
dbj|BAF43572.1|  pectate lyase                                          631   0.0      Prunus persica
ref|XP_003526981.1|  PREDICTED: probable pectate lyase 18-like          629   0.0      
emb|CDY08948.1|  BnaC08g11780D                                          629   0.0      
emb|CDY24847.1|  BnaA08g14630D                                          628   0.0      
ref|XP_009109237.1|  PREDICTED: probable pectate lyase 18               627   0.0      
gb|KFK29019.1|  hypothetical protein AALP_AA7G078200                    627   0.0      
ref|XP_004236303.1|  PREDICTED: probable pectate lyase 18               625   0.0      
ref|XP_009138507.1|  PREDICTED: probable pectate lyase 18               622   0.0      
emb|CDY34310.1|  BnaA01g14130D                                          621   0.0      
ref|XP_009406385.1|  PREDICTED: probable pectate lyase 18               620   0.0      
gb|KDP46367.1|  hypothetical protein JCGZ_10207                         620   0.0      
emb|CDY28857.1|  BnaC06g26450D                                          620   0.0      
ref|XP_006351443.1|  PREDICTED: probable pectate lyase 18-like          620   0.0      
ref|XP_010695977.1|  PREDICTED: probable pectate lyase 18               620   0.0      
ref|XP_010929962.1|  PREDICTED: probable pectate lyase 5                620   0.0      
ref|XP_003638513.1|  Pectate lyase                                      619   0.0      
ref|NP_001268051.1|  pectate lyase precursor                            619   0.0      
ref|XP_007151585.1|  hypothetical protein PHAVU_004G059200g             619   0.0      
ref|XP_009762540.1|  PREDICTED: probable pectate lyase 18               619   0.0      
ref|XP_006283843.1|  hypothetical protein CARUB_v10004942mg             619   0.0      
gb|AAF19195.1|AF206319_1  pectate lyase 1                               618   0.0      Musa acuminata [banana]
ref|XP_010444201.1|  PREDICTED: probable pectate lyase 22 isoform X3    616   0.0      
ref|XP_002314576.1|  pectate lyase 5 precursor family protein           617   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004489554.1|  PREDICTED: probable pectate lyase 5-like           615   0.0      
ref|XP_010433725.1|  PREDICTED: probable pectate lyase 18               615   0.0      
ref|XP_010448519.1|  PREDICTED: probable pectate lyase 18               615   0.0      
ref|XP_009631254.1|  PREDICTED: probable pectate lyase 18               614   0.0      
ref|XP_010682362.1|  PREDICTED: probable pectate lyase 5                613   0.0      
ref|XP_010415362.1|  PREDICTED: probable pectate lyase 5                613   0.0      
ref|XP_002867644.1|  pectate lyase family protein                       613   0.0      
ref|XP_009788173.1|  PREDICTED: probable pectate lyase 18               613   0.0      
ref|XP_010470701.1|  PREDICTED: probable pectate lyase 5                612   0.0      
ref|NP_567707.1|  putative pectate lyase 18                             612   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003618787.1|  Pectate lyase                                      611   0.0      
ref|XP_007215475.1|  hypothetical protein PRUPE_ppa006569mg             610   0.0      
gb|AAG28907.1|AC008113_23  F12A21.12                                    610   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002300069.1|  pectate lyase family protein                       610   0.0      Populus trichocarpa [western balsam poplar]
gb|AAK25850.1|AF360140_1  putative pectate lyase                        610   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010949.1|  PREDICTED: pectate lyase-like                      608   0.0      
ref|XP_011042354.1|  PREDICTED: probable pectate lyase 5                608   0.0      
gb|AAM65103.1|  putative pectate lyase                                  607   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008230481.1|  PREDICTED: pectate lyase-like                      607   0.0      
gb|EPS69872.1|  hypothetical protein M569_04891                         606   0.0      
ref|XP_003551943.1|  PREDICTED: probable pectate lyase 5-like           606   0.0      
emb|CDY12666.1|  BnaA02g13340D                                          605   0.0      
emb|CDY32557.1|  BnaC02g17500D                                          604   0.0      
ref|XP_009127577.1|  PREDICTED: probable pectate lyase 5                603   0.0      
ref|XP_006591479.1|  PREDICTED: probable pectate lyase 5-like           603   0.0      
ref|XP_002526952.1|  Pectate lyase precursor, putative                  603   0.0      Ricinus communis
emb|CAA22985.1|  putative pectate lyase                                 602   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007163701.1|  hypothetical protein PHAVU_001G256900g             604   0.0      
emb|CAA63496.1|  pectate lyase                                          601   0.0      Musa acuminata AAA Group [Cavendish banana]
ref|XP_006852264.1|  hypothetical protein AMTR_s00049p00173370          600   0.0      
ref|XP_008796023.1|  PREDICTED: probable pectate lyase 5                599   0.0      
ref|XP_004502358.1|  PREDICTED: probable pectate lyase 5-like           599   0.0      
ref|XP_010239620.1|  PREDICTED: probable pectate lyase 8 isoform X2     599   0.0      
ref|XP_006347419.1|  PREDICTED: probable pectate lyase 18-like          598   0.0      
ref|XP_003601871.1|  Pectate lyase                                      598   0.0      
ref|XP_010322529.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    598   0.0      
ref|XP_010239619.1|  PREDICTED: probable pectate lyase 8 isoform X1     599   0.0      
ref|XP_010511733.1|  PREDICTED: probable pectate lyase 5                597   0.0      
ref|XP_003524720.1|  PREDICTED: pectate lyase-like                      595   0.0      
gb|EEE60442.1|  hypothetical protein OsJ_13660                          597   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAE02420.2|  OSJNBa0095E20.8                                        597   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010536660.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    594   0.0      
gb|EEC76710.1|  hypothetical protein OsI_14719                          597   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004143054.1|  PREDICTED: probable pectate lyase 5-like           594   0.0      
dbj|BAK06362.1|  predicted protein                                      595   0.0      
ref|XP_009340844.1|  PREDICTED: pectate lyase-like                      593   0.0      
ref|XP_011097349.1|  PREDICTED: pectate lyase-like                      591   0.0      
ref|XP_006604001.1|  PREDICTED: pectate lyase-like                      590   0.0      
ref|XP_010935686.1|  PREDICTED: probable pectate lyase 8 isoform X2     590   0.0      
ref|XP_010935685.1|  PREDICTED: probable pectate lyase 8 isoform X1     591   0.0      
ref|XP_011073763.1|  PREDICTED: probable pectate lyase 8                589   0.0      
ref|XP_008800563.1|  PREDICTED: probable pectate lyase 8 isoform X1     589   0.0      
ref|XP_008800564.1|  PREDICTED: probable pectate lyase 8 isoform X2     588   0.0      
ref|XP_004975048.1|  PREDICTED: probable pectate lyase 15-like is...    587   0.0      
gb|AFK32131.1|  pectate lyase                                           583   0.0      
ref|XP_009391056.1|  PREDICTED: probable pectate lyase 8                587   0.0      
ref|XP_008667903.1|  PREDICTED: pectate lyase 8 isoform X1              588   0.0      
emb|CDY03964.1|  BnaC02g36790D                                          585   0.0      
ref|XP_008444399.1|  PREDICTED: probable pectate lyase 5                585   0.0      
ref|XP_004304685.1|  PREDICTED: pectate lyase-like                      584   0.0      
emb|CDO99404.1|  unnamed protein product                                587   0.0      
emb|CDP16631.1|  unnamed protein product                                584   0.0      
ref|XP_008804450.1|  PREDICTED: probable pectate lyase 8 isoform X2     585   0.0      
ref|XP_009408120.1|  PREDICTED: probable pectate lyase 8                585   0.0      
ref|XP_004975047.1|  PREDICTED: probable pectate lyase 15-like is...    586   0.0      
ref|XP_008804449.1|  PREDICTED: probable pectate lyase 8 isoform X1     585   0.0      
gb|EYU43815.1|  hypothetical protein MIMGU_mgv1a006554mg                584   0.0      
ref|XP_004975046.1|  PREDICTED: probable pectate lyase 15-like is...    587   0.0      
ref|XP_006653139.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    585   0.0      
ref|XP_010940647.1|  PREDICTED: probable pectate lyase 8                582   0.0      
ref|XP_010918897.1|  PREDICTED: probable pectate lyase 8 isoform X2     582   0.0      
ref|XP_010918895.1|  PREDICTED: probable pectate lyase 8 isoform X1     582   0.0      
ref|XP_009411363.1|  PREDICTED: probable pectate lyase 8                582   0.0      
gb|EYU32621.1|  hypothetical protein MIMGU_mgv1a006198mg                582   0.0      
ref|XP_007034463.1|  Pectin lyase-like superfamily protein              582   0.0      
gb|KHG06252.1|  hypothetical protein F383_10745                         581   0.0      
gb|KHG30349.1|  hypothetical protein F383_15991                         583   0.0      
ref|XP_008438392.1|  PREDICTED: probable pectate lyase 8                581   0.0      
ref|XP_006854398.1|  hypothetical protein AMTR_s00039p00189000          582   0.0      
ref|XP_006447221.1|  hypothetical protein CICLE_v10015474mg             579   0.0      
ref|XP_010023767.1|  PREDICTED: probable pectate lyase 8 isoform X1     581   0.0      
gb|KDO40644.1|  hypothetical protein CISIN_1g015623mg                   579   0.0      
gb|EPS68938.1|  hypothetical protein M569_05827                         578   0.0      
ref|XP_004134015.1|  PREDICTED: probable pectate lyase 15-like          580   0.0      
ref|XP_007031685.1|  Pectin lyase-like superfamily protein              578   0.0      
ref|NP_001141589.1|  uncharacterized protein LOC100273705               581   0.0      Zea mays [maize]
emb|CBI17713.3|  unnamed protein product                                577   0.0      
ref|XP_010435229.1|  PREDICTED: probable pectate lyase 15               580   0.0      
ref|XP_010023768.1|  PREDICTED: probable pectate lyase 1 isoform X2     579   0.0      
ref|XP_010440536.1|  PREDICTED: probable pectate lyase 15 isoform X2    580   0.0      
dbj|BAF43573.1|  pectate lyase                                          578   0.0      Prunus persica
ref|XP_010440534.1|  PREDICTED: probable pectate lyase 15 isoform X1    580   0.0      
ref|NP_001147553.1|  pectate lyase 8                                    579   0.0      Zea mays [maize]
ref|XP_007222160.1|  hypothetical protein PRUPE_ppa005761mg             578   0.0      
ref|XP_009382167.1|  PREDICTED: probable pectate lyase 8                577   0.0      
gb|EYU34765.1|  hypothetical protein MIMGU_mgv1a023431mg                576   0.0      
ref|XP_003555714.2|  PREDICTED: probable pectate lyase 1-like           580   0.0      
ref|XP_004289729.1|  PREDICTED: probable pectate lyase 15-like          578   0.0      
ref|XP_011091390.1|  PREDICTED: probable pectate lyase 8                578   0.0      
gb|EMT28700.1|  hypothetical protein F775_17439                         575   0.0      
ref|XP_008223974.1|  PREDICTED: probable pectate lyase 8                577   0.0      
ref|XP_010450168.1|  PREDICTED: probable pectate lyase 15 isoform X2    577   0.0      
ref|XP_009384552.1|  PREDICTED: probable pectate lyase 8                577   0.0      
ref|NP_001052103.1|  Os04g0137100                                       578   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010450167.1|  PREDICTED: probable pectate lyase 15 isoform X1    577   0.0      
gb|KDP33375.1|  hypothetical protein JCGZ_12924                         577   0.0      
ref|XP_010038352.1|  PREDICTED: probable pectate lyase 8                577   0.0      
ref|XP_004156698.1|  PREDICTED: putative pectate lyase 11-like          575   0.0      
ref|XP_004142773.1|  PREDICTED: putative pectate lyase 11-like          575   0.0      
ref|XP_004171543.1|  PREDICTED: probable pectate lyase 15-like          576   0.0      
ref|XP_004138973.1|  PREDICTED: probable pectate lyase 15-like          576   0.0      
ref|XP_010528200.1|  PREDICTED: putative pectate lyase 11               573   0.0      
gb|KHG12411.1|  hypothetical protein F383_06737                         572   0.0      
ref|XP_002870357.1|  pectate lyase family protein                       575   0.0      
ref|XP_009385867.1|  PREDICTED: probable pectate lyase 8 isoform X2     573   0.0      
gb|AAF19196.1|AF206320_1  pectate lyase 2                               573   0.0      Musa acuminata [banana]
emb|CDX83690.1|  BnaC07g24300D                                          572   0.0      
ref|XP_008460726.1|  PREDICTED: probable pectate lyase 8 isoform X1     572   0.0      
ref|XP_009370039.1|  PREDICTED: probable pectate lyase 8                572   0.0      
gb|ABK25017.1|  unknown                                                 572   0.0      Picea sitchensis
gb|EPS63108.1|  hypothetical protein M569_11679                         570   0.0      
ref|XP_006282594.1|  hypothetical protein CARUB_v10004736mg             573   0.0      
ref|XP_009385866.1|  PREDICTED: probable pectate lyase 8 isoform X1     573   0.0      
ref|XP_009400924.1|  PREDICTED: probable pectate lyase 8 isoform X2     572   0.0      
gb|AAK66161.1|  pectate lyase                                           568   0.0      Fragaria x ananassa
ref|NP_567409.1|  probable pectate lyase 15                             572   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009362042.1|  PREDICTED: probable pectate lyase 8                571   0.0      
ref|XP_009775177.1|  PREDICTED: probable pectate lyase 8                571   0.0      
ref|XP_008458848.1|  PREDICTED: pectate lyase-like                      570   0.0      
emb|CDY18738.1|  BnaC08g08780D                                          572   0.0      
ref|XP_004497757.1|  PREDICTED: probable pectate lyase 15-like          571   0.0      
emb|CAN75298.1|  hypothetical protein VITISV_008675                     571   0.0      Vitis vinifera
gb|AEX93472.1|  nodulation pectate lyase                                569   0.0      
ref|XP_009593549.1|  PREDICTED: probable pectate lyase 8                571   0.0      
ref|XP_010069078.1|  PREDICTED: probable pectate lyase 8                571   0.0      
ref|XP_002265100.1|  PREDICTED: probable pectate lyase 8                570   0.0      Vitis vinifera
ref|XP_008460727.1|  PREDICTED: probable pectate lyase 1 isoform X2     570   0.0      
ref|NP_001190720.1|  probable pectate lyase 15                          570   0.0      
ref|XP_010243989.1|  PREDICTED: probable pectate lyase 8                570   0.0      
ref|XP_003535958.1|  PREDICTED: probable pectate lyase 1-like           570   0.0      
emb|CDP03845.1|  unnamed protein product                                570   0.0      
ref|XP_010033351.1|  PREDICTED: pectate lyase-like                      568   0.0      
emb|CBI33346.3|  unnamed protein product                                569   0.0      
ref|XP_006360328.1|  PREDICTED: probable pectate lyase 15-like          570   0.0      
ref|XP_010532807.1|  PREDICTED: probable pectate lyase 15               570   0.0      
ref|XP_008360481.1|  PREDICTED: probable pectate lyase 8                569   0.0      
ref|XP_008391438.1|  PREDICTED: probable pectate lyase 8                569   0.0      
ref|XP_010672089.1|  PREDICTED: probable pectate lyase 1                569   0.0      
ref|XP_009107745.1|  PREDICTED: probable pectate lyase 15               569   0.0      
ref|XP_010264036.1|  PREDICTED: probable pectate lyase 8                568   0.0      
ref|XP_004247823.1|  PREDICTED: probable pectate lyase 8                569   0.0      
gb|KHN07962.1|  Putative pectate lyase 22                               568   0.0      
ref|NP_189376.1|  putative pectate lyase 11                             567   0.0      
ref|XP_010106682.1|  hypothetical protein L484_004616                   566   0.0      
ref|XP_009400922.1|  PREDICTED: probable pectate lyase 8 isoform X1     568   0.0      
ref|XP_002521130.1|  Pectate lyase precursor, putative                  568   0.0      
ref|XP_002285639.2|  PREDICTED: probable pectate lyase 8                569   0.0      
ref|XP_008812405.1|  PREDICTED: probable pectate lyase 8                568   0.0      
ref|XP_006487597.1|  PREDICTED: probable pectate lyase 1-like           568   0.0      
gb|AFD54064.1|  nodulation pectate lyase mutant                         566   0.0      
ref|XP_010933172.1|  PREDICTED: probable pectate lyase 8 isoform X2     566   0.0      
ref|XP_010933171.1|  PREDICTED: probable pectate lyase 8 isoform X1     567   0.0      
ref|XP_002875382.1|  predicted protein                                  566   0.0      
ref|XP_008339288.1|  PREDICTED: probable pectate lyase 8                566   0.0      
gb|KDO69409.1|  hypothetical protein CISIN_1g015569mg                   562   0.0      
gb|KDP26417.1|  hypothetical protein JCGZ_17575                         566   0.0      
ref|XP_007145412.1|  hypothetical protein PHAVU_007G236800g             566   0.0      
ref|XP_007140561.1|  hypothetical protein PHAVU_008G123000g             566   0.0      
ref|XP_002297822.1|  pectate lyase family protein                       565   0.0      
gb|KCW57296.1|  hypothetical protein EUGRSUZ_H00093                     565   0.0      
emb|CDY53564.1|  BnaC04g55760D                                          565   0.0      
gb|KDO82121.1|  hypothetical protein CISIN_1g015702mg                   560   0.0      
ref|XP_010425491.1|  PREDICTED: putative pectate lyase 11               563   0.0      
gb|EYU46355.1|  hypothetical protein MIMGU_mgv1a007094mg                563   0.0      
ref|XP_002301766.2|  hypothetical protein POPTR_0002s23990g             564   0.0      
ref|XP_011024740.1|  PREDICTED: probable pectate lyase 20               564   0.0      
ref|XP_003552152.2|  PREDICTED: probable pectate lyase 20-like          565   0.0      
emb|CDY01151.1|  BnaA04g06680D                                          565   0.0      
gb|KFK33662.1|  hypothetical protein AALP_AA5G043100                    563   0.0      
ref|XP_008460728.1|  PREDICTED: probable pectate lyase 1 isoform X3     561   0.0      
sp|O24554.1|PLY_ZINVI  RecName: Full=Pectate lyase; AltName: Full...    562   0.0      
ref|XP_010514446.1|  PREDICTED: putative pectate lyase 11 isoform X1    563   0.0      
ref|XP_009397895.1|  PREDICTED: probable pectate lyase 8                564   0.0      
ref|XP_011002172.1|  PREDICTED: probable pectate lyase 8                564   0.0      
ref|XP_006420567.1|  hypothetical protein CICLE_v10004783mg             566   0.0      
ref|XP_002304700.1|  pectate lyase family protein                       564   0.0      
ref|XP_009139602.1|  PREDICTED: probable pectate lyase 15               563   0.0      
gb|EYU17974.1|  hypothetical protein MIMGU_mgv1a006571mg                562   0.0      
ref|XP_009151964.1|  PREDICTED: putative pectate lyase 11 isoform X1    561   0.0      
ref|XP_010502717.1|  PREDICTED: putative pectate lyase 11               561   0.0      
emb|CAB36835.1|  putative pectate lyase A11 (fragment)                  559   0.0      
ref|XP_011020694.1|  PREDICTED: probable pectate lyase 8                561   0.0      
ref|XP_003530885.1|  PREDICTED: probable pectate lyase 20-like          561   0.0      
gb|ACB12931.1|  pectate lyase 1-27                                      561   0.0      
gb|AFZ78654.1|  pectate lyase                                           561   0.0      
ref|XP_006291220.1|  hypothetical protein CARUB_v10017351mg             559   0.0      
ref|XP_009129418.1|  PREDICTED: putative pectate lyase 11               558   0.0      
ref|XP_006338637.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    558   0.0      
gb|KEH41255.1|  pectate lyase family protein                            560   0.0      
ref|XP_008447332.1|  PREDICTED: probable pectate lyase 8                559   0.0      
ref|XP_004515610.1|  PREDICTED: probable pectate lyase 8-like           558   0.0      
gb|KDO65869.1|  hypothetical protein CISIN_1g013239mg                   558   0.0      
gb|ADP09680.1|  pectate lyase                                           558   0.0      
ref|XP_010684949.1|  PREDICTED: probable pectate lyase 8                558   0.0      
ref|NP_189110.1|  probable pectate lyase 10                             558   0.0      
ref|XP_004290232.1|  PREDICTED: probable pectate lyase 8-like           558   0.0      
ref|XP_006480190.1|  PREDICTED: probable pectate lyase 8-like           558   0.0      
gb|AAX88800.1|  ripening-related pectate lyase                          558   0.0      
ref|NP_001234029.1|  probable pectate lyase P18 precursor               556   0.0      
ref|XP_009151965.1|  PREDICTED: putative pectate lyase 11 isoform X2    556   0.0      
ref|XP_004152014.1|  PREDICTED: probable pectate lyase 8-like           557   0.0      
ref|XP_003622996.1|  Pectate lyase 1-27                                 557   0.0      
ref|XP_009349844.1|  PREDICTED: probable pectate lyase 8                557   0.0      
ref|XP_009799817.1|  PREDICTED: probable pectate lyase 8                556   0.0      
ref|XP_006854397.1|  hypothetical protein AMTR_s00039p00186640          555   0.0      
ref|XP_011009338.1|  PREDICTED: probable pectate lyase 8                555   0.0      
ref|XP_009609746.1|  PREDICTED: probable pectate lyase 8                555   0.0      
ref|XP_008235520.1|  PREDICTED: probable pectate lyase 8                555   0.0      
ref|XP_010109687.1|  hypothetical protein L484_015172                   554   0.0      
ref|XP_007049844.1|  Pectin lyase-like superfamily protein              554   0.0      
ref|XP_010532870.1|  PREDICTED: putative pectate lyase 14               554   0.0      
dbj|BAB01216.1|  pectate lyase                                          554   0.0      
emb|CDY20049.1|  BnaA09g02020D                                          553   0.0      
emb|CDY00156.1|  BnaC09g01450D                                          553   0.0      
ref|XP_009111570.1|  PREDICTED: putative pectate lyase 11               553   0.0      
dbj|BAA95715.1|  pectate lyase-like protein                             552   0.0      
ref|XP_009111860.1|  PREDICTED: probable pectate lyase 20               552   0.0      
emb|CDY19932.1|  BnaA09g03190D                                          552   0.0      
ref|NP_563715.1|  putative pectate lyase 1                              552   0.0      
ref|XP_006443655.1|  hypothetical protein CICLE_v10019202mg             561   0.0      
ref|XP_004163042.1|  PREDICTED: LOW QUALITY PROTEIN: probable pec...    550   0.0      
emb|CDY56668.1|  BnaCnng30870D                                          551   0.0      
ref|XP_002321242.2|  pectate lyase family protein                       549   0.0      
ref|XP_006307575.1|  hypothetical protein CARUB_v10009197mg             551   0.0      
ref|XP_007201029.1|  hypothetical protein PRUPE_ppa006229mg             551   0.0      
ref|XP_009139642.1|  PREDICTED: putative pectate lyase 14               551   0.0      
ref|XP_010527219.1|  PREDICTED: probable pectate lyase 10               549   0.0      
ref|XP_002511275.1|  Pectate lyase precursor, putative                  547   0.0      
emb|CDY61137.1|  BnaC05g48970D                                          550   0.0      
ref|XP_010484103.1|  PREDICTED: probable pectate lyase 1                550   0.0      
ref|XP_007037816.1|  Pectin lyase-like superfamily protein isoform 2    547   0.0      
gb|KFK42808.1|  hypothetical protein AALP_AA1G041400                    550   0.0      
emb|CDX89799.1|  BnaA10g02830D                                          550   0.0      
ref|XP_010475133.1|  PREDICTED: probable pectate lyase 1                550   0.0      
gb|KFK38096.1|  hypothetical protein AALP_AA3G068900                    549   0.0      
ref|XP_009371193.1|  PREDICTED: probable pectate lyase 8                550   0.0      
ref|XP_010556943.1|  PREDICTED: probable pectate lyase 1                549   0.0      
ref|XP_009111089.1|  PREDICTED: probable pectate lyase 1                549   0.0      
ref|XP_010457526.1|  PREDICTED: probable pectate lyase 1                549   0.0      
ref|XP_006297767.1|  hypothetical protein CARUB_v10013802mg             548   0.0      
ref|XP_006352706.1|  PREDICTED: probable pectate lyase 10-like          548   0.0      
ref|XP_002892236.1|  pectate lyase family protein                       548   0.0      
ref|XP_011080166.1|  PREDICTED: probable pectate lyase 8                547   0.0      
ref|XP_004242391.1|  PREDICTED: probable pectate lyase 8                548   0.0      
ref|XP_002884619.1|  pectate lyase family protein                       547   0.0      
emb|CDX86615.1|  BnaC08g00880D                                          547   0.0      
ref|XP_009624534.1|  PREDICTED: probable pectate lyase 8                548   0.0      
ref|XP_008372438.1|  PREDICTED: probable pectate lyase 8                548   0.0      
ref|XP_009119265.1|  PREDICTED: probable pectate lyase 1                547   0.0      
emb|CDY05305.1|  BnaC05g44980D                                          546   0.0      
gb|EPS58104.1|  pectate lyase                                           543   0.0      
gb|ABR17909.1|  unknown                                                 546   0.0      
ref|XP_010464311.1|  PREDICTED: probable pectate lyase 8                546   0.0      
emb|CDY01119.1|  BnaA04g07000D                                          546   0.0      
ref|XP_010447044.1|  PREDICTED: probable pectate lyase 8                546   0.0      
ref|XP_010486231.1|  PREDICTED: probable pectate lyase 8                546   0.0      
ref|NP_187357.1|  putative pectate lyase 8                              545   0.0      
gb|ABR18471.1|  unknown                                                 548   0.0      
ref|XP_006297766.1|  hypothetical protein CARUB_v10013802mg             541   0.0      
gb|AAM61584.1|  putative pectate lyase                                  542   0.0      
emb|CDY24654.1|  BnaA05g30530D                                          542   0.0      
gb|AAZ31564.1|  pectate lyase isoform 2                                 542   0.0      
ref|XP_009147117.1|  PREDICTED: probable pectate lyase 8                542   0.0      
gb|KHF99208.1|  hypothetical protein F383_08934                         543   0.0      
gb|AAZ31566.1|  pectate lyase isoform 4                                 541   0.0      
gb|AAK66160.1|  pectate lyase B                                         541   0.0      
ref|XP_009804999.1|  PREDICTED: probable pectate lyase 8                542   0.0      
emb|CAC80136.1|  pectate lyase II enzyme                                543   0.0      
ref|XP_010671109.1|  PREDICTED: probable pectate lyase 5                541   0.0      
gb|ABR26682.1|  pectate lyase                                           541   0.0      
gb|ABR17766.1|  unknown                                                 541   0.0      
ref|XP_004502359.1|  PREDICTED: probable pectate lyase 22-like          540   0.0      
ref|XP_009118623.1|  PREDICTED: probable pectate lyase 1 isoform X2     540   0.0      
emb|CAN78491.1|  hypothetical protein VITISV_004934                     539   0.0      
gb|ABO28477.1|  pectate lyase precursor                                 535   0.0      
gb|KFK31278.1|  hypothetical protein AALP_AA6G091900                    538   0.0      
ref|XP_010547043.1|  PREDICTED: probable pectate lyase 8                537   0.0      
ref|XP_007163700.1|  hypothetical protein PHAVU_001G256800g             536   0.0      
gb|AAB71208.1|  pectate lyase                                           536   0.0      
emb|CAN71915.1|  hypothetical protein VITISV_007917                     535   0.0      
gb|AAZ31563.1|  pectate lyase isoform 1                                 535   0.0      
gb|KFK39719.1|  hypothetical protein AALP_AA3G279700                    536   0.0      
gb|KHG26906.1|  hypothetical protein F383_09796                         536   0.0      
gb|ABR17791.1|  unknown                                                 536   0.0      
ref|XP_004247105.1|  PREDICTED: probable pectate lyase 8                536   0.0      
ref|XP_006350301.1|  PREDICTED: probable pectate lyase 20-like          536   0.0      
gb|KFK39718.1|  hypothetical protein AALP_AA3G279700                    533   0.0      
ref|XP_009102476.1|  PREDICTED: probable pectate lyase 10               536   0.0      
emb|CDY46471.1|  BnaC07g03950D                                          535   0.0      
ref|NP_568705.1|  putative pectate lyase 20                             535   0.0      
ref|XP_006280540.1|  hypothetical protein CARUB_v10026482mg             534   0.0      
ref|XP_002863927.1|  pectate lyase family protein                       534   0.0      
gb|AAM63307.1|  pectate lyase                                           534   0.0      
ref|XP_010450305.1|  PREDICTED: putative pectate lyase 14               535   0.0      
gb|KFK39788.1|  hypothetical protein AALP_AA3G287800                    535   0.0      
ref|XP_010111662.1|  hypothetical protein L484_017690                   533   0.0      
ref|XP_009118622.1|  PREDICTED: probable pectate lyase 1 isoform X1     534   0.0      
ref|XP_010435301.1|  PREDICTED: putative pectate lyase 14 isoform X1    534   0.0      
emb|CDX88845.1|  BnaA03g08040D                                          546   0.0      
ref|XP_010435302.1|  PREDICTED: putative pectate lyase 14 isoform X2    533   0.0      
emb|CDX77400.1|  BnaA07g05380D                                          534   0.0      
ref|XP_010440665.1|  PREDICTED: putative pectate lyase 14               531   0.0      
ref|XP_002885665.1|  pectate lyase family protein                       531   0.0      
ref|XP_002885608.1|  pectate lyase family protein                       531   0.0      
ref|XP_010522431.1|  PREDICTED: probable pectate lyase 1                530   0.0      
ref|XP_010442341.1|  PREDICTED: probable pectate lyase 20               530   0.0      
ref|XP_010439830.1|  PREDICTED: probable pectate lyase 20               529   0.0      
ref|XP_010488576.1|  PREDICTED: probable pectate lyase 10               530   0.0      
gb|ABG66730.2|  pectate lyase                                           527   0.0      
ref|NP_001190715.1|  putative pectate lyase 14                          530   0.0      
ref|XP_002863264.1|  pectate lyase family protein                       529   0.0      
ref|XP_010466894.1|  PREDICTED: probable pectate lyase 10               529   0.0      
ref|XP_006297684.1|  hypothetical protein CARUB_v10013715mg             529   0.0      
gb|ACK38190.1|  unknown                                                 525   0.0      
emb|CAB41931.1|  pectate lyase like protein                             528   0.0      
ref|XP_006297643.1|  hypothetical protein CARUB_v10013661mg             529   0.0      
ref|NP_193057.4|  putative pectate lyase 14                             527   0.0      
gb|ABG66729.2|  pectate lyase                                           526   0.0      
ref|XP_010513666.1|  PREDICTED: probable pectate lyase 10               528   0.0      
ref|XP_010488478.1|  PREDICTED: probable pectate lyase 9                528   0.0      
emb|CDY47327.1|  BnaCnng14640D                                          526   2e-180   
dbj|BAB10313.1|  pectate lyase                                          525   3e-180   
ref|XP_006285259.1|  hypothetical protein CARUB_v10006630mg             523   4e-180   
ref|XP_002446075.1|  hypothetical protein SORBIDRAFT_06g001410          524   4e-180   
gb|EPS60822.1|  hypothetical protein M569_13978                         523   5e-180   
ref|NP_189065.2|  putative pectate lyase 9                              526   6e-180   
emb|CDY05655.1|  BnaC02g38820D                                          525   8e-180   
ref|XP_009129753.1|  PREDICTED: probable pectate lyase 20               524   1e-179   
ref|XP_009102560.1|  PREDICTED: probable pectate lyase 9                525   1e-179   
emb|CDY66697.1|  BnaAnng22760D                                          525   1e-179   
emb|CDX77470.1|  BnaA07g06080D                                          525   2e-179   
emb|CDY33938.1|  BnaA02g30490D                                          523   3e-179   
gb|AAM12784.1|  putative pectate-lyase                                  519   5e-179   
gb|AFD54065.1|  nodulation pectate lyase mutant                         516   8e-178   
gb|KHN24117.1|  Putative pectate lyase 5                                518   9e-178   
gb|AES72123.2|  pectate lyase family protein                            515   3e-176   
ref|XP_008789532.1|  PREDICTED: probable pectate lyase 8                510   1e-175   
ref|XP_004306262.1|  PREDICTED: probable pectate lyase 12-like          515   3e-175   
ref|XP_010558823.1|  PREDICTED: probable pectate lyase 8                511   1e-174   
ref|XP_010037136.1|  PREDICTED: probable pectate lyase 12 isoform X2    509   5e-173   
ref|XP_006830637.1|  hypothetical protein AMTR_s00120p00111300          512   6e-173   
gb|KFK39766.1|  hypothetical protein AALP_AA3G285000                    505   3e-172   
ref|XP_010918903.1|  PREDICTED: probable pectate lyase 5                507   1e-171   
ref|XP_008382653.1|  PREDICTED: probable pectate lyase 10               502   1e-171   
ref|XP_003601872.1|  Pectate lyase                                      504   1e-171   
ref|XP_002519460.1|  Pectate lyase precursor, putative                  506   2e-171   
ref|NP_001290001.1|  pectate lyase-like protein 3 precursor             506   2e-171   
ref|XP_010933176.1|  PREDICTED: probable pectate lyase 5                505   5e-171   
ref|XP_008241385.1|  PREDICTED: probable pectate lyase 12               504   1e-170   
ref|XP_007201984.1|  hypothetical protein PRUPE_ppa004881mg             503   2e-170   



>ref|XP_011086701.1| PREDICTED: probable pectate lyase 5 [Sesamum indicum]
Length=401

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/391 (88%), Positives = 363/391 (93%), Gaps = 4/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT T SSP+PDPEL+VQEVNEKI     +RR L FLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15    APTLTLSSPFPDPELVVQEVNEKI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             RLADCAIGFGK AIGGRDGK+YVVTD+GDDAVNPKPGTLRYG IQ+EPLWIIFARDMVIK
Sbjct  72    RLADCAIGFGKHAIGGRDGKIYVVTDSGDDAVNPKPGTLRYGVIQNEPLWIIFARDMVIK  131

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH
Sbjct  132   LKQELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEH  191

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YG+RT+SDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLL
Sbjct  192   YGYRTVSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLL  251

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI
Sbjct  252   GHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTI  311

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAP+   NKEVTKHEDAPESQWK WNWRSEGDLMLNGAFF T   AGASS+YA
Sbjct  312   NSQGNRFLAPDRVDNKEVTKHEDAPESQWKNWNWRSEGDLMLNGAFF-TRSGAGASSNYA  370

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLVGS+T GAG+L CKKGK C
Sbjct  371   KASSLSARPSSLVGSMTMGAGSLSCKKGKRC  401



>ref|XP_009804979.1| PREDICTED: probable pectate lyase 5 [Nicotiana sylvestris]
Length=402

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/387 (88%), Positives = 361/387 (93%), Gaps = 3/387 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
             TFS+P PDPE+IVQEVN+KI NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQ LAD
Sbjct  19    TFSTPVPDPEVIVQEVNDKIFNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQMLAD  76

Query  302   CAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             CAIGFGKQAIGGRDGK+Y+VTDT DD VNPKPGTLRYGAIQ+EPLWIIF RDMVIKLKEE
Sbjct  77    CAIGFGKQAIGGRDGKIYIVTDTSDDPVNPKPGTLRYGAIQNEPLWIIFGRDMVIKLKEE  136

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             L++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEHYGWR
Sbjct  137   LMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHYGWR  196

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             TLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAIRGSTAITISNNYMTHHNKVMLLGHSD
Sbjct  197   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIRGSTAITISNNYMTHHNKVMLLGHSD  256

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             ++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINSQG
Sbjct  257   SFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAVGGSASPTINSQG  316

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPND FNKEVTKHEDAPES+WK WNWRSEGDLMLNGAFF T   AGAS SYAKASS
Sbjct  317   NRFLAPNDIFNKEVTKHEDAPESEWKTWNWRSEGDLMLNGAFF-TRSGAGASKSYAKASS  375

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             LSARPS+LV S+T  AGAL CKKGK C
Sbjct  376   LSARPSTLVSSITLNAGALGCKKGKRC  402



>ref|XP_009586995.1| PREDICTED: probable pectate lyase 5 [Nicotiana tomentosiformis]
Length=404

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/389 (88%), Positives = 360/389 (93%), Gaps = 3/389 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T + S   PDPE+IVQ+VN+KI NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRL
Sbjct  19    TFSTSVAVPDPEVIVQQVNDKIFNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRL  76

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  475
             ADCAIGFGKQAIGGRDGK+Y+VTDT DD VNPKPGTLRYGAIQDEPLWIIFARDMVIKLK
Sbjct  77    ADCAIGFGKQAIGGRDGKIYIVTDTSDDPVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  136

Query  476   EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYG  655
             EELI+NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEHYG
Sbjct  137   EELILNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHYG  196

Query  656   WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGH  835
             WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAIRGSTAITISNNYMTHHNKVMLLGH
Sbjct  197   WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIRGSTAITISNNYMTHHNKVMLLGH  256

Query  836   SDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINS  1015
             SD++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTINS
Sbjct  257   SDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAVGGSASPTINS  316

Query  1016  QGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyaka  1195
             QGNRFLAPND FNKEVTKHEDA ES+WK WNWRSEGDLMLNGAFF T   AGAS SYAKA
Sbjct  317   QGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLMLNGAFF-TRSGAGASKSYAKA  375

Query  1196  sslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SSLSARPS+LV S+T  AGAL CKKGK C
Sbjct  376   SSLSARPSTLVSSITVNAGALGCKKGKRC  404



>emb|CDP13269.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   674 bits (1740),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/391 (86%), Positives = 355/391 (91%), Gaps = 4/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             A T T SSP PDPE +VQEVNEKI     +RR L FLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  14    ASTNTLSSPVPDPESVVQEVNEKI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRQ  70

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
              LADCAIGFGK A+GGRDG++YVVTD GD  VNPKPGTLRYG IQDEPLWIIFARDMVI+
Sbjct  71    SLADCAIGFGKHAVGGRDGEIYVVTDNGDHPVNPKPGTLRYGVIQDEPLWIIFARDMVIQ  130

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNII+HGLNIHDC+QGGNA VRDSPEH
Sbjct  131   LKEELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIVHGLNIHDCKQGGNAYVRDSPEH  190

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNY+THHNKVMLL
Sbjct  191   FGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYLTHHNKVMLL  250

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI
Sbjct  251   GHSDTYLQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTI  310

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND F KEVTKHE APES+WK WNWRSEGDLMLNGAFFTT   AGASSSY+
Sbjct  311   NSQGNRFLAPNDIFTKEVTKHEVAPESEWKSWNWRSEGDLMLNGAFFTT-SGAGASSSYS  369

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KA SLSARPSSLV SLT GAG+L C+KG  C
Sbjct  370   KAYSLSARPSSLVASLTSGAGSLICRKGSRC  400



>ref|XP_010320956.1| PREDICTED: probable pectate lyase 5 [Solanum lycopersicum]
Length=401

 Score =   674 bits (1739),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/390 (87%), Positives = 359/390 (92%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P  TFSS  PDPE+IVQ+VNEKI     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16    PIFTFSSHVPDPEVIVQQVNEKI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGKQAIGG+DGK+YVVTDT DD VNPKPGTLRYGAIQDEPLWIIF+RDMVIKL
Sbjct  73    LADCAIGFGKQAIGGKDGKIYVVTDTSDDPVNPKPGTLRYGAIQDEPLWIIFSRDMVIKL  132

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP+HY
Sbjct  133   KEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPQHY  192

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNYMTHHNKVMLLG
Sbjct  193   GWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYMTHHNKVMLLG  252

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  253   HSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIN  312

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPND FNKEVTKHEDA ES+WK WNWRSEGDLMLNGAFF     AGASSSYAK
Sbjct  313   SQGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLMLNGAFF-IRSGAGASSSYAK  371

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSLSARPS+LV S+T  AGAL CKKGK C
Sbjct  372   ASSLSARPSTLVNSITMNAGALGCKKGKRC  401



>ref|XP_006341783.1| PREDICTED: probable pectate lyase 5-like [Solanum tuberosum]
Length=401

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/390 (87%), Positives = 358/390 (92%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P  TFSS  PDPE+IVQEVNEKI     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16    PIFTFSSHVPDPEVIVQEVNEKI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGKQAIGG+DG +Y+VTDT DD VNPKPGTLRYGAIQDEPLWIIF+RDMVIKL
Sbjct  73    LADCAIGFGKQAIGGKDGNIYIVTDTSDDPVNPKPGTLRYGAIQDEPLWIIFSRDMVIKL  132

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL++NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP+HY
Sbjct  133   KEELMLNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPQHY  192

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNN+MTHHNKVMLLG
Sbjct  193   GWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNFMTHHNKVMLLG  252

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSDT+ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  253   HSDTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIN  312

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPND FNKEVTKHEDA ES+WK WNWRSEGDLMLNGAFF     AGASSSYAK
Sbjct  313   SQGNRFLAPNDIFNKEVTKHEDAAESEWKNWNWRSEGDLMLNGAFF-IRSGAGASSSYAK  371

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSLSARPS+LV S+T  AGAL CKKGK C
Sbjct  372   ASSLSARPSTLVNSITMNAGALGCKKGKKC  401



>ref|XP_011029589.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   667 bits (1722),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/392 (86%), Positives = 355/392 (91%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP     SP  DPEL+V+EV+  I     +RRKLGFLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15    APNFISCSPVQDPELVVEEVHRSI---NASRRKLGFLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+YVVTD G DD VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72    RLADCAIGFGKHAIGGRDGKIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP 
Sbjct  132   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPS  191

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVML
Sbjct  192   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVML  251

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HW+MYAIGGSADPT
Sbjct  252   LGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWKMYAIGGSADPT  311

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRFNKEVTKHEDAP+S+WKGWNWRSEGDL+LNGAFFT    AGASSSY
Sbjct  312   INSQGNRFLAPNDRFNKEVTKHEDAPQSEWKGWNWRSEGDLLLNGAFFTA-SGAGASSSY  370

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSLV S+T GAG+L CKKG  C
Sbjct  371   AKASSLGARPSSLVSSITAGAGSLVCKKGSRC  402



>gb|KHN34377.1| Putative pectate lyase 22 [Glycine soja]
Length=406

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/391 (85%), Positives = 358/391 (92%), Gaps = 3/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP  DPE + QE+N KI NA++ARR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  18    PTLISSSPVQDPEFVAQEINRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP H
Sbjct  137   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  197   YGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  257   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+AP+DRF+KEVTKHEDA ES+WKGWNWRSEGDL++NGAFFT    AGASSSYA
Sbjct  317   NSQGNRFVAPDDRFSKEVTKHEDAAESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSSLVGS+T GAGAL C+KG  C
Sbjct  376   RASSLSARPSSLVGSITTGAGALTCRKGSRC  406



>gb|EYU30593.1| hypothetical protein MIMGU_mgv1a007569mg [Erythranthe guttata]
Length=403

 Score =   667 bits (1720),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/389 (84%), Positives = 356/389 (92%), Gaps = 4/389 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T TFSSP P PEL+VQ+VNE+I    ++RR LGFLSC TGNPIDDCWRCDP+WE NR+RL
Sbjct  19    TPTFSSPLPHPELVVQQVNEQI---NVSRRSLGFLSCNTGNPIDDCWRCDPDWEKNRKRL  75

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  475
             ADCAIGFGK AIGGRDGK Y VTD+GDDAVNPKPGTLRYG IQ EPLWI FARDMVIKLK
Sbjct  76    ADCAIGFGKHAIGGRDGKFYTVTDSGDDAVNPKPGTLRYGVIQSEPLWITFARDMVIKLK  135

Query  476   EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYG  655
             +EL++NSFKTIDGRGASVHIAGGPCITIQYVTN+I+HGLNIHDC+QGGNA VRDSP+HYG
Sbjct  136   QELMLNSFKTIDGRGASVHIAGGPCITIQYVTNVIVHGLNIHDCKQGGNAYVRDSPDHYG  195

Query  656   WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGH  835
             WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNY THHNKVMLLGH
Sbjct  196   WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYFTHHNKVMLLGH  255

Query  836   SDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINS  1015
             SD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINS
Sbjct  256   SDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINS  315

Query  1016  QGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyaka  1195
             QGNRFLAP+   NKEVTKHEDAP+S+WK WNWRSEGDL+LNGAFF T   AG+SS+YAKA
Sbjct  316   QGNRFLAPDRANNKEVTKHEDAPQSKWKNWNWRSEGDLLLNGAFF-TRSGAGSSSNYAKA  374

Query  1196  sslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SSLSARPSSLVG++T GAG+L CKKG+ C
Sbjct  375   SSLSARPSSLVGTITVGAGSLGCKKGRRC  403



>ref|XP_003549832.1| PREDICTED: probable pectate lyase 18 isoform 1 [Glycine max]
Length=406

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/391 (85%), Positives = 358/391 (92%), Gaps = 3/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP  DPE + QEV+ KI NA++ARR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  18    PTLISSSPVQDPEFVAQEVHRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP H
Sbjct  137   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GST ITISNNYMTHH+KVMLL
Sbjct  197   YGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTGITISNNYMTHHDKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  257   GHSDSYTQDKSMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+AP+DRF+KEVTKHEDAPES+WKGWNWRSEGDL++NGAFFT    AGASSSYA
Sbjct  317   NSQGNRFVAPDDRFSKEVTKHEDAPESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSSLVGS+T GAGAL C+KG  C
Sbjct  376   RASSLSARPSSLVGSITTGAGALSCRKGSRC  406



>ref|XP_008340139.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008361827.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=401

 Score =   664 bits (1712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/390 (84%), Positives = 349/390 (89%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP  DPEL++QEV E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16    PTTISSSPVKDPELVMQEVQESI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWIIF RDM IKL
Sbjct  73    LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIIFQRDMTIKL  132

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
              EEL+MNSFKTIDGRG+SVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH+
Sbjct  133   NEELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHF  192

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLG
Sbjct  193   GWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLG  252

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGLIQRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  253   HSDSYTQDKNMQVTIAFNHFGEGLIQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTIN  312

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPNDRFNKEVTKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGAS+SY+K
Sbjct  313   SQGNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASTSYSK  371

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSLSARPSSLV SLT GAG+L CKKG  C
Sbjct  372   ASSLSARPSSLVSSLTAGAGSLRCKKGSRC  401



>ref|XP_007155507.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
 gb|ESW27501.1| hypothetical protein PHAVU_003G207400g [Phaseolus vulgaris]
Length=406

 Score =   663 bits (1711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/386 (85%), Positives = 357/386 (92%), Gaps = 3/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP  +P+L+ QEVN KI NA++ARR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  23    SSPVQNPQLVAQEVNRKI-NASVARRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  81

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGG++GK+YVVTD+ DD AV PKPGTLRY  IQ+EPLWIIFARDMVIKLKEEL
Sbjct  82    IGFGKNAIGGKNGKIYVVTDSSDDDAVTPKPGTLRYAVIQEEPLWIIFARDMVIKLKEEL  141

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGWRT
Sbjct  142   IMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGWRT  201

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+
Sbjct  202   VSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDS  261

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  262   YTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGN  321

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RF+AP+DRF+KEVTKHEDAPES+WKGWNWRSEGDL++NGAFFT    AGASSSYA+ASSL
Sbjct  322   RFVAPDDRFSKEVTKHEDAPESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYARASSL  380

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARPSSLVGS+T  AGAL C+KG  C
Sbjct  381   SARPSSLVGSITTNAGALTCRKGSRC  406



>ref|NP_001242543.1| uncharacterized protein LOC100779940 precursor [Glycine max]
 gb|ACU21247.1| unknown [Glycine max]
Length=406

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/391 (84%), Positives = 356/391 (91%), Gaps = 3/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPE + QEVN KI NA++ARR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  18    PALISSSPVQDPEFVAQEVNRKI-NASVARRNLGYLSCATGNPIDDCWRCDPNWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEE IMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP H
Sbjct  137   LKEERIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  197   YGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  257   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NS+GNRF+AP+DRF+KEVTKHEDA ES+WKGWNWRSEGDL++NGAFFT    AGASSSYA
Sbjct  317   NSRGNRFVAPDDRFSKEVTKHEDAAESEWKGWNWRSEGDLLVNGAFFTA-SGAGASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSSLVGS+T GAGAL C+KG  C
Sbjct  376   RASSLSARPSSLVGSITTGAGALTCRKGSRC  406



>ref|XP_010250930.1| PREDICTED: probable pectate lyase 5 [Nelumbo nucifera]
Length=406

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/390 (85%), Positives = 352/390 (90%), Gaps = 5/390 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T   SS   DPEL+V+EV   I      RR LGFLSCGTGNPIDDCWRCDPNWE NRQRL
Sbjct  21    TLINSSAVQDPELVVKEVERSI---NTTRRNLGFLSCGTGNPIDDCWRCDPNWEKNRQRL  77

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADCAIGFGKQAIGGRDG++YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+L
Sbjct  78    ADCAIGFGKQAIGGRDGRIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIQL  137

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL+MNSFKTIDGRGASVHIAGGPCITIQYV NIIIHGLNIHDC+QGGNANVRDSPEHY
Sbjct  138   KEELLMNSFKTIDGRGASVHIAGGPCITIQYVNNIIIHGLNIHDCKQGGNANVRDSPEHY  197

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDG+SIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLG
Sbjct  198   GWRTISDGDGISIFGGSHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLG  257

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSDTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  258   HSDTYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIN  317

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRF+AP+DRF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAK
Sbjct  318   SQGNRFVAPDDRFSKEVTKHEDAPESEWKNWNWRSEGDLMMNGAFFTP-SGAGASSSYAK  376

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSSLVGS+T  AGAL CKKG  C
Sbjct  377   ASSLGARPSSLVGSITMSAGALGCKKGSRC  406



>ref|XP_008221954.1| PREDICTED: probable pectate lyase 5 [Prunus mume]
Length=401

 Score =   659 bits (1700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 349/390 (89%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P  T SSP  DPEL++QEV + I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16    PAFTSSSPVQDPELVIQEVQKSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGRDGK+YVVTD GD  VNPKPGTLRYG IQD+PLWI+F  DMVIKL
Sbjct  73    LADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQDQPLWIVFKGDMVIKL  132

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HY
Sbjct  133   KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPSHY  192

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLG
Sbjct  193   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLG  252

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  253   HSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTIN  312

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPNDRFNKE+TKHEDAP+ +W  WNWRS GDL+LNGAFFT+   AGASSSYA+
Sbjct  313   SQGNRFLAPNDRFNKEITKHEDAPQKEWSKWNWRSSGDLLLNGAFFTS-SGAGASSSYAR  371

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSSLV SLT GAG+L C+KG  C
Sbjct  372   ASSLGARPSSLVSSLTAGAGSLKCRKGSRC  401



>ref|XP_010100325.1| hypothetical protein L484_027633 [Morus notabilis]
 gb|EXB82459.1| hypothetical protein L484_027633 [Morus notabilis]
Length=406

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/391 (83%), Positives = 351/391 (90%), Gaps = 2/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             A T   SSP PD EL+VQEV + I N +I RR LG+LSCGTGNPIDDCWRCD NWE NRQ
Sbjct  18    ASTLISSSPVPDSELVVQEVQKSI-NESINRRNLGYLSCGTGNPIDDCWRCDANWEKNRQ  76

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             RLA CAIGFGK A+GGRDGK+YVVTD GD  VNPKPGTLRYG IQ+EPLWIIF RDMVIK
Sbjct  77    RLAGCAIGFGKNAVGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL++NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHGLNIHDC+QGGNA VRDSP H
Sbjct  137   LKEELMVNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGLNIHDCKQGGNAYVRDSPSH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRTLSDGDGVSIFGGSH+WVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLL
Sbjct  197   YGWRTLSDGDGVSIFGGSHIWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI
Sbjct  257   GHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPN++ NKE+TKHEDA +S+WK WNWRS GDL++NGAFFT    AGASS+YA
Sbjct  317   NSQGNRFLAPNNKDNKEITKHEDAAQSEWKKWNWRSSGDLLMNGAFFTA-SGAGASSNYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLV ++T GAG+L C+KG  C
Sbjct  376   KASSLSARPSSLVSTITSGAGSLKCRKGSRC  406



>ref|XP_010102919.1| hypothetical protein L484_018936 [Morus notabilis]
 gb|EXB94437.1| hypothetical protein L484_018936 [Morus notabilis]
Length=410

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/386 (85%), Positives = 354/386 (92%), Gaps = 3/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP PDPE +V EV+  I NA+++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  27    SSPTPDPERVVGEVHRSI-NASVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  85

Query  308   IGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK A+GGRDGK+YVVTD+ D D VNPKPGTLRY  IQDEPLWIIFARDMVIKLKEEL
Sbjct  86    IGFGKNAVGGRDGKIYVVTDSSDNDVVNPKPGTLRYAVIQDEPLWIIFARDMVIKLKEEL  145

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+ GGNA VRDSP HYGWRT
Sbjct  146   IMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKPGGNAMVRDSPRHYGWRT  205

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD+
Sbjct  206   ISDGDGVSIFGGSHVWVDHCSLSNCQDGLIDAIHGSTAITLSNNYMTHHDKVMLLGHSDS  265

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  266   YTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  325

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAP+ RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSYAKASSL
Sbjct  326   RFLAPDKRFSKEVTKHEDAPESEWKNWNWRSEGDLMVNGAFFTA-SGAGASSSYAKASSL  384

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              ARPS+LVG++T  AGAL C+KG  C
Sbjct  385   GARPSTLVGTITTNAGALSCRKGSRC  410



>ref|XP_009359258.1| PREDICTED: probable pectate lyase 5 [Pyrus x bretschneideri]
Length=401

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/390 (85%), Positives = 351/390 (90%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP  DP+L++QEV+E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  16    PTTISSSPVKDPQLVMQEVHESI---NASRRSLGYLSCGTGNPIDDCWRCDPNWEKNRQR  72

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWIIF RDM IKL
Sbjct  73    LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIIFQRDMTIKL  132

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL+MNSFKTIDGRG+SVHIAGGPCITIQYVTNIIIHGLNIHDC QGGNA VRDSPEH+
Sbjct  133   KEELMMNSFKTIDGRGSSVHIAGGPCITIQYVTNIIIHGLNIHDCTQGGNAYVRDSPEHF  192

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLG
Sbjct  193   GWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLG  252

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGLIQRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  253   HSDSYTQDKNMQVTIAFNHFGEGLIQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTIN  312

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPNDRFNKEVTKHEDAP+++W  WNWRS GDL+LNGAFFT    AGASSSY+K
Sbjct  313   SQGNRFLAPNDRFNKEVTKHEDAPQTEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYSK  371

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSLSARPSSLV SLT GAG+L CKKG  C
Sbjct  372   ASSLSARPSSLVSSLTTGAGSLRCKKGSRC  401



>ref|XP_002285340.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI16836.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/390 (85%), Positives = 356/390 (91%), Gaps = 5/390 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T   SSP  DPEL+V+EV+++I     +RR LGFLSCGTGNPIDDCWRCDP+WE NRQ L
Sbjct  18    TFISSSPVQDPELVVEEVHKRI---NASRRNLGFLSCGTGNPIDDCWRCDPDWEKNRQGL  74

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADC+IGFG+ AIGGRDG++YVVTD+GD D VNPKPGTLRY  IQ EPLWIIF RDMVIKL
Sbjct  75    ADCSIGFGRHAIGGRDGEIYVVTDSGDYDPVNPKPGTLRYAVIQKEPLWIIFQRDMVIKL  134

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNANVRDSP+HY
Sbjct  135   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNANVRDSPDHY  194

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNYMTHHNKVMLLG
Sbjct  195   GWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLVDAIHGSTAITISNNYMTHHNKVMLLG  254

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HWEMYAIGGSA+PTIN
Sbjct  255   HSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWEMYAIGGSAEPTIN  314

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAP+DRF+KEVTKHEDAP+SQWK WNWRSEGDL+LNGAFFT    AGASSSYAK
Sbjct  315   SQGNRFLAPDDRFSKEVTKHEDAPQSQWKNWNWRSEGDLLLNGAFFTA-SGAGASSSYAK  373

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSSL+ ++T GAGAL CKKGK C
Sbjct  374   ASSLGARPSSLITTITNGAGALNCKKGKRC  403



>ref|XP_008389758.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/390 (84%), Positives = 349/390 (89%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP  DPEL++Q+V E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PTTISSSPVKDPELVMQQVQESI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWI+F RDM IKL
Sbjct  74    LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIVFQRDMTIKL  133

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH+
Sbjct  134   KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHF  193

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHH+KVMLLG
Sbjct  194   GWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHDKVMLLG  253

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  254   HSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTIN  313

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPNDRFNKEVTKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGASSSYAK
Sbjct  314   SQGNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYAK  372

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSSLV SLT GAG+L CKKG  C
Sbjct  373   ASSLGARPSSLVSSLTAGAGSLRCKKGSRC  402



>ref|XP_010023435.1| PREDICTED: probable pectate lyase 5 [Eucalyptus grandis]
 gb|KCW59688.1| hypothetical protein EUGRSUZ_H02448 [Eucalyptus grandis]
Length=406

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/390 (84%), Positives = 357/390 (92%), Gaps = 6/390 (2%)
 Frame = +2

Query  122   TFSSPYP--DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
              F+SP P  DPEL+VQEVNE I NA+  RR LGFLSCGTGNPIDDCWRCDPNWE NRQRL
Sbjct  20    AFASPSPVQDPELVVQEVNESIFNAS--RRNLGFLSCGTGNPIDDCWRCDPNWEKNRQRL  77

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADCAIGFGK AIGGRDGK+YVVTD GDD  VNPK GTLR+  IQ+EPLWI+FARDMVI+L
Sbjct  78    ADCAIGFGKHAIGGRDGKIYVVTDPGDDNPVNPKLGTLRHAVIQNEPLWIVFARDMVIRL  137

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VRDSP+HY
Sbjct  138   KEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAYVRDSPDHY  197

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSH+WVDHCSLSNCRDGL+DAIRG+TAIT+SNNY+THHNKVMLLG
Sbjct  198   GWRTVSDGDGVSIFGGSHIWVDHCSLSNCRDGLIDAIRGATAITLSNNYLTHHNKVMLLG  257

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PTIN
Sbjct  258   HSDSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAVGGSAAPTIN  317

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRF+AP+D FNKEVTKHEDAP+S+WK WNWRSEGDLM+NGAFFT    AGASSSYAK
Sbjct  318   SQGNRFVAPDDAFNKEVTKHEDAPQSEWKHWNWRSEGDLMVNGAFFTA-SGAGASSSYAK  376

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSS+VGS+T  AG L CKKGK C
Sbjct  377   ASSLGARPSSVVGSITASAGTLGCKKGKRC  406



>ref|XP_007222794.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
 gb|EMJ23993.1| hypothetical protein PRUPE_ppa006665mg [Prunus persica]
Length=401

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/390 (83%), Positives = 347/390 (89%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPEL++QEV + I     +RR LG+LSCGTGNP+DDCWRCDPNWE NRQR
Sbjct  16    PAFISSSPVQDPELVIQEVQKSI---NASRRNLGYLSCGTGNPMDDCWRCDPNWEKNRQR  72

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGRDGK+YVVTD GD  VNPKPGTLRYG IQD+PLWI+F  DMVIKL
Sbjct  73    LADCAIGFGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQDQPLWIVFKGDMVIKL  132

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HY
Sbjct  133   KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPSHY  192

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GST+ITISNNYMTHHNKVMLLG
Sbjct  193   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTSITISNNYMTHHNKVMLLG  252

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  253   HSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTIN  312

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPNDRFNKE+TKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGASSSYA+
Sbjct  313   SQGNRFLAPNDRFNKEITKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYAR  371

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSSLV SLT GAG+L C+KG  C
Sbjct  372   ASSLGARPSSLVSSLTAGAGSLKCRKGSRC  401



>ref|XP_010663062.1| PREDICTED: probable pectate lyase 5 [Vitis vinifera]
 emb|CBI14899.3| unnamed protein product [Vitis vinifera]
Length=403

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/391 (84%), Positives = 351/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPEL++QEV+  I  +   RR LG+LSCG+GNPIDDCWRC+ NWE NRQ 
Sbjct  17    PILIASSPVQDPELVIQEVHRSINES---RRNLGYLSCGSGNPIDDCWRCNANWEKNRQS  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+YVVTD+ DD  VNPKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  74    LADCAIGFGKNAIGGKNGKIYVVTDSSDDDVVNPKPGTLRYAVIQDEPLWIIFARDMVIK  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGN NVRDSP H
Sbjct  134   LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNTNVRDSPSH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YG+RT+SDGDGVSIFGGSH+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  194   YGFRTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI
Sbjct  254   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPNDRF+KEVTKHEDAPESQWK WNWRSEGDLMLNGA+FT    AGASSSYA
Sbjct  314   NSQGNRFLAPNDRFSKEVTKHEDAPESQWKNWNWRSEGDLMLNGAYFTP-SGAGASSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPSSLV S+TG AGAL CKKG  C
Sbjct  373   RASSLGARPSSLVASITGSAGALSCKKGSRC  403



>dbj|BAB59066.1| pectate lyase [Salix gilgiana]
Length=409

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/392 (84%), Positives = 352/392 (90%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP     SP  DPE++V+EV+  I     +RRKLGFLSCGTGNPIDDCWRCDP W  NRQ
Sbjct  22    APNFISCSPVQDPEVVVEEVHRSI---NASRRKLGFLSCGTGNPIDDCWRCDPKWGENRQ  78

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+Y VTD+GDD  VNPKPGTLRY  IQDEPLWI+FARDMVI
Sbjct  79    RLADCAIGFGKHAIGGRDGKIYAVTDSGDDDPVNPKPGTLRYAVIQDEPLWIVFARDMVI  138

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KL+EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC++GGNA+VRDSP 
Sbjct  139   KLREELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGVNIHDCKRGGNAHVRDSPS  198

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVML
Sbjct  199   HYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVML  258

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSADPT
Sbjct  259   LGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSADPT  318

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRFNKEVTKHEDAP+S WKGWNWRSEGDL+LNGAFFT    AGASSSY
Sbjct  319   INSQGNRFLAPNDRFNKEVTKHEDAPQSAWKGWNWRSEGDLLLNGAFFTA-SGAGASSSY  377

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL AR SSLV S+T GAG+L CKKG  C
Sbjct  378   AKASSLGARSSSLVSSITAGAGSLVCKKGSRC  409



>ref|XP_004515847.1| PREDICTED: probable pectate lyase 22-like [Cicer arietinum]
Length=411

 Score =   655 bits (1691),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/386 (84%), Positives = 356/386 (92%), Gaps = 2/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP P+P L+ Q+V  KI N +IARR LG+LSCG+GNPIDDCWRCDPNWE NRQRLADCA
Sbjct  27    SSPLPNPHLVSQQVTRKI-NESIARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCA  85

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGG++GK+YVVTD+ DD  VNPKPGTLRY  IQDEPLWIIF RDMVI+LKEEL
Sbjct  86    IGFGKNAIGGKNGKIYVVTDSKDDDPVNPKPGTLRYAVIQDEPLWIIFERDMVIQLKEEL  145

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP HYGWRT
Sbjct  146   IMNSFKTIDGRGASVHIANGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPRHYGWRT  205

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSDT
Sbjct  206   VSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDT  265

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  266   YTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  325

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RF+APNDRF+KEVTKHEDA E++WKGWNWR+EGDLM+NGAFFT+SG+ G+SSSYA+ASSL
Sbjct  326   RFVAPNDRFSKEVTKHEDAAENEWKGWNWRTEGDLMVNGAFFTSSGAGGSSSSYARASSL  385

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARPSSLVG++T  AGAL C+KG  C
Sbjct  386   SARPSSLVGTITTTAGALNCRKGSRC  411



>ref|XP_008350945.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
 ref|XP_008350949.1| PREDICTED: probable pectate lyase 5 [Malus domestica]
Length=402

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/390 (84%), Positives = 348/390 (89%), Gaps = 4/390 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP   PEL++Q+V E I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PTTISSSPVKXPELVMQQVQESI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGRDGK+YVVTD+GD  VNPKPGTLRYG IQ+EPLWI+F RDM IKL
Sbjct  74    LADCAIGFGKHAIGGRDGKIYVVTDSGDHPVNPKPGTLRYGVIQNEPLWIVFQRDMTIKL  133

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSPEH+
Sbjct  134   KEELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPEHF  193

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSHVWVDH SLSNCRDGL+DAI GST+ITISNNYMTHH+KVMLLG
Sbjct  194   GWRTLSDGDGVSIFGGSHVWVDHNSLSNCRDGLIDAIHGSTSITISNNYMTHHDKVMLLG  253

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  254   HSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTIN  313

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAPNDRFNKEVTKHEDAP+ +W  WNWRS GDL+LNGAFFT    AGASSSYAK
Sbjct  314   SQGNRFLAPNDRFNKEVTKHEDAPQKEWSKWNWRSSGDLLLNGAFFTA-SGAGASSSYAK  372

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSL ARPSSLV SLT GAG+L CKKG  C
Sbjct  373   ASSLGARPSSLVSSLTAGAGSLRCKKGSRC  402



>ref|XP_003608909.1| Pectate lyase [Medicago truncatula]
 gb|AES91106.1| pectate lyase family protein [Medicago truncatula]
Length=407

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/384 (85%), Positives = 356/384 (93%), Gaps = 2/384 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P  DP+L+ QEVN KI N ++ARR LG+LSCG+GNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  25    PLQDPDLVTQEVNRKI-NGSLARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIG  83

Query  314   FGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FGK AIGG++GK+YVVTD+GDD  V PKPGTLR+  IQDEPLWIIFARDMVI+LKEELIM
Sbjct  84    FGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRFAVIQDEPLWIIFARDMVIQLKEELIM  143

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGWRT+S
Sbjct  144   NSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPGHYGWRTVS  203

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSDTY 
Sbjct  204   DGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDTYT  263

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF
Sbjct  264   QDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRF  323

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
             +AP+DRF+KEVTKHEDAPE +WKGWNWRSEGDL++NGAFFT SG+ GASSSYA+ASSLSA
Sbjct  324   VAPDDRFSKEVTKHEDAPEGEWKGWNWRSEGDLLINGAFFTPSGAGGASSSYARASSLSA  383

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             RPSSLVG++T GAG L CKKG  C
Sbjct  384   RPSSLVGTITTGAGVLGCKKGSRC  407



>ref|XP_004501839.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=407

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/392 (83%), Positives = 354/392 (90%), Gaps = 3/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              PT   SS   +P+L+VQEVN KI NA+++RRKLG+LSCG+GNPIDDCWRCD NWE NRQ
Sbjct  18    TPTLISSSSLQNPQLVVQEVNRKI-NASVSRRKLGYLSCGSGNPIDDCWRCDSNWEKNRQ  76

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+YVV D  D DAVNPKPGTLRY  IQ+EPLWIIFARDMVI
Sbjct  77    RLADCAIGFGKNAIGGRDGKIYVVNDDSDNDAVNPKPGTLRYAVIQNEPLWIIFARDMVI  136

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG+NIHDC+QGGNA VRDSP 
Sbjct  137   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGINIHDCKQGGNAMVRDSPG  196

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  197   HYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVML  256

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +D+ MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PT
Sbjct  257   LGHSDSYTEDRNMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPT  316

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRF+APNDRF+KEVTK+EDA ES+WK WNWRSEGDLMLNGAFFT    A +SSSY
Sbjct  317   INSQGNRFVAPNDRFSKEVTKYEDASESEWKNWNWRSEGDLMLNGAFFTA-SGAESSSSY  375

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLVGS+T  AG L CKKG  C
Sbjct  376   ARASSLSARPSSLVGSITVAAGTLNCKKGSPC  407



>emb|CAN76500.1| hypothetical protein VITISV_004734 [Vitis vinifera]
Length=403

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/391 (84%), Positives = 350/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPEL+ QEV+  I  +   RR LG+LSCG+GNPIDDCWRC+ NWE NRQ 
Sbjct  17    PILIASSPVQDPELVXQEVHRSINES---RRNLGYLSCGSGNPIDDCWRCNANWEKNRQS  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+YVVTD+ DD  VNPKPGTLRY  IQDEPLWIIFARDMVIK
Sbjct  74    LADCAIGFGKNAIGGKNGKIYVVTDSSDDDVVNPKPGTLRYAVIQDEPLWIIFARDMVIK  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGN NVRDSP H
Sbjct  134   LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNTNVRDSPSH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YG+RT+SDGDGVSIFGGSH+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  194   YGFRTISDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI
Sbjct  254   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPNDRF+KEVTKHEDAPESQWK WNWRSEGDLMLNGA+FT    AGASSSYA
Sbjct  314   NSQGNRFLAPNDRFSKEVTKHEDAPESQWKNWNWRSEGDLMLNGAYFTP-SGAGASSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPSSLV S+TG AGAL CKKG  C
Sbjct  373   RASSLGARPSSLVASITGSAGALSCKKGSRC  403



>gb|KHG22755.1| hypothetical protein F383_29653 [Gossypium arboreum]
Length=408

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/392 (82%), Positives = 349/392 (89%), Gaps = 2/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT  FSSP   PE IVQ+VNE I N TIARR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  18    APTSIFSSPLQHPEHIVQQVNESIMNGTIARRNLGFLSCGTGNPIDDCWRCDPQWEKNRQ  77

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGG+ GK+YVVTD  D D +NPKPGTLR+ AIQ +PLWI+FA DMVI
Sbjct  78    RLADCAIGFGKHAIGGKHGKIYVVTDPSDRDPINPKPGTLRHAAIQVQPLWIVFAHDMVI  137

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLK+EL+MNSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHDC++GGNA VRDSP 
Sbjct  138   KLKQELLMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGISIHDCKRGGNAYVRDSPS  197

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGD VSIFGGSHVWVDHCSLSNC DGLVDAI+GSTAITISNNYMTHHNKVML
Sbjct  198   HYGWRTISDGDAVSIFGGSHVWVDHCSLSNCTDGLVDAIQGSTAITISNNYMTHHNKVML  257

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT
Sbjct  258   LGHSDSYKQDKNMQVTIAFNHFGERLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  317

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRF+AP++  +KEVTKHEDAP+S+WK WNWRSEGDLMLNGAFFT     G SSSY
Sbjct  318   INSQGNRFVAPDNVNSKEVTKHEDAPQSKWKEWNWRSEGDLMLNGAFFTA-SGKGTSSSY  376

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSLV SLT GAGAL CKKG  C
Sbjct  377   AKASSLGARPSSLVNSLTAGAGALVCKKGSRC  408



>gb|AFK44189.1| unknown [Medicago truncatula]
Length=407

 Score =   652 bits (1683),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/384 (84%), Positives = 355/384 (92%), Gaps = 2/384 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P  DP+L+ QEVN KI N ++ARR LG+LSCG+GNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  25    PLQDPDLVTQEVNRKI-NGSLARRNLGYLSCGSGNPIDDCWRCDPNWEKNRQRLADCAIG  83

Query  314   FGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FGK AIGG++GK+YVVTD+GDD  V PKPGTLR+  IQDEPLWIIFARDMVI+LKEELIM
Sbjct  84    FGKNAIGGKNGKIYVVTDSGDDDPVTPKPGTLRFAVIQDEPLWIIFARDMVIQLKEELIM  143

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGWRT+S
Sbjct  144   NSFKTIDGRGASVHIAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSPGHYGWRTVS  203

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSDTY 
Sbjct  204   DGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDTYT  263

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF
Sbjct  264   QDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRF  323

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
             +AP+DRF+KEVTK EDAPE +WKGWNWRSEGDL++NGAFFT SG+ GASSSYA+ASSLSA
Sbjct  324   VAPDDRFSKEVTKQEDAPEGEWKGWNWRSEGDLLINGAFFTPSGAGGASSSYARASSLSA  383

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             RPSSLVG++T GAG L CKKG  C
Sbjct  384   RPSSLVGTITTGAGVLGCKKGSRC  407



>gb|KHG22990.1| hypothetical protein F383_28754 [Gossypium arboreum]
Length=404

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/391 (84%), Positives = 350/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P+   SSP  DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18    PSPISSSPVQDPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75    LADCAIGFGKNAIGGRDGKIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMTIR  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP H
Sbjct  135   LKEELLMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPRH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT+SDGDGVSIFGGSHVWVDH SLSNC DGLVDAI GSTAITISNNYMTHH+KVMLL
Sbjct  195   YGWRTISDGDGVSIFGGSHVWVDHNSLSNCNDGLVDAIHGSTAITISNNYMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF APNDRF+KEVTKHEDAPES WK WNWRSEGDLM+NGAFFT    AGASSSY+
Sbjct  315   NSQGNRFTAPNDRFSKEVTKHEDAPESDWKNWNWRSEGDLMVNGAFFTG-SGAGASSSYS  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSL ARPSSLV ++T  AG+L CKKG  C
Sbjct  374   KASSLGARPSSLVATITTNAGSLNCKKGSRC  404



>ref|XP_011086987.1| PREDICTED: probable pectate lyase 22 [Sesamum indicum]
Length=404

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/392 (84%), Positives = 353/392 (90%), Gaps = 6/392 (2%)
 Frame = +2

Query  113   PTCTFSSP-YPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             P+   SSP   DPEL+VQEV+ K+    ++RRKLGFLSC TGNPIDDCWRCDPNWE NRQ
Sbjct  17    PSLIASSPTLQDPELVVQEVHRKL---NVSRRKLGFLSCNTGNPIDDCWRCDPNWEENRQ  73

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             +LADCAIGFGK AIGG+DG++YVVTD+GDD  VNPKPGTLRY  IQD+PLWIIFARDMVI
Sbjct  74    KLADCAIGFGKNAIGGKDGEIYVVTDSGDDDPVNPKPGTLRYAVIQDQPLWIIFARDMVI  133

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LKEELIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP 
Sbjct  134   QLKEELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGVHIHDCKQGGNAMVRDSPR  193

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVML
Sbjct  194   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVML  253

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD Y QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  254   LGHSDLYPQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPT  313

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRFNKEVTK+EDA ES+WK WNWRSEGDLMLNGAFFT    AGASSSY
Sbjct  314   INSQGNRFLAPNDRFNKEVTKYEDAAESEWKNWNWRSEGDLMLNGAFFTA-SGAGASSSY  372

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSL+ S+T  +GAL C+KG  C
Sbjct  373   AKASSLGARPSSLITSITAASGALNCRKGSRC  404



>ref|XP_011005597.1| PREDICTED: probable pectate lyase 18 [Populus euphratica]
Length=403

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/391 (83%), Positives = 355/391 (91%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPEL+VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PALISSSPVQDPELVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  74    LADCAIGFGKNAIGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQ  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGNA VRDSP+H
Sbjct  134   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNAMVRDSPQH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+HVWVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLL
Sbjct  194   FGWRTISDGDGVSIFGGTHVWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  254   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL++NGAFFT    AGASSSYA
Sbjct  314   NSQGNRFVAPDIRFSKEVTKHEDAPESEWKHWNWRSEGDLLVNGAFFTA-SGAGASSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPSSLVG++TGGAGAL C+KG  C
Sbjct  373   RASSLGARPSSLVGTITGGAGALGCRKGARC  403



>ref|XP_008351757.1| PREDICTED: probable pectate lyase 18 [Malus domestica]
Length=411

 Score =   650 bits (1677),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/381 (85%), Positives = 351/381 (92%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  33    DPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGKLYVVTD+GDD AVNPKPGTLR+  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKLYVVTDSGDDDAVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VR+SPEH+GWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAMVRNSPEHFGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHCSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFAAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + RF+KEVTKHEDAPES+WK WNWRSEGDLMLNGAFF     AGASSSYA+ASSL ARPS
Sbjct  332   DIRFSKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFRA-SGAGASSSYARASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVGS+T  AGAL C+KG  C
Sbjct  391   SLVGSITTTAGALSCRKGSHC  411



>gb|KCW83228.1| hypothetical protein EUGRSUZ_B00168 [Eucalyptus grandis]
Length=484

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/387 (83%), Positives = 352/387 (91%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP  DPE +V EV++ IANAT  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADC
Sbjct  99    FSSPVQDPEGVVHEVHQSIANATRNRRGLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADC  158

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK A+GGRDG++YVVTD+GDD  VNPKPGT+R+  IQDEPLWIIF RDM I+LKEE
Sbjct  159   AIGFGKNAVGGRDGRIYVVTDSGDDDPVNPKPGTIRHAVIQDEPLWIIFQRDMSIQLKEE  218

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHDC+QGGNANVR SP HYGWR
Sbjct  219   LIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGLHIHDCKQGGNANVRSSPRHYGWR  278

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD
Sbjct  279   TISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIEGSTAITISNNYMTHHDKVMLLGHSD  338

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             +Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG
Sbjct  339   SYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  398

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF AP+ RF+KEVTKHE AP+S+W+ WNWRSEGDL+LNGAFFT    AGASSSYAKASS
Sbjct  399   NRFTAPDKRFSKEVTKHEVAPQSEWRNWNWRSEGDLLLNGAFFTP-SGAGASSSYAKASS  457

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG++TG AG L CKKG  C
Sbjct  458   LGARPSSLVGTITGNAGTLGCKKGSRC  484



>ref|XP_010248740.1| PREDICTED: probable pectate lyase 18 [Nelumbo nucifera]
Length=405

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/385 (85%), Positives = 353/385 (92%), Gaps = 5/385 (1%)
 Frame = +2

Query  131   SPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  310
             S   DPEL+V++V E+  NA+  RR LGFLSCGTGNPIDDCWRCDPNWE NRQRLADCAI
Sbjct  25    SAVQDPELVVKDV-ERSINAS--RRNLGFLSCGTGNPIDDCWRCDPNWEKNRQRLADCAI  81

Query  311   GFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  487
             GFGKQA+GGRDG++YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDMVIKLKEELI
Sbjct  82    GFGKQAVGGRDGRIYVVTDSGDDNPVNPKPGTLRFAVIQDEPLWIIFARDMVIKLKEELI  141

Query  488   MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTL  667
             MNSFKTIDGRGASVHIAGGPCITIQYV+NIIIHGL+IHDC+QGGNANVRDSP HYGWRT+
Sbjct  142   MNSFKTIDGRGASVHIAGGPCITIQYVSNIIIHGLHIHDCKQGGNANVRDSPTHYGWRTI  201

Query  668   SDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTY  847
             SDGDGVSIFGGSH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THH+KVMLLGHSDTY
Sbjct  202   SDGDGVSIFGGSHIWVDHCSLSNCHDGLIDAIHGSTAITLSNNYFTHHDKVMLLGHSDTY  261

Query  848   IQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR  1027
              QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR
Sbjct  262   TQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGNR  321

Query  1028  FLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassls  1207
             FLAP++RF+KEVTKHEDAPES+W+ WNWRSEGDL+LNGAFFT    AGASSSYAKASSL 
Sbjct  322   FLAPDNRFSKEVTKHEDAPESEWRHWNWRSEGDLLLNGAFFTP-SGAGASSSYAKASSLG  380

Query  1208  aRPSSLVGSLTGGAGALPCKKGKSC  1282
             ARPSSLVGS+T  AGAL CKKG  C
Sbjct  381   ARPSSLVGSITTAAGALNCKKGSRC  405



>ref|XP_007037815.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY22316.1| Pectin lyase-like superfamily protein isoform 1 [Theobroma cacao]
Length=404

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/391 (83%), Positives = 351/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SSP  DPE ++Q+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  18    PTLISSSPVQDPEAVMQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK A+GGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWIIFARDM I+
Sbjct  75    LADCAIGFGKNAVGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQ  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGLNIHDC+QGGNA VRDSP H
Sbjct  135   LKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLNIHDCKQGGNAMVRDSPRH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT+SDGDGVSIFG SHVWVDH SLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLL
Sbjct  195   YGWRTISDGDGVSIFGSSHVWVDHNSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF AP DRF+KEVTKHEDAPES+WKGWNWRSEGDLM+NGAFFT    AGASSSYA
Sbjct  315   NSQGNRFTAPEDRFSKEVTKHEDAPESEWKGWNWRSEGDLMVNGAFFTP-SGAGASSSYA  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSL ARPSSLV ++T  AGAL CKKG  C
Sbjct  374   KASSLGARPSSLVATITTNAGALNCKKGSRC  404



>ref|XP_004299169.1| PREDICTED: probable pectate lyase 18-like [Fragaria vesca subsp. 
vesca]
Length=412

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/386 (83%), Positives = 349/386 (90%), Gaps = 2/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP  DPEL+VQ+V   I NA+  RRKLG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  28    SSPVQDPELVVQQVQRSIYNASTTRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  87

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD+GDD  V PKPGTLR+  IQDEPLWIIF RDM IKLKEEL
Sbjct  88    IGFGKNAIGGRDGRIYVVTDSGDDDPVTPKPGTLRHAVIQDEPLWIIFERDMSIKLKEEL  147

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKT+DGRGASVHI+GGPCIT+QYVTNIIIHGLNIHDC+ GGNA VRDSP H+GWRT
Sbjct  148   IMNSFKTLDGRGASVHISGGPCITVQYVTNIIIHGLNIHDCKPGGNAMVRDSPNHFGWRT  207

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNYMTHH+KVMLLGHSD+
Sbjct  208   ISDGDGVSIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYMTHHDKVMLLGHSDS  267

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  268   YTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  327

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGD+++NGAFFT    AGASSSYAKASSL
Sbjct  328   RFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDMLINGAFFTA-SGAGASSSYAKASSL  386

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              ARPSSLVGS+T  +GAL C+KG  C
Sbjct  387   GARPSSLVGSITTTSGALNCRKGSRC  412



>ref|XP_004310004.1| PREDICTED: probable pectate lyase 5-like [Fragaria vesca subsp. 
vesca]
Length=402

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/383 (84%), Positives = 342/383 (89%), Gaps = 4/383 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P+P+P+ ++QEV+  I     +RR LG+LSCG+GNPIDDCWRCDP WE NRQRLADCAIG
Sbjct  24    PFPNPDSVIQEVHRSI---NASRRSLGYLSCGSGNPIDDCWRCDPKWEQNRQRLADCAIG  80

Query  314   FGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMN  493
             FGK AIGGRDGK+YVVTD GD  VNPKPGTLRYG IQDEPLWIIF  DM IKLKEEL+MN
Sbjct  81    FGKHAIGGRDGKIYVVTDAGDHPVNPKPGTLRYGVIQDEPLWIIFKGDMTIKLKEELMMN  140

Query  494   SFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSD  673
             SFKTIDGRGA+VHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRTLSD
Sbjct  141   SFKTIDGRGANVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAYVRDSPGHYGWRTLSD  200

Query  674   GDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQ  853
             GDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHSD+Y Q
Sbjct  201   GDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHSDSYTQ  260

Query  854   DKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFL  1033
             DK MQVTIAFNHFGEGL+QRMPRCRHG FHVVNNDYTHWEMYAIGGSA PTINSQGNRFL
Sbjct  261   DKNMQVTIAFNHFGEGLVQRMPRCRHGNFHVVNNDYTHWEMYAIGGSASPTINSQGNRFL  320

Query  1034  APNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaR  1213
             APNDRFNKEVTKHEDAP+  W  WNWRS GDLMLNGAFFT    AGASSSYAKASSL AR
Sbjct  321   APNDRFNKEVTKHEDAPQKDWSKWNWRSSGDLMLNGAFFTA-SGAGASSSYAKASSLGAR  379

Query  1214  PSSLVGSLTGGAGALPCKKGKSC  1282
             PSSLV S+T GAG+L CKKG  C
Sbjct  380   PSSLVSSITAGAGSLKCKKGSRC  402



>ref|XP_010026892.1| PREDICTED: probable pectate lyase 18 [Eucalyptus grandis]
Length=408

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/387 (83%), Positives = 352/387 (91%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP  DPE +V EV++ IANAT  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADC
Sbjct  23    FSSPVQDPEGVVHEVHQSIANATRNRRGLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADC  82

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK A+GGRDG++YVVTD+GDD  VNPKPGT+R+  IQDEPLWIIF RDM I+LKEE
Sbjct  83    AIGFGKNAVGGRDGRIYVVTDSGDDDPVNPKPGTIRHAVIQDEPLWIIFQRDMSIQLKEE  142

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHDC+QGGNANVR SP HYGWR
Sbjct  143   LIMNSFKTLDGRGASVHIAGGPCITVQFVTNIIIHGLHIHDCKQGGNANVRSSPRHYGWR  202

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD
Sbjct  203   TISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIEGSTAITISNNYMTHHDKVMLLGHSD  262

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             +Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG
Sbjct  263   SYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  322

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF AP+ RF+KEVTKHE AP+S+W+ WNWRSEGDL+LNGAFFT    AGASSSYAKASS
Sbjct  323   NRFTAPDKRFSKEVTKHEVAPQSEWRNWNWRSEGDLLLNGAFFTP-SGAGASSSYAKASS  381

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG++TG AG L CKKG  C
Sbjct  382   LGARPSSLVGTITGNAGTLGCKKGSRC  408



>ref|XP_004152502.1| PREDICTED: probable pectate lyase 22-like [Cucumis sativus]
 gb|KGN64357.1| hypothetical protein Csa_1G049960 [Cucumis sativus]
Length=413

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/389 (84%), Positives = 352/389 (90%), Gaps = 7/389 (2%)
 Frame = +2

Query  131   SPYP----DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  298
             SP P    +PEL+VQEV+  I NAT  RR LG+LSCGTGNPIDDCWRCD NWE NRQRLA
Sbjct  27    SPNPAAVSNPELVVQEVHRSIINAT-KRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLA  85

Query  299   DCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  475
             DC IGFGK AIGGRDGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+LK
Sbjct  86    DCGIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIRLK  145

Query  476   EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYG  655
             EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGN +VRDSP H+G
Sbjct  146   EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNTDVRDSPRHFG  205

Query  656   WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGH  835
             +RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGH
Sbjct  206   FRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGH  265

Query  836   SDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINS  1015
             SD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINS
Sbjct  266   SDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINS  325

Query  1016  QGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyaka  1195
             QGNRF+APNDRF+KEVTK+EDAPES+WK W+WRSEGDLMLNGA+FT    AGASSSYA+A
Sbjct  326   QGNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLMLNGAYFTA-SGAGASSSYARA  384

Query  1196  sslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SSL ARPSSLVG++T  AGAL C+KG  C
Sbjct  385   SSLGARPSSLVGTITTNAGALNCRKGSRC  413



>gb|AEN70965.1| pectate lyase [Gossypium schwendimanii]
Length=411

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/386 (83%), Positives = 350/386 (91%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP  DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCA
Sbjct  30    SSPVQDPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCA  86

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDGK+YVVTD+GDD  +NPKPGTLR+  IQDEPLWIIFARDM I+LKEEL
Sbjct  87    IGFGKNAIGGRDGKIYVVTDSGDDDPINPKPGTLRHAVIQDEPLWIIFARDMTIQLKEEL  146

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT
Sbjct  147   IMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRT  206

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+
Sbjct  207   MSDGDGVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDS  266

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  267   YTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  326

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RF AP++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AG+SSSYA+ASSL
Sbjct  327   RFTAPDNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGSSSSYARASSL  385

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              ARPSSLV ++T  AGAL CKKG  C
Sbjct  386   GARPSSLVATITTNAGALNCKKGSRC  411



>emb|CDX92652.1| BnaC07g39100D [Brassica napus]
Length=406

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/387 (81%), Positives = 348/387 (90%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WE++RQRLADC
Sbjct  21    FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWETHRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIRLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHDC++GGNA VR SP HYGWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHDCKRGGNAMVRSSPRHYGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYARDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKASS
Sbjct  321   NRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAQSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT G+GAL C+KG  C
Sbjct  380   LGAKPSSLVGPLTVGSGALNCRKGSRC  406



>emb|CDY11033.1| BnaA03g46920D [Brassica napus]
Length=406

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/387 (81%), Positives = 347/387 (90%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WES+R RLADC
Sbjct  21    FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWESHRHRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIRLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHDC++GGNA VR SP HYGWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHDCKRGGNAMVRSSPRHYGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYARDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKASS
Sbjct  321   NRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAQSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT G+GAL C+KG  C
Sbjct  380   LGAKPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_007044917.1| Pectate lyase family protein [Theobroma cacao]
 gb|EOY00749.1| Pectate lyase family protein [Theobroma cacao]
Length=406

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/392 (85%), Positives = 357/392 (91%), Gaps = 2/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT  FSSP  DPE +VQ+VNE + NATIARR LG+LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  16    APTFIFSSPVQDPEQVVQQVNESVRNATIARRNLGYLSCGTGNPIDDCWRCDPRWEKNRQ  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFA DMVI
Sbjct  76    RLADCAIGFGKHAIGGRDGKIYVVTDSSDRDPVNPKPGTLRHAVIQDEPLWIIFASDMVI  135

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEEL+MNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHG+NIHDC++GGNA VRDSP 
Sbjct  136   KLKEELLMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNAYVRDSPS  195

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISN+Y+THHNKVML
Sbjct  196   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNSYLTHHNKVML  255

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA+PT
Sbjct  256   LGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWDMYAIGGSANPT  315

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPN+ +NKEVTKHEDAP+SQWK WNWRSEGDLMLNGAFFT     GASSSY
Sbjct  316   INSQGNRFLAPNNEYNKEVTKHEDAPQSQWKHWNWRSEGDLMLNGAFFTP-SGTGASSSY  374

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSLVGSLT GAG+L CK+G  C
Sbjct  375   AKASSLGARPSSLVGSLTAGAGSLVCKEGSRC  406



>ref|XP_009359518.1| PREDICTED: probable pectate lyase 18 [Pyrus x bretschneideri]
Length=411

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/381 (85%), Positives = 348/381 (91%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  33    DPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDNPVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP H+GWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPGHFGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF+AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFVAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + RF+KEVTKHEDAPE +WK WNWRSEGDLMLNGAFF     AGASSSYA+ASSL ARPS
Sbjct  332   DIRFSKEVTKHEDAPEGEWKNWNWRSEGDLMLNGAFFRA-SGAGASSSYARASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVGS+T  AGAL C+KG  C
Sbjct  391   SLVGSITTAAGALSCRKGSHC  411



>ref|XP_002322215.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
 gb|EEF06342.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
Length=403

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/391 (83%), Positives = 354/391 (91%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPEL+VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PALISSSPVQDPELVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+G DD VNP+PGTLR+  IQ+EPLWIIFARDM I+
Sbjct  74    LADCAIGFGKNAIGGRDGKIYVVTDSGNDDPVNPRPGTLRHAVIQEEPLWIIFARDMTIQ  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGNA VRDSP+H
Sbjct  134   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNAMVRDSPKH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+HVWVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLL
Sbjct  194   FGWRTVSDGDGVSIFGGTHVWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  254   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL++NGAFFT    AGASSSYA
Sbjct  314   NSQGNRFVAPDIRFSKEVTKHEDAPESEWKHWNWRSEGDLLMNGAFFTA-SGAGASSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPSSLVG++T GAGAL C+KG  C
Sbjct  373   RASSLGARPSSLVGTITVGAGALGCRKGARC  403



>gb|KDO69407.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=404

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/391 (82%), Positives = 351/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    +S  PDPEL+V EV++ I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18    PALILASAVPDPELVVHEVHKSI-NAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  75    LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H
Sbjct  135   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLL
Sbjct  195   FGWRTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDTY QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDTYTQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA
Sbjct  315   NSQGNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYA  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPS+LVG +TG AGAL CKKG  C
Sbjct  374   RASSLGARPSALVGPITGSAGALICKKGARC  404



>emb|CDY03419.1| BnaC01g16630D [Brassica napus]
Length=406

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/387 (82%), Positives = 346/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCD NWE NRQRLADC
Sbjct  21    FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCSTGNPIDDCWRCDSNWEKNRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM I LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVIQDEPLWIIFQRDMTIHLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+++HDC+QGGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHLHDCKQGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCDDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SSSYAKASS
Sbjct  321   NRFVAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGASSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT G+GAL C+KG  C
Sbjct  380   LGARPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_004157771.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 22-like 
[Cucumis sativus]
Length=413

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/389 (84%), Positives = 351/389 (90%), Gaps = 7/389 (2%)
 Frame = +2

Query  131   SPYP----DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  298
             SP P    +PEL+VQEV+  I NAT  RR LG+LSCGTGNPIDDCWRCD NWE NRQRLA
Sbjct  27    SPNPAAVSNPELVVQEVHRSIINAT-KRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLA  85

Query  299   DCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLK  475
             DC IGFGK AIGGRDG +YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+LK
Sbjct  86    DCGIGFGKNAIGGRDGXIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIRLK  145

Query  476   EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYG  655
             EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGN +VRDSP H+G
Sbjct  146   EELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNTDVRDSPRHFG  205

Query  656   WRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGH  835
             +RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGH
Sbjct  206   FRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGH  265

Query  836   SDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINS  1015
             SD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINS
Sbjct  266   SDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINS  325

Query  1016  QGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyaka  1195
             QGNRF+APNDRF+KEVTK+EDAPES+WK W+WRSEGDLMLNGA+FT    AGASSSYA+A
Sbjct  326   QGNRFVAPNDRFSKEVTKYEDAPESEWKNWHWRSEGDLMLNGAYFTA-SGAGASSSYARA  384

Query  1196  sslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SSL ARPSSLVG++T  AGAL C+KG  C
Sbjct  385   SSLGARPSSLVGTITTNAGALNCRKGSRC  413



>ref|XP_006439991.1| hypothetical protein CICLE_v10020423mg [Citrus clementina]
 gb|ESR53231.1| hypothetical protein CICLE_v10020423mg [Citrus clementina]
Length=404

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/391 (82%), Positives = 350/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    +S  PDPEL+V EV++ I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18    PALILASAVPDPELVVHEVHKSI-NAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  75    LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H
Sbjct  135   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+HVWVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLL
Sbjct  195   FGWRTVSDGDGVSIFGGTHVWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDTY QDK MQ TIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDTYTQDKNMQATIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA
Sbjct  315   NSQGNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYA  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPS+LVG +TG AGAL CKKG  C
Sbjct  374   RASSLGARPSALVGPITGSAGALICKKGARC  404



>ref|XP_008439105.1| PREDICTED: probable pectate lyase 22 [Cucumis melo]
Length=411

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/381 (85%), Positives = 348/381 (91%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQEV+  I NAT  RR LG+LSCGTGNPIDDCWRCD NWE NRQRLADC IGFGK
Sbjct  33    DPELVVQEVHRSIINAT-KRRNLGYLSCGTGNPIDDCWRCDSNWEKNRQRLADCGIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDAGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVIRLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+ GGN +VRDSP H+G+RT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKPGGNTDVRDSPRHFGFRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNRF+AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGNRFVAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             NDRF+KEVTK+EDAPES+WK W+WRSEGDLMLNGAFFT+   AGASSSYA+ASSL ARPS
Sbjct  332   NDRFSKEVTKYEDAPESEWKNWHWRSEGDLMLNGAFFTS-SGAGASSSYARASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVG++T  AGAL C+KG  C
Sbjct  391   SLVGTITTNAGALNCRKGSRC  411



>ref|NP_001280201.1| probable pectate lyase 18 precursor [Prunus mume]
 dbj|BAE48664.1| Pectate lyase [Prunus mume]
Length=413

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/393 (81%), Positives = 353/393 (90%), Gaps = 4/393 (1%)
 Frame = +2

Query  110   APTCTFSSPYP-DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  286
              PT   S P   +PEL+VQ+V   I N +++RR LG+LSCGTGNPIDDCWRCDPNWE NR
Sbjct  23    TPTLIASRPLQQNPELVVQDVQRSI-NDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEQNR  81

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             +RLADCAIGFGK A+GGRDGK+YVVTD+GD D VNPKPGTLR+  IQDEPLWIIF RDM 
Sbjct  82    ERLADCAIGFGKNAVGGRDGKIYVVTDSGDSDPVNPKPGTLRHAVIQDEPLWIIFQRDMT  141

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VR SP
Sbjct  142   IQLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSP  201

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
             EHYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVM
Sbjct  202   EHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVM  261

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+P
Sbjct  262   LLGHSDSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANP  321

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TINSQGNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSS
Sbjct  322   TINSQGNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLMINGAFFTA-SGAGASSS  380

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSL A+PSSLVGS+T  +GAL C+KG  C
Sbjct  381   YARASSLGAKPSSLVGSITTASGALSCRKGSRC  413



>ref|XP_009105097.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
 emb|CDY56520.1| BnaA07g38610D [Brassica napus]
Length=407

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/392 (83%), Positives = 347/392 (89%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT T S+   DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  20    APTFTASNHVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  76

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDG++YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  77    RLADCAIGFGKHAIGGRDGRIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVI  136

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEEL+MNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP 
Sbjct  137   KLKEELMMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKKRGNAYVRDSPS  196

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT SDGD VSIFGGSHVWVDHCSLSNC DGLVDAIRGSTAITISNNY+THHNKVML
Sbjct  197   HYGWRTASDGDAVSIFGGSHVWVDHCSLSNCDDGLVDAIRGSTAITISNNYLTHHNKVML  256

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PT
Sbjct  257   LGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPT  316

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSY
Sbjct  317   INSQGNRFLAPNDHVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSSY  375

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSLSARPSSLV S+TG AG+L C+KG  C
Sbjct  376   AKASSLSARPSSLVASVTGNAGSLSCRKGSRC  407



>gb|ADB90475.1| pectate lyase [Gossypium herbaceum]
Length=411

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/381 (84%), Positives = 347/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   NNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|XP_003523121.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/393 (83%), Positives = 356/393 (91%), Gaps = 5/393 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  286
             PT   SSP  +P+ +VQEVN+KI N +IAR  R LG+LSCG+GNPIDDCWRCDPNWE NR
Sbjct  18    PTLISSSPVLNPQEVVQEVNKKI-NGSIARPRRNLGYLSCGSGNPIDDCWRCDPNWEQNR  76

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             QRLADCAIGFGK AIGGRDGK+YVV D GDD AVNPKPGTLR+  IQDEPLWIIFARDMV
Sbjct  77    QRLADCAIGFGKNAIGGRDGKIYVVEDDGDDDAVNPKPGTLRHAVIQDEPLWIIFARDMV  136

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEEL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP
Sbjct  137   IQLKEELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSP  196

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
              HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVM
Sbjct  197   RHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVM  256

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+P
Sbjct  257   LLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANP  316

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TIN QGNRF+AP+DRF+KEVTK ED PES+W+ WNWRSEGDL++NGAFFT    AGASSS
Sbjct  317   TINCQGNRFVAPDDRFSKEVTKREDTPESEWQDWNWRSEGDLLVNGAFFTA-SGAGASSS  375

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSLSARPSSLVGS+T GAGAL CKKG  C
Sbjct  376   YARASSLSARPSSLVGSITTGAGALSCKKGSPC  408



>gb|KHG19997.1| hypothetical protein F383_02891 [Gossypium arboreum]
Length=411

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/381 (84%), Positives = 347/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   NNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSHC  411



>gb|ADB90477.1| pectate lyase [Gossypium hirsutum]
Length=411

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/381 (84%), Positives = 348/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKASSL ARPS
Sbjct  332   NNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|XP_006476937.1| PREDICTED: probable pectate lyase 18-like [Citrus sinensis]
Length=449

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/391 (82%), Positives = 351/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    +S  PDPEL+V EV++ I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  63    PALISASAVPDPELVVHEVHKSI-NAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  119

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  120   LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  179

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H
Sbjct  180   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRH  239

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLL
Sbjct  240   FGWRTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLL  299

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDTY QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYA+GGSA+PTI
Sbjct  300   GHSDTYTQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAVGGSANPTI  359

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA
Sbjct  360   NSQGNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYA  418

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPS+LVG +TG AGAL CKKG  C
Sbjct  419   RASSLGARPSALVGPITGSAGALICKKGARC  449



>ref|XP_009150377.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=413

 Score =   643 bits (1658),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/388 (82%), Positives = 348/388 (90%), Gaps = 3/388 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP  DPELIV+EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR+RLADC
Sbjct  27    LSSPVSDPELIVEEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKRLADC  85

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
              IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF+RDM I+LKEE
Sbjct  86    GIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFSRDMTIQLKEE  145

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN +VRDSPEHYGWR
Sbjct  146   LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTDVRDSPEHYGWR  205

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSD
Sbjct  206   TISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSD  265

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  266   TYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  325

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakas  1198
             NRFLAP++ F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +      SSSY++AS
Sbjct  326   NRFLAPDNSFSKEVTKHEDAPESEWSRWNWRSEGDLMLNGAFFTLSGAGPTKSSSYSRAS  385

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL+ARPSS VG +T  +GAL CKKG  C
Sbjct  386   SLAARPSSNVGEITISSGALSCKKGSHC  413



>gb|EYU22243.1| hypothetical protein MIMGU_mgv1a007460mg [Erythranthe guttata]
Length=406

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/388 (82%), Positives = 352/388 (91%), Gaps = 5/388 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
              FS    DPEL+V EV+ K+  +   RR+LGFLSC TGNPIDDCWRCDPNWE NRQ+LAD
Sbjct  23    AFSPTLNDPELVVHEVHRKLNES---RRRLGFLSCNTGNPIDDCWRCDPNWEKNRQKLAD  79

Query  302   CAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             CAIGFGK A+GGRDGK+YVVT++G DD VNPKPGTLR+G IQ+EPLWIIFARDMVI+LKE
Sbjct  80    CAIGFGKNAVGGRDGKIYVVTESGNDDPVNPKPGTLRWGVIQEEPLWIIFARDMVIQLKE  139

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             ELIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG+++HDC+QGGNA VRDSP HYGW
Sbjct  140   ELIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGIHVHDCKQGGNAMVRDSPRHYGW  199

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RT+SDGDGVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS
Sbjct  200   RTISDGDGVSIFGGSHVWVDHVSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHS  259

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             D+Y QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  260   DSYTQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  319

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  1198
             GNRFLAP+DRF+KEVTK+EDAPES+WK WNWRSEGDLMLNGA+FT    A +SSSYAKAS
Sbjct  320   GNRFLAPDDRFSKEVTKYEDAPESEWKNWNWRSEGDLMLNGAYFTP-SGARSSSSYAKAS  378

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL ARPS+L+ S+T G+GAL C+KG  C
Sbjct  379   SLGARPSTLISSITSGSGALNCRKGSRC  406



>ref|XP_010459939.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=412

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/391 (81%), Positives = 349/391 (89%), Gaps = 3/391 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T   SSP  DPEL+V+EV+ KI N +++RRKLGF SCGTGNPIDDCWRCD +WE NR+RL
Sbjct  23    TLASSSPVSDPELVVEEVHRKI-NESMSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRL  81

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+L
Sbjct  82    ADCGIGFGKNAIGGRDGQIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQL  141

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHY
Sbjct  142   KEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHY  201

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLG
Sbjct  202   GWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLG  261

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSDTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTIN
Sbjct  262   HSDTYAQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTIN  321

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssya  1189
             SQGNRFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+
Sbjct  322   SQGNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYS  381

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  382   KASSLAARPSSHVGEITVASGALSCKRGSRC  412



>emb|CDY41506.1| BnaA06g22590D [Brassica napus]
Length=413

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/388 (82%), Positives = 347/388 (89%), Gaps = 3/388 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP  DPELIV EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR+RLADC
Sbjct  27    LSSPVSDPELIVAEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKRLADC  85

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
              IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF+RDM I+LKEE
Sbjct  86    GIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFSRDMTIQLKEE  145

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN +VRDSPEHYGWR
Sbjct  146   LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTDVRDSPEHYGWR  205

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSD
Sbjct  206   TISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSD  265

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  266   TYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  325

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakas  1198
             NRFLAP++ F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +      SSSY++AS
Sbjct  326   NRFLAPDNSFSKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPTKSSSYSRAS  385

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL+ARPSS VG +T  +GAL CKKG  C
Sbjct  386   SLAARPSSNVGEITISSGALSCKKGSHC  413



>ref|XP_010545988.1| PREDICTED: probable pectate lyase 22 [Tarenaya hassleriana]
Length=412

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/382 (84%), Positives = 340/382 (89%), Gaps = 3/382 (1%)
 Frame = +2

Query  140   PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFG  319
             PDPEL+VQEV+ K+ N +IARR LGF SC TGNPIDDCWRCDP WE NRQRLADCAIGFG
Sbjct  33    PDPELVVQEVHRKL-NESIARRNLGFFSCRTGNPIDDCWRCDPEWEKNRQRLADCAIGFG  91

Query  320   KQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNS  496
             K AIGGRDGKLYVVTD  D D VNPKPGTLRY  IQDEPLWIIF RDM I+LKEEL+MNS
Sbjct  92    KNAIGGRDGKLYVVTDPSDSDPVNPKPGTLRYAVIQDEPLWIIFNRDMTIQLKEELMMNS  151

Query  497   FKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDG  676
             FKTIDGRGASVHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP HYGWRT+SDG
Sbjct  152   FKTIDGRGASVHIAGGPCITIQYVTNVIIHGVHIHDCKQGGNAMVRDSPRHYGWRTVSDG  211

Query  677   DGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQD  856
             DGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNN+MTHHNKVMLLGHSDTY QD
Sbjct  212   DGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNHMTHHNKVMLLGHSDTYAQD  271

Query  857   KGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLA  1036
             K MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ NRFLA
Sbjct  272   KNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQANRFLA  331

Query  1037  PNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRP  1216
             PN  F+KEVTKHEDAPE++WK WNWRSEGDL LNGAFF        SSSY+KASSLSA+P
Sbjct  332   PNIAFSKEVTKHEDAPENEWKNWNWRSEGDLFLNGAFFRA-SGKDVSSSYSKASSLSAQP  390

Query  1217  SSLVGSLTGGAGALPCKKGKSC  1282
             SS VG +T  AGAL CKKG SC
Sbjct  391   SSRVGDITTTAGALNCKKGSSC  412



>ref|XP_007209185.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
 gb|ABV32549.1| pectase lyase [Prunus persica]
 gb|EMJ10384.1| hypothetical protein PRUPE_ppa006392mg [Prunus persica]
Length=413

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/393 (81%), Positives = 352/393 (90%), Gaps = 4/393 (1%)
 Frame = +2

Query  110   APTCTFSSPYP-DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  286
              PT   S P   +PEL+VQ+V   I N +++RR LG+LSCGTGNPIDDCWRCDPNWE NR
Sbjct  23    TPTLIASRPLQQNPELVVQDVQRSI-NDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEQNR  81

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             QRLADCAIGFGK AIGGRDGK+YVVTD+GD D VNPKPGTLR+  IQDEPLWIIF RDM 
Sbjct  82    QRLADCAIGFGKNAIGGRDGKIYVVTDSGDNDPVNPKPGTLRHAVIQDEPLWIIFQRDMT  141

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEELIMNSFKTIDGRGASVHIAGGPCIT+Q+VTNIIIHGL+IHDC+ GGNA VR SP
Sbjct  142   IQLKEELIMNSFKTIDGRGASVHIAGGPCITVQFVTNIIIHGLHIHDCKPGGNAMVRSSP  201

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
             EHYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVM
Sbjct  202   EHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVM  261

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+P
Sbjct  262   LLGHSDSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANP  321

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TINSQGNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSS
Sbjct  322   TINSQGNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLMINGAFFTA-SGAGASSS  380

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSL A+PSSLVGS+T  +GAL C+KG  C
Sbjct  381   YARASSLGAKPSSLVGSITTASGALSCRKGSRC  413



>ref|XP_006484000.1| PREDICTED: probable pectate lyase 5-like [Citrus sinensis]
Length=402

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/392 (85%), Positives = 357/392 (91%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15    APTFISSSPVQDPELVVEEVHKSI---NASRRNLGFLSCGTGNPIDDCWRCDPKWEENRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72    QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
              LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC++GGNANVRDSP 
Sbjct  132   TLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNANVRDSPS  191

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVML
Sbjct  192   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVML  251

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSDT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PT
Sbjct  252   LGHSDTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPT  311

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSY
Sbjct  312   INSQGNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSY  370

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  371   AKASSLGARPSSLISSITAGAGSLNCRKGKPC  402



>gb|AEN70981.1| pectate lyase [Gossypium davidsonii]
 gb|AEN70982.1| pectate lyase [Gossypium klotzschianum]
Length=411

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 346/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V   I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVQRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>emb|CDY65626.1| BnaC03g74840D [Brassica napus]
Length=454

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/391 (81%), Positives = 346/391 (88%), Gaps = 3/391 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             +   SSP  DPELIV EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR+RL
Sbjct  65    SLALSSPVSDPELIVDEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKRL  123

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+L
Sbjct  124   ADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFNRDMTIQL  183

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNSFKT+DGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHY
Sbjct  184   KEELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHY  243

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLG
Sbjct  244   GWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLG  303

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSDTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTIN
Sbjct  304   HSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTIN  363

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssya  1189
             SQGNRF+AP+D F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +      SSSY+
Sbjct  364   SQGNRFVAPDDSFSKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPTKSSSYS  423

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL+ARPSS VG +T  +GAL CKKG  C
Sbjct  424   RASSLAARPSSNVGEITISSGALSCKKGSHC  454



>gb|AEN70964.1| pectate lyase [Gossypium laxum]
 gb|AEN70983.1| pectate lyase [Gossypium aridum]
Length=411

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 347/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYA+ASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYARASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>gb|AEN70963.1| pectate lyase [Gossypium thurberi]
 gb|AEN70966.1| pectate lyase [Gossypium turneri]
 gb|AEN70979.1| pectate lyase [Gossypium armourianum]
 gb|AEN70980.1| pectate lyase [Gossypium harknessii]
 gb|AEN70986.1| pectate lyase [Gossypium trilobum]
Length=411

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 347/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>gb|ADB90478.1| pectate lyase [Gossypium hirsutum]
 gb|ADB90480.1| pectate lyase [Gossypium barbadense]
 gb|AEN70970.1| pectate lyase [Gossypium darwinii]
 gb|AEN70972.1| pectate lyase [Gossypium tomentosum]
 gb|AEN70974.1| pectate lyase [Gossypium barbadense var. brasiliense]
 gb|AEN70976.1| pectate lyase [Gossypium barbadense var. peruvianum]
 gb|AEN70978.1| pectate lyase [Gossypium hirsutum subsp. latifolium]
Length=411

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 348/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|XP_011040439.1| PREDICTED: probable pectate lyase 18 [Populus euphratica]
Length=403

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/391 (82%), Positives = 350/391 (90%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  +PEL+VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PALISSSPVQEPELVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVT++G DD VNPKPGTLR+  IQ+EPLWIIFARDM I+
Sbjct  74    LADCAIGFGKNAIGGRDGKIYVVTESGNDDPVNPKPGTLRHAVIQEEPLWIIFARDMTIQ  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H
Sbjct  134   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPNH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+H+WVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLL
Sbjct  194   FGWRTVSDGDGVSIFGGAHIWVDHNSLSNCDDGLVDAIHGSSAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI
Sbjct  254   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+AP+ RF+KEVTKHEDAP+S+WK WNWRSEGDL+LNGAFF     AGASSSYA
Sbjct  314   NSQGNRFVAPDIRFSKEVTKHEDAPQSEWKNWNWRSEGDLLLNGAFFVA-SGAGASSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPSSLVG +T GAGAL CKKG  C
Sbjct  373   RASSLGARPSSLVGPITMGAGALNCKKGTRC  403



>gb|AEN70985.1| pectate lyase [Gossypium lobatum]
Length=411

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 346/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPEHVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYA+ASSL ARPS
Sbjct  332   NNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYARASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|XP_007137977.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
 gb|ESW09971.1| hypothetical protein PHAVU_009G170500g [Phaseolus vulgaris]
Length=410

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/393 (82%), Positives = 354/393 (90%), Gaps = 5/393 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  286
             PT  FSSP  + E +VQEVN KI NA++AR  R LG+LSCG+GNPIDDCWRCDPNWE NR
Sbjct  18    PTLIFSSPLHNAEEVVQEVNRKI-NASMARHRRNLGYLSCGSGNPIDDCWRCDPNWEQNR  76

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             QRLADCAIGFGK AIGGRDGK+YVV D GDD  VNPKPGTLR+  IQDEPLWIIFARDMV
Sbjct  77    QRLADCAIGFGKNAIGGRDGKIYVVDDAGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMV  136

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEEL+MNSFKTIDGRGASVHIAGGPCIT+QYVTN+IIHG+++HDC+QGGNA VR SP
Sbjct  137   IQLKEELLMNSFKTIDGRGASVHIAGGPCITVQYVTNVIIHGIHLHDCKQGGNAMVRSSP  196

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
              HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVM
Sbjct  197   RHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVM  256

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+P
Sbjct  257   LLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANP  316

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TINSQGNRF+AP+DRF+KEVTK E+A ES+W+GWNWRSEGDL++NGAFFT    AGASSS
Sbjct  317   TINSQGNRFVAPDDRFSKEVTKREEAAESEWQGWNWRSEGDLLVNGAFFTA-SGAGASSS  375

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSLSARPSSLV S+T GAGAL CKK   C
Sbjct  376   YARASSLSARPSSLVASITTGAGALSCKKASPC  408



>gb|KDO82120.1| hypothetical protein CISIN_1g015702mg [Citrus sinensis]
Length=402

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/392 (84%), Positives = 357/392 (91%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT   SSP  DPEL+V+EV++ I     +RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15    APTFISSSPVQDPELVVEEVHKSI---NASRRNLGFLSCGTGNPIDDCWRCDPKWEENRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  72    QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  131

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
              LKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC++GGNANVRDSP 
Sbjct  132   TLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKRGGNANVRDSPS  191

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVML
Sbjct  192   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVML  251

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSDT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PT
Sbjct  252   LGHSDTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPT  311

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSY
Sbjct  312   INSQGNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSY  370

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  371   AKASSLGARPSSLISSITAGAGSLNCRKGKPC  402



>ref|XP_006438176.1| hypothetical protein CICLE_v10031429mg [Citrus clementina]
 gb|ESR51416.1| hypothetical protein CICLE_v10031429mg [Citrus clementina]
Length=469

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/392 (85%), Positives = 359/392 (92%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT   SSP  DPEL+V+EV++ I NA+  RR LGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  82    APTFISSSPVQDPELVVEEVHKSI-NAS--RRSLGFLSCGTGNPIDDCWRCDPKWEENRQ  138

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             +LADCAIGFGKQAIGG+DGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIFARDMVI
Sbjct  139   QLADCAIGFGKQAIGGKDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFARDMVI  198

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
              LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC++GGNANVRDSP 
Sbjct  199   TLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNANVRDSPS  258

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVML
Sbjct  259   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVML  318

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSDT+ QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYA+GGSA PT
Sbjct  319   LGHSDTFTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYALGGSASPT  378

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRF+APNDRFNKEVTK+EDAPES+WK WNWRSEGDLM+NGAFFT    AGASSSY
Sbjct  379   INSQGNRFVAPNDRFNKEVTKYEDAPESEWKNWNWRSEGDLMVNGAFFTP-SGAGASSSY  437

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSL+ S+T GAG+L C+KGK C
Sbjct  438   AKASSLGARPSSLISSITAGAGSLNCRKGKPC  469



>gb|AEN70977.1| pectate lyase [Gossypium hirsutum subsp. latifolium]
Length=411

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 346/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   NNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGA  CKKG  C
Sbjct  391   SLVATITTNAGAHNCKKGSRC  411



>gb|ADB90479.1| pectate lyase [Gossypium barbadense]
 gb|AEN70967.1| pectate lyase [Gossypium mustelinum]
 gb|AEN70969.1| pectate lyase [Gossypium darwinii]
 gb|AEN70971.1| pectate lyase [Gossypium tomentosum]
 gb|AEN70973.1| pectate lyase [Gossypium barbadense var. brasiliense]
 gb|AEN70975.1| pectate lyase [Gossypium barbadense var. peruvianum]
Length=411

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/381 (84%), Positives = 346/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N+RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   NNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGA  CKKG  C
Sbjct  391   SLVATITTNAGAHNCKKGSRC  411



>ref|XP_010531484.1| PREDICTED: probable pectate lyase 5 [Tarenaya hassleriana]
Length=404

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/391 (81%), Positives = 344/391 (88%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P+   SSP PDPEL+VQEVNEKI     +RR LG LSCG GNPIDDCWRCDP+WE NRQR
Sbjct  18    PSFVASSPVPDPELVVQEVNEKI---NASRRNLGVLSCGNGNPIDDCWRCDPHWEKNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  75    LADCAIGFGKHAIGGRDGKIYVVTDPTDKDPVNPKPGTLRHAVIQDEPLWIIFARDMVIK  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRG+SVHIAGG C+TIQYVTNIIIHG+N+HDC++ GN  VRDSP H
Sbjct  135   LKEELIMNSFKTIDGRGSSVHIAGGACVTIQYVTNIIIHGINVHDCKRAGNTYVRDSPSH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD +SIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNNYMTHHNKVMLL
Sbjct  195   YGWRTASDGDAISIFGGSHVWVDHCSLSNCQDGLIDAIHGSTAITISNNYMTHHNKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  255   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPNDR  KEVTK+EDAP+S+WK WNWRSEGD+ LNGAFFT      ASSSYA
Sbjct  315   NSQGNRFLAPNDRVFKEVTKYEDAPQSEWKKWNWRSEGDMFLNGAFFTA-SGKAASSSYA  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSL+ARPS+LV S+T  AGAL CKKG  C
Sbjct  374   KASSLAARPSTLVASVTANAGALVCKKGSRC  404



>ref|XP_006302330.1| hypothetical protein CARUB_v10020387mg [Capsella rubella]
 gb|EOA35228.1| hypothetical protein CARUB_v10020387mg [Capsella rubella]
Length=409

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/386 (83%), Positives = 344/386 (89%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             ++P  DP+L+VQEVNEKI NA+  RR LG LSCGTGNPIDDCWRCDP WE NRQRLADCA
Sbjct  28    TTPVSDPDLVVQEVNEKI-NAS--RRNLGVLSCGTGNPIDDCWRCDPKWEKNRQRLADCA  84

Query  308   IGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLRY  IQDEPLWIIFARDMVIKLKEEL
Sbjct  85    IGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRYAVIQDEPLWIIFARDMVIKLKEEL  144

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRG +VHIAGG CIT+QYVTN+IIHG+NIHDC++ GNA VRDSP HYGWRT
Sbjct  145   IMNSFKTIDGRGVNVHIAGGACITVQYVTNVIIHGINIHDCKRKGNAYVRDSPSHYGWRT  204

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
              SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHSD+
Sbjct  205   ASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYMTHHNKVMLLGHSDS  264

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQGN
Sbjct  265   YTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQGN  324

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYAKASSL
Sbjct  325   RFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYAKASSL  383

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARPSSLV S+TG AGAL CKKG  C
Sbjct  384   SARPSSLVASVTGSAGALFCKKGSRC  409



>emb|CDP15081.1| unnamed protein product [Coffea canephora]
Length=408

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/386 (85%), Positives = 352/386 (91%), Gaps = 2/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             +SP  DPEL+ QEV   IANAT ARRKLG+LSCGTGNPIDDCWRC P+WE NRQRLADC 
Sbjct  24    ASPVRDPELVAQEVQRSIANATRARRKLGYLSCGTGNPIDDCWRCQPDWEQNRQRLADCG  83

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK A+GGRDG++YVVTD+GDD  V PKPGTLRY  IQ+EPLWIIFARDMVI+LKEEL
Sbjct  84    IGFGKNAVGGRDGRIYVVTDSGDDDPVTPKPGTLRYAVIQEEPLWIIFARDMVIQLKEEL  143

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNANVR SP HYGWRT
Sbjct  144   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNANVRSSPSHYGWRT  203

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAI+GSTAITISNN+ THH+KVMLLG SDT
Sbjct  204   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIQGSTAITISNNFFTHHDKVMLLGASDT  263

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGN
Sbjct  264   YEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGN  323

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAP+DRFNKEVTK+EDAPES+WK WNWRSEGDLMLNGAFF T   A ASSSYA+ASSL
Sbjct  324   RFLAPDDRFNKEVTKYEDAPESEWKSWNWRSEGDLMLNGAFF-TQAGASASSSYARASSL  382

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARPS+LV +LT GAG L C+KG SC
Sbjct  383   SARPSTLVSALTSGAGVLGCRKGSSC  408



>ref|XP_002311747.2| pectate lyase 5 precursor family protein [Populus trichocarpa]
 gb|ABK94358.1| unknown [Populus trichocarpa]
 gb|EEE89114.2| pectate lyase 5 precursor family protein [Populus trichocarpa]
Length=402

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/392 (85%), Positives = 355/392 (91%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP     SP  DPEL+V+EV+  I     +RRKLGFLSCGTGNPIDDCWRCDP WE NRQ
Sbjct  15    APNFISCSPVQDPELVVEEVHRSI---NASRRKLGFLSCGTGNPIDDCWRCDPKWEKNRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK+AIGGRDGK+YVVTD G DD VNPKPGTLRY  IQ+EPLWIIFARDMVI
Sbjct  72    RLADCAIGFGKRAIGGRDGKIYVVTDPGNDDPVNPKPGTLRYAVIQEEPLWIIFARDMVI  131

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC+QGGNA VRDSP 
Sbjct  132   KLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKQGGNAYVRDSPG  191

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVML
Sbjct  192   HYGWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYLTHHNKVML  251

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HW+MYAIGGSADPT
Sbjct  252   LGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWKMYAIGGSADPT  311

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRFNKEVTKHEDAP+S+WKGWNWRSEGDL+LNGAFFT    AGASSSY
Sbjct  312   INSQGNRFLAPNDRFNKEVTKHEDAPQSEWKGWNWRSEGDLLLNGAFFTA-SGAGASSSY  370

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSLV S+T GAG+L CKKG  C
Sbjct  371   AKASSLGARPSSLVSSITAGAGSLACKKGSRC  402



>gb|AEN70968.1| pectate lyase [Gossypium mustelinum]
Length=411

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 348/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE++VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPEVVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>gb|ADB90476.1| pectate lyase [Gossypium raimondii]
Length=411

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 347/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHS++Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSNSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|XP_006280553.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
 gb|EOA13451.1| hypothetical protein CARUB_v10026494mg [Capsella rubella]
Length=412

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/391 (81%), Positives = 348/391 (89%), Gaps = 3/391 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T   S P  DPEL+V+EV+ KI N +++RRKLGF SCGTGNPIDDCWRCD +WE NR+RL
Sbjct  23    TLASSLPVSDPELVVEEVHRKI-NESVSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRL  81

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+L
Sbjct  82    ADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQL  141

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNSFKT+DGRGASVHIAGGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHY
Sbjct  142   KEELIMNSFKTLDGRGASVHIAGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHY  201

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             G+RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNYMTHHNKVMLLG
Sbjct  202   GYRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYMTHHNKVMLLG  261

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSDTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTIN
Sbjct  262   HSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTIN  321

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssya  1189
             SQGNRFLAP+D  +KEVTKHEDAPES+W+GWNWRSEGDLMLNGAFF  +      SSSY+
Sbjct  322   SQGNRFLAPDDSDSKEVTKHEDAPESEWQGWNWRSEGDLMLNGAFFRFSGAGPTKSSSYS  381

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  382   KASSLAARPSSHVGEITVASGALSCKRGSLC  412



>gb|AGC94753.1| putative pectate lyase [Euphorbia lathyris]
Length=404

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/386 (82%), Positives = 344/386 (89%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP  +PEL+ ++V++ I      RRKLGFLSCG+GNPIDDCWRCDPNWE NRQRLADCA
Sbjct  23    SSPVQNPELVAEQVHKSI---NTTRRKLGFLSCGSGNPIDDCWRCDPNWEKNRQRLADCA  79

Query  308   IGFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDGK+YVVTD+  DD V PKPGTLR+  IQ+EPLWIIF RDMVI LKEEL
Sbjct  80    IGFGKHAIGGRDGKIYVVTDSQNDDPVTPKPGTLRHAVIQEEPLWIIFERDMVITLKEEL  139

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIA GPCITIQYVTN+IIHG+NIHDC+ GGNA VRDSP HYGWRT
Sbjct  140   IMNSFKTIDGRGASVHIAEGPCITIQYVTNVIIHGINIHDCKSGGNAYVRDSPGHYGWRT  199

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDG+SIFGGSHVW+DHCSL+NC DGL+DAI GSTAITISNNYMTHHNKVMLLGHSDT
Sbjct  200   ISDGDGISIFGGSHVWIDHCSLANCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHSDT  259

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             ++QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HWEMYAIGGSA+PTINSQGN
Sbjct  260   FLQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWEMYAIGGSANPTINSQGN  319

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPNDRFNKEVTKHE+A E +WK WNWRSEGDL+LNGAFFT    A ASSSYAKASSL
Sbjct  320   RFLAPNDRFNKEVTKHEEAGEDEWKNWNWRSEGDLLLNGAFFTK-SGAAASSSYAKASSL  378

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              ARPSSLV S+T  AGAL CKKG  C
Sbjct  379   GARPSSLVNSITAAAGALLCKKGSRC  404



>gb|AEN70984.1| pectate lyase [Gossypium gossypioides]
Length=411

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/381 (83%), Positives = 347/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     +RR LG+LSCGTGNPIDDCW+CDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASRRNLGYLSCGTGNPIDDCWKCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNY+THH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYLTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF     AGASSSYAKASSL ARPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIA-SGAGASSSYAKASSLGARPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|XP_002318694.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
 gb|EEE96914.1| pectate lyase 22 precursor family protein [Populus trichocarpa]
Length=403

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/391 (82%), Positives = 349/391 (89%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP  DPE +VQEV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PALVSSSPVQDPEFVVQEVHRAI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGR+GK+YVVT++G DD VNPKPGTLR+  IQ+EPLWIIFARDM I+
Sbjct  74    LADCAIGFGKNAIGGRNGKIYVVTESGNDDPVNPKPGTLRHAVIQEEPLWIIFARDMTIQ  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H
Sbjct  134   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKRGGNAMVRDSPNH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+H+WVDH SLSNC DGLVDAI GS+AITISNNYMTHH+KVMLL
Sbjct  194   FGWRTVSDGDGVSIFGGAHIWVDHNSLSNCNDGLVDAIHGSSAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI
Sbjct  254   GHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+AP+ RF+KEVTKHEDAPES+WK WNWRSEGDL+LNGAFF     AGASSSYA
Sbjct  314   NSQGNRFVAPDIRFSKEVTKHEDAPESEWKNWNWRSEGDLLLNGAFFVA-SGAGASSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPSSLVG +T GAGAL C+KG  C
Sbjct  373   RASSLGARPSSLVGPITMGAGALNCRKGGRC  403



>ref|XP_009628975.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=407

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/384 (82%), Positives = 347/384 (90%), Gaps = 4/384 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P  +P+ +V EV+  +     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  27    PLSNPQAVVDEVHRSV---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIG  83

Query  314   FGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FGK AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQ EPLWIIFARDMVI+LKEELIM
Sbjct  84    FGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIM  143

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+++HDC+QGGNA VR SP HYGWRT+S
Sbjct  144   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHVHDCKQGGNAMVRSSPSHYGWRTIS  203

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGDGVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNN+MTHH+KVMLLGHSD+Y+
Sbjct  204   DGDGVSIFGGSHVWVDHCSLSNCKDGLIDAIMGSTAITISNNFMTHHDKVMLLGHSDSYV  263

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNRF
Sbjct  264   QDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRF  323

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
             LAP+ RF+KEVTKHEDAPES+WK WNWR+EGDLMLNGA+FT SG+   SSSYAKASSLSA
Sbjct  324   LAPDIRFSKEVTKHEDAPESEWKNWNWRTEGDLMLNGAYFTQSGAGAKSSSYAKASSLSA  383

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             RPSSLV +L  G+GAL C+KG  C
Sbjct  384   RPSSLVSNLVSGSGALNCRKGSRC  407



>emb|CDY56220.1| BnaAnng14170D [Brassica napus]
Length=406

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/392 (82%), Positives = 345/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT   SS   DPEL+VQEVN+ I NA+  RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  19    APTYVASSHVSDPELVVQEVNQHI-NAS--RRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK+AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQ+EPLWIIFARDMVI
Sbjct  76    RLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQEEPLWIIFARDMVI  135

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGA+VHIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP 
Sbjct  136   KLKEELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGISIHDCKKRGNAYVRDSPS  195

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT SDGD VSIFGGSHVWVDHCSLSNC DGLVD I GSTAITISNNY+THH+KVML
Sbjct  196   HYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLVDVIHGSTAITISNNYLTHHDKVML  255

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PT
Sbjct  256   LGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPT  315

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPND+  KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASS Y
Sbjct  316   INSQGNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSKY  374

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSLSARPSSLV S+TG AGAL CKKG  C
Sbjct  375   AKASSLSARPSSLVASVTGNAGALSCKKGSRC  406



>ref|XP_002866540.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42799.1| pectate lyase [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   639 bits (1647),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/389 (81%), Positives = 350/389 (90%), Gaps = 3/389 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
             T S P  DPEL+V+EV+ KI N +++RRKLGF SCGTGNPIDDCWRC+ +WE+NR+RLAD
Sbjct  23    TSSLPVSDPELVVEEVHRKI-NESMSRRKLGFFSCGTGNPIDDCWRCEKDWENNRKRLAD  81

Query  302   CAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             C IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKE
Sbjct  82    CGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFKRDMTIQLKE  141

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             ELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+
Sbjct  142   ELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGY  201

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHS
Sbjct  202   RTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHS  261

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             DTY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  262   DTYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  321

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyaka  1195
             GNRFLAP+D  +KEVTKHEDAPE++W+ WNWRSEGDLMLNGAFFT +      SSSY+KA
Sbjct  322   GNRFLAPDDSSSKEVTKHEDAPENEWRNWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKA  381

Query  1196  sslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  382   SSLAARPSSHVGEITIASGALSCKRGSHC  410



>ref|XP_010444198.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
 ref|XP_010444199.1| PREDICTED: probable pectate lyase 22 isoform X1 [Camelina sativa]
 ref|XP_010444200.1| PREDICTED: probable pectate lyase 22 isoform X2 [Camelina sativa]
Length=413

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/391 (81%), Positives = 347/391 (89%), Gaps = 3/391 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             T   S P  DPEL+V+EV+ KI N  ++RRKLGF SCGTGNPIDDCWRCD +WE NR+RL
Sbjct  24    TLASSLPVSDPELVVEEVHRKI-NELMSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRL  82

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADC IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+L
Sbjct  83    ADCGIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQL  142

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHY
Sbjct  143   KEELIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHY  202

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLG
Sbjct  203   GWRTISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLG  262

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSDTY QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTIN
Sbjct  263   HSDTYEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTIN  322

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssya  1189
             SQGNRFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+
Sbjct  323   SQGNRFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYS  382

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSL+ARPSS VG +T  +GAL CK+G  C
Sbjct  383   KASSLAARPSSHVGEITVASGALSCKRGSRC  413



>gb|KFK41187.1| hypothetical protein AALP_AA2G097000 [Arabis alpina]
Length=406

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/392 (82%), Positives = 343/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP  T S+P  DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  19    APAFTASTPVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  76    RLADCAIGFGKHAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVI  135

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRG SVHIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP 
Sbjct  136   KLKEELIMNSFKTIDGRGTSVHIAGGACITVQYVTNIIIHGISIHDCKRKGNAYVRDSPS  195

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVML
Sbjct  196   HYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVML  255

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PT
Sbjct  256   LGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWHMYAIGGSAAPT  315

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDR  KEVTK+ED P+S+WK WNWRSEGDL LNGAFFT     GASSSY
Sbjct  316   INSQGNRFLAPNDRVFKEVTKYEDTPQSKWKHWNWRSEGDLFLNGAFFTP-SGGGASSSY  374

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSLSARPSSLV S+T  AGAL C+KG  C
Sbjct  375   AKASSLSARPSSLVASVTSNAGALVCRKGSRC  406



>ref|XP_010484044.1| PREDICTED: probable pectate lyase 22 [Camelina sativa]
Length=413

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/387 (81%), Positives = 347/387 (90%), Gaps = 3/387 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S P  DPEL+V+EV+ K+ N +++RRKLGF SCGTGNPIDDCWRCD +WE NR+RLADC 
Sbjct  28    SLPVSDPELVVEEVHRKV-NESMSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRLADCG  86

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK A+GGRDG++YVVTD G DD VNPKPGTLRY  I+DEPLWIIF RDM I+LKEEL
Sbjct  87    IGFGKNAVGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQLKEEL  146

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGWRT
Sbjct  147   IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGWRT  206

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSDT
Sbjct  207   ISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSDT  266

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  267   YEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  326

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakass  1201
             RFLAP+D  +KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFFT +      SSSY+KASS
Sbjct  327   RFLAPDDSDSKEVTKHEDAPESEWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKASS  386

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L+ARPSS VG +T  +GAL CK+G  C
Sbjct  387   LAARPSSHVGEITVASGALSCKRGSRC  413



>ref|XP_009105327.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/392 (82%), Positives = 344/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT   SS   DPEL+VQEVN+ I NA+  RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  19    APTYVASSHVSDPELVVQEVNQHI-NAS--RRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK+AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQ+EPLWIIFARDMVI
Sbjct  76    RLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQEEPLWIIFARDMVI  135

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGA+VHIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP 
Sbjct  136   KLKEELIMNSFKTIDGRGANVHIAGGACITVQYVTNIIIHGVSIHDCKKRGNAYVRDSPS  195

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT SDGD VSIFGGSHVWVDHCSLSNC DGLVD I GSTAITISNNY+THH+KVML
Sbjct  196   HYGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLVDVIHGSTAITISNNYLTHHDKVML  255

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +DK MQVTIAFNHF EGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PT
Sbjct  256   LGHSDSYTRDKNMQVTIAFNHFDEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPT  315

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPND+  KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASS Y
Sbjct  316   INSQGNRFLAPNDKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSKY  374

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSLSARPSSLV S+TG AGAL CKKG  C
Sbjct  375   AKASSLSARPSSLVASVTGNAGALSCKKGSRC  406



>ref|XP_002887143.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63402.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/391 (83%), Positives = 344/391 (88%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+P  DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRC+P WE NRQ+
Sbjct  22    PTFIASTPVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCNPKWEKNRQQ  78

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79    LADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGG CITIQYVTNIIIHGLNIHDC++ GNA VRDSP H
Sbjct  139   LKEELIMNSFKTIDGRGASVHIAGGACITIQYVTNIIIHGLNIHDCKRKGNAYVRDSPSH  198

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLL
Sbjct  199   YGWRTASDGDAVSIFGGSHVWVDHCSLSNCDDGLIDAIHGSTAITISNNYLTHHNKVMLL  258

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  259   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  318

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT     GASSSYA
Sbjct  319   NSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYA  377

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLV S+T  AGAL C+KG  C
Sbjct  378   KASSLSARPSSLVASVTSNAGALFCRKGSRC  408



>gb|AAY85180.1| pectate lyase [Gossypium hirsutum]
Length=411

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/381 (83%), Positives = 346/381 (91%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQ+V+  I     ++R LG+LSCGTGNPIDDCWRCDPNWE+NRQ+LADCAIGFGK
Sbjct  35    DPELVVQDVHRAI---NASKRNLGYLSCGTGNPIDDCWRCDPNWETNRQKLADCAIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQ EPLWIIFARDM I+LKEELIMNSF
Sbjct  92    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQGEPLWIIFARDMTIQLKEELIMNSF  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHGLNIHDC+QGGNA VRDSP HYGWRT+SDGD
Sbjct  152   KTIDGRGASVHIAGGPCITVQYVTNIIIHGLNIHDCKQGGNAMVRDSPRHYGWRTISDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  212   GVSIFGGSHVWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF AP
Sbjct  272   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFTAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++RF+KEVTKHEDAPES+WK WNWRSEGDLM+NGAFF +   AGASSSYAKASSL  RPS
Sbjct  332   DNRFSKEVTKHEDAPESEWKSWNWRSEGDLMVNGAFFIS-SGAGASSSYAKASSLGVRPS  390

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV ++T  AGAL CKKG  C
Sbjct  391   SLVATITTNAGALNCKKGSRC  411



>ref|NP_001289258.1| probable pectate lyase 18 precursor [Pyrus x bretschneideri]
 gb|AHX37592.1| pectate lyase [Pyrus x bretschneideri]
Length=414

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/393 (81%), Positives = 351/393 (89%), Gaps = 5/393 (1%)
 Frame = +2

Query  113   PTCTFSSPY--PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  286
             PT   S P    DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NR
Sbjct  24    PTLISSRPLHLQDPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNR  82

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             Q LADCAIGFGK AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQ+EPLWIIF RDM 
Sbjct  83    QSLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQEEPLWIIFQRDMT  142

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEELIMNSFKTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VR SP
Sbjct  143   IQLKEELIMNSFKTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSP  202

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
              H+GWRT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVM
Sbjct  203   SHFGWRTVSDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIYGSTAITISNNYMTHHDKVM  262

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD+Y +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP
Sbjct  263   LLGHSDSYTKDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  322

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TINSQGNRF AP+ R +KEVTKHEDAPES+WK WNWRSEGDL+LNGAFFT    AGASSS
Sbjct  323   TINSQGNRFAAPDIRSSKEVTKHEDAPESEWKNWNWRSEGDLLLNGAFFTA-SGAGASSS  381

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSL A+PSSLVG++T  +GAL C+KG  C
Sbjct  382   YARASSLGAKPSSLVGAITTASGALSCRKGSRC  414



>emb|CDY48132.1| BnaCnng15740D [Brassica napus]
Length=428

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/388 (81%), Positives = 346/388 (89%), Gaps = 3/388 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              S P  DPEL+V+EV+ KI N +I+RR LG+ SC TGNPIDDCWRCD +WE NR++LADC
Sbjct  42    LSLPVSDPELVVEEVHRKI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKQLADC  100

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
              IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQD+PLWIIF RDM I+LKEE
Sbjct  101   GIGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDQPLWIIFNRDMTIQLKEE  160

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGWR
Sbjct  161   LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGWR  220

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSD
Sbjct  221   TISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSD  280

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  281   TYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  340

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakas  1198
             NRFLAPN  F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +    G SSSY+KAS
Sbjct  341   NRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPGKSSSYSKAS  400

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL+ARPSS VG +T  +GAL CKKG  C
Sbjct  401   SLAARPSSHVGEITIASGALSCKKGSHC  428



>gb|KDP26717.1| hypothetical protein JCGZ_17875 [Jatropha curcas]
Length=407

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/392 (84%), Positives = 351/392 (90%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP    SSP  DPE +V+EV++ I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  20    APNYISSSPVQDPETVVEEVHKSI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQ  76

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+YVVTD+GDD  V PKPGTLRY  IQDEPLWIIFARDM I
Sbjct  77    RLADCAIGFGKHAIGGRDGKIYVVTDSGDDDPVTPKPGTLRYAVIQDEPLWIIFARDMTI  136

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC+ GGNA VRDSP 
Sbjct  137   KLKEELIMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKSGGNAYVRDSPN  196

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHCSL+NC DGL+DAI GSTAITISNNYMTHHNKVML
Sbjct  197   HYGWRTISDGDGVSIFGGSHVWVDHCSLANCNDGLIDAIHGSTAITISNNYMTHHNKVML  256

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDY+HWEMYAIGGSA PT
Sbjct  257   LGHSDSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYSHWEMYAIGGSASPT  316

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRFNKEVTKHEDAPES+WK WNWRSEGD +LNGAFFT    AGASSSY
Sbjct  317   INSQGNRFLAPNDRFNKEVTKHEDAPESEWKNWNWRSEGDSLLNGAFFTP-SGAGASSSY  375

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSLV S+T GAGAL CKKG  C
Sbjct  376   AKASSLGARPSSLVTSITAGAGALACKKGSRC  407



>ref|NP_564906.1| putative pectate lyase 5 [Arabidopsis thaliana]
 sp|Q9FXD8.2|PLY5_ARATH RecName: Full=Probable pectate lyase 5; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL58893.1|AF462797_1 At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AAM26656.1| At1g67750/F12A21_12 [Arabidopsis thaliana]
 gb|AEE34690.1| putative pectate lyase 5 [Arabidopsis thaliana]
Length=408

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/391 (83%), Positives = 345/391 (88%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+P  +PEL+VQEVNEKI NA+  RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22    PTFIASTPVSEPELVVQEVNEKI-NAS--RRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79    LADCAIGFGKHAIGGRDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  139   LKEELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSH  198

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY++HHNKVMLL
Sbjct  199   YGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLSHHNKVMLL  258

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  259   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  318

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP S+WK WNWRSEGDL LNGAFFT     GASSSYA
Sbjct  319   NSQGNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYA  377

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLV S+T  AGAL C+KG  C
Sbjct  378   KASSLSARPSSLVASVTSNAGALFCRKGSRC  408



>ref|XP_009137472.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/387 (80%), Positives = 344/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +  ARRKL +LSC TGNPIDDCWR  P+WES+R RLADC
Sbjct  21    FSSPVPDPEAIVEEVHKSINASVAARRKLDYLSCTTGNPIDDCWRRPPHWESHRHRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIRLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPC+TIQYVTNIIIHG++IHDC++GGNA VR SP HYGWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCVTIQYVTNIIIHGVHIHDCKRGGNAMVRSSPRHYGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TVSDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYARDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKASS
Sbjct  321   NRFVAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAQSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT G+GAL C+KG  C
Sbjct  380   LGAKPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_009112069.1| PREDICTED: probable pectate lyase 22 [Brassica rapa]
Length=428

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/388 (81%), Positives = 345/388 (89%), Gaps = 3/388 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              S P  DPEL+V+EV+ +I N +I+RR LG+ SC TGNPIDDCWRCD +WE NR++LADC
Sbjct  42    LSLPVSDPELVVEEVHRQI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKQLADC  100

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
              IGFGK AIGGRDG+ YVVTD G DD VNPKPGTLRY  IQD+PLWIIF RDM I+LKEE
Sbjct  101   GIGFGKNAIGGRDGEFYVVTDPGNDDPVNPKPGTLRYAVIQDQPLWIIFIRDMTIQLKEE  160

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGWR
Sbjct  161   LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGWR  220

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSD
Sbjct  221   TISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSD  280

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  281   TYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  340

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakas  1198
             NRFLAPN  F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +    G SSSY+KAS
Sbjct  341   NRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPGKSSSYSKAS  400

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL+ARPSS VG +T  +GAL CKKG  C
Sbjct  401   SLAARPSSHVGEITIASGALSCKKGSHC  428



>ref|NP_001280839.1| probable pectate lyase 18 precursor [Malus domestica]
 ref|XP_008346717.1| PREDICTED: probable pectate lyase 18 [Malus domestica]
 gb|AAQ84042.1| pectate lyase [Malus domestica]
Length=418

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/381 (83%), Positives = 346/381 (91%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQEV   I++ +++RR LG+LSCGTGNPIDDCWRCDPNWE NRQ LADCAIGFGK
Sbjct  40    DPELVVQEVQRNISD-SVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQSLADCAIGFGK  98

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  99    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEELIMNSF  158

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VR SP H+GWRT+SDGD
Sbjct  159   KTIDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAMVRSSPRHFGWRTVSDGD  218

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVMLLGHSD+Y  DK
Sbjct  219   GVSIFGGSHVWVDHCSLSNCKDGLVDAIYGSTAITISNNYMTHHDKVMLLGHSDSYTNDK  278

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF AP
Sbjct  279   NMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFAAP  338

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + R +KEVTKHEDAPES+WK WNWRSEGDLMLNGAFFT    AGASSSYA+ASSL A+PS
Sbjct  339   DIRSSKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTA-SGAGASSSYARASSLGAKPS  397

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVG++T  +GAL C+KG  C
Sbjct  398   SLVGAITTASGALSCRKGSRC  418



>emb|CDY01846.1| BnaC06g28860D [Brassica napus]
Length=406

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/392 (81%), Positives = 343/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT   SS   DPEL+VQEVN++I     +RR LG LSCGTGNPIDDCWRCDP WE+NRQ
Sbjct  19    APTYVASSHVSDPELVVQEVNQQI---NASRRNLGVLSCGTGNPIDDCWRCDPKWENNRQ  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK+AIGGRDGK+YVVTD  D DAVNPKPGTLR+  IQ+EPLWIIFARDMVI
Sbjct  76    RLADCAIGFGKRAIGGRDGKIYVVTDPSDKDAVNPKPGTLRHAVIQEEPLWIIFARDMVI  135

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNSFKTIDGRGA+ HIAGG CIT+QYVTNIIIHG++IHDC++ GNA VRDSP 
Sbjct  136   KLKEELIMNSFKTIDGRGANAHIAGGACITVQYVTNIIIHGISIHDCKKRGNAYVRDSPS  195

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT SDGD VSIFGGSHVWVDHCSLSNC DGLVD I GSTAITISNNY+THH+KVML
Sbjct  196   HYGWRTASDGDAVSIFGGSHVWVDHCSLSNCEDGLVDVIHGSTAITISNNYLTHHDKVML  255

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PT
Sbjct  256   LGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWGMYAIGGSAAPT  315

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPN++  KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASS Y
Sbjct  316   INSQGNRFLAPNNKVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRASSMY  374

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSLSARPSSLV S+TG AGAL CKKG  C
Sbjct  375   AKASSLSARPSSLVASVTGNAGALSCKKGSRC  406



>gb|KDO69408.1| hypothetical protein CISIN_1g015569mg [Citrus sinensis]
Length=402

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/391 (82%), Positives = 349/391 (89%), Gaps = 7/391 (2%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    +S  PDPEL+V EV++ I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  18    PALILASAVPDPELVVHEVHKSI-NAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK A+GGRDG++YVVTD GD D VNPKPGTLRY  IQDEPLWIIFARDM I+
Sbjct  75    LADCAIGFGKNAVGGRDGRIYVVTDPGDYDVVNPKPGTLRYAVIQDEPLWIIFARDMTIR  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDC++GGNA VRDSP H
Sbjct  135   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCKKGGNAMVRDSPRH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGG+H+WVDHCSLSNC DGLVDAI GSTAITISNN+MTHH+KVMLL
Sbjct  195   FGWRTVSDGDGVSIFGGTHIWVDHCSLSNCDDGLVDAIHGSTAITISNNFMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDTY QDK MQVTIAFNHFGEGL+QR+P  RHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDTYTQDKNMQVTIAFNHFGEGLVQRIP--RHGYFHVVNNDYTHWEMYAIGGSANPTI  312

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF AP+  F+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSSYA
Sbjct  313   NSQGNRFAAPDRAFSKEVTKHEDAPESEWRNWNWRSEGDLMVNGAFFTA-SGAGASSSYA  371

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL ARPS+LVG +TG AGAL CKKG  C
Sbjct  372   RASSLGARPSALVGPITGSAGALICKKGARC  402



>emb|CDY16732.1| BnaA09g06500D [Brassica napus]
Length=428

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/388 (81%), Positives = 345/388 (89%), Gaps = 3/388 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              S P  DPEL+V+EV+ +I N +I+RR LG+ SC TGNPIDDCWRCD +WE NR++LADC
Sbjct  42    LSLPVSDPELVVEEVHRQI-NESISRRNLGYFSCETGNPIDDCWRCDKDWEKNRKQLADC  100

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
              IGFGK AIGGRDG+ YVVTD G DD VNPKPGTLRY  IQD+PLWIIF RDM I+LKEE
Sbjct  101   GIGFGKNAIGGRDGEFYVVTDPGNDDPVNPKPGTLRYAVIQDQPLWIIFNRDMTIQLKEE  160

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGWR
Sbjct  161   LIMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGWR  220

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSD
Sbjct  221   TISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSD  280

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  281   TYVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  340

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakas  1198
             NRFLAPN  F+KEVTKHEDAPES+W  WNWRSEGDLMLNGAFFT +    G SSSY+KAS
Sbjct  341   NRFLAPNGPFDKEVTKHEDAPESEWSHWNWRSEGDLMLNGAFFTLSGAGPGKSSSYSKAS  400

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL+ARPSS VG +T  +GAL CKKG  C
Sbjct  401   SLAARPSSHVGEITIASGALSCKKGSHC  428



>ref|XP_011072008.1| PREDICTED: probable pectate lyase 18 [Sesamum indicum]
Length=405

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/387 (85%), Positives = 353/387 (91%), Gaps = 6/387 (2%)
 Frame = +2

Query  128   SSP-YPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             SSP   DPEL+VQEV+ K+     +RRKLGFLSC TGNPIDDCWRCDPNWE NRQ+LADC
Sbjct  23    SSPTLQDPELVVQEVHSKL---NASRRKLGFLSCNTGNPIDDCWRCDPNWEQNRQKLADC  79

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK A+GGRDGK+YVVTD+GDD  VNPKPGTLRY  IQ+EPLWIIFARDMVI+LKEE
Sbjct  80    AIGFGKNAVGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFARDMVIQLKEE  139

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIA GPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGWR
Sbjct  140   LIMNSFKTIDGRGASVHIANGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRDSPRHYGWR  199

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD
Sbjct  200   TISDGDGVSIFGGSHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSD  259

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             +Y QDKGMQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQG
Sbjct  260   SYTQDKGMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQG  319

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPNDRF+KEVTKHEDAPE++WK WNWRSEGDLMLNGA+FT    AGASSSYAKASS
Sbjct  320   NRFLAPNDRFSKEVTKHEDAPETEWKNWNWRSEGDLMLNGAYFTP-SGAGASSSYAKASS  378

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLV S+T G+GAL C+KG  C
Sbjct  379   LGARPSSLVSSITSGSGALNCRKGSRC  405



>ref|NP_568967.1| putative pectate lyase 22 [Arabidopsis thaliana]
 sp|Q93Z25.1|PLY22_ARATH RecName: Full=Probable pectate lyase 22; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAL25610.1| AT5g63180/MDC12_15 [Arabidopsis thaliana]
 gb|AED97715.1| putative pectate lyase 22 [Arabidopsis thaliana]
Length=432

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/387 (81%), Positives = 346/387 (89%), Gaps = 3/387 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S P  DPEL+V+EV+ KI N +I+RRKLGF SCG+GNPIDDCWRCD +WE NR+RLADC 
Sbjct  47    SLPVSDPELVVEEVHRKI-NESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLADCG  105

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD G DD VNP+PGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  106   IGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFKRDMTIQLKEEL  165

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+RT
Sbjct  166   IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGYRT  225

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSDT
Sbjct  226   VSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSDT  285

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  286   YEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  345

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakass  1201
             RFLAP+D  +KEVTKHEDAPE +W+ WNWRSEGDL+LNGAFFT +      SSSY+KASS
Sbjct  346   RFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSEGDLLLNGAFFTYSGAGPAKSSSYSKASS  405

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L+ARPSS VG +T  +GAL CK+G  C
Sbjct  406   LAARPSSHVGEITIASGALSCKRGSHC  432



>dbj|BAB10560.1| pectate lyase [Arabidopsis thaliana]
Length=410

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/387 (81%), Positives = 346/387 (89%), Gaps = 3/387 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S P  DPEL+V+EV+ KI N +I+RRKLGF SCG+GNPIDDCWRCD +WE NR+RLADC 
Sbjct  25    SLPVSDPELVVEEVHRKI-NESISRRKLGFFSCGSGNPIDDCWRCDKDWEKNRKRLADCG  83

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD G DD VNP+PGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  84    IGFGKNAIGGRDGEIYVVTDPGNDDPVNPRPGTLRYAVIQDEPLWIIFKRDMTIQLKEEL  143

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+RT
Sbjct  144   IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGYRT  203

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSDT
Sbjct  204   VSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSDT  263

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  264   YEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  323

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT-Tsgsagasssyakass  1201
             RFLAP+D  +KEVTKHEDAPE +W+ WNWRSEGDL+LNGAFFT +      SSSY+KASS
Sbjct  324   RFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSEGDLLLNGAFFTYSGAGPAKSSSYSKASS  383

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L+ARPSS VG +T  +GAL CK+G  C
Sbjct  384   LAARPSSHVGEITIASGALSCKRGSHC  410



>gb|AAM67091.1| putative pectate lyase [Arabidopsis thaliana]
Length=406

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/391 (82%), Positives = 341/391 (87%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+P  +PEL+VQEVNEKI     ARR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  20    PTFIASTPVSEPELVVQEVNEKI---NAARRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG DGK+YVVTD+ D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKHAIGGLDGKIYVVTDSSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  137   LKEELIMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI  STAITISNNY++HHNKVMLL
Sbjct  197   YGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHASTAITISNNYLSHHNKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  257   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP S+WK WNWRSEGDL LNGAFFT     GASSSYA
Sbjct  317   NSQGNRFLAPNDHVFKEVTKYEDAPRSKWKKWNWRSEGDLFLNGAFFTP-SGGGASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLV S+T  AGAL C+KG  C
Sbjct  376   KASSLSARPSSLVASVTSNAGALFCRKGSRC  406



>dbj|BAI94495.1| pectate lyase [Dianthus caryophyllus]
Length=407

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/392 (80%), Positives = 347/392 (89%), Gaps = 5/392 (1%)
 Frame = +2

Query  116   TCTFSSP--YPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             T   S+P  +PDPEL+V +V+  I N ++ARR LG+LSCGTGNPIDDCWRCDP+WESNRQ
Sbjct  18    TLVLSAPAIHPDPELVVNQVHRAI-NESVARRNLGYLSCGTGNPIDDCWRCDPDWESNRQ  76

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK A+GG++G++YVVTD+ D D V PKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  77    RLADCAIGFGKNALGGKNGRIYVVTDSSDNDPVTPKPGTLRHAVIQDEPLWIIFQRDMVI  136

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LKEELIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG+N+HDC+ GGNA VR SP 
Sbjct  137   RLKEELIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGINVHDCKPGGNAMVRSSPR  196

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVS+FG S VWVDH SLSNC DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  197   HYGWRTVSDGDGVSLFGASQVWVDHVSLSNCADGLIDAIMGSTAITISNNYMTHHDKVML  256

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y  DK MQ TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  257   LGHSDSYSPDKNMQATIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPT  316

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRF KEVTKHEDAPE +WK WNWRSEGDLMLNGAFFT    AGASSSY
Sbjct  317   INSQGNRFLAPNDRFKKEVTKHEDAPEGEWKNWNWRSEGDLMLNGAFFTP-SGAGASSSY  375

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSL ARPS+LVG+LTG AG+L C+KG  C
Sbjct  376   ARASSLGARPSTLVGTLTGSAGSLVCRKGSRC  407



>gb|KHN05801.1| Putative pectate lyase 22 [Glycine soja]
Length=412

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/397 (82%), Positives = 354/397 (89%), Gaps = 9/397 (2%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  286
             PT   SSP  +P+ +VQEVN KI N +IAR  R LG+LSCG+GNPIDDCWRCDPNWE NR
Sbjct  18    PTLISSSPVLNPQEVVQEVNRKI-NGSIARPRRNLGYLSCGSGNPIDDCWRCDPNWEQNR  76

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-----AVNPKPGTLRYGAIQDEPLWIIFA  451
             QRLADCAIGFGK AIGGRDGK+YVV   GDD     AVNPKPGTLR+  IQDEPLWIIFA
Sbjct  77    QRLADCAIGFGKNAIGGRDGKIYVVDGDGDDDGDDDAVNPKPGTLRHAVIQDEPLWIIFA  136

Query  452   RDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANV  631
             RDMVI+LKEEL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHDC+QGGNA V
Sbjct  137   RDMVIQLKEELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMV  196

Query  632   RDSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHH  811
             RDSP HYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH
Sbjct  197   RDSPRHYGWRTVSDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHH  256

Query  812   NKVMLLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGG  991
             +KVMLLGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGG
Sbjct  257   DKVMLLGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGG  316

Query  992   SADPTINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsag  1171
             SA+PTIN QGNRF+AP+DRF+KEVTK ED PES+W+ WNWRSEGDL++NGAFFT    AG
Sbjct  317   SANPTINCQGNRFVAPDDRFSKEVTKREDTPESEWQDWNWRSEGDLLVNGAFFTA-SGAG  375

Query  1172  asssyakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSSYA+ASSLSARPSSLVGS+T GAGAL CKKG  C
Sbjct  376   ASSSYARASSLSARPSSLVGSITTGAGALSCKKGSPC  412



>gb|KFK28033.1| hypothetical protein AALP_AA8G463100 [Arabis alpina]
Length=411

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/387 (81%), Positives = 343/387 (89%), Gaps = 3/387 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SS   DPELIV EV+ KI N +I+RRKLGF SCGTGNPIDDCWRCD +WE NR+RLADC 
Sbjct  26    SSHVSDPELIVDEVHRKI-NESISRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRLADCG  84

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKEEL
Sbjct  85    IGFGKNAIGGRDGEIYVVTDPGNDDPVNPKPGTLRYAVIQDEPLWIIFNRDMTIQLKEEL  144

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKT+DGRGASVHI+GGPCITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYG+RT
Sbjct  145   IMNSFKTLDGRGASVHISGGPCITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGYRT  204

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSDT
Sbjct  205   ISDGDGVSIFGGSHVWVDHCSLSNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSDT  264

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  265   YEQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  324

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFF-TTsgsagasssyakass  1201
             RFLAP+D  +KEVTKHEDAPE +W  WNWRSEGDL+LNGAFF  +      SSSY+KASS
Sbjct  325   RFLAPDDSESKEVTKHEDAPEDEWSHWNWRSEGDLLLNGAFFRLSGAGPAKSSSYSKASS  384

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L+ARPSS VG +T  +GAL CK+G  C
Sbjct  385   LAARPSSHVGEITVASGALSCKRGSHC  411



>gb|KDP30994.1| hypothetical protein JCGZ_11370 [Jatropha curcas]
Length=411

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/384 (82%), Positives = 348/384 (91%), Gaps = 5/384 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P  D EL+VQ+V+  I ++   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIG
Sbjct  32    PVQDQELVVQQVHRAINDS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIG  88

Query  314   FGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FGK AIGGR+G++YVVTD G DD V PKPGTLR+  IQDEPLWIIFARDM I+LKEELIM
Sbjct  89    FGKNAIGGRNGRIYVVTDPGNDDPVTPKPGTLRHAVIQDEPLWIIFARDMTIQLKEELIM  148

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKT+DGRGASVHIAGGPCITIQ+VTNIIIHGL+IHDC+QGGNA VRDSP+HYGWRT+S
Sbjct  149   NSFKTLDGRGASVHIAGGPCITIQFVTNIIIHGLHIHDCKQGGNAYVRDSPQHYGWRTIS  208

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGDGVSIFG SH+WVDH SLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y 
Sbjct  209   DGDGVSIFGASHIWVDHNSLSNCKDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSYT  268

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF
Sbjct  269   QDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRF  328

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
             LAP++RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFF     AGASSSYAKASSLSA
Sbjct  329   LAPDNRFSKEVTKHEDAPESEWRNWNWRSEGDLMMNGAFFKA-SGAGASSSYAKASSLSA  387

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             RPS+LVG++T  AGAL CKKG  C
Sbjct  388   RPSTLVGTITVAAGALGCKKGSRC  411



>ref|XP_002515037.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF47591.1| Pectate lyase precursor, putative [Ricinus communis]
Length=404

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/386 (84%), Positives = 352/386 (91%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP  DPEL+V+EV+  I     +RRKLG+LSCGTGNPIDDCWRCDPNWE NRQRLADCA
Sbjct  23    SSPVQDPELVVEEVHRSI---NASRRKLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCA  79

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQ+EPLWIIFARDMVIKLKEEL
Sbjct  80    IGFGKHAIGGRDGKIYVVTDSGNDDPVNPKPGTLRHAVIQEEPLWIIFARDMVIKLKEEL  139

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIAGGPCIT+QYVTNIIIHG+NIHDC++GGNA VRDSP HYGWRT
Sbjct  140   IMNSFKTIDGRGASVHIAGGPCITVQYVTNIIIHGINIHDCKRGGNAYVRDSPSHYGWRT  199

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGS+VWVDHCSLSNC DGL+DAI GSTAITISNNYMTHHNKVMLLGHSD+
Sbjct  200   ISDGDGVSIFGGSYVWVDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHNKVMLLGHSDS  259

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             + QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  260   FTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  319

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPNDRFNKEVTKHEDA +++WK WNWRSEGDL+LNGAFFT     GASSSYA+ASSL
Sbjct  320   RFLAPNDRFNKEVTKHEDAAQNEWKHWNWRSEGDLLLNGAFFTA-SGFGASSSYARASSL  378

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              ARPSSLV S+T GAG+L CKKG  C
Sbjct  379   GARPSSLVSSITAGAGSLVCKKGSRC  404



>dbj|BAF43572.1| pectate lyase [Prunus persica]
Length=413

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/393 (81%), Positives = 348/393 (89%), Gaps = 4/393 (1%)
 Frame = +2

Query  110   APTCTFSSPYP-DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  286
              PT   S P   +PEL+VQ+V   I N +++RR LG+LSCGTGNPIDDCWRCDPNWE NR
Sbjct  23    TPTLIASRPLQQNPELVVQDVQRSI-NDSVSRRNLGYLSCGTGNPIDDCWRCDPNWEQNR  81

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             QRLADCAIGFGK AIGGRDGK+YVVTD+GD D VNPKPGTLR+  IQDEPLWIIF RDM 
Sbjct  82    QRLADCAIGFGKNAIGGRDGKIYVVTDSGDNDPVNPKPGTLRHAVIQDEPLWIIFQRDMT  141

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEELIMNSFKTIDGRGASVHIAGGPC    +VTNIIIHGL+IHDC+ GGNA VR SP
Sbjct  142   IQLKEELIMNSFKTIDGRGASVHIAGGPCNHRPFVTNIIIHGLHIHDCKPGGNAMVRSSP  201

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
             EHYGWRT+SDGDGVSIFGGSHVWVDHCSLSNC+DGLVDAI GSTAITISNNYMTHH+KVM
Sbjct  202   EHYGWRTISDGDGVSIFGGSHVWVDHCSLSNCKDGLVDAIHGSTAITISNNYMTHHDKVM  261

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+P
Sbjct  262   LLGHSDSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANP  321

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TINSQGNRF AP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLM+NGAFFT    AGASSS
Sbjct  322   TINSQGNRFAAPDIRFSKEVTKHEDAPESEWRNWNWRSEGDLMINGAFFTA-SGAGASSS  380

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSL A+PSSLVGS+T  +GAL C+KG  C
Sbjct  381   YARASSLGAKPSSLVGSITTASGALSCRKGSRC  413



>ref|XP_003526981.1| PREDICTED: probable pectate lyase 18-like [Glycine max]
Length=408

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/393 (82%), Positives = 355/393 (90%), Gaps = 5/393 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIAR--RKLGFLSCGTGNPIDDCWRCDPNWESNR  286
             P+   SSP  +PE +VQEVN KI N +IAR  R LG+L CG+GNPIDDCWRCDPNWE NR
Sbjct  18    PSFISSSPVRNPEEVVQEVNRKI-NGSIARPRRNLGYLWCGSGNPIDDCWRCDPNWEQNR  76

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMV  463
             QRLADCAIGFGK AIGGRDGK+YVV D GDD AVNPKPG+LR+  IQDEPLWIIFARDMV
Sbjct  77    QRLADCAIGFGKNAIGGRDGKIYVVDDDGDDDAVNPKPGSLRHAVIQDEPLWIIFARDMV  136

Query  464   IKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSP  643
             I+LKEEL+MNSFKTIDGRGASVH+AGGPCITIQYVTN+IIHG++IHDC+QGGNA VRDSP
Sbjct  137   IQLKEELLMNSFKTIDGRGASVHVAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRDSP  196

Query  644   EHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVM  823
              HYGWRT+SDGDGVSIFGGSHVW+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVM
Sbjct  197   RHYGWRTVSDGDGVSIFGGSHVWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVM  256

Query  824   LLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADP  1003
             LLGHSD Y QDK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+P
Sbjct  257   LLGHSDAYTQDKAMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANP  316

Query  1004  TINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasss  1183
             TIN QGNRF+AP+DRF+KEVTK EDAPES+W+ WNWRSEGDL++NGAFFT+   AGASSS
Sbjct  317   TINCQGNRFVAPDDRFSKEVTKREDAPESEWQDWNWRSEGDLLVNGAFFTS-SGAGASSS  375

Query  1184  yakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             YA+ASSLSARPSSLVGS+T GAGAL CKKG  C
Sbjct  376   YARASSLSARPSSLVGSITTGAGALSCKKGSPC  408



>emb|CDY08948.1| BnaC08g11780D [Brassica napus]
Length=406

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/387 (82%), Positives = 345/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  21    LSSPVPDPEAIVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWETNRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP HYGWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHYGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAP+ RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKASS
Sbjct  321   NRFLAPDIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGATSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT G+GAL C+KG  C
Sbjct  380   LGARPSSLVGPLTVGSGALNCRKGSRC  406



>emb|CDY24847.1| BnaA08g14630D [Brassica napus]
Length=406

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/387 (82%), Positives = 345/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  21    LSSPVPDPEAIVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWETNRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLRY  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRYAVVQDEPLWIIFQRDMTIQLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP HYGWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHYGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIIGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAP+ RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKASS
Sbjct  321   NRFLAPDIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGATSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT G+GAL C+KG  C
Sbjct  380   LGARPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_009109237.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/387 (81%), Positives = 345/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  21    LSSPVPDPEAIVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWETNRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLRY  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRYAVVQDEPLWIIFQRDMTIQLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVH+AGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP HYGWR
Sbjct  141   LIMNSFKTIDGRGASVHMAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHYGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIIGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAP+ RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT       SSSYAKASS
Sbjct  321   NRFLAPDIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGATSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT G+GAL C+KG  C
Sbjct  380   LGARPSSLVGPLTVGSGALNCRKGSRC  406



>gb|KFK29019.1| hypothetical protein AALP_AA7G078200 [Arabis alpina]
Length=407

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/387 (81%), Positives = 348/387 (90%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE+NRQRLADC
Sbjct  22    FSSPVPDPESIVEEVHKSINASVAGRRKLGYLSCATGNPIDDCWRCDPHWETNRQRLADC  81

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             +IGFGK AIGGRDG++YVVTD+G DD V+PKPGTLR+  +QDEPLWIIF RDM IKLKEE
Sbjct  82    SIGFGKNAIGGRDGRIYVVTDSGNDDPVSPKPGTLRHAVVQDEPLWIIFQRDMTIKLKEE  141

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGWR
Sbjct  142   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHYGWR  201

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLS+C DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  202   TVSDGDGVSIFGGSHVWVDHCSLSSCADGLIDAIMGSTAITLSNNFMTHHDKVMLLGHSD  261

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG
Sbjct  262   TYGRDKIMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  321

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SS+YAKASS
Sbjct  322   NRFVAPNIRFSKEVTKHEDAPESEWKNWNWRSSGDLLLNGAFFTP-SGGASSSTYAKASS  380

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT  +GAL C+KG  C
Sbjct  381   LGARPSSLVGPLTLSSGALNCRKGSRC  407



>ref|XP_004236303.1| PREDICTED: probable pectate lyase 18 [Solanum lycopersicum]
Length=403

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 344/381 (90%), Gaps = 4/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +P+ +V EV+  I  +   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  26    NPQQVVDEVHRSINGS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  82

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD AV PKPGTLR+  IQ EPLWIIFARDMVI+LKEELIMNSF
Sbjct  83    NAIGGRDGKIYVVTDSGDDNAVTPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIMNSF  142

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGWRT+SDGD
Sbjct  143   KTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPSHYGWRTVSDGD  202

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSDTY QDK
Sbjct  203   GVSIFGGSHVWVDHCSLSNCKDGLIDAIMGSTAITISNNYMTHHDKVMLLGHSDTYTQDK  262

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP
Sbjct  263   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  322

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + RF+KEVTKHEDAPES+WK WNWR++GDLMLNGAFFT SG    SSSYAKASSLSARPS
Sbjct  323   DIRFSKEVTKHEDAPESEWKNWNWRTDGDLMLNGAFFTRSGVRTGSSSYAKASSLSARPS  382

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV +L   +GAL CKKG  C
Sbjct  383   SLVANLVSSSGALNCKKGSRC  403



>ref|XP_009138507.1| PREDICTED: probable pectate lyase 18 [Brassica rapa]
Length=406

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/387 (82%), Positives = 345/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCD NWE NRQRLADC
Sbjct  21    FSSPVPDPEAIVEEVHKSINASGAARRKLGYLSCSTGNPIDDCWRCDSNWEKNRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM I LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVIQDEPLWIIFQRDMTIHLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCDDGLIDAIMGSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SSSYAKASS
Sbjct  321   NRFVAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGASSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT G+GAL C+KG  C
Sbjct  380   LGARPSSLVGPLTLGSGALNCRKGSRC  406



>emb|CDY34310.1| BnaA01g14130D [Brassica napus]
Length=406

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/387 (82%), Positives = 344/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
             FSSP PDPE IV+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCD NWE NRQRLADC
Sbjct  21    FSSPVPDPEAIVEEVHKSINASVAARRKLGYLSCSTGNPIDDCWRCDSNWEKNRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G DD V PKPGTLR+  IQDEPLWIIF RDM I LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDDPVTPKPGTLRHAVIQDEPLWIIFQRDMTIHLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+ GGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKPGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI  STAIT+SNNYMTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCDDGLIDAIMDSTAITLSNNYMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRF+APN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      +SSSYAKASS
Sbjct  321   NRFVAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGASSSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L ARPSSLVG LT G+GAL C+KG  C
Sbjct  380   LGARPSSLVGPLTVGSGALNCRKGSRC  406



>ref|XP_009406385.1| PREDICTED: probable pectate lyase 18 [Musa acuminata subsp. malaccensis]
Length=407

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/386 (81%), Positives = 339/386 (88%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S+   DPEL+VQEV   +    ++RR+LG+LSCGTGNPIDDCWRCDP+W  NRQRLADCA
Sbjct  26    SAAVRDPELVVQEVQRSL---NVSRRRLGYLSCGTGNPIDDCWRCDPDWADNRQRLADCA  82

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD+GDD  VNPKPGTLRY  IQ+EPLWIIF RDMVI+LKEEL
Sbjct  83    IGFGKNAIGGRDGEIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFKRDMVIQLKEEL  142

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGWRT
Sbjct  143   IMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHDCKQGGNAYVRDSPGHYGWRT  202

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHC+LSNC DGL+DAI GSTAITISNNY++HH+KVMLLGHSD 
Sbjct  203   VSDGDGVSIFGGSHVWVDHCTLSNCHDGLIDAIHGSTAITISNNYLSHHDKVMLLGHSDE  262

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
                DK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGN
Sbjct  263   LTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGN  322

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPNDRF KEVTK EDA ES+WK WNWRSEGD MLNGAFFT    AGASSSYAKASSL
Sbjct  323   RFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQMLNGAFFTP-SGAGASSSYAKASSL  381

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              AR SSLVG++T  AG L CKKG  C
Sbjct  382   GARSSSLVGTITVSAGVLSCKKGSRC  407



>gb|KDP46367.1| hypothetical protein JCGZ_10207 [Jatropha curcas]
Length=403

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/392 (78%), Positives = 338/392 (86%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP   FSSP  DPEL+VQEV+  I  +   RR L +LSCGTGNPIDDCWRCDP+WE NRQ
Sbjct  16    APPFVFSSPVQDPELVVQEVHRSINES---RRSLAYLSCGTGNPIDDCWRCDPSWERNRQ  72

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGR+G++YVVTDT D DAVNPKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  73    RLADCAIGFGKNAIGGRNGRIYVVTDTSDEDAVNPKPGTLRHAVIQDEPLWIIFQRDMVI  132

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LK+EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHGL+IHDC++GGN N+RDSP 
Sbjct  133   RLKQELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGLHIHDCKRGGNGNIRDSPH  192

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H GW T SDGDG+SIF   H+WVDHCSLSNC+DGL+DAI GSTAITIS+N+MTHH+KVML
Sbjct  193   HSGWWTQSDGDGISIFSSKHIWVDHCSLSNCQDGLIDAIHGSTAITISSNFMTHHDKVML  252

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  253   LGHSDSYTQDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPT  312

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDR  KEVTKHE APES+W  WNWRSEGDL LNGAFF     AGASSSY
Sbjct  313   INSQGNRFLAPNDRSKKEVTKHEHAPESEWMHWNWRSEGDLFLNGAFF-RRSGAGASSSY  371

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
              +A SLSARPS+LV S+T  AGAL C++G  C
Sbjct  372   GRAFSLSARPSTLVDSMTRTAGALSCRRGSRC  403



>emb|CDY28857.1| BnaC06g26450D [Brassica napus]
Length=407

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/392 (82%), Positives = 347/392 (89%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             APT T SS   DPEL+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQ
Sbjct  20    APTFTASSHVSDPELVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQ  76

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDG++YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVI
Sbjct  77    RLADCAIGFGKHAIGGRDGRIYVVTDSSDNDAVNPKPGTLRHAVIQDEPLWIIFARDMVI  136

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEEL+MNSFKTIDGRGASVHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP 
Sbjct  137   KLKEELMMNSFKTIDGRGASVHIAGGACITVQYVTNIIIHGINIHDCKKRGNAYVRDSPS  196

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT SDGD VSIFGGSHVWVDHCSLSNC DGLVDAIRGSTAITISNNY+THHNKVML
Sbjct  197   HYGWRTASDGDAVSIFGGSHVWVDHCSLSNCDDGLVDAIRGSTAITISNNYLTHHNKVML  256

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PT
Sbjct  257   LGHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPT  316

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      +SSSY
Sbjct  317   INSQGNRFLAPNDHVFKEVTKYEDAPQSKWKNWNWRSEGDLFLNGAFFTP-SGGRSSSSY  375

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSLSARPSS+V S+TG AG+L C+KG  C
Sbjct  376   AKASSLSARPSSVVASVTGNAGSLSCRKGSRC  407



>ref|XP_006351443.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=403

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/381 (84%), Positives = 345/381 (91%), Gaps = 4/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +P+ +V EV   I  +   RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  26    NPQQVVDEVQRSINGS---RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  82

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD AV PKPGTLR+  IQ EPLWIIFARDMVI+LKEELIMNSF
Sbjct  83    NAIGGRDGKIYVVTDSGDDNAVTPKPGTLRHAVIQTEPLWIIFARDMVIQLKEELIMNSF  142

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGWRT+SDGD
Sbjct  143   KTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPSHYGWRTISDGD  202

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+Y QDK
Sbjct  203   GVSIFGGSHVWVDHCSLSNCMDGLIDAIMGSTAITISNNYMTHHDKVMLLGHSDSYTQDK  262

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP
Sbjct  263   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  322

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + RF+KEVTKHEDAPES+WK WNWR++GDLMLNGAFFT SG+  +SSSYAKASSLSARPS
Sbjct  323   DIRFSKEVTKHEDAPESEWKNWNWRTDGDLMLNGAFFTRSGAGASSSSYAKASSLSARPS  382

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVG+L   +GAL CKKG  C
Sbjct  383   SLVGNLVSSSGALNCKKGSRC  403



>ref|XP_010695977.1| PREDICTED: probable pectate lyase 18 [Beta vulgaris subsp. vulgaris]
Length=406

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/394 (81%), Positives = 352/394 (89%), Gaps = 5/394 (1%)
 Frame = +2

Query  110   APTCTFSSPY--PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESN  283
             AP+   SSP    DPEL+V EV+  I N +IARR LG+LSCGTGNPIDDCWRCDPNW  N
Sbjct  15    APSFVLSSPTVASDPELVVHEVHRSI-NESIARRSLGYLSCGTGNPIDDCWRCDPNWHEN  73

Query  284   RQRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDM  460
             RQRLADCAIGFGK AIGG++G++YVVTD+GDD  VNPKPGTLRYG +QDEPLWIIF RDM
Sbjct  74    RQRLADCAIGFGKNAIGGKNGRIYVVTDSGDDDPVNPKPGTLRYGVVQDEPLWIIFQRDM  133

Query  461   VIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDS  640
             VI+LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VR +
Sbjct  134   VIRLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAMVRSN  193

Query  641   PEHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKV  820
             P HYGWRT+SDGDGVS+FG SHVWVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KV
Sbjct  194   PHHYGWRTISDGDGVSLFGASHVWVDHCSLSNCADGLIDAIMGSTAITISNNFMTHHDKV  253

Query  821   MLLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAD  1000
             MLLGHSD+Y  DK MQ TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+
Sbjct  254   MLLGHSDSYTADKNMQATIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAN  313

Query  1001  PTINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagass  1180
             PTINSQGNRFLAP+ RF+KEVTKHEDAPE++WK WNWRSEGDLMLNGAFFT    AGAS+
Sbjct  314   PTINSQGNRFLAPDRRFSKEVTKHEDAPENEWKNWNWRSEGDLMLNGAFFTP-SGAGASA  372

Query  1181  syakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SYA+ASSL ARPS+LVGS+T  +GAL C+KG  C
Sbjct  373   SYARASSLGARPSTLVGSITAASGALNCRKGARC  406



>ref|XP_010929962.1| PREDICTED: probable pectate lyase 5 [Elaeis guineensis]
Length=409

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/392 (83%), Positives = 350/392 (89%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             +PT   S+   DPEL+V+EV+  + N+   RR+LG+LSCGTGNPIDDCWRCD NWESNRQ
Sbjct  22    SPTPKPSAAVQDPELVVREVHRSLNNS---RRRLGYLSCGTGNPIDDCWRCDQNWESNRQ  78

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGRDGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIF RDMVI
Sbjct  79    RLADCAIGFGKNAIGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFQRDMVI  138

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLKEELIMNS+KT+DGRGASVHIAGGPCITIQYV +IIIHG++IHDC+QGGNA VRDSPE
Sbjct  139   KLKEELIMNSYKTLDGRGASVHIAGGPCITIQYVDHIIIHGVHIHDCKQGGNAYVRDSPE  198

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGSHVWVDHC+LS+C DGLVDAI GSTAITISNNYMTHH+KVML
Sbjct  199   HYGWRTVSDGDGVSIFGGSHVWVDHCTLSSCHDGLVDAIHGSTAITISNNYMTHHDKVML  258

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+ + DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  259   LGHSDSLMVDKNMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPT  318

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAP+DRF KEVTK EDA ESQWK WNWRSEGDLMLNGAFFT    AGASSSY
Sbjct  319   INSQGNRFLAPDDRFAKEVTKREDASESQWKNWNWRSEGDLMLNGAFFTP-SGAGASSSY  377

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             AKASSL ARPSSLV S+T  AGAL CKKG  C
Sbjct  378   AKASSLGARPSSLVSSITMSAGALVCKKGSRC  409



>ref|XP_003638513.1| Pectate lyase [Medicago truncatula]
 gb|KEH35001.1| pectate lyase family protein [Medicago truncatula]
Length=406

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/391 (82%), Positives = 350/391 (90%), Gaps = 3/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   SS   +PEL+VQEVN KI NA+ ARR LG+LSCG+GNPIDDCWRCD NWE NRQR
Sbjct  18    PTLISSSLVQNPELVVQEVNRKI-NASSARRNLGYLSCGSGNPIDDCWRCDSNWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+YVVTD  DD  V PKPGTLR+  IQ EPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKNAIGGKNGKIYVVTDASDDNPVTPKPGTLRHAVIQVEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP H
Sbjct  137   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRDSPRH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             +GWRT+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  197   FGWRTISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIYGSTAITISNNYMTHHDKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y  DK MQVTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  257   GHSDSYTHDKNMQVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSANPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF+APN+RF+KEVTK+EDA ES+WK WNWRSEGDLM+NGAFFT     GASSSYA
Sbjct  317   NSQGNRFVAPNNRFSKEVTKYEDAAESEWKHWNWRSEGDLMVNGAFFTK-SGGGASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSS+VGS+T GAG L CKKG  C
Sbjct  376   RASSLSARPSSIVGSITIGAGTLNCKKGSPC  406



>ref|NP_001268051.1| pectate lyase precursor [Vitis vinifera]
 gb|AAF63756.1|AF243475_1 pectate lyase [Vitis vinifera]
Length=398

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/385 (79%), Positives = 342/385 (89%), Gaps = 5/385 (1%)
 Frame = +2

Query  131   SPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  310
             +P  DPE++VQEV+  I     +RR LG+ SCGTGNPIDDCWRCD NW+ NRQRLADCAI
Sbjct  18    APVQDPEVVVQEVHRSI---NASRRNLGYFSCGTGNPIDDCWRCDANWDKNRQRLADCAI  74

Query  311   GFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  487
             GFGK A+GG++G++YVVTD+  DD VNP+PGTLR+  IQDEPLWIIF RDMVIKLK+EL+
Sbjct  75    GFGKDAMGGKNGRIYVVTDSEDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVIKLKQELV  134

Query  488   MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTL  667
             MNSFKTIDGRGASVHIAGGPCITI Y +NIIIHGL+IHDC+QGGNAN+R+SP H GW T+
Sbjct  135   MNSFKTIDGRGASVHIAGGPCITIHYASNIIIHGLHIHDCKQGGNANIRNSPHHSGWWTV  194

Query  668   SDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTY  847
             SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHSD+Y
Sbjct  195   SDGDGVSIFGGRHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVMLLGHSDSY  254

Query  848   IQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR  1027
              +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR
Sbjct  255   TEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR  314

Query  1028  FLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassls  1207
             FLAPNDRF K VTKHEDAPES+W+ WNWRSEGDLMLNGAFF     AGASSSYA+ SSLS
Sbjct  315   FLAPNDRFKKAVTKHEDAPESEWRHWNWRSEGDLMLNGAFFLQ-SGAGASSSYARRSSLS  373

Query  1208  aRPSSLVGSLTGGAGALPCKKGKSC  1282
             ARPSSLVGS+T G+GAL C+KG  C
Sbjct  374   ARPSSLVGSITLGSGALGCRKGSRC  398



>ref|XP_007151585.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
 gb|ESW23579.1| hypothetical protein PHAVU_004G059200g [Phaseolus vulgaris]
Length=403

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/391 (78%), Positives = 341/391 (87%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P+   SS  PDPE++VQEV   I     +RR LG+LSCGTGNPIDDCWRC PNWE+NRQR
Sbjct  17    PSFVSSSTLPDPEMVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCHPNWENNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGR+G++Y VTD+GDD AVNPKPGTLRY AIQDEPLWIIF RDMVI 
Sbjct  74    LADCAIGFGKDAIGGRNGRIYEVTDSGDDDAVNPKPGTLRYAAIQDEPLWIIFKRDMVIT  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL++NSFKTIDGRGASVHIAGG CITI YV+N+I+HG++IHDC+  GN N+RDSPEH
Sbjct  134   LKQELLVNSFKTIDGRGASVHIAGGGCITIHYVSNVIVHGIHIHDCKPTGNTNIRDSPEH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
              G+ T SDGDGVSIF   HVW+DHCSLSNCRDGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  194   SGFWTQSDGDGVSIFNSKHVWIDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  254   GHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPN RF+KEVTKHEDAP+S+W  WNWRSEGD+ LNGA+F     AGASS YA
Sbjct  314   NSQGNRFLAPNIRFSKEVTKHEDAPQSEWMSWNWRSEGDMFLNGAYF-RQSGAGASSIYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  373   RASSLSARPSSLVGSMTITAGALTCRKGNRC  403



>ref|XP_009762540.1| PREDICTED: probable pectate lyase 18 [Nicotiana sylvestris]
Length=407

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/381 (82%), Positives = 346/381 (91%), Gaps = 4/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DP+ +V EV+  +     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLADCAIGFGK
Sbjct  30    DPQAVVDEVHRSV---NASRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLADCAIGFGK  86

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDGK+YVVTD+GDD  VNPKPGTLR+  +Q EPLWIIFARDMVI+LKEELIMNSF
Sbjct  87    NAVGGRDGKIYVVTDSGDDDPVNPKPGTLRHAVVQTEPLWIIFARDMVIQLKEELIMNSF  146

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP HYGWRT+SDGD
Sbjct  147   KTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPSHYGWRTISDGD  206

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCSLSNC+DGL+DAI GSTAITISNN+MTHH+KVMLLGHSD+Y+QDK
Sbjct  207   GVSIFGGSHVWVDHCSLSNCKDGLIDAIMGSTAITISNNFMTHHDKVMLLGHSDSYVQDK  266

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNRFLAP
Sbjct  267   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRFLAP  326

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + RF+KEVTKHEDAPES+WK WNWR+EGDLMLNGA+FT SG+   SSSYAKASSLSARPS
Sbjct  327   DIRFSKEVTKHEDAPESEWKNWNWRTEGDLMLNGAYFTQSGAGAKSSSYAKASSLSARPS  386

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV +L  G+GAL C+KG  C
Sbjct  387   SLVSNLVSGSGALNCRKGSRC  407



>ref|XP_006283843.1| hypothetical protein CARUB_v10004942mg [Capsella rubella]
 gb|EOA16741.1| hypothetical protein CARUB_v10004942mg [Capsella rubella]
Length=409

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/387 (81%), Positives = 347/387 (90%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  24    LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  83

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+GDD  V+PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  84    AIGFGKNAIGGRDGRIYVVTDSGDDNPVSPKPGTLRHAVIQDEPLWIIFQRDMTIRLKEE  143

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  144   LIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  203

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  204   TISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  263

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  264   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  323

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  324   NRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  382

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT G+GAL C+KG  C
Sbjct  383   LGAKPSSLVGPLTSGSGALNCRKGSRC  409



>gb|AAF19195.1|AF206319_1 pectate lyase 1 [Musa acuminata AAA Group]
Length=407

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/386 (81%), Positives = 338/386 (88%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S+   DPEL+VQEV   +    ++RR+LG+LSCGTGNPIDDCWRCDP+W  NRQRLADCA
Sbjct  26    SAAVRDPELVVQEVQRSL---NVSRRRLGYLSCGTGNPIDDCWRCDPDWADNRQRLADCA  82

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD+GDD  VNPK GTLRY  IQ+EPLWIIF RDMVI+LKEEL
Sbjct  83    IGFGKNAIGGRDGEIYVVTDSGDDDPVNPKTGTLRYAVIQEEPLWIIFKRDMVIQLKEEL  142

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGWRT
Sbjct  143   IMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHDCKQGGNAYVRDSPGHYGWRT  202

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSHVWVDHC+LSNC DGL+DAI GSTAITISNNY++HH+KVMLLGHSD 
Sbjct  203   VSDGDGVSIFGGSHVWVDHCTLSNCHDGLIDAIHGSTAITISNNYLSHHDKVMLLGHSDE  262

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
                DK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGN
Sbjct  263   LTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGN  322

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPNDRF KEVTK EDA ES+WK WNWRSEGD MLNGAFFT    AGASSSYAKASSL
Sbjct  323   RFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQMLNGAFFTP-SGAGASSSYAKASSL  381

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              AR SSLVG++T  AG L CKKG  C
Sbjct  382   GARSSSLVGTITVSAGVLSCKKGSRC  407



>ref|XP_010444201.1| PREDICTED: probable pectate lyase 22 isoform X3 [Camelina sativa]
Length=365

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/365 (83%), Positives = 331/365 (91%), Gaps = 2/365 (1%)
 Frame = +2

Query  194   IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGKQAIGGRDGKLYVVTDTG  373
             ++RRKLGF SCGTGNPIDDCWRCD +WE NR+RLADC IGFGK AIGGRDG++YVVTD G
Sbjct  1     MSRRKLGFFSCGTGNPIDDCWRCDKDWEKNRKRLADCGIGFGKNAIGGRDGEIYVVTDPG  60

Query  374   -DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPC  550
              DD VNPKPGTLRY  I+DEPLWIIF RDM I+LKEELIMNSFKT+DGRGASVHI+GGPC
Sbjct  61    NDDPVNPKPGTLRYAVIRDEPLWIIFNRDMTIQLKEELIMNSFKTLDGRGASVHISGGPC  120

Query  551   ITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSL  730
             ITIQYVTNIIIHGL+IHDC+QGGN  VRDSPEHYGWRT+SDGDGVSIFGGSHVWVDHCSL
Sbjct  121   ITIQYVTNIIIHGLHIHDCKQGGNTYVRDSPEHYGWRTISDGDGVSIFGGSHVWVDHCSL  180

Query  731   SNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDKGMQVTIAFNHFGEGLIQ  910
             SNC DGL+DAIRGSTAITISNNY+THHNKVMLLGHSDTY QDK MQVTIAFNHFGEGL+Q
Sbjct  181   SNCNDGLIDAIRGSTAITISNNYLTHHNKVMLLGHSDTYEQDKNMQVTIAFNHFGEGLVQ  240

Query  911   RMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFNKEVTKHEDAPES  1090
             RMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRFLAP+D  +KEVTKHEDAPES
Sbjct  241   RMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPDDSDSKEVTKHEDAPES  300

Query  1091  QWKGWNWRSEGDLMLNGAFFT-TsgsagasssyakasslsaRPSSLVGSLTGGAGALPCK  1267
             +W+ WNWRSEGDLMLNGAFFT +      SSSY+KASSL+ARPSS VG +T  +GAL CK
Sbjct  301   EWQSWNWRSEGDLMLNGAFFTYSGAGPTKSSSYSKASSLAARPSSHVGEITVASGALSCK  360

Query  1268  KGKSC  1282
             +G  C
Sbjct  361   RGSRC  365



>ref|XP_002314576.1| pectate lyase 5 precursor family protein [Populus trichocarpa]
 gb|EEF00747.1| pectate lyase 5 precursor family protein [Populus trichocarpa]
Length=402

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/392 (83%), Positives = 347/392 (89%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP+     P  DPEL+V+EV+  I     +RR L FLSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15    APSFISCLPVQDPELVVEEVHRSI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLA+CAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWI FARDMVI
Sbjct  72    RLANCAIGFGKNAIGGRDGKIYVVTDSGHDDPVNPKPGTLRHAVIQDEPLWITFARDMVI  131

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LKEELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP 
Sbjct  132   RLKEELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPS  191

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGS VWVDHCSLSNC DGL+DAI GSTAITISN+Y T HNKVML
Sbjct  192   HYGWRTISDGDGVSIFGGSQVWVDHCSLSNCNDGLIDAIHGSTAITISNSYFTRHNKVML  251

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PT
Sbjct  252   LGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPT  311

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRF KEVTKHE AP+SQWK WNWRS+GDLMLNGAFFT    AGASSSY
Sbjct  312   INSQGNRFLAPNDRFKKEVTKHEAAPQSQWKRWNWRSDGDLMLNGAFFTP-SGAGASSSY  370

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLV S+T GAGAL CKKG  C
Sbjct  371   ARASSLSARPSSLVSSITAGAGALVCKKGSRC  402



>ref|XP_004489554.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=405

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/386 (78%), Positives = 340/386 (88%), Gaps = 4/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SS   DPEL+VQ+V   I NA+  RR LG+LSCGTGNPIDDCWRCD NWE+NRQRLADCA
Sbjct  23    SSAVQDPELVVQDVQRSINNAS--RRNLGYLSCGTGNPIDDCWRCDTNWENNRQRLADCA  80

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGG++GK+Y+VTD+ DD  VNPKPGTLRYG+IQDEPLWIIF RDMVI LK+EL
Sbjct  81    IGFGKDAIGGKNGKIYIVTDSSDDDPVNPKPGTLRYGSIQDEPLWIIFKRDMVITLKQEL  140

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             ++NSFKTIDGRGASVHIA G CITI YV+NIIIHG+N+HDC+  GN N+RDSPEHYG+ T
Sbjct  141   LVNSFKTIDGRGASVHIANGGCITIHYVSNIIIHGINVHDCKPRGNTNIRDSPEHYGFWT  200

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDG+SIF   H+WVDHCSLSNCRDGL+D I GSTAITISNNYMTHH+KVMLLGHSD+
Sbjct  201   VSDGDGISIFNSKHIWVDHCSLSNCRDGLIDVIHGSTAITISNNYMTHHDKVMLLGHSDS  260

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  261   YTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  320

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPN+RF+KEVTK+E+AP+S+W  WNWRSEGDL LNGAFF     AGASS YA+ASSL
Sbjct  321   RFLAPNNRFSKEVTKYENAPQSEWNNWNWRSEGDLFLNGAFF-RQSGAGASSIYARASSL  379

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARPSSLV S+T  +GAL CKKG  C
Sbjct  380   SARPSSLVASITTTSGALNCKKGVRC  405



>ref|XP_010433725.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
 ref|XP_010438969.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
Length=408

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/387 (80%), Positives = 344/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  23    LSSPVPDPESVVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  82

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+GDD  V PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  83    AIGFGKNAIGGRDGRIYVVTDSGDDNPVTPKPGTLRHAVIQDEPLWIIFQRDMTIRLKEE  142

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRG SVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  143   LIMNSFKTIDGRGVSVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  202

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  203   TISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  262

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  263   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  322

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  323   NRFLAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  381

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+K   C
Sbjct  382   LGAKPSSLVGPLTFSSGALNCRKSSRC  408



>ref|XP_010448519.1| PREDICTED: probable pectate lyase 18 [Camelina sativa]
Length=406

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/387 (80%), Positives = 344/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +  ARRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21    LSSPVPDPESVVEEVHKSINASVAARRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+GDD  V PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGDDNPVTPKPGTLRHAVIQDEPLWIIFQRDMTIRLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRG SVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGVSVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCSLSNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSLSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQ+TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYTRDKNMQITIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  321   NRFLAPNIRFSKEVTKHEDAPESEWKSWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+K   C
Sbjct  380   LGAKPSSLVGPLTFSSGALNCRKSSRC  406



>ref|XP_009631254.1| PREDICTED: probable pectate lyase 18 [Nicotiana tomentosiformis]
Length=406

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/391 (80%), Positives = 350/391 (90%), Gaps = 4/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SS   +P+ +V +V+  I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  19    PALFASSTLQNPQSVVDQVHRSINNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LA+CAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLRY  IQ+EPLWIIFARDMVI+
Sbjct  77    LAECAIGFGKNAIGGRDGKIYVVTDSGNDDPVNPKPGTLRYAVIQNEPLWIIFARDMVIQ  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRGASVHI GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP+H
Sbjct  137   LKEELIMNSFKTIDGRGASVHITGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPQH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT+SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  197   YGWRTISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIMGSTAITISNNYMTHHDKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+++QDK MQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  257   GHSDSHVQDKNMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAP+ RF+KEVTKHEDAPES+WK WNWR++GDLMLNGA+F     A ASSSYA
Sbjct  317   NSQGNRFLAPDIRFSKEVTKHEDAPESEWKKWNWRTDGDLMLNGAYF-IQSGAAASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSA+PSSL+ S+   AGAL C+KG  C
Sbjct  376   KASSLSAKPSSLITSIVSSAGALTCRKGSPC  406



>ref|XP_010682362.1| PREDICTED: probable pectate lyase 5 [Beta vulgaris subsp. vulgaris]
Length=404

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/392 (79%), Positives = 343/392 (88%), Gaps = 4/392 (1%)
 Frame = +2

Query  110   APT-CTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNR  286
             APT    SSP  DPEL+V EV EKI NAT  RR LG+LSCGTGNPIDDCWRCD  W  NR
Sbjct  16    APTFINSSSPVQDPELVVHEVQEKIRNAT--RRNLGYLSCGTGNPIDDCWRCDHKWLKNR  73

Query  287   QRLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             QRLADC IGFGK AIGG++GK+YVVT+ GDD VNPKPGTLR+G IQD+PLWIIF  DMVI
Sbjct  74    QRLADCGIGFGKGAIGGKNGKMYVVTNKGDDPVNPKPGTLRWGVIQDKPLWIIFDGDMVI  133

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             KLK+EL++NSFKTIDGRGA++HIAGGPCITIQYVTN+IIHG++IHDC+ GGNA VRD+P 
Sbjct  134   KLKQELMVNSFKTIDGRGANIHIAGGPCITIQYVTNVIIHGIHIHDCKPGGNAMVRDTPT  193

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDG+SIFGGSH+WVDHCSLS+C DGL+DAI GSTAITISNNYMTHHNKVML
Sbjct  194   HYGWRTISDGDGISIFGGSHIWVDHCSLSSCTDGLIDAIHGSTAITISNNYMTHHNKVML  253

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+  +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  254   LGHSDSLTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPT  313

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPND  NKEVTK E+ P+S WK WNWRS+GDLMLNGAFFT+   AGASSSY
Sbjct  314   INSQGNRFLAPNDPDNKEVTKREEWPKSVWKKWNWRSQGDLMLNGAFFTS-SGAGASSSY  372

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSL+ARPS+ VGSLT  AG L CKK   C
Sbjct  373   ARASSLNARPSTFVGSLTMSAGVLNCKKSSHC  404



>ref|XP_010415362.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/391 (82%), Positives = 343/391 (88%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+P   P+L+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22    PTFIASTPVSHPDLVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79    LADCAIGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRG +VHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  139   LKEELIMNSFKTIDGRGVNVHIAGGACITVQYVTNIIIHGINIHDCKRKGNAYVRDSPSH  198

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLL
Sbjct  199   YGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVMLL  258

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  259   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  318

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYA
Sbjct  319   NSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYA  377

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSS+V S+TG AGAL CKKG  C
Sbjct  378   KASSLSARPSSVVASVTGSAGALFCKKGSRC  408



>ref|XP_002867644.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43903.1| pectate lyase family protein [Arabidopsis lyrata subsp. lyrata]
Length=406

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/387 (80%), Positives = 345/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21    LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G+D  V+PKPGTLR+  IQDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVIQDEPLWIIFQRDMTIQLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  321   NRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+KG  C
Sbjct  380   LGAKPSSLVGPLTSTSGALNCRKGSRC  406



>ref|XP_009788173.1| PREDICTED: probable pectate lyase 18 [Nicotiana sylvestris]
Length=406

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/386 (81%), Positives = 349/386 (90%), Gaps = 4/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SS   +P+ +V  V+  I NA+  RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLA+CA
Sbjct  24    SSTLQNPQSVVDPVHRSINNAS--RRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLAECA  81

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGG+DGK+YVVTD+G DD VNPKPGTLRY  IQ+EPLW+IFARDMVI+LKEEL
Sbjct  82    IGFGKNAIGGKDGKIYVVTDSGNDDPVNPKPGTLRYAVIQNEPLWVIFARDMVIQLKEEL  141

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG++IHDC+QGGN  VR SP+HYGWRT
Sbjct  142   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGIHIHDCKQGGNTMVRSSPQHYGWRT  201

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGSH+WVDHCSLSNC+DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD+
Sbjct  202   ISDGDGVSIFGGSHIWVDHCSLSNCKDGLIDAIMGSTAITISNNYMTHHDKVMLLGHSDS  261

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             ++QDK MQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  262   HVQDKNMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  321

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAP+ RF+KEVTKHEDAPES+WK WNWR++GDLMLNGA+F     A ASSSYAKASSL
Sbjct  322   RFLAPDIRFSKEVTKHEDAPESEWKKWNWRTDGDLMLNGAYF-IQSGAAASSSYAKASSL  380

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SA+PSSLV S+  GAGAL C+KG  C
Sbjct  381   SAKPSSLVTSIVSGAGALTCRKGSRC  406



>ref|XP_010470701.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/391 (82%), Positives = 343/391 (88%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+P   P+L+VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22    PTFIASTPVSHPDLVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79    LADCAIGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL+MNSFKTIDGRG +VHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  139   LKEELLMNSFKTIDGRGVNVHIAGGACITVQYVTNIIIHGINIHDCKRKGNAYVRDSPSH  198

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLL
Sbjct  199   YGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVMLL  258

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  259   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  318

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYA
Sbjct  319   NSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYA  377

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSS+V S+TG AGAL CKKG  C
Sbjct  378   KASSLSARPSSVVASVTGSAGALFCKKGSRC  408



>ref|NP_567707.1| putative pectate lyase 18 [Arabidopsis thaliana]
 ref|NP_001190827.1| putative pectate lyase 18 [Arabidopsis thaliana]
 sp|Q9C5M8.2|PLY18_ARATH RecName: Full=Probable pectate lyase 18; AltName: Full=Pectate 
lyase A10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAW38990.1| At4g24780 [Arabidopsis thaliana]
 gb|AEE84955.1| putative pectate lyase 18 [Arabidopsis thaliana]
 gb|AEE84956.1| putative pectate lyase 18 [Arabidopsis thaliana]
Length=408

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/387 (80%), Positives = 345/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  23    LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  82

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G+D  V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  83    AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  142

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  143   LIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  202

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  203   TISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  262

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  263   TYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  322

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  323   NRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  381

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+KG  C
Sbjct  382   LGAKPSSLVGPLTSTSGALNCRKGSRC  408



>ref|XP_003618787.1| Pectate lyase [Medicago truncatula]
 gb|AES75005.1| pectate lyase family protein [Medicago truncatula]
 gb|AFK34950.1| unknown [Medicago truncatula]
Length=404

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/391 (76%), Positives = 339/391 (87%), Gaps = 3/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SS   DPEL+VQ+V   I N + +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  16    PNFVSSSSVQDPELVVQDVQRSI-NVSRSRRNLGYLSCGTGNPIDDCWRCDPNWENNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGG++GK+Y+VTD+GDD AVNPKPGTLRYGAIQDEPLWIIF RDMVI+
Sbjct  75    LADCAIGFGKDAIGGKNGKIYIVTDSGDDDAVNPKPGTLRYGAIQDEPLWIIFKRDMVIQ  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL++NS+KTIDGRGASVHIA G CITI YV N+IIHG+++HDC   GN N+RDSPEH
Sbjct  135   LKQELLVNSYKTIDGRGASVHIANGGCITIHYVNNVIIHGIHVHDCVPTGNTNIRDSPEH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
              G+ T+SDGDG+S+F   H+W+DHCSLSNCRDGL+D I GS AITISNNYMTHH+KVMLL
Sbjct  195   SGFWTVSDGDGISVFNSQHIWIDHCSLSNCRDGLIDVIHGSNAITISNNYMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAP++RF+KEVTKHEDA ES++  WNWRSEGDL LNGAFF     A +SS YA
Sbjct  315   NSQGNRFLAPDNRFSKEVTKHEDASESEYNSWNWRSEGDLFLNGAFF-RQTGAESSSIYA  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARP+SLVGS+T  +G L CKKG  C
Sbjct  374   RASSLSARPASLVGSITTTSGVLTCKKGNRC  404



>ref|XP_007215475.1| hypothetical protein PRUPE_ppa006569mg [Prunus persica]
 gb|EMJ16674.1| hypothetical protein PRUPE_ppa006569mg [Prunus persica]
Length=405

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/392 (81%), Positives = 348/392 (89%), Gaps = 7/392 (2%)
 Frame = +2

Query  116   TCTF--SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             T TF  SS   DPEL+ QEV+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  18    TATFASSSQLHDPELVAQEVHRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEQNRQ  74

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGR+G++YVVTD+GDD  VNP+PGTLR+  IQDEPLWIIF RDMV+
Sbjct  75    RLADCAIGFGKDAIGGRNGRIYVVTDSGDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVV  134

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LK+EL+MNSFKTIDGRGASVHIAGGPCITI Y TNIIIHG+NIHDC+Q GN N+RDSP+
Sbjct  135   QLKQELVMNSFKTIDGRGASVHIAGGPCITIHYATNIIIHGINIHDCKQAGNGNIRDSPQ  194

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H GW T+SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  195   HSGWWTISDGDGVSIFGGKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVML  254

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDKGMQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  255   LGHSDSYTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPT  314

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPN RFNKEVTKHEDAPES+W+GWNWRSEGDLMLNGA+F     AGASSSY
Sbjct  315   INSQGNRFLAPNTRFNKEVTKHEDAPESEWRGWNWRSEGDLMLNGAYF-RQSGAGASSSY  373

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  374   ARASSLSARPSSLVGSITTTAGALICRKGSRC  405



>gb|AAG28907.1|AC008113_23 F12A21.12 [Arabidopsis thaliana]
Length=392

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/363 (84%), Positives = 325/363 (90%), Gaps = 2/363 (1%)
 Frame = +2

Query  197   ARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGKQAIGGRDGKLYVVTDTGD  376
             +RR LG LSCGTGNPIDDCWRCDP WE NRQRLADCAIGFGK AIGGRDGK+YVVTD+ D
Sbjct  31    SRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQRLADCAIGFGKHAIGGRDGKIYVVTDSSD  90

Query  377   -DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCI  553
              D VNPKPGTLR+  IQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGG CI
Sbjct  91    KDVVNPKPGTLRHAVIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGACI  150

Query  554   TIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSLS  733
             T+QYVTNIIIHG+NIHDC++ GNA VRDSP HYGWRT SDGD VSIFGGSHVWVDHCSLS
Sbjct  151   TVQYVTNIIIHGVNIHDCKRKGNAYVRDSPSHYGWRTASDGDAVSIFGGSHVWVDHCSLS  210

Query  734   NCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDKGMQVTIAFNHFGEGLIQR  913
             NC DGL+DAI GSTAITISNNY++HHNKVMLLGHSD+Y +DK MQVTIAFNHFGEGL+QR
Sbjct  211   NCADGLIDAIHGSTAITISNNYLSHHNKVMLLGHSDSYTRDKNMQVTIAFNHFGEGLVQR  270

Query  914   MPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFNKEVTKHEDAPESQ  1093
             MPRCRHGYFHVVNNDYTHW+MYAIGGSA PTINSQGNRFLAPND   KEVTK+EDAP S+
Sbjct  271   MPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTINSQGNRFLAPNDHVFKEVTKYEDAPRSK  330

Query  1094  WKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPSSLVGSLTGGAGALPCKKG  1273
             WK WNWRSEGDL LNGAFFT     GASSSYAKASSLSARPSSLV S+T  AGAL C+KG
Sbjct  331   WKKWNWRSEGDLFLNGAFFTP-SGGGASSSYAKASSLSARPSSLVASVTSNAGALFCRKG  389

Query  1274  KSC  1282
               C
Sbjct  390   SRC  392



>ref|XP_002300069.1| pectate lyase family protein [Populus trichocarpa]
 gb|EEE84874.1| pectate lyase family protein [Populus trichocarpa]
Length=403

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/392 (79%), Positives = 343/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP   FSS   DPEL+VQEV+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  16    APHFVFSSSIQDPELVVQEVHRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWERNRQ  72

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGR+G++YVVTD+G DDAVNPKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  73    RLADCAIGFGKNAIGGRNGRIYVVTDSGNDDAVNPKPGTLRHAVIQDEPLWIIFKRDMVI  132

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +L++EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+QGGN ++RDSP 
Sbjct  133   QLRQELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKQGGNGDIRDSPR  192

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H GW T SDGDGVSIF   H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVML
Sbjct  193   HSGWWTPSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVML  252

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  253   LGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPT  312

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPN RFNKEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     AGASSSY
Sbjct  313   INSQGNRFLAPNRRFNKEVTKHEDAPESEWRHWNWRSEGDLMLNGAYFRQ-SGAGASSSY  371

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+A SLSARPSSLVGS+T  +G L C+KG  C
Sbjct  372   ARAYSLSARPSSLVGSMTLTSGVLNCRKGSRC  403



>gb|AAK25850.1|AF360140_1 putative pectate lyase [Arabidopsis thaliana]
Length=408

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/387 (80%), Positives = 344/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  23    LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  82

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G+D  V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  83    AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  142

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  143   LIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  202

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  203   TISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  262

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK M VTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  263   TYSRDKNMHVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  322

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  323   NRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  381

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+KG  C
Sbjct  382   LGAKPSSLVGPLTSTSGALNCRKGSRC  408



>ref|XP_011010949.1| PREDICTED: pectate lyase-like [Populus euphratica]
Length=403

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/392 (79%), Positives = 342/392 (87%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             A    FSS   DPEL+VQEV   I     +RR LG+LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  16    ATHLVFSSSIQDPELVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWERNRQ  72

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGR+G++YVVTD+G DDAVNPKPGTLR+  IQDEPLWIIF RDMVI
Sbjct  73    RLADCAIGFGKNAIGGRNGRIYVVTDSGNDDAVNPKPGTLRHAVIQDEPLWIIFKRDMVI  132

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +L++EL+MNS+KTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+QGGN ++RDSP 
Sbjct  133   QLRQELVMNSYKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKQGGNGDIRDSPR  192

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H+GW T SDGDGVSIF   H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVML
Sbjct  193   HFGWWTPSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVML  252

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  253   LGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPT  312

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPN RFNKEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     AGASSSY
Sbjct  313   INSQGNRFLAPNRRFNKEVTKHEDAPESEWRHWNWRSEGDLMLNGAYFRQ-SGAGASSSY  371

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+A SLSARPSSLVGS+T  +G L C+KG  C
Sbjct  372   ARAYSLSARPSSLVGSMTLTSGVLNCRKGSRC  403



>ref|XP_011042354.1| PREDICTED: probable pectate lyase 5 [Populus euphratica]
Length=402

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/392 (82%), Positives = 345/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             AP+    SP  DPEL+V+EV+  I     +RR L  LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  15    APSFISCSPVQDPELVVEEVHRSI---NASRRNLASLSCGTGNPIDDCWRCDPNWEKNRQ  71

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLA+CAIGFGK AIGGRDGK+YVVTD+G DD VNPKPGTLR+  IQDEPLWI FAR+MVI
Sbjct  72    RLANCAIGFGKNAIGGRDGKIYVVTDSGHDDPVNPKPGTLRHAVIQDEPLWITFARNMVI  131

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LKEELIMNSFKTIDGRGA+VHIAGGPCITIQYVTNIIIHG+NIHDC++GGNA VRDSP 
Sbjct  132   RLKEELIMNSFKTIDGRGANVHIAGGPCITIQYVTNIIIHGINIHDCKRGGNAYVRDSPS  191

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFGGS VWVDHCSLS C DGL+DAI GSTAITISN+Y T HNKVML
Sbjct  192   HYGWRTISDGDGVSIFGGSQVWVDHCSLSKCNDGLIDAIHGSTAITISNSYFTRHNKVML  251

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PT
Sbjct  252   LGHSDSYKQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWKMYAIGGSAAPT  311

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPNDRF KEVTKHE A +SQWK WNWRS+GDLMLNGAFFT    AGASSSY
Sbjct  312   INSQGNRFLAPNDRFKKEVTKHEAASQSQWKRWNWRSQGDLMLNGAFFTP-SGAGASSSY  370

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLV S+T GAGAL CKKG  C
Sbjct  371   ARASSLSARPSSLVSSITAGAGALVCKKGSRC  402



>gb|AAM65103.1| putative pectate lyase [Arabidopsis thaliana]
Length=406

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/387 (80%), Positives = 344/387 (89%), Gaps = 2/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21    LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G+ + V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNYNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYSRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  320

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTK EDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  321   NRFLAPNIRFSKEVTKDEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  379

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+KG  C
Sbjct  380   LGAKPSSLVGPLTSTSGALNCRKGSRC  406



>ref|XP_008230481.1| PREDICTED: pectate lyase-like [Prunus mume]
Length=405

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/392 (79%), Positives = 348/392 (89%), Gaps = 7/392 (2%)
 Frame = +2

Query  116   TCTF--SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             T TF  SS   DPEL+ QEV+  I     +RR LG+LSCGTGNPIDDCWRCDPNWE NR+
Sbjct  18    TATFVSSSQLHDPELVAQEVHRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWEQNRE  74

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGG++G++YVV+D+GDD  VNP+PGTLR+  IQDEPLWIIF RDMV+
Sbjct  75    RLADCAIGFGKDAIGGKNGRIYVVSDSGDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVV  134

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LK+EL+MNSFKTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+Q GN N+R+SPE
Sbjct  135   QLKQELVMNSFKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKQAGNGNIRNSPE  194

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H GW T+SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  195   HSGWWTISDGDGVSIFGGKHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVML  254

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDKGMQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  255   LGHSDSYTQDKGMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPT  314

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INS+GNRFLAPN RFNKEVTKHEDAPES+W+GWNWRSEGD+MLNGA+F     AGASSSY
Sbjct  315   INSEGNRFLAPNTRFNKEVTKHEDAPESEWRGWNWRSEGDMMLNGAYF-RQSGAGASSSY  373

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  374   ARASSLSARPSSLVGSITTTAGALICRKGSRC  405



>gb|EPS69872.1| hypothetical protein M569_04891, partial [Genlisea aurea]
Length=401

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/392 (78%), Positives = 346/392 (88%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P    S+P  DP+L+V+E ++++ N T  RRKLGFLSC TGNPIDDCWRCDP+WE NR+
Sbjct  14    VPFVVASTPPQDPDLVVEEFHQRM-NGT--RRKLGFLSCSTGNPIDDCWRCDPDWEKNRR  70

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             +LADCAIGFGK AIGGRDG +YVVTD+GDD  VNPKPGTLR+  IQDEPLWI F+RDMVI
Sbjct  71    KLADCAIGFGKNAIGGRDGNIYVVTDSGDDDPVNPKPGTLRWAVIQDEPLWITFSRDMVI  130

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LKEELIMNSFKTIDGRGASVHI+ GPCIT+Q+VTNIIIHG++IHDC+ GGNA VRDSP 
Sbjct  131   QLKEELIMNSFKTIDGRGASVHISNGPCITVQFVTNIIIHGIHIHDCKPGGNAMVRDSPR  190

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT+SDGDGVSIFG SHVWVDHCSLS+C DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  191   HYGWRTISDGDGVSIFGASHVWVDHCSLSSCADGLIDAIHGSTAITISNNYMTHHDKVML  250

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD Y+QD+ MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  251   LGHSDAYVQDQSMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPT  310

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAP+DRF KEVTK+EDA ES+WK WNWR+EGDLMLNGA+FT     GASS+Y
Sbjct  311   INSQGNRFLAPDDRFKKEVTKYEDAAESEWKNWNWRTEGDLMLNGAYFTP-SGTGASSTY  369

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSL AR SSLVGS+T G+G L C+KG  C
Sbjct  370   ARASSLGARSSSLVGSITAGSGVLTCRKGSRC  401



>ref|XP_003551943.1| PREDICTED: probable pectate lyase 5-like [Glycine max]
 gb|KHN24116.1| Putative pectate lyase 5 [Glycine soja]
Length=405

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/391 (79%), Positives = 337/391 (86%), Gaps = 4/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P C  SSP  DPEL+V++V + I     +RR L FLSCGTGNPIDDCWRCDPNWE NR+
Sbjct  19    VPCCICSSPLQDPELVVEDVQKSI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRK  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             RLADC+IGFGK A+GGRDGKLYVVTD GD  VNPKPGTLRYG IQ+EPLWIIF RDMVIK
Sbjct  76    RLADCSIGFGKHAVGGRDGKLYVVTDPGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIK  135

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL+MNSFKTIDGRG SVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP H
Sbjct  136   LKQELMMNSFKTIDGRGVSVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPTH  195

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLL
Sbjct  196   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLL  255

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDT+ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTI
Sbjct  256   GHSDTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWRMYAIGGSAAPTI  315

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK E++P+S+WK WNWRS GDLMLNGAFFT SG+  +SS   
Sbjct  316   NSQGNRFLAPNDNTFKEVTKRENSPQSKWKNWNWRSNGDLMLNGAFFTASGAGASSSYAR  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
              +S  +   SSLV S+T  AG+L C+KG  C
Sbjct  376   ASSLAAKS-SSLVSSITASAGSLRCRKGSRC  405



>emb|CDY12666.1| BnaA02g13340D [Brassica napus]
Length=406

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/391 (82%), Positives = 340/391 (87%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+   DPEL+VQEVN+KI     +RR LG LSCGTGNPIDDCWRCD  WE NRQR
Sbjct  20    PTFIDSAHVSDPELVVQEVNQKI---NASRRNLGVLSCGTGNPIDDCWRCDKKWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKHAIGGRDGKIYVVTDPSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL+MNSFKTIDGRGA+VHIAGG CIT QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  137   LKEELLMNSFKTIDGRGANVHIAGGACITAQYVTNIIIHGINIHDCKKRGNAYVRDSPSH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD +SIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNY+THHNKVMLL
Sbjct  197   YGWRTASDGDAISIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYLTHHNKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  257   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYA
Sbjct  317   NSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-AGGRASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLV S+TG AGAL CKKG  C
Sbjct  376   KASSLSARPSSLVASVTGNAGALYCKKGSRC  406



>emb|CDY32557.1| BnaC02g17500D [Brassica napus]
Length=406

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/391 (81%), Positives = 340/391 (87%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+   DPEL+VQEVN+KI     +RR LG LSCGTGNPIDDCWRCD  WE NRQR
Sbjct  20    PTFIDSAHVSDPELVVQEVNQKI---NASRRNLGVLSCGTGNPIDDCWRCDKKWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKHAIGGRDGKIYVVTDPSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL+MNSFKTIDGRGA+VHIAGG CIT QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  137   LKEELLMNSFKTIDGRGANVHIAGGACITAQYVTNIIIHGINIHDCKKRGNAYVRDSPSH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD +SIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNY+THHNKVMLL
Sbjct  197   YGWRTASDGDAISIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYLTHHNKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  257   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYA
Sbjct  317   NSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-AGGRASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPS+LV S+TG AGAL CKKG  C
Sbjct  376   KASSLSARPSALVASVTGNAGALYCKKGSRC  406



>ref|XP_009127577.1| PREDICTED: probable pectate lyase 5 [Brassica rapa]
Length=406

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/391 (81%), Positives = 340/391 (87%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+   DPEL+VQEVN+KI     +RR LG LSCGTGNPIDDCWRCD  WE NRQR
Sbjct  20    PTFIDSAHVSDPELVVQEVNQKI---NASRRNLGVLSCGTGNPIDDCWRCDKKWEKNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD  D D VNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  77    LADCAIGFGKHAIGGRDGKIYVVTDPSDKDVVNPKPGTLRHAVIQDEPLWIIFARDMVIK  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL+MNSFKTIDGRGA+VHIAGG CIT QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  137   LKEELLMNSFKTIDGRGANVHIAGGACITAQYVTNIIIHGINIHDCKKRGNAYVRDSPSH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD +SIFGGSHVWVDHCSLSNC DGLVDAI GSTAITISNNY+THHNKVMLL
Sbjct  197   YGWRTASDGDAISIFGGSHVWVDHCSLSNCADGLVDAIHGSTAITISNNYLTHHNKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  257   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVT++EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYA
Sbjct  317   NSQGNRFLAPNDHVFKEVTRYEDAPQSKWKKWNWRSEGDLFLNGAFFTP-AGGRASSSYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSSLV S+TG AGAL CKKG  C
Sbjct  376   KASSLSARPSSLVASVTGNAGALYCKKGSRC  406



>ref|XP_006591479.1| PREDICTED: probable pectate lyase 5-like [Glycine max]
 gb|KHN44386.1| Putative pectate lyase 5 [Glycine soja]
Length=402

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/391 (78%), Positives = 337/391 (86%), Gaps = 4/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P+C  SSP  DPEL+V++V + I     +RR L FLSCGTGNPIDDCWRCDPNWE NR+
Sbjct  16    VPSCICSSPLQDPELVVEDVQKSI---NASRRNLAFLSCGTGNPIDDCWRCDPNWEKNRK  72

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             RLADC+IGFGK A+GGRDGK+YVVTD GD  VNPKPGTLRYG IQ+EPLWIIF RDMVIK
Sbjct  73    RLADCSIGFGKHAVGGRDGKIYVVTDPGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIK  132

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP H
Sbjct  133   LKQELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPTH  192

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GST ITISNNY+THHNKVMLL
Sbjct  193   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTGITISNNYLTHHNKVMLL  252

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSDT+ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTI
Sbjct  253   GHSDTFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWRMYAIGGSAAPTI  312

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK E++ +S+WK WNWRS GDLMLNGAFFT SG+  +SS   
Sbjct  313   NSQGNRFLAPNDNTFKEVTKRENSAQSKWKNWNWRSSGDLMLNGAFFTASGAGASSSYAR  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
              +S  +   SSLV S+T  AG+L C+KG  C
Sbjct  373   ASSLAAKS-SSLVSSITASAGSLSCRKGSRC  402



>ref|XP_002526952.1| Pectate lyase precursor, putative [Ricinus communis]
 gb|EEF35439.1| Pectate lyase precursor, putative [Ricinus communis]
Length=396

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/390 (76%), Positives = 331/390 (85%), Gaps = 12/390 (3%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SSP PDPEL+VQ+V+  I     +RR L +LSCGTGNPIDDCWRCDPNWE+NR+R
Sbjct  19    PHLVLSSPLPDPELVVQDVHRSI---NASRRNLAYLSCGTGNPIDDCWRCDPNWETNRKR  75

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             LADCAIGFGK AIGGR+G+ YVVT         KPGTLR+  IQDEPLWIIF RDMVI+L
Sbjct  76    LADCAIGFGKDAIGGRNGRFYVVTX--------KPGTLRHAVIQDEPLWIIFKRDMVIQL  127

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             K+EL+MNSFKTIDGRGASVHIA GPCITI Y TNIIIHGLNIHDC+QGGN ++RDSP+H+
Sbjct  128   KQELVMNSFKTIDGRGASVHIANGPCITIHYATNIIIHGLNIHDCKQGGNGDIRDSPDHF  187

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GW T SDGDGVSIF   H+WVDHCSLSNC DGL+DAI GSTAIT+SNN+ THH+KVMLLG
Sbjct  188   GWWTQSDGDGVSIFASKHIWVDHCSLSNCHDGLIDAIHGSTAITLSNNFFTHHDKVMLLG  247

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  248   HSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIN  307

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAP+ R  KEVTKHEDAPES+W+ WNWRSEGD +LNGAFF     AGASS+YA+
Sbjct  308   SQGNRFLAPDAREKKEVTKHEDAPESEWRHWNWRSEGDQLLNGAFFRQ-SGAGASSTYAR  366

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSLSARPSSLV S+T  AGAL C+KG  C
Sbjct  367   ASSLSARPSSLVNSITRTAGALNCRKGSRC  396



>emb|CAA22985.1| putative pectate lyase [Arabidopsis thaliana]
 emb|CAB79388.1| putative pectate lyase [Arabidopsis thaliana]
Length=404

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/387 (80%), Positives = 343/387 (89%), Gaps = 4/387 (1%)
 Frame = +2

Query  125   FSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADC  304
              SSP PDPE +V+EV++ I  +   RRKLG+LSC TGNPIDDCWRCDP+WE +RQRLADC
Sbjct  21    LSSPVPDPESVVEEVHKSINASVAGRRKLGYLSCTTGNPIDDCWRCDPHWEQHRQRLADC  80

Query  305   AIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEE  481
             AIGFGK AIGGRDG++YVVTD+G+D  V+PKPGTLR+  +QDEPLWIIF RDM I+LKEE
Sbjct  81    AIGFGKNAIGGRDGRIYVVTDSGNDNPVSPKPGTLRHAVVQDEPLWIIFQRDMTIQLKEE  140

Query  482   LIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWR  661
             LIMNSFKTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VR SP H+GWR
Sbjct  141   LIMNSFKTIDGRGASVHISGGPCITIQYVTNIIIHGIHIHDCKQGGNAMVRSSPRHFGWR  200

Query  662   TLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             T+SDGDGVSIFGGSHVWVDHCS SNC DGL+DAI GSTAIT+SNN+MTHH+KVMLLGHSD
Sbjct  201   TISDGDGVSIFGGSHVWVDHCSFSNCEDGLIDAIMGSTAITLSNNHMTHHDKVMLLGHSD  260

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
             TY +DK MQVTIAFNHFGEGL+QRMP  RHGYFHVVNNDYTHWEMYAIGGSA+PTINSQG
Sbjct  261   TYSRDKNMQVTIAFNHFGEGLVQRMP--RHGYFHVVNNDYTHWEMYAIGGSANPTINSQG  318

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPN RF+KEVTKHEDAPES+WK WNWRS GDL+LNGAFFT      ASSSYAKASS
Sbjct  319   NRFLAPNIRFSKEVTKHEDAPESEWKRWNWRSSGDLLLNGAFFTP-SGGAASSSYAKASS  377

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L A+PSSLVG LT  +GAL C+KG  C
Sbjct  378   LGAKPSSLVGPLTSTSGALNCRKGSRC  404



>ref|XP_007163701.1| hypothetical protein PHAVU_001G256900g [Phaseolus vulgaris]
 gb|ESW35695.1| hypothetical protein PHAVU_001G256900g [Phaseolus vulgaris]
Length=452

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/388 (80%), Positives = 345/388 (89%), Gaps = 4/388 (1%)
 Frame = +2

Query  119   CTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLA  298
             C  SSP  DPEL+V++V + I NA+  RR L FLSCGTGNPIDDCWRCD NWE NR+ LA
Sbjct  69    CICSSPLQDPELVVEDVQKSI-NAS--RRNLAFLSCGTGNPIDDCWRCDANWEKNRKNLA  125

Query  299   DCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             +C+IGFGK AIGGRDGK+YVV+D GD  VNPKPGTLRYG IQ+EPLWIIF RDMVI+LK+
Sbjct  126   ECSIGFGKHAIGGRDGKIYVVSDPGDHPVNPKPGTLRYGVIQEEPLWIIFKRDMVIRLKQ  185

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             EL+MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHG+NIHDC+QGGNA VRDSP HYGW
Sbjct  186   ELMMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGINIHDCKQGGNAYVRDSPTHYGW  245

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RTLSDGDG+SIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNNYMTHHNKVMLLGHS
Sbjct  246   RTLSDGDGISIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHNKVMLLGHS  305

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             DT+ +DK MQVTIAFNHFGEGL+QRMPRCR+GYFHVVNNDYTHW+MYAIGGSA PTINSQ
Sbjct  306   DTFTRDKNMQVTIAFNHFGEGLVQRMPRCRYGYFHVVNNDYTHWKMYAIGGSAAPTINSQ  365

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  1198
             GNRFLAPND   KEVTK E++ +S+WK WNWRS GDLMLNGAFFT    AGASSSYA+AS
Sbjct  366   GNRFLAPNDHTFKEVTKRENSAQSKWKNWNWRSTGDLMLNGAFFTA-SGAGASSSYARAS  424

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL+A+PSSLV S+T  AG+L C+KG  C
Sbjct  425   SLAAKPSSLVSSITASAGSLACRKGSRC  452



>emb|CAA63496.1| pectate lyase [Musa acuminata AAA Group]
Length=398

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/387 (79%), Positives = 333/387 (86%), Gaps = 6/387 (2%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S+   DPEL+VQEV   +    ++RR+LG+LSCGTGNPIDDCWRCDP+W  NRQRLADCA
Sbjct  16    SAAVRDPELVVQEVQRSL---NVSRRRLGYLSCGTGNPIDDCWRCDPDWADNRQRLADCA  72

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDG++YVVTD+GDD  VNPKPGTLRY  IQ+EPLWIIF RD+VI+LKEEL
Sbjct  73    IGFGKNAIGGRDGEIYVVTDSGDDDPVNPKPGTLRYAVIQEEPLWIIFKRDIVIQLKEEL  132

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNS KTIDGRGASVHI+GGPCITIQYVTNIIIHG++IHDC+QGGNA VRDSP HYGWRT
Sbjct  133   IMNSHKTIDGRGASVHISGGPCITIQYVTNIIIHGVHIHDCKQGGNAYVRDSPGHYGWRT  192

Query  665   LSDGDGVSIFGGSH-VWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSD  841
             +SDGDGVSIFGG    WVDHC+L NC DGL+DAI GSTAITISNNY+ HH+KVMLLGHSD
Sbjct  193   VSDGDGVSIFGGQPPSWVDHCTLFNCHDGLIDAIHGSTAITISNNYLRHHDKVMLLGHSD  252

Query  842   TYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQG  1021
                 DK MQVTIAFNHFGE L+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQG
Sbjct  253   ELTSDKSMQVTIAFNHFGEDLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQG  312

Query  1022  NRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakass  1201
             NRFLAPNDRF KEVTK EDA ES+WK WNWRSEGD MLNGAFFT    AGASSS+AKASS
Sbjct  313   NRFLAPNDRFAKEVTKREDAQESEWKKWNWRSEGDQMLNGAFFTP-SGAGASSSHAKASS  371

Query  1202  lsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             L  R SSLVG++T  AG L CKKG  C
Sbjct  372   LGPRSSSLVGTITVSAGVLSCKKGSRC  398



>ref|XP_006852264.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
 gb|ERN13731.1| hypothetical protein AMTR_s00049p00173370 [Amborella trichopoda]
Length=409

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/390 (80%), Positives = 336/390 (86%), Gaps = 2/390 (1%)
 Frame = +2

Query  116   TCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRL  295
             TC  S   P  +     V E   +   +RR LG+LSC TGNPIDDCWRCDP+W +NRQRL
Sbjct  21    TCISSRVLPQVQEPESVVEEVERSLNHSRRNLGYLSCNTGNPIDDCWRCDPDWATNRQRL  80

Query  296   ADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKL  472
             ADCAIGFGK ++GG+ G++Y VTD  DD  V PKPGTLRY  IQDEPLWIIFARDM I L
Sbjct  81    ADCAIGFGKNSVGGKGGEIYTVTDPSDDNPVTPKPGTLRYAVIQDEPLWIIFARDMTITL  140

Query  473   KEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHY  652
             KEELIMNS+KTIDGRGASVHIA GPCIT+QYVTNIIIHG++IHDC+QGGNA VRDSP HY
Sbjct  141   KEELIMNSYKTIDGRGASVHIANGPCITVQYVTNIIIHGIHIHDCKQGGNAMVRDSPNHY  200

Query  653   GWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLG  832
             GWRTLSDGDGVSIFGGSH+WVDHC+LSNCRDGL+DAI GSTAITISNNYMTHH+KVMLLG
Sbjct  201   GWRTLSDGDGVSIFGGSHIWVDHCTLSNCRDGLIDAIHGSTAITISNNYMTHHDKVMLLG  260

Query  833   HSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTIN  1012
             HSD+Y QDK MQVTIAFNHFGEGLIQRMPRCR GYFHVVNNDYTHWEMYAIGGSA PTIN
Sbjct  261   HSDSYAQDKNMQVTIAFNHFGEGLIQRMPRCRFGYFHVVNNDYTHWEMYAIGGSASPTIN  320

Query  1013  SQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyak  1192
             SQGNRFLAP+DRFNKEVTKHEDAPES+WK WNWRSEGDLMLNGAFFT    AGASSSY +
Sbjct  321   SQGNRFLAPDDRFNKEVTKHEDAPESEWKNWNWRSEGDLMLNGAFFTP-SGAGASSSYNR  379

Query  1193  asslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             ASSLSARPSSLVG +T  AGAL CKKG  C
Sbjct  380   ASSLSARPSSLVGGITVSAGALNCKKGSRC  409



>ref|XP_008796023.1| PREDICTED: probable pectate lyase 5 [Phoenix dactylifera]
Length=409

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/381 (83%), Positives = 339/381 (89%), Gaps = 5/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+VQEV   + ++   RR+LG+LSCGTGNPIDDCWRCD NWESNRQRLADCAIGFGK
Sbjct  33    DPELVVQEVQRSLNSS---RRRLGYLSCGTGNPIDDCWRCDRNWESNRQRLADCAIGFGK  89

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD+GDD  VNPKPGTLRY  IQDEPLWIIF +DMVIKLKEELIMNS+
Sbjct  90    NAIGGRDGKIYVVTDSGDDDPVNPKPGTLRYAVIQDEPLWIIFQQDMVIKLKEELIMNSY  149

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KT+DGRGASVHIAGGPCITIQYV +IIIHGL+IHDC+ GGNA VRDSPEHYGWRT+SDGD
Sbjct  150   KTLDGRGASVHIAGGPCITIQYVNHIIIHGLHIHDCKPGGNAYVRDSPEHYGWRTVSDGD  209

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHC+LS+C DGLVDAI GSTAITISNNYM+HH+KVMLLGHSD +  DK
Sbjct  210   GVSIFGGSHVWVDHCTLSSCHDGLVDAIHGSTAITISNNYMSHHDKVMLLGHSDGFTNDK  269

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQ TIAFNHFGEGLIQRMPRCR GYFHVVNNDYTHWEMYAIGGSA PTINSQGNRFLAP
Sbjct  270   NMQATIAFNHFGEGLIQRMPRCRLGYFHVVNNDYTHWEMYAIGGSAAPTINSQGNRFLAP  329

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             + RF+KEVTK EDA E +WK WNWRSEGDLMLNGAFFT    AGASSSYAKASSL ARPS
Sbjct  330   DTRFSKEVTKREDASEGEWKNWNWRSEGDLMLNGAFFTP-SGAGASSSYAKASSLGARPS  388

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLV S+T  AGAL CKKG  C
Sbjct  389   SLVSSITMSAGALLCKKGSHC  409



>ref|XP_004502358.1| PREDICTED: probable pectate lyase 5-like [Cicer arietinum]
Length=405

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/391 (79%), Positives = 340/391 (87%), Gaps = 4/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P+   SSP  DPEL+VQ+V + I  +   RR L FLSCGTGNPIDDCWRCDPNWE NR+
Sbjct  19    VPSFIHSSPLQDPELVVQDVQKSINGS---RRNLAFLSCGTGNPIDDCWRCDPNWEKNRK  75

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             RLADCAIGFGK AIGGRDGK+YVVTD GD  V PKPGTLRYG IQ+EPLWIIF RDMVIK
Sbjct  76    RLADCAIGFGKHAIGGRDGKIYVVTDPGDHPVKPKPGTLRYGVIQEEPLWIIFKRDMVIK  135

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL+MNSFKTIDGRG +VHIAGGPCITIQ+VTNIIIHG+NIHDC++GGNA VRDS  H
Sbjct  136   LKQELMMNSFKTIDGRGTNVHIAGGPCITIQFVTNIIIHGINIHDCKRGGNAYVRDSTTH  195

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YG+RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+DAI GSTAITISNN+MTHHNKVMLL
Sbjct  196   YGFRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDAIHGSTAITISNNFMTHHNKVMLL  255

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  256   GHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  315

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLA ND   KEVTK E AP+SQWK WNWRS GDLMLNGAFF      GASSSYA
Sbjct  316   NSQGNRFLASNDNTFKEVTKREIAPQSQWKNWNWRSSGDLMLNGAFFRA-SGTGASSSYA  374

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL+A+PSSLV S+T  AG+L C+KG  C
Sbjct  375   RASSLAAKPSSLVASITASAGSLNCRKGSRC  405



>ref|XP_010239620.1| PREDICTED: probable pectate lyase 8 isoform X2 [Brachypodium 
distachyon]
Length=424

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/381 (77%), Positives = 330/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  46    DPETVASQVHMSIKNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  104

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGKLYVVTD GDD  VNPK GTLRY  IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  105   NAIGGRDGKLYVVTDAGDDDPVNPKEGTLRYAVIQDEPLWIIFKRDMVITLKQELIMNSF  164

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  165   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGD  224

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  225   AVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYLKDK  284

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  285   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  344

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++ASSL A+ S
Sbjct  345   TNPFAKEVTKRVETAQTTWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRASSLGAKSS  403

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAG L C+KG SC
Sbjct  404   SMVGTITSGAGVLSCRKGSSC  424



>ref|XP_006347419.1| PREDICTED: probable pectate lyase 18-like [Solanum tuberosum]
Length=405

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/384 (76%), Positives = 334/384 (87%), Gaps = 5/384 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P  + + +V +V+  I    ++RR LG+LSC TGNPIDDCWRCDPNWE NRQRLA+CAIG
Sbjct  26    PLQNHQYVVDQVHRSI---NVSRRNLGYLSCETGNPIDDCWRCDPNWEKNRQRLANCAIG  82

Query  314   FGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FGK A+GGRDGK+YVVT++G DD VNPKPGTLRYG IQDEPLWIIFARDMVI+LKEELIM
Sbjct  83    FGKNAVGGRDGKIYVVTNSGNDDPVNPKPGTLRYGVIQDEPLWIIFARDMVIQLKEELIM  142

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGA+VHIAGGPCITIQYVTN+IIHG++IHDC+QGGNA VR +P HYGWRT+S
Sbjct  143   NSFKTIDGRGATVHIAGGPCITIQYVTNVIIHGIHIHDCKQGGNAMVRSTPHHYGWRTIS  202

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGDGVSIFGGSH+W+DHCSLSNC DGL+DAI GSTAITISNNYMT H+KVMLLGHSD+++
Sbjct  203   DGDGVSIFGGSHIWIDHCSLSNCVDGLIDAIMGSTAITISNNYMTKHDKVMLLGHSDSHV  262

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNRF
Sbjct  263   QDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRF  322

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
             LA + RF+KEVTKHE +PES+WK WNWRS+GDLMLNGAFF  SG+  +S+    +S  + 
Sbjct  323   LASDIRFSKEVTKHEISPESEWKNWNWRSDGDLMLNGAFFVKSGAGASSNYAKASSLSAK  382

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
               S +  SL  GAGAL C++G  C
Sbjct  383   SSSLIS-SLVSGAGALSCREGSRC  405



>ref|XP_003601871.1| Pectate lyase [Medicago truncatula]
 gb|AES72122.1| pectate lyase family protein [Medicago truncatula]
Length=403

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/391 (79%), Positives = 342/391 (87%), Gaps = 4/391 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P+   SSP  DPEL+VQ+V + I ++   RR L FLSCG+GNPIDDCWRCD NWE NRQ
Sbjct  17    VPSFIQSSPLQDPELVVQDVQKSINDS---RRNLAFLSCGSGNPIDDCWRCDKNWEKNRQ  73

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             RLADCAIGFGK AIGGRDGK+YVVTD GD AVNPKPGTLRYG IQ+EPLWIIF RDMVIK
Sbjct  74    RLADCAIGFGKHAIGGRDGKIYVVTDPGDHAVNPKPGTLRYGVIQEEPLWIIFKRDMVIK  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LK+EL+MNSFKTIDGRG +VHIAGGPCIT+Q+VTNIIIHG+NIHDC++GGN  VRD+P H
Sbjct  134   LKQELMMNSFKTIDGRGTNVHIAGGPCITVQFVTNIIIHGINIHDCKRGGNTYVRDTPTH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YG+RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGL+D I GSTAITISNN+MTHHNKVMLL
Sbjct  194   YGFRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLIDVIHGSTAITISNNFMTHHNKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD++ +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA+PTI
Sbjct  254   GHSDSFTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWRMYAIGGSANPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLA ND   KEVTK E+A +SQWK WNWRS GDLMLNGAFF     AG+SSSYA
Sbjct  314   NSQGNRFLASNDNTFKEVTKRENAGQSQWKNWNWRSSGDLMLNGAFFRP-SGAGSSSSYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL+A+PSSLV SLT  AG+L C+KG  C
Sbjct  373   RASSLAAKPSSLVASLTASAGSLNCRKGSRC  403



>ref|XP_010322529.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 18 [Solanum 
lycopersicum]
Length=405

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/386 (75%), Positives = 336/386 (87%), Gaps = 5/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP  + + +V +V+  I    ++RR LG+LSCGTGNPIDDCWRCDPNWE NRQRLA+CA
Sbjct  24    SSPLQNHQYVVDQVDRSI---NVSRRNLGYLSCGTGNPIDDCWRCDPNWEKNRQRLANCA  80

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK AIGGRDGK+YVVT++G DD VNPKPGTLRYG IQDEPLWIIFA DMVI+LKEEL
Sbjct  81    IGFGKNAIGGRDGKIYVVTNSGNDDPVNPKPGTLRYGVIQDEPLWIIFASDMVIQLKEEL  140

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRGA+VHIAGGPCITIQYV+N+IIHG++IHDC+QGGNA VR +P+HYGWRT
Sbjct  141   IMNSFKTIDGRGANVHIAGGPCITIQYVSNVIIHGIHIHDCKQGGNAMVRSTPQHYGWRT  200

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGGS +W+DHCSLSNC DGL+DAI GST+IT SNNYMT+H+KVMLLGHSD+
Sbjct  201   ISDGDGVSIFGGSDIWIDHCSLSNCVDGLIDAIMGSTSITXSNNYMTNHDKVMLLGHSDS  260

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             ++QDK MQVTIAFNHFGEGL+QR+PRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  261   HVQDKNMQVTIAFNHFGEGLVQRIPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  320

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLA + RF+KEVTKHE+APES+WK WNWRS+GDLMLNGAFF  SG+  +S+    +S  
Sbjct  321   RFLASDIRFSKEVTKHENAPESEWKNWNWRSDGDLMLNGAFFVKSGAGASSNYAKASSLS  380

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             +   S +  SL  GAGAL C KG  C
Sbjct  381   AKSSSLIS-SLVSGAGALSCWKGSRC  405



>ref|XP_010239619.1| PREDICTED: probable pectate lyase 8 isoform X1 [Brachypodium 
distachyon]
Length=450

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/381 (77%), Positives = 330/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  72    DPETVASQVHMSIKNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  130

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGKLYVVTD GDD  VNPK GTLRY  IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  131   NAIGGRDGKLYVVTDAGDDDPVNPKEGTLRYAVIQDEPLWIIFKRDMVITLKQELIMNSF  190

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  191   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGD  250

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  251   AVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYLKDK  310

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  311   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  370

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++ASSL A+ S
Sbjct  371   TNPFAKEVTKRVETAQTTWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRASSLGAKSS  429

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAG L C+KG SC
Sbjct  430   SMVGTITSGAGVLSCRKGSSC  450



>ref|XP_010511733.1| PREDICTED: probable pectate lyase 5 [Camelina sativa]
Length=408

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/391 (82%), Positives = 342/391 (87%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             PT   S+P  DP+ +VQEVNEKI     +RR LG LSCGTGNPIDDCWRCDP WE NRQR
Sbjct  22    PTFIASTPVSDPDFVVQEVNEKI---NASRRNLGVLSCGTGNPIDDCWRCDPKWEKNRQR  78

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK AIGGRDGK+YVVTD+ D DAVNPKPGTLR+  IQDEPLWIIFARDMVIK
Sbjct  79    LADCAIGFGKHAIGGRDGKIYVVTDSSDKDAVNPKPGTLRHAVIQDEPLWIIFARDMVIK  138

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEELIMNSFKTIDGRG +VHIAGG CIT+QYVTNIIIHG+NIHDC++ GNA VRDSP H
Sbjct  139   LKEELIMNSFKTIDGRGVNVHIAGGACITVQYVTNIIIHGINIHDCKRKGNAYVRDSPSH  198

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT SDGD VSIFGGSHVWVDHCSLSNC DGL+DAI GSTAITISNNY+THHNKVMLL
Sbjct  199   YGWRTASDGDAVSIFGGSHVWVDHCSLSNCADGLIDAIHGSTAITISNNYLTHHNKVMLL  258

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW+MYAIGGSA PTI
Sbjct  259   GHSDSYTRDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWQMYAIGGSAAPTI  318

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPND   KEVTK+EDAP+S+WK WNWRSEGDL LNGAFFT      ASSSYA
Sbjct  319   NSQGNRFLAPNDHVFKEVTKYEDAPQSKWKKWNWRSEGDLFLNGAFFTA-SGGRASSSYA  377

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             KASSLSARPSS+V S+T  AGAL CKKG  C
Sbjct  378   KASSLSARPSSVVASVTSSAGALFCKKGSRC  408



>ref|XP_003524720.1| PREDICTED: pectate lyase-like [Glycine max]
 gb|KHN45984.1| Putative pectate lyase 5 [Glycine soja]
Length=404

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/391 (79%), Positives = 343/391 (88%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P+   SS   DPEL+VQEV   I     +RR LG+LSCGTGNPIDDCWRCDPNWE+NRQR
Sbjct  18    PSFVSSSAVRDPELVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCDPNWENNRQR  74

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADC+IGFGK AIGG++G++YVVTD+GDD AVNP+PGTLRY AIQDEPLWI+F RDMVI 
Sbjct  75    LADCSIGFGKDAIGGKNGRIYVVTDSGDDDAVNPRPGTLRYAAIQDEPLWIMFKRDMVIT  134

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             LKEEL++NSFKTIDGRGASVHIAGG CITI YV+NIIIHG++IHDC+  GN N+RDSP H
Sbjct  135   LKEELLVNSFKTIDGRGASVHIAGGGCITIHYVSNIIIHGIHIHDCKPTGNTNIRDSPHH  194

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
              G+ T SDGDGVSIF   H+WVDHCSLSNCRDGL+DAI GSTAITISNNYMTHH+KVMLL
Sbjct  195   SGFWTQSDGDGVSIFNSKHIWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHDKVMLL  254

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  255   GHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTI  314

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRFLAPN RF+KEVTKHEDAP+S+W GWNWRSEGD+ LNGA+F     AGASSSYA
Sbjct  315   NSQGNRFLAPNIRFSKEVTKHEDAPQSEWMGWNWRSEGDMFLNGAYF-RQSGAGASSSYA  373

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  374   RASSLSARPSSLVGSMTTTAGALNCRKGNRC  404



>gb|EEE60442.1| hypothetical protein OsJ_13660 [Oryza sativa Japonica Group]
Length=443

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/388 (76%), Positives = 334/388 (86%), Gaps = 3/388 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
             T      DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLAD
Sbjct  58    TVPGAVDDPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLAD  116

Query  302   CAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             C IGFG+ AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+
Sbjct  117   CGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQ  176

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  177   ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  236

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  237   RTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  296

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  297   DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  356

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  1198
             GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++AS
Sbjct  357   GNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRAS  415

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL A+ SS+VG++T GAGAL C+ G +C
Sbjct  416   SLGAKSSSMVGTITSGAGALSCRGGSAC  443



>emb|CAE02420.2| OSJNBa0095E20.8 [Oryza sativa Japonica Group]
 emb|CAH65848.1| OSIGBa0147B06.7 [Oryza sativa Indica Group]
Length=472

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/381 (77%), Positives = 333/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLADC IGFG+
Sbjct  94    DPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGR  152

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+ELIMNSF
Sbjct  153   NAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQELIMNSF  212

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  213   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGD  272

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  273   AVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  332

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  333   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  392

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++ASSL A+ S
Sbjct  393   TNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRASSLGAKSS  451

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C+ G +C
Sbjct  452   SMVGTITSGAGALSCRGGSAC  472



>ref|XP_010536660.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 18 [Tarenaya 
hassleriana]
Length=401

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/381 (79%), Positives = 331/381 (87%), Gaps = 7/381 (2%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V+EV+  I  +  ARRKLG+LSCGTGNPIDDCWRCDPNWE  RQRLADCAIGFGK
Sbjct  27    DPETVVEEVHRSINASVAARRKLGYLSCGTGNPIDDCWRCDPNWEKTRQRLADCAIGFGK  86

Query  323   QAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG++YVVTD+G DD VNPKPGTLRY  IQDEPLWIIF RDM I+LKEELIMNSF
Sbjct  87    NAIGGRDGRIYVVTDSGNDDPVNPKPGTLRYAVIQDEPLWIIFQRDMTIQLKEELIMNSF  146

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHIAGGPCIT+QYVTNIIIHG+++HDC+QGGNA VR SP HYGWRT+SDGD
Sbjct  147   KTIDGRGASVHIAGGPCITVQYVTNIIIHGIHVHDCKQGGNAMVRSSPRHYGWRTISDGD  206

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFGGSHVWVDHCS SNC DGLVDAI GSTAITISNNY THH+KVMLLGHSDTY + K
Sbjct  207   GVSIFGGSHVWVDHCSFSNCNDGLVDAIMGSTAITISNNYFTHHDKVMLLGHSDTYARCK  266

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
                +  +  +FG      + RCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF+AP
Sbjct  267   XGGMVGSKCNFGN-----LRRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFVAP  321

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N RF+KEVTKHEDAPES+WK WNWRSEGDL+LNGAFF T   AGASSSYA+ASSL ARPS
Sbjct  322   NIRFSKEVTKHEDAPESEWKNWNWRSEGDLLLNGAFF-TRSGAGASSSYARASSLGARPS  380

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVG++T GAGAL C+KG  C
Sbjct  381   SLVGTITVGAGALSCRKGAHC  401



>gb|EEC76710.1| hypothetical protein OsI_14719 [Oryza sativa Indica Group]
Length=473

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/381 (77%), Positives = 333/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLADC IGFG+
Sbjct  95    DPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLADCGIGFGR  153

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+ELIMNSF
Sbjct  154   NAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQELIMNSF  213

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  214   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGD  273

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  274   AVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  333

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  334   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  393

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT    AGAS+SY++ASSL A+ S
Sbjct  394   TNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFTP-SGAGASASYSRASSLGAKSS  452

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C+ G +C
Sbjct  453   SMVGTITSGAGALSCRGGSAC  473



>ref|XP_004143054.1| PREDICTED: probable pectate lyase 5-like [Cucumis sativus]
 ref|XP_004171247.1| PREDICTED: probable pectate lyase 5-like [Cucumis sativus]
 gb|KGN62338.1| hypothetical protein Csa_2G350210 [Cucumis sativus]
Length=415

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/384 (77%), Positives = 331/384 (86%), Gaps = 2/384 (1%)
 Frame = +2

Query  134   PYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             P PDP+L+ QEV   I NATI RR LGFLSC TGNPIDDCWRCD NWE NR++LADCAIG
Sbjct  33    PVPDPDLVAQEVLTSINNATITRRNLGFLSCKTGNPIDDCWRCDANWEKNRKKLADCAIG  92

Query  314   FGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FGK+AIGG++GK Y+VTD  D D VNPKPGTLR+  IQ EPLWI F RDMVIKLK EL+M
Sbjct  93    FGKRAIGGKNGKYYIVTDPSDNDVVNPKPGTLRHAVIQKEPLWITFKRDMVIKLKAELLM  152

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRG SVHIAGGPCITIQ+VTNIIIHG+NIHDC+QGGN  VRDSPEHYGWRT+S
Sbjct  153   NSFKTIDGRGVSVHIAGGPCITIQFVTNIIIHGINIHDCKQGGNTYVRDSPEHYGWRTVS  212

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGDG+SIFGGSHVW+DHCSLSNCRDGL+DAI GSTAIT+SNNYMTHHNKVMLLGHSD+Y 
Sbjct  213   DGDGISIFGGSHVWIDHCSLSNCRDGLIDAIHGSTAITVSNNYMTHHNKVMLLGHSDSYT  272

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQGNR+
Sbjct  273   QDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWIMYAIGGSASPTINSQGNRY  332

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
             LAPN++ +KEVTK ED P+S+WK WNWRS+GDLMLNGAFF  SG+  +SS    +S  + 
Sbjct  333   LAPNNQNSKEVTKREDTPQSRWKNWNWRSDGDLMLNGAFFVRSGAGASSSYARASSLSAK  392

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
               SSL+ S+T GAG L C+KG  C
Sbjct  393   S-SSLINSITAGAGVLKCRKGSRC  415



>dbj|BAK06362.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=466

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/381 (76%), Positives = 328/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGFG+
Sbjct  88    DPETVVSQVHMSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFGR  146

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD GDD  VNPK GTLRY  IQDEPLWIIF RDMVI L +ELIMNSF
Sbjct  147   NAIGGRDGKIYVVTDAGDDDPVNPKKGTLRYAVIQDEPLWIIFKRDMVITLSQELIMNSF  206

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  207   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTIADGD  266

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  267   AVSIFGASHVWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYLKDK  326

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  327   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  386

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ WK WNWRSEGD++LNGAFFT    AGAS+SY++ASSL A+ S
Sbjct  387   TNPFAKEVTKRVETAQTTWKAWNWRSEGDMLLNGAFFTP-SGAGASASYSRASSLGAKSS  445

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V ++T GAGAL C KG SC
Sbjct  446   SMVATITSGAGALSCHKGSSC  466



>ref|XP_009340844.1| PREDICTED: pectate lyase-like [Pyrus x bretschneideri]
Length=404

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/392 (78%), Positives = 340/392 (87%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             + T   SS   DPE +V+EV+  I     +RR L +LSCGTGNPIDDCWRCDPNWE NRQ
Sbjct  17    SATFVSSSQVQDPERVVEEVHRSI---NASRRNLAYLSCGTGNPIDDCWRCDPNWERNRQ  73

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             R ADCAIGFGK AIGGR+G++YVVTD+GDD  VNPKPGTLR+  IQDEPLWIIF RDMV+
Sbjct  74    RFADCAIGFGKDAIGGRNGRIYVVTDSGDDDPVNPKPGTLRHAVIQDEPLWIIFKRDMVV  133

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LK+EL+MNSFKTIDGRGASVHIAGGPCITI Y TNIIIHG++IHDC+  GN N+R+SPE
Sbjct  134   QLKQELVMNSFKTIDGRGASVHIAGGPCITIHYATNIIIHGIHIHDCKPAGNGNIRNSPE  193

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H GW T+SDGDGVSIF G H+WVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  194   HSGWWTVSDGDGVSIFNGQHIWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVML  253

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  254   LGHSDSYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPT  313

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             I SQGNRFLAP+ RF+KEVTKHEDAPES+W+ WNWRSEGD++LNGAFF     AGASSSY
Sbjct  314   ILSQGNRFLAPDRRFDKEVTKHEDAPESEWRKWNWRSEGDMLLNGAFF-RQSGAGASSSY  372

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLVGS+T  AGAL C++G  C
Sbjct  373   ARASSLSARPSSLVGSITTAAGALNCRRGSRC  404



>ref|XP_011097349.1| PREDICTED: pectate lyase-like [Sesamum indicum]
Length=406

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/391 (74%), Positives = 330/391 (84%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SS   DP+++VQ+V++ I     +RR LG+LSC TGNPIDDCWRCDPNWE NRQR
Sbjct  20    PILASSSSLQDPDIVVQDVHKSI---NASRRNLGYLSCATGNPIDDCWRCDPNWEQNRQR  76

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFGK A+GG+ G++YVVTD+GDD  VNP+PGTLR+  IQD PLWIIF RDMVI+
Sbjct  77    LADCAIGFGKNAMGGKGGRIYVVTDSGDDDPVNPRPGTLRHAVIQDGPLWIIFRRDMVIR  136

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             L +EL+MNS KTIDGRGASVHIAGG CITI +VTN+IIHG++IHDC + GN  +RDSPEH
Sbjct  137   LNQELVMNSHKTIDGRGASVHIAGGACITIHHVTNVIIHGIHIHDCVKAGNGIIRDSPEH  196

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
              GW  +SDGDG+SIFGG  +WVDHCSLSNC DGL+DAI GSTAITISNNY THH+KVMLL
Sbjct  197   KGWWEVSDGDGISIFGGRDIWVDHCSLSNCNDGLIDAIHGSTAITISNNYFTHHDKVMLL  256

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI
Sbjct  257   GHSDEYTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTI  316

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
              SQGNRFLAPNDR  K+VTKHEDAPES+W+ WNWRSEGDLMLNGA+F      GA ++YA
Sbjct  317   YSQGNRFLAPNDRDRKQVTKHEDAPESEWRHWNWRSEGDLMLNGAYFLQ-SGTGAGATYA  375

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSLSARPSSLV S+T  AGAL CK+G  C
Sbjct  376   RASSLSARPSSLVASITTAAGALNCKRGARC  406



>ref|XP_006604001.1| PREDICTED: pectate lyase-like [Glycine max]
Length=404

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/392 (78%), Positives = 340/392 (87%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P    SS   DPEL+VQEV   I     +RR LG+LSCGTGNPIDDCWRC+ NWE+NRQ
Sbjct  17    TPCFVSSSAVRDPELVVQEVQRSI---NASRRNLGYLSCGTGNPIDDCWRCESNWENNRQ  73

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGG++G++YVVTD+GDD AVNP+PGTLRY AIQDEPLWIIF RDMVI
Sbjct  74    RLADCAIGFGKDAIGGKNGRIYVVTDSGDDDAVNPRPGTLRYAAIQDEPLWIIFKRDMVI  133

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
              LKEEL++NSFKTIDGRGASVHIA G CITI YV+NIIIHG++IHDC+  GN N+RDSP 
Sbjct  134   TLKEELLVNSFKTIDGRGASVHIANGGCITIHYVSNIIIHGIHIHDCKPTGNTNIRDSPH  193

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H G+ T SDGDGVSIF   H+WVDHCSLSNCRDGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  194   HSGFWTQSDGDGVSIFNSKHIWVDHCSLSNCRDGLIDAIHGSTAITISNNYMTHHDKVML  253

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PT
Sbjct  254   LGHSDSYTQDKDMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPT  313

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAPN RF+KEVTKHEDAP+S+W GWNWRSEGD+ LNGA+F     AGASSSY
Sbjct  314   INSQGNRFLAPNIRFSKEVTKHEDAPQSEWMGWNWRSEGDMFLNGAYF-RQSGAGASSSY  372

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLVGS+T  AGAL C+KG  C
Sbjct  373   ARASSLSARPSSLVGSMTTTAGALTCRKGNRC  404



>ref|XP_010935686.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=425

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/381 (76%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+RLADC IGFG+
Sbjct  47    DPEMVASMVQMSIRNST-ARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGIGFGR  105

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+PGTLR+  +QDEPLWI+F RDMVI LKEELIMNSF
Sbjct  106   NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVVQDEPLWIVFQRDMVITLKEELIMNSF  165

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  166   KTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  225

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SHVWVDHCSLSNC DGLVDAI GSTAITISNN++THHN+VMLLGHSD+Y +DK
Sbjct  226   AVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITISNNHLTHHNEVMLLGHSDSYERDK  285

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  286   DMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  345

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  DA  S WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+PS
Sbjct  346   ANPFAKEVTKRLDASSSAWKNWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKPS  404

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C+K   C
Sbjct  405   SMVGTITSGAGALSCRKAAQC  425



>ref|XP_010935685.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=453

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/381 (76%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+RLADC IGFG+
Sbjct  75    DPEMVASMVQMSIRNST-ARRALGYLSCGTGNPIDDCWRCDPDWHHNRKRLADCGIGFGR  133

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+PGTLR+  +QDEPLWI+F RDMVI LKEELIMNSF
Sbjct  134   NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVVQDEPLWIVFQRDMVITLKEELIMNSF  193

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  194   KTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  253

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SHVWVDHCSLSNC DGLVDAI GSTAITISNN++THHN+VMLLGHSD+Y +DK
Sbjct  254   AVSIFGSSHVWVDHCSLSNCADGLVDAIMGSTAITISNNHLTHHNEVMLLGHSDSYERDK  313

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  314   DMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  373

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  DA  S WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+PS
Sbjct  374   ANPFAKEVTKRLDASSSAWKNWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKPS  432

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C+K   C
Sbjct  433   SMVGTITSGAGALSCRKAAQC  453



>ref|XP_011073763.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=444

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/381 (76%), Positives = 328/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE + + V     N+T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  66    DPEEVARMVEMATRNST-ERRKLGFFSCGTGNPIDDCWRCDPNWQRNRKRLADCGIGFGR  124

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD AVNPKPGTLR+  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  125   NAIGGRDGRYYVVTDPGDDDAVNPKPGTLRHAVIQDEPLWIVFKRDMVITLKQELIMNSF  184

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  185   KTIDGRGVNVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  244

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             G+SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  245   GISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  304

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGY+HVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  305   QMQVTIAYNHFGEGLIQRMPRCRHGYYHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  364

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D  E QWK WNWRSEGDLMLNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  365   VNPFAKEVTKRVDTAEGQWKSWNWRSEGDLMLNGAYFTP-SGAGASASYARASSLGAKSS  423

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C++G+ C
Sbjct  424   SMVGTITAGAGALGCRRGRQC  444



>ref|XP_008800563.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=456

 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/381 (76%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCD +W  +R RLADC IGFG+
Sbjct  78    DPEMVASTVQMTIRNST-ARRALGYLSCGTGNPIDDCWRCDSDWHLHRTRLADCGIGFGR  136

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDG LYVVTD GDD  VNP+PGTLRY  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  137   NAVGGRDGSLYVVTDPGDDDPVNPRPGTLRYAVIQDEPLWIVFERDMVITLKQELIMNSF  196

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+V+NIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  197   KTIDGRGANVHIANGACITIQFVSNIIIHGLHIHDCKATGNAMVRSSPSHYGWRTMADGD  256

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SHVWVDHCSLSNC DGLVDA+ GSTAITISNNY+THHN+VMLLGHSD+Y +DK
Sbjct  257   GVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITISNNYLTHHNEVMLLGHSDSYEKDK  316

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  317   DMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  376

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D+  ++WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+PS
Sbjct  377   ANAFAKEVTKRLDSSSNEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKPS  435

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C+K   C
Sbjct  436   SMVGTMTSGAGALSCRKAAQC  456



>ref|XP_008800564.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=455

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/381 (76%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCD +W  +R RLADC IGFG+
Sbjct  77    DPEMVASTVQMTIRNST-ARRALGYLSCGTGNPIDDCWRCDSDWHLHRTRLADCGIGFGR  135

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDG LYVVTD GDD  VNP+PGTLRY  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  136   NAVGGRDGSLYVVTDPGDDDPVNPRPGTLRYAVIQDEPLWIVFERDMVITLKQELIMNSF  195

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+V+NIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  196   KTIDGRGANVHIANGACITIQFVSNIIIHGLHIHDCKATGNAMVRSSPSHYGWRTMADGD  255

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SHVWVDHCSLSNC DGLVDA+ GSTAITISNNY+THHN+VMLLGHSD+Y +DK
Sbjct  256   GVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITISNNYLTHHNEVMLLGHSDSYEKDK  315

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  316   DMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  375

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D+  ++WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+PS
Sbjct  376   ANAFAKEVTKRLDSSSNEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKPS  434

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAGAL C+K   C
Sbjct  435   SMVGTMTSGAGALSCRKAAQC  455



>ref|XP_004975048.1| PREDICTED: probable pectate lyase 15-like isoform X3 [Setaria 
italica]
Length=440

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 331/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARR L +LSCGTGNPIDDCWRCD +W  NRQRLADC IGFG+
Sbjct  62    DPEAVVDDVHVSIRNST-ARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGFGR  120

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD + DDAVNP+ GTLRYG IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  121   NAIGGRDGKIYVVTDPSDDDAVNPRKGTLRYGVIQDEPLWIIFKRDMVITLKQELIMNSF  180

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  181   KTIDGRGANVHISGGACITIQYVSNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTIADGD  240

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  241   AVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  300

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  301   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  360

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ W+ WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  361   TNPFAKEVTKRVETAQTVWQSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  419

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL C+KG +C
Sbjct  420   SMVGSITSDAGALSCRKGVAC  440



>gb|AFK32131.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32132.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32133.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32134.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32135.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32136.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32137.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32138.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32139.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32140.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32141.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32142.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32143.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32144.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32145.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32146.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32147.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32148.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32149.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32150.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32151.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32152.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32153.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32154.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32155.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32156.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32157.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32158.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32159.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32160.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32161.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32162.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32163.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32164.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32165.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32166.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32167.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32168.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32169.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32170.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32171.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32172.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32173.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32174.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32175.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32176.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32177.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32178.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32179.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32180.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32181.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32182.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32183.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32184.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32185.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32186.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32187.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32188.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32189.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32190.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32191.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32192.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32193.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32194.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32195.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32196.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32197.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32198.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32199.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32200.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32201.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32202.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32203.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32204.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32205.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32206.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32207.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32208.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32209.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32210.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32211.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32212.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32213.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32214.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32215.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32216.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32217.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32218.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32219.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32220.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32221.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32222.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32223.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32224.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32225.1| pectate lyase, partial [Vitis vinifera]
 gb|AFK32226.1| pectate lyase, partial [Vitis vinifera]
Length=351

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/352 (82%), Positives = 318/352 (90%), Gaps = 2/352 (1%)
 Frame = +2

Query  230   TGNPIDDCWRCDPNWESNRQRLADCAIGFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTL  406
             TGNPIDDCWRCD NW  NRQRLADCAIGFGK A+GG++G++YVVTD+  DD VNP+PGTL
Sbjct  1     TGNPIDDCWRCDANWXKNRQRLADCAIGFGKDAMGGKNGRIYVVTDSEDDDPVNPRPGTL  60

Query  407   RYGAIQDEPLWIIFARDMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIH  586
             R+  IQDEPLWIIF RDMVIKLK+EL+MNSFKTIDGRGASVHIAGGPCITI Y +NIIIH
Sbjct  61    RHAVIQDEPLWIIFKRDMVIKLKQELVMNSFKTIDGRGASVHIAGGPCITIHYASNIIIH  120

Query  587   GLNIHDCQQGGNANVRDSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIR  766
             GL+IHDC+QGGNAN+R+SP H GW T+SDGDGVSIF G H+WVDHCSLSNC DGL+DAI 
Sbjct  121   GLHIHDCKQGGNANIRNSPHHSGWWTVSDGDGVSIFXGRHIWVDHCSLSNCHDGLIDAIH  180

Query  767   GSTAITISNNYMTHHNKVMLLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHV  946
             GSTAITISNN+MTHH+KVMLLGHSD+Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHV
Sbjct  181   GSTAITISNNFMTHHDKVMLLGHSDSYTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHV  240

Query  947   VNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGD  1126
             VNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRF K VTKHEDAPES+W+ WNWRSEGD
Sbjct  241   VNNDYTHWEMYAIGGSADPTINSQGNRFLAPNDRFKKAVTKHEDAPESEWRHWNWRSEGD  300

Query  1127  LMLNGAFFTTsgsagasssyakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             LMLNGAFF      GASSSYA+ASSLSARPSSLVGS+T G+GAL C+KG  C
Sbjct  301   LMLNGAFFLQ-SXXGASSSYARASSLSARPSSLVGSITLGSGALXCRKGSRC  351



>ref|XP_009391056.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/381 (76%), Positives = 324/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +   V+  I+N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+ LADC IGFG+
Sbjct  75    DPEEVASAVHMSISNST-ARRSLGYLSCGTGNPIDDCWRCDPDWHLNRKTLADCGIGFGR  133

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+GDD  VNP+PGTLRY  +QD+PLWI F RDMVI L +ELIMNSF
Sbjct  134   NAIGGRDGEFYVVTDSGDDDPVNPRPGTLRYAVVQDDPLWITFERDMVITLDQELIMNSF  193

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  194   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  253

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SHVWVDHCSLSNC DGLVDA+ GSTAIT+SNNY THHN+VMLLGHSD+Y +DK
Sbjct  254   GVSIFGSSHVWVDHCSLSNCADGLVDAVMGSTAITVSNNYFTHHNEVMLLGHSDSYERDK  313

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  314   SMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  373

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D   S WK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+PS
Sbjct  374   TNPFAKEVTKRVDTDASLWKNWNWRSEGDLLLNGAYFTP-SGAGASTSYARASSLGAKPS  432

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG+LT  AGAL C+ G  C
Sbjct  433   SMVGTLTSDAGALSCRAGTQC  453



>ref|XP_008667903.1| PREDICTED: pectate lyase 8 isoform X1 [Zea mays]
 tpg|DAA38670.1| TPA: pectate lyase 8 [Zea mays]
Length=479

 Score =   588 bits (1515),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/391 (74%), Positives = 333/391 (85%), Gaps = 3/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P+   +    DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W SNRQR
Sbjct  91    PSRAVTGAVEDPEAVANDVHVSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQR  149

Query  293   LADCAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADC IGFG+ AIGGRDGK+YVVTD + DD VNP+ GTLR+  IQ+EPLWIIF RDMVI 
Sbjct  150   LADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRHAVIQEEPLWIIFKRDMVIT  209

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             L+EELIMNSFKTIDGRGA+VHIA G C+TIQYVTN+IIHGL+IHDC+  GNA VR SP H
Sbjct  210   LREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSH  269

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT++DGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLL
Sbjct  270   YGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITLSNNYFTHHNEVMLL  329

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  330   GHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTI  389

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNR+LAP + F KEVTK  +  ++ WK WNWRSEGDL+LNGA+FT    AGAS+SY+
Sbjct  390   NSQGNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLLLNGAYFTP-SGAGASASYS  448

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL A+ SS+VG++T  AGAL C+KG +C
Sbjct  449   RASSLGAKSSSMVGTITSDAGALSCRKGAAC  479



>emb|CDY03964.1| BnaC02g36790D [Brassica napus]
Length=412

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/381 (74%), Positives = 321/381 (84%), Gaps = 4/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DP L+V EVN  + NA+  RR L +LSC TGNPIDDCWRCDPNWE+NRQRLADCAIGFGK
Sbjct  35    DPNLVVDEVNRSVFNAS--RRSLAYLSCRTGNPIDDCWRCDPNWETNRQRLADCAIGFGK  92

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGR G++YVVTD   DD VNP+PGTLR+   Q+EPLWIIF RDMVI+LK+ELI+ SF
Sbjct  93    HAIGGRSGRIYVVTDPANDDPVNPRPGTLRHAVTQEEPLWIIFKRDMVIRLKKELIITSF  152

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG+SVHI  GPCI I Y TNII+HG+NIHDC+ G    +RD P H GW   SDGD
Sbjct  153   KTIDGRGSSVHITDGPCIKIHYATNIIVHGINIHDCKPGSAGMIRDGPRHTGWWVKSDGD  212

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              V++FGG HVW+DHCS SNC DGL+DAI GSTAITISNN+MTHH+KVMLLGH D+Y QDK
Sbjct  213   AVALFGGRHVWIDHCSFSNCDDGLIDAIHGSTAITISNNHMTHHDKVMLLGHHDSYTQDK  272

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQGNRFLAP
Sbjct  273   NMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIFSQGNRFLAP  332

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             N RFNKEVTKHEDAPES+W+ WNWRSEGD++LNGA+F     A +SS+YA+ASSLSARPS
Sbjct  333   NTRFNKEVTKHEDAPESKWRHWNWRSEGDILLNGAYF-RQSGARSSSTYARASSLSARPS  391

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVGS+T  AG L C++G+ C
Sbjct  392   SLVGSITTTAGTLSCRRGRRC  412



>ref|XP_008444399.1| PREDICTED: probable pectate lyase 5 [Cucumis melo]
 ref|XP_008444400.1| PREDICTED: probable pectate lyase 5 [Cucumis melo]
Length=415

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/386 (77%), Positives = 332/386 (86%), Gaps = 3/386 (1%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SSP PDP+L+ QEV   I NAT  RR LGFLSC TGNPIDDCWRCD NWE NR+RLA+CA
Sbjct  32    SSPVPDPDLVAQEVLTSINNAT-TRRNLGFLSCRTGNPIDDCWRCDANWEKNRKRLANCA  90

Query  308   IGFGKQAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK+AIGG++G+ Y+VTD  D D VNPKPGTLR+  IQ EPLWIIF RDMVIKLK EL
Sbjct  91    IGFGKRAIGGKNGRYYIVTDPSDNDVVNPKPGTLRHAVIQKEPLWIIFKRDMVIKLKAEL  150

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             +MNSFKTIDGRG SVHIAGGPCITIQ+VTNIIIHG+NIHDC+QGGN  VRDSPEHYGWRT
Sbjct  151   LMNSFKTIDGRGVSVHIAGGPCITIQFVTNIIIHGINIHDCKQGGNTYVRDSPEHYGWRT  210

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDG+SIFGGSHVW+DHCSLSNCRDGL+DAI GSTAIT+SNNYMTHHNKVMLLGHSD+
Sbjct  211   VSDGDGISIFGGSHVWIDHCSLSNCRDGLIDAIHGSTAITVSNNYMTHHNKVMLLGHSDS  270

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHW MYAIGGSA PTINSQGN
Sbjct  271   YTQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWIMYAIGGSASPTINSQGN  330

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             R+LAPN++  KEVTK EDAP+S+WK WNWRS+GDLMLNGAFF  SG+  +S     +S  
Sbjct  331   RYLAPNNQDRKEVTKREDAPQSKWKNWNWRSDGDLMLNGAFFVRSGAGASSRYARASSLS  390

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             +   SSLV S+T GAG L C+KG  C
Sbjct  391   AKS-SSLVSSITSGAGVLKCRKGSRC  415



>ref|XP_004304685.1| PREDICTED: pectate lyase-like [Fragaria vesca subsp. vesca]
Length=399

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/392 (76%), Positives = 337/392 (86%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             A T    S   DPE++VQEV+  I   + +RR+L   SCG GNPIDDCWRCDPNWE NRQ
Sbjct  12    ATTSVSCSQLQDPEVVVQEVHRNI---SASRRQLAHSSCGNGNPIDDCWRCDPNWEQNRQ  68

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK AIGGR+G++YVV+D+GDD  VNP+PGT+R+  IQDEPLWIIF RDMVI
Sbjct  69    RLADCAIGFGKDAIGGRNGRIYVVSDSGDDDPVNPRPGTIRHAVIQDEPLWIIFKRDMVI  128

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
             +LK+EL+MNSFKTIDGRGASVHIA GPCITI +VTNIIIHG++IHDC+Q GN ++RDSP 
Sbjct  129   QLKQELVMNSFKTIDGRGASVHIANGPCITIHHVTNIIIHGIHIHDCKQAGNGDIRDSPS  188

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H GW T SDGDGVSIFGG HVWVDHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVML
Sbjct  189   HAGWWTQSDGDGVSIFGGKHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYMTHHDKVML  248

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD++ +DKGM VTIAFNHFGEGL+QRMPRCR GYFHVVNNDYTHWEMYAIGGSA PT
Sbjct  249   LGHSDSFTEDKGMHVTIAFNHFGEGLVQRMPRCRLGYFHVVNNDYTHWEMYAIGGSAAPT  308

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             I SQGNRFLAP+ RF+KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFF     AG+ SSY
Sbjct  309   IYSQGNRFLAPDRRFDKEVTKHEDAPESKWRKWNWRSEGDLMLNGAFFRQ-SGAGSWSSY  367

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLS RPSSLVGS+T  AGAL C++G  C
Sbjct  368   ARASSLSGRPSSLVGSMTVTAGALNCRRGSRC  399



>emb|CDO99404.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/381 (75%), Positives = 324/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE I   V   I N+T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  74    DPEEIASMVAMSIKNST-ERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGR  132

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+ DD  VNP+PGTLR+  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  133   NAIGGRDGRYYVVTDSSDDDPVNPRPGTLRHAVIQDEPLWIVFKRDMVITLKQELIMNSF  192

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTID RG +VHIA   CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  193   KTIDARGVNVHIANRACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  252

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  253   AISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  312

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  313   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  372

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ESQWKGWNWRSEGDLMLNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  373   LNPFAKEVTKRVETAESQWKGWNWRSEGDLMLNGAYFTP-SGAGASASYARASSLGAKSS  431

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T GAG L C++G++C
Sbjct  432   SMVASMTSGAGVLSCRRGRTC  452



>emb|CDP16631.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/382 (77%), Positives = 335/382 (88%), Gaps = 5/382 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DP+L+VQ+V   +     +RR LG+LSCGTGNPIDDCWRCDP+WE+NRQRLADC IGFGK
Sbjct  35    DPDLVVQDVQRSM---NASRRNLGYLSCGTGNPIDDCWRCDPDWENNRQRLADCGIGFGK  91

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGR+G++YVVTD GDD AVNPKPGTLR+  IQDEPLWIIF RDMVI+L++EL+MNS 
Sbjct  92    DAMGGRNGRIYVVTDAGDDDAVNPKPGTLRHAVIQDEPLWIIFKRDMVIQLRQELVMNSH  151

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGASVHI+ GPCITI Y TNIIIHG++IHDC+QGGN N+R+SPEH G+ T+SDGD
Sbjct  152   KTIDGRGASVHISDGPCITIHYATNIIIHGIHIHDCKQGGNGNIRNSPEHSGYWTVSDGD  211

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             G+SIFGG HVWVDHCSLSNC DGL+DAI GSTAITISNNY T+H+KVMLLGHSD Y QDK
Sbjct  212   GISIFGGQHVWVDHCSLSNCHDGLIDAIHGSTAITISNNYFTNHDKVMLLGHSDYYTQDK  271

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQ TIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNRFLAP
Sbjct  272   NMQATIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAAPTINSQGNRFLAP  331

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFF-TTsgsagasssyakasslsaRP  1216
             N+ F KEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F  +  +  +S++YA+ASSLSARP
Sbjct  332   NENFRKEVTKHEDAPESEWQHWNWRSEGDLMLNGAYFRESGAAGASSTNYARASSLSARP  391

Query  1217  SSLVGSLTGGAGALPCKKGKSC  1282
             SSLVGS+T  AGAL C+ G  C
Sbjct  392   SSLVGSMTVAAGALTCRGGSRC  413



>ref|XP_008804450.1| PREDICTED: probable pectate lyase 8 isoform X2 [Phoenix dactylifera]
Length=426

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/381 (76%), Positives = 324/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  48    DPELVASEVHMTINNHT-ARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIGFGR  106

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+PGTLRY  IQD+PLWI+F RDMVI LKEELIMNSF
Sbjct  107   NAIGGRDGRYYVVTDPGDDDPVNPRPGTLRYAVIQDQPLWIVFKRDMVITLKEELIMNSF  166

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  167   KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  226

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITI+NNY THHN+VMLLGHSD+Y++DK
Sbjct  227   GVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITITNNYFTHHNEVMLLGHSDSYVKDK  286

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  287   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  346

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  347   ADPFAKEVTKRVDTDTSEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  405

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T  AG L C++   C
Sbjct  406   SMVASITTDAGVLQCRRNSQC  426



>ref|XP_009408120.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=447

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/388 (75%), Positives = 324/388 (84%), Gaps = 3/388 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
             T  +   DPE +   V   I+N+T ARR LG+LSCGTGNPIDDCWRCDP+W  NR+RLAD
Sbjct  62    TAEAAVDDPEEVASAVQMIISNST-ARRSLGYLSCGTGNPIDDCWRCDPDWHLNRKRLAD  120

Query  302   CAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             C IGFG+ A+GGRDG+ YVVTD GDD  VNP+PGTLRY  IQDEPLWI F RDMVI LKE
Sbjct  121   CGIGFGRNALGGRDGQYYVVTDAGDDDPVNPRPGTLRYAVIQDEPLWITFERDMVITLKE  180

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             ELIMNSFKT+DGRGA+VHIA G CITIQ +TN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  181   ELIMNSFKTVDGRGANVHIANGACITIQDITNVIIHGLHIHDCKPTGNAMVRSSPSHYGW  240

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RT++DGDGVSIF  SH+WVDHCSLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  241   RTMADGDGVSIFSSSHIWVDHCSLSNCADGLVDAVVGSTAITISNNYFTHHNEVMLLGHS  300

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  301   DSYVRDKSMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQ  360

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  1198
             GNR+LAP D F KEVTK  D   S WK WNWRSEGDL+LNGA+FT    AGAS+SYA+AS
Sbjct  361   GNRYLAPTDPFAKEVTKRVDTDASVWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARAS  419

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL A+PSSLV +LT  AG L C+ G  C
Sbjct  420   SLGAKPSSLVATLTSNAGVLSCRAGAQC  447



>ref|XP_004975047.1| PREDICTED: probable pectate lyase 15-like isoform X2 [Setaria 
italica]
Length=473

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 331/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARR L +LSCGTGNPIDDCWRCD +W  NRQRLADC IGFG+
Sbjct  95    DPEAVVDDVHVSIRNST-ARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGFGR  153

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD + DDAVNP+ GTLRYG IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  154   NAIGGRDGKIYVVTDPSDDDAVNPRKGTLRYGVIQDEPLWIIFKRDMVITLKQELIMNSF  213

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  214   KTIDGRGANVHISGGACITIQYVSNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTIADGD  273

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  274   AVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  333

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  334   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  393

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ W+ WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  394   TNPFAKEVTKRVETAQTVWQSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  452

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL C+KG +C
Sbjct  453   SMVGSITSDAGALSCRKGVAC  473



>ref|XP_008804449.1| PREDICTED: probable pectate lyase 8 isoform X1 [Phoenix dactylifera]
Length=451

 Score =   585 bits (1508),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/381 (76%), Positives = 324/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  73    DPELVASEVHMTINNHT-ARRALGYLSCGTGNSIDDCWRCDPEWHRNRKRLADCGIGFGR  131

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+PGTLRY  IQD+PLWI+F RDMVI LKEELIMNSF
Sbjct  132   NAIGGRDGRYYVVTDPGDDDPVNPRPGTLRYAVIQDQPLWIVFKRDMVITLKEELIMNSF  191

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  192   KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  251

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITI+NNY THHN+VMLLGHSD+Y++DK
Sbjct  252   GVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITITNNYFTHHNEVMLLGHSDSYVKDK  311

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  312   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  371

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  372   ADPFAKEVTKRVDTDTSEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  430

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T  AG L C++   C
Sbjct  431   SMVASITTDAGVLQCRRNSQC  451



>gb|EYU43815.1| hypothetical protein MIMGU_mgv1a006554mg [Erythranthe guttata]
Length=439

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/381 (75%), Positives = 325/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V+ V     N+T  RRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IGFG+
Sbjct  59    DPEEVVRMVEMATRNST-ERRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGR  117

Query  323   QAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ Y+VTD G DD VNP+PGTLRY  IQ +PLWI+F RDMVI LK+ELIMNSF
Sbjct  118   NAIGGRDGRFYIVTDPGNDDPVNPRPGTLRYAVIQTQPLWILFKRDMVITLKQELIMNSF  177

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  178   KTIDGRGANVHIANGGCITIQYVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  237

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+WVDH SLSNC DGLVDA+ GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  238   AISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITVSNNYFTHHNEVMLLGHSDSYMKDK  297

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  298   QMQVTIAYNHFGEGLMQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  357

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D  E QWKGWNWRSEGDLMLNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  358   VNPFAKEVTKRVDTGEGQWKGWNWRSEGDLMLNGAYFTP-SGAGASASYARASSLGAKSS  416

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T GAG L CK+G  C
Sbjct  417   SMVGTITSGAGVLGCKRGHQC  437



>ref|XP_004975046.1| PREDICTED: probable pectate lyase 15-like isoform X1 [Setaria 
italica]
Length=509

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 331/381 (87%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARR L +LSCGTGNPIDDCWRCD +W  NRQRLADC IGFG+
Sbjct  131   DPEAVVDDVHVSIRNST-ARRNLAYLSCGTGNPIDDCWRCDQDWHKNRQRLADCGIGFGR  189

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD + DDAVNP+ GTLRYG IQDEPLWIIF RDMVI LK+ELIMNSF
Sbjct  190   NAIGGRDGKIYVVTDPSDDDAVNPRKGTLRYGVIQDEPLWIIFKRDMVITLKQELIMNSF  249

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHI+GG CITIQYV+N+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  250   KTIDGRGANVHISGGACITIQYVSNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTIADGD  309

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  310   AVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  369

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  370   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  429

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ W+ WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  430   TNPFAKEVTKRVETAQTVWQSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  488

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL C+KG +C
Sbjct  489   SMVGSITSDAGALSCRKGVAC  509



>ref|XP_006653139.1| PREDICTED: LOW QUALITY PROTEIN: probable pectate lyase 8-like 
[Oryza brachyantha]
Length=483

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/349 (79%), Positives = 304/349 (87%), Gaps = 2/349 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
             A T T      DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W +NRQ
Sbjct  75    AATMTVPGAVDDPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHNNRQ  133

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADC IGFG+ AIGGRDGK+YVVTD GDD  VNPKPGTLRY  I+DEPLWIIF RDMVI
Sbjct  134   RLADCGIGFGRNAIGGRDGKIYVVTDPGDDDPVNPKPGTLRYAVIRDEPLWIIFKRDMVI  193

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
              LK+ELIMNSFKTIDGRGA+VHIA G C+TIQYVTNIIIHGL+IHDC+  GNA VR SP 
Sbjct  194   TLKQELIMNSFKTIDGRGANVHIANGACLTIQYVTNIIIHGLHIHDCRPTGNAMVRSSPS  253

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             HYGWRT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VML
Sbjct  254   HYGWRTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVML  313

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PT
Sbjct  314   LGHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPT  373

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT  1153
             INSQGNR+LAP + F KEVTK  +  +S WKGWNWRSEGDL+LNGAFFT
Sbjct  374   INSQGNRYLAPTNPFAKEVTKRVETAQSIWKGWNWRSEGDLLLNGAFFT  422



>ref|XP_010940647.1| PREDICTED: probable pectate lyase 8 [Elaeis guineensis]
Length=448

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/396 (73%), Positives = 329/396 (83%), Gaps = 11/396 (3%)
 Frame = +2

Query  122   TFSSPY--------PDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWE  277
             TFS P          DPE++   V   I N+T ARR LG+LSCGTGNPIDDCWRCDP+W 
Sbjct  55    TFSRPVLEAVKAAVDDPEVVASMVQMSIRNST-ARRALGYLSCGTGNPIDDCWRCDPDWH  113

Query  278   SNRQRLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFAR  454
              NR+RLADC IGFG+ A+GGRDG+ YVVTD GDD  VNP+PGTLR+  IQDEPLWI+F R
Sbjct  114   LNRKRLADCGIGFGRNAVGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQDEPLWIVFKR  173

Query  455   DMVIKLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVR  634
             DMVI LK+ELIMNSFKTIDGRGA+VHIA G CITIQ+VTNIIIHGL++HDC+  GNA VR
Sbjct  174   DMVITLKQELIMNSFKTIDGRGANVHIANGACITIQFVTNIIIHGLHVHDCKPTGNAMVR  233

Query  635   DSPEHYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHN  814
              SP HYGWRT++DGDG+SIFG SH+WVDHCSLSNC DGLVDA+  ST+ITISNNY THHN
Sbjct  234   SSPSHYGWRTMADGDGISIFGSSHLWVDHCSLSNCADGLVDAVVDSTSITISNNYFTHHN  293

Query  815   KVMLLGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGS  994
             +VMLLGHSD+Y +DKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGS
Sbjct  294   EVMLLGHSDSYERDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGS  353

Query  995   ADPTINSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsaga  1174
             A PTINSQGNR+LAP + F KEVTK  D P   WK WNWRSEGDL+LNGAFFT    AGA
Sbjct  354   ASPTINSQGNRYLAPVNPFAKEVTKRLDTPSGVWKSWNWRSEGDLLLNGAFFTP-SGAGA  412

Query  1175  sssyakasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             S+SY++ASSL A+PSS+VG++T  AGAL C+K   C
Sbjct  413   SASYSRASSLGAKPSSMVGTITSEAGALSCRKAAKC  448



>ref|XP_010918897.1| PREDICTED: probable pectate lyase 8 isoform X2 [Elaeis guineensis]
Length=426

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 323/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  48    DPELVASEVHMAINNHT-ARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIGFGR  106

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDG+ Y VTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI LKEELIMNSF
Sbjct  107   NAVGGRDGRYYAVTDPGDDDPVNPRPGTLRHAVIQEEPLWIVFKRDMVITLKEELIMNSF  166

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  167   KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  226

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  227   GVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  286

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  287   SMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  346

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  347   ADPFAKEVTKRVDTDASEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  405

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T  AG L C++   C
Sbjct  406   SMVASITSEAGVLQCRRNAHC  426



>ref|XP_010918895.1| PREDICTED: probable pectate lyase 8 isoform X1 [Elaeis guineensis]
Length=451

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 323/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I N T ARR LG+LSCGTGN IDDCWRCDP W  NR+RLADC IGFG+
Sbjct  73    DPELVASEVHMAINNHT-ARRSLGYLSCGTGNSIDDCWRCDPQWHRNRKRLADCGIGFGR  131

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDG+ Y VTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI LKEELIMNSF
Sbjct  132   NAVGGRDGRYYAVTDPGDDDPVNPRPGTLRHAVIQEEPLWIVFKRDMVITLKEELIMNSF  191

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  192   KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  251

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDHCSLSNC DGL+DAI GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  252   GVSIFGSSHIWVDHCSLSNCADGLIDAIMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  311

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  312   SMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  371

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              D F KEVTK  D   S+WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  372   ADPFAKEVTKRVDTDASEWKSWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  430

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T  AG L C++   C
Sbjct  431   SMVASITSEAGVLQCRRNAHC  451



>ref|XP_009411363.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=454

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/381 (76%), Positives = 326/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I+N+T +RR LG+LSCGTGNPIDDCWRCDP W  +R+RLADC IGFG+
Sbjct  76    DPELVASEVDMMISNST-SRRALGYLSCGTGNPIDDCWRCDPEWHRHRKRLADCGIGFGR  134

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+ GTLRY  IQ+EPLWI+F R MVI LK+ELIMNSF
Sbjct  135   NAIGGRDGRFYVVTDPGDDDPVNPRHGTLRYAVIQEEPLWIVFKRSMVITLKQELIMNSF  194

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG  VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  195   KTIDGRGVDVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  254

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VS+FG SH+WVDH SLSNC DGLVDAI GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  255   AVSMFGASHIWVDHNSLSNCADGLVDAIMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  314

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  315   AMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  374

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              D+  KEVTK  D  ES+WKGWNWRSEGDL+LNGA+FT    AGAS+SYAKASSL A+ S
Sbjct  375   VDQSAKEVTKRVDTDESEWKGWNWRSEGDLLLNGAYFTP-SGAGASASYAKASSLGAKSS  433

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL C++G  C
Sbjct  434   SMVGSITSDAGALNCRRGSHC  454



>gb|EYU32621.1| hypothetical protein MIMGU_mgv1a006198mg [Erythranthe guttata]
Length=453

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/381 (74%), Positives = 324/381 (85%), Gaps = 2/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V+ V     N+T  RR+LG+ SCGTGNPIDDCWRCDPNW  NR+RLADC IGFG+
Sbjct  74    DPEEVVRMVEMATRNSTDRRRRLGYFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGR  133

Query  323   QAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+G DD V PKPGTLRY  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  134   NAIGGRDGRFYVVTDSGNDDPVTPKPGTLRYAVIQDEPLWIVFQRDMVITLKQELIMNSF  193

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTID RGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  194   KTIDARGANVHIANGACITIQFITNVIIHGLHIHDCRPTGNAMVRSSPSHYGWRTMADGD  253

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDH S+SNC DGLVDA+ GSTAITISNNY THHN+V+LLGHSD+Y++DK
Sbjct  254   AVSIFGSSHIWVDHNSMSNCADGLVDAVMGSTAITISNNYFTHHNEVILLGHSDSYMRDK  313

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQ TIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  314   QMQATIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  373

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ES+WKGWNWR+EGDLMLNGA+F     AGAS SYA+ASSL A+ S
Sbjct  374   VNPFAKEVTKRVETAESRWKGWNWRTEGDLMLNGAYFIP-SGAGASGSYARASSLGAKSS  432

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T GAGAL C++G+ C
Sbjct  433   SMVASITSGAGALGCRRGRQC  453



>ref|XP_007034463.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY05389.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=447

 Score =   582 bits (1500),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/386 (74%), Positives = 329/386 (85%), Gaps = 7/386 (2%)
 Frame = +2

Query  140   PDPELIVQEV----NEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             PDP  +  EV    +  I N T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC 
Sbjct  64    PDPGAVAAEVETMIDMNIRNVT-ERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCG  122

Query  308   IGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFG+ AIGGRDG+ YVVTD GDD  VNP+PGTLR+  IQD+PLWI+F RDMVI+LK+EL
Sbjct  123   IGFGRNAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQDQPLWIVFKRDMVIQLKQEL  182

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             IMNSFKTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP H+GWRT
Sbjct  183   IMNSFKTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRT  242

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             ++DGDG+SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHSD+
Sbjct  243   MADGDGISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHSDS  302

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGN
Sbjct  303   YTRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGN  362

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             R+ AP + F KEVTK  D  ESQWK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL
Sbjct  363   RYAAPTNPFAKEVTKRVDTGESQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSL  421

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
              A+ SS+VG++T  AGALPC++G+ C
Sbjct  422   GAKSSSMVGAMTSNAGALPCRRGRQC  447



>gb|KHG06252.1| hypothetical protein F383_10745 [Gossypium arboreum]
Length=429

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/385 (74%), Positives = 328/385 (85%), Gaps = 7/385 (2%)
 Frame = +2

Query  143   DPELIVQEV----NEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  310
             DPE +  EV    +  I NAT  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC I
Sbjct  47    DPEAVAAEVETIIDMNIRNAT-ERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCGI  105

Query  311   GFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  487
             GFG+ AIGGRDG+ YVVTD+ DD  VNPKPGTLR+  IQ++PLWI+F RDMVIKLK+EL+
Sbjct  106   GFGRNAIGGRDGRFYVVTDSNDDDPVNPKPGTLRHAVIQEQPLWIVFKRDMVIKLKQELL  165

Query  488   MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTL  667
             +NSFKTIDGRG +VHIA G CITIQYVTN+I+HGL+IHDC+  GNA VR SP H+GWRT+
Sbjct  166   VNSFKTIDGRGVNVHIANGACITIQYVTNVIVHGLHIHDCKPTGNAMVRSSPTHFGWRTM  225

Query  668   SDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTY  847
             +DGD +SIFG SHVWVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHSD+Y
Sbjct  226   ADGDAISIFGSSHVWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHSDSY  285

Query  848   IQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR  1027
              +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR
Sbjct  286   TRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNR  345

Query  1028  FLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassls  1207
             + AP + F KEVTK  D  ES WK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL 
Sbjct  346   YAAPRNPFAKEVTKRVDTAESHWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLG  404

Query  1208  aRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ SS+VGS+T  AGALPC++G+ C
Sbjct  405   AKSSSMVGSMTSNAGALPCRRGRQC  429



>gb|KHG30349.1| hypothetical protein F383_15991 [Gossypium arboreum]
Length=487

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/385 (74%), Positives = 328/385 (85%), Gaps = 7/385 (2%)
 Frame = +2

Query  143   DPELIVQEV----NEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAI  310
             DPE +  EV    +  I NAT  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC I
Sbjct  105   DPEAVAAEVETIIDMNIRNAT-ERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCGI  163

Query  311   GFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELI  487
             GFG+ AIGGRDG+ YVVTD+ DD  VNPKPGTLR+  IQ++PLWI+F RDMVIKLK+EL+
Sbjct  164   GFGRNAIGGRDGRFYVVTDSNDDDPVNPKPGTLRHAVIQEQPLWIVFKRDMVIKLKQELL  223

Query  488   MNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTL  667
             +NSFKTIDGRG +VHIA G CITIQYVTN+I+HGL+IHDC+  GNA VR SP H+GWRT+
Sbjct  224   VNSFKTIDGRGVNVHIANGACITIQYVTNVIVHGLHIHDCKPTGNAMVRSSPTHFGWRTM  283

Query  668   SDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTY  847
             +DGD +SIFG SHVWVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHSD+Y
Sbjct  284   ADGDAISIFGSSHVWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHSDSY  343

Query  848   IQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR  1027
              +DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR
Sbjct  344   TRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNR  403

Query  1028  FLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassls  1207
             + AP + F KEVTK  D  ES WK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL 
Sbjct  404   YAAPRNPFAKEVTKRVDTAESHWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLG  462

Query  1208  aRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ SS+VGS+T  AGALPC++G+ C
Sbjct  463   AKSSSMVGSMTSNAGALPCRRGRQC  487



>ref|XP_008438392.1| PREDICTED: probable pectate lyase 8 [Cucumis melo]
Length=447

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/381 (75%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +PE I   V+  I NAT ARR+LGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  69    NPEEIAAMVDMSIRNAT-ARRELGFFSCGTGNPIDDCWRCDPNWQQNRKRLADCGIGFGR  127

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  128   NAIGGRDGRFYVVTDSGDDNPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  187

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTID RG +VHIA G C+TIQ+VTN+I+HGLNIHDC+  GNA VR SP H GWRT++DGD
Sbjct  188   KTIDARGTNVHIANGACLTIQFVTNVIVHGLNIHDCKPTGNAMVRSSPNHVGWRTIADGD  247

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+W+DH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  248   AISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  307

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  308   LMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYAAP  367

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ES+WKGWNWRSEGDL+LNGAFFT    AGAS+SYA+ASSL A+ S
Sbjct  368   TNPFAKEVTKRVETAESEWKGWNWRSEGDLLLNGAFFTP-SGAGASASYARASSLGAKSS  426

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T  AGAL C++G  C
Sbjct  427   SMVGTITSNAGALSCRRGHPC  447



>ref|XP_006854398.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
 gb|ERN15865.1| hypothetical protein AMTR_s00039p00189000 [Amborella trichopoda]
Length=457

 Score =   582 bits (1499),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/381 (75%), Positives = 323/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE++   V   I NAT  RR+LGF SCGTGNPIDDCWRCDP W   R+RLADC IGFG+
Sbjct  79    DPEMVASMVEMSIHNAT-QRRRLGFFSCGTGNPIDDCWRCDPLWARRRKRLADCGIGFGR  137

Query  323   QAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDG+ YVVTD+ D DAVNP+PGTLR+  IQDEPLWI+F RDMVIKLK+ELIMNSF
Sbjct  138   NAVGGRDGRYYVVTDSSDNDAVNPRPGTLRHAVIQDEPLWIVFNRDMVIKLKQELIMNSF  197

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIAGG CIT+Q+VTNIIIHGL+IHDC   GNA VR SP HYGWRT++DGD
Sbjct  198   KTIDGRGVNVHIAGGACITVQFVTNIIIHGLHIHDCHPTGNAMVRSSPSHYGWRTIADGD  257

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDHCSLSNC DGLVDAI GST+ITISNNY THHN+VMLLGHSD+Y +DK
Sbjct  258   GVSIFGSSHIWVDHCSLSNCADGLVDAIMGSTSITISNNYFTHHNEVMLLGHSDSYERDK  317

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
             GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  318   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  377

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D  +  WKGWNWRS+ DLMLNGA+FT    AGAS+SY++ASSL A+ +
Sbjct  378   TNPFAKEVTKRVDTADGVWKGWNWRSQNDLMLNGAYFTP-SGAGASASYSRASSLGAKSA  436

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T GAG L C++   C
Sbjct  437   SMVASITSGAGVLTCRRDSVC  457



>ref|XP_006447221.1| hypothetical protein CICLE_v10015474mg [Citrus clementina]
 ref|XP_006469935.1| PREDICTED: pectate lyase-like [Citrus sinensis]
 gb|ESR60461.1| hypothetical protein CICLE_v10015474mg [Citrus clementina]
Length=403

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/391 (75%), Positives = 330/391 (84%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SS   DPEL+ Q+V+  I     +RR L +LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PNLVSSSSIQDPELVAQDVHRSI---NASRRNLAYLSCGTGNPIDDCWRCDPNWERNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFG+ AIGGR+G++YVVTD+GDD   NPKPGTLR+  IQDEPLWIIF RDMVIK
Sbjct  74    LADCAIGFGRDAIGGRNGRIYVVTDSGDDNPTNPKPGTLRHAVIQDEPLWIIFNRDMVIK  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             L +EL+MNS KTIDGRGASVHIA GPCITI + TNIIIHG++IHDC++ GN N+RDSPEH
Sbjct  134   LNQELVMNSHKTIDGRGASVHIADGPCITIHFATNIIIHGIHIHDCKKAGNGNIRDSPEH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
              GW   SDGDGVSIF   H+W+DHCSLSNC+DGL+DAI GSTAITISNNY THH+KVMLL
Sbjct  194   SGWWDASDGDGVSIFSSQHIWIDHCSLSNCQDGLIDAIHGSTAITISNNYFTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQ TIAFNHFGEGL+QRMPRCR GYFHVVNNDYT W+MYAIGGSA PTI
Sbjct  254   GHSDSYTQDKNMQATIAFNHFGEGLVQRMPRCRQGYFHVVNNDYTEWQMYAIGGSAAPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF APN+RF KEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     AGASS+YA
Sbjct  314   NSQGNRFFAPNERFRKEVTKHEDAPESEWRNWNWRSEGDLMLNGAYFRQ-TGAGASSTYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL+ARPS+LVG +T  AGAL C+KG  C
Sbjct  373   RASSLNARPSTLVGPMTMRAGALNCRKGSRC  403



>ref|XP_010023767.1| PREDICTED: probable pectate lyase 8 isoform X1 [Eucalyptus grandis]
 gb|KCW60135.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=444

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/381 (75%), Positives = 322/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE I   V   I N+T  RRKLG+ SCGTGNPIDDCWRCDPNW  NR+RLADC IGFG+
Sbjct  66    DPEEIASMVEMSIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGR  124

Query  323   QAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD  D D VNP+PGTLR+  IQD PLWI+F RDMVI LK+EL+MNSF
Sbjct  125   NAIGGRDGRFYVVTDPSDNDPVNPRPGTLRHAVIQDRPLWIVFKRDMVIVLKQELLMNSF  184

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA +R SP HYGWRT++DGD
Sbjct  185   KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMIRSSPTHYGWRTMADGD  244

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDH SLS C DGLVDAI GSTAITISNN+MTHHN+VMLLGHSD+Y +DK
Sbjct  245   AVSIFGASHIWVDHNSLSKCADGLVDAIMGSTAITISNNHMTHHNEVMLLGHSDSYTRDK  304

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+ AP
Sbjct  305   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYAAP  364

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++ F KEVTK  D   SQWK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  365   SNPFAKEVTKRVDTATSQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  423

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T GAG LPC++G+ C
Sbjct  424   SMVGSITSGAGPLPCRRGRQC  444



>gb|KDO40644.1| hypothetical protein CISIN_1g015623mg [Citrus sinensis]
Length=403

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/391 (75%), Positives = 330/391 (84%), Gaps = 5/391 (1%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P    SS   DPEL+ Q+V+  I     +RR L +LSCGTGNPIDDCWRCDPNWE NRQR
Sbjct  17    PNLVSSSSIQDPELVAQDVHRSI---NASRRNLAYLSCGTGNPIDDCWRCDPNWEGNRQR  73

Query  293   LADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADCAIGFG+ AIGGR+G++YVVTD+GDD   NPKPGTLR+  IQDEPLWIIF RDMVIK
Sbjct  74    LADCAIGFGRDAIGGRNGRIYVVTDSGDDNPTNPKPGTLRHAVIQDEPLWIIFNRDMVIK  133

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             L +EL+MNS KTIDGRGASVHIA GPCITI + TNIIIHG++IHDC++ GN N+RDSPEH
Sbjct  134   LNQELVMNSHKTIDGRGASVHIADGPCITIHFATNIIIHGIHIHDCKKAGNGNIRDSPEH  193

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
              GW   SDGDGVSIF   H+W+DHCSLSNC+DGL+DAI GSTAITISNNY THH+KVMLL
Sbjct  194   SGWWDASDGDGVSIFSSQHIWIDHCSLSNCQDGLIDAIHGSTAITISNNYFTHHDKVMLL  253

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y QDK MQ TIAFNHFGEGL+QRMPRCR GYFHVVNNDYT W+MYAIGGSA PTI
Sbjct  254   GHSDSYTQDKNMQATIAFNHFGEGLVQRMPRCRQGYFHVVNNDYTEWQMYAIGGSAAPTI  313

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNRF APN+RF KEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     AGASS+YA
Sbjct  314   NSQGNRFFAPNERFRKEVTKHEDAPESEWRNWNWRSEGDLMLNGAYFRQ-SGAGASSTYA  372

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             +ASSL+ARPS+LVG +T  AGAL C+KG  C
Sbjct  373   RASSLNARPSTLVGPMTMRAGALNCRKGSRC  403



>gb|EPS68938.1| hypothetical protein M569_05827, partial [Genlisea aurea]
Length=394

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/388 (74%), Positives = 323/388 (83%), Gaps = 2/388 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
              F+    DPE + + V     N+T  RRKLGF SCGTGNPIDDCWRCDPNW  NR+RLAD
Sbjct  8     AFNYTMEDPEEVARMVEMATRNSTERRRKLGFFSCGTGNPIDDCWRCDPNWHKNRRRLAD  67

Query  302   CAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             C IGFG+ AIGGRDG+ YVV+D GDD  VNP+PGTLR+  IQD PLWI+F RDMVI LK+
Sbjct  68    CGIGFGRNAIGGRDGRFYVVSDPGDDDPVNPRPGTLRHAVIQDRPLWIVFKRDMVITLKQ  127

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             ELIMNSFKTIDGRGA+VH+A G CIT+Q+VTNIIIHGL+IHDC+  GNA VR SP HYGW
Sbjct  128   ELIMNSFKTIDGRGANVHVAYGACITVQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGW  187

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RT++DGDGVSIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHS
Sbjct  188   RTMADGDGVSIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHS  247

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             D+Y++DK MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQ
Sbjct  248   DSYVRDKQMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQ  307

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakas  1198
             GNR+LAP + F KEVTK  D  E  WK WNWRSEGDLMLNGA+FT    AGAS+SYA+AS
Sbjct  308   GNRYLAPVNPFAKEVTKRVDTAEYHWKSWNWRSEGDLMLNGAYFTP-SGAGASASYARAS  366

Query  1199  slsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             SL A+ SS+V S+T GAG L C+ G+ C
Sbjct  367   SLGAKSSSMVASITSGAGVLACRLGRQC  394



>ref|XP_004134015.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 ref|XP_004157662.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
 gb|KGN56767.1| hypothetical protein Csa_3G133180 [Cucumis sativus]
Length=447

 Score =   580 bits (1496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/381 (75%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +PE I   V+  I NAT ARR+LGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  69    NPEEIAAMVDMSIRNAT-ARRELGFFSCGTGNPIDDCWRCDPNWQQNRKRLADCGIGFGR  127

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  128   NAIGGRDGRFYVVTDSGDDNPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  187

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTID RG +VHIA G C+TIQ+VTN+I+HGLNIHDC+  GNA VR SP H GWRT++DGD
Sbjct  188   KTIDARGTNVHIANGACLTIQFVTNVIVHGLNIHDCKPTGNAMVRSSPNHVGWRTIADGD  247

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+W+DH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  248   AISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  307

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  308   LMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYAAP  367

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ES+WKGWNWRSEGDL+LNGAFF     AGASSSYA+ASSL A+ S
Sbjct  368   TNPFAKEVTKRVETSESEWKGWNWRSEGDLLLNGAFFIP-SGAGASSSYARASSLGAKSS  426

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T  AGAL C++G +C
Sbjct  427   SMVGTITSNAGALSCRRGHAC  447



>ref|XP_007031685.1| Pectin lyase-like superfamily protein [Theobroma cacao]
 gb|EOY02611.1| Pectin lyase-like superfamily protein [Theobroma cacao]
Length=405

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/392 (76%), Positives = 338/392 (86%), Gaps = 5/392 (1%)
 Frame = +2

Query  110   APTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQ  289
              P    SS   DPEL+V EV++ I NA+  RR L +LSCG+GNPIDDCWRCDP+WESNRQ
Sbjct  18    VPNLVSSSAVQDPELVVDEVHKSI-NAS--RRNLAYLSCGSGNPIDDCWRCDPSWESNRQ  74

Query  290   RLADCAIGFGKQAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVI  466
             RLADCAIGFGK A+GG++G++YVVTD GDD AVNP+PGTLR+  IQDEPLWIIF  DMVI
Sbjct  75    RLADCAIGFGKNAMGGKNGRIYVVTDAGDDDAVNPRPGTLRHAVIQDEPLWIIFKTDMVI  134

Query  467   KLKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPE  646
              LKEEL+MNSFKTIDGRGASVHI+GGPC+TI YV+NIIIHG+NIHDC  GG+  +RDSP+
Sbjct  135   TLKEELVMNSFKTIDGRGASVHISGGPCLTIHYVSNIIIHGINIHDCTPGGSTIIRDSPQ  194

Query  647   HYGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVML  826
             H G  T SDGDGVSIF   ++WVDHCSLSNC DGL+D I GSTA+TISNNYMTHH+KVML
Sbjct  195   HAGHWTPSDGDGVSIFASKNIWVDHCSLSNCHDGLIDVIHGSTAVTISNNYMTHHDKVML  254

Query  827   LGHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  1006
             LGHSD+Y QDK MQVT+AFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT
Sbjct  255   LGHSDSYTQDKDMQVTVAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPT  314

Query  1007  INSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssy  1186
             INSQGNRFLAP+D   KEVTKHEDAPES+W+ WNWRSEGDLMLNGAFF     AGASS+Y
Sbjct  315   INSQGNRFLAPDDGSKKEVTKHEDAPESEWRSWNWRSEGDLMLNGAFF-RQSGAGASSTY  373

Query  1187  akasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
             A+ASSLSARPSSLVG++T  AGAL C++G  C
Sbjct  374   ARASSLSARPSSLVGAMTVTAGALNCRRGSRC  405



>ref|NP_001141589.1| uncharacterized protein LOC100273705 [Zea mays]
 gb|ACF86672.1| unknown [Zea mays]
 gb|AFW57904.1| hypothetical protein ZEAMMB73_963462 [Zea mays]
Length=466

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/381 (75%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +  +V+  I N T ARR LG+LSCGTGNPIDDCWRCD +W +NR+RLADC IGFG+
Sbjct  88    DPEAVANDVHASINNIT-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRKRLADCGIGFGR  146

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK+YVVTD + DD VNP+ GTLRY  IQ+EPLWIIF RDMVI LKEELIMNSF
Sbjct  147   NAIGGRDGKIYVVTDPSDDDPVNPRKGTLRYAVIQEEPLWIIFKRDMVITLKEELIMNSF  206

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQY+TN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  207   KTIDGRGANVHIANGACITIQYITNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  266

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  267   GVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYVKDK  326

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  327   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  386

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +   + WK WNWRSEGDL+LNGA+FT    AGAS+SY++ASSL A+ S
Sbjct  387   TNPFAKEVTKRVETAHTVWKRWNWRSEGDLLLNGAYFTP-SGAGASASYSRASSLGAKSS  445

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VG++T  AGAL C KG +C
Sbjct  446   SMVGTITLDAGALSCHKGAAC  466



>emb|CBI17713.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/386 (73%), Positives = 317/386 (82%), Gaps = 37/386 (10%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             S+P  DPE++VQEV+  I     +RR LG+ SCGTGNPIDDCWRCD NW+ NRQRLADCA
Sbjct  22    SAPVQDPEVVVQEVHRSI---NASRRNLGYFSCGTGNPIDDCWRCDANWDKNRQRLADCA  78

Query  308   IGFGKQAIGGRDGKLYVVTDT-GDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK A+GG++G++YVVTD+  DD VNP+PGTLR+  IQDEPLWIIF RDMVIKLK+EL
Sbjct  79    IGFGKDAMGGKNGRIYVVTDSEDDDPVNPRPGTLRHAVIQDEPLWIIFKRDMVIKLKQEL  138

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             +MNSFKTIDGRGASVHIAGGPCITI Y +NIIIHGL+IHDC+QGGNAN+R+SP H GW T
Sbjct  139   VMNSFKTIDGRGASVHIAGGPCITIHYASNIIIHGLHIHDCKQGGNANIRNSPHHSGWWT  198

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
             +SDGDGVSIFGG H+WVDHCSLSNC DGL+DAI GSTAITISNN+MTHH+KVMLLGHSD+
Sbjct  199   VSDGDGVSIFGGRHIWVDHCSLSNCHDGLIDAIHGSTAITISNNFMTHHDKVMLLGHSDS  258

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y +DK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN
Sbjct  259   YTEDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  318

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPNDRF K VTKHEDAPES+                                 ASSL
Sbjct  319   RFLAPNDRFKKAVTKHEDAPESE---------------------------------ASSL  345

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARPSSLVGS+T G+GAL C+KG  C
Sbjct  346   SARPSSLVGSITLGSGALGCRKGSRC  371



>ref|XP_010435229.1| PREDICTED: probable pectate lyase 15 [Camelina sativa]
Length=461

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 324/384 (84%), Gaps = 5/384 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             DPE +  EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  79    DPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  138

Query  314   FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  139   FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  198

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP H+GWRT++
Sbjct  199   NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMA  258

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGD VSIFG SH+W+DH SLS+C DGLVDA+ GSTAIT+SNN+ THHN+VMLLGHSD+Y 
Sbjct  259   DGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYT  318

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             +DK MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+
Sbjct  319   KDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRY  378

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
              AP DRF KEVTK  +   S+WK WNWRSEGDL+LNGA+F +     AS+SY +ASSL+A
Sbjct  379   AAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRS-SGEEASASYGRASSLAA  437

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             +PSS+V ++T  AGAL C+KG+ C
Sbjct  438   KPSSMVDTITSTAGALGCRKGRPC  461



>ref|XP_010023768.1| PREDICTED: probable pectate lyase 1 isoform X2 [Eucalyptus grandis]
 gb|KCW60136.1| hypothetical protein EUGRSUZ_H02860 [Eucalyptus grandis]
Length=427

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/381 (75%), Positives = 322/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE I   V   I N+T  RRKLG+ SCGTGNPIDDCWRCDPNW  NR+RLADC IGFG+
Sbjct  49    DPEEIASMVEMSIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIGFGR  107

Query  323   QAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD  D D VNP+PGTLR+  IQD PLWI+F RDMVI LK+EL+MNSF
Sbjct  108   NAIGGRDGRFYVVTDPSDNDPVNPRPGTLRHAVIQDRPLWIVFKRDMVIVLKQELLMNSF  167

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA +R SP HYGWRT++DGD
Sbjct  168   KTIDGRGANVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMIRSSPTHYGWRTMADGD  227

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDH SLS C DGLVDAI GSTAITISNN+MTHHN+VMLLGHSD+Y +DK
Sbjct  228   AVSIFGASHIWVDHNSLSKCADGLVDAIMGSTAITISNNHMTHHNEVMLLGHSDSYTRDK  287

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+ AP
Sbjct  288   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYAAP  347

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
             ++ F KEVTK  D   SQWK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  348   SNPFAKEVTKRVDTATSQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  406

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T GAG LPC++G+ C
Sbjct  407   SMVGSITSGAGPLPCRRGRQC  427



>ref|XP_010440536.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=462

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 324/384 (84%), Gaps = 5/384 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             DPE +  EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  80    DPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  139

Query  314   FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  140   FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  199

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP H+GWRT++
Sbjct  200   NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMA  259

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGD VSIFG SH+W+DH SLS+C DGLVDA+ GSTAIT+SNN+ THHN+VMLLGHSD+Y 
Sbjct  260   DGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYT  319

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             +DK MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+
Sbjct  320   KDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRY  379

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
              AP DRF KEVTK  +   S+WK WNWRSEGDL+LNGA+F +     AS+SY +ASSL+A
Sbjct  380   AAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRS-SGEEASASYGRASSLAA  438

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             +PSS+V ++T  AGAL C+KG+ C
Sbjct  439   KPSSMVDTITSTAGALGCRKGRPC  462



>dbj|BAF43573.1| pectate lyase [Prunus persica]
Length=425

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/381 (74%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V  V+  I N+T  RRKLGF SCGTGNPIDDCWRCD NW+ NR+RLADC IGFG+
Sbjct  47    DPEEVVAMVDMSIRNST-ERRKLGFFSCGTGNPIDDCWRCDSNWQKNRKRLADCGIGFGR  105

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI+LK+ELIMNSF
Sbjct  106   NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQNEPLWIVFKRDMVIQLKQELIMNSF  165

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  166   KTIDGRGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNALVRSSPSHFGWRTMADGD  225

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN+ THHN+VMLLGHSD+Y +DK
Sbjct  226   AVSIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSYTRDK  285

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  286   AMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAP  345

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  + P +QWK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  346   TNPFAKEVTKRVETPTTQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  404

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             ++VG++T G+GALPC++G  C
Sbjct  405   AMVGAITSGSGALPCRRGHPC  425



>ref|XP_010440534.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=466

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 324/384 (84%), Gaps = 5/384 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             DPE +  EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  84    DPEKVADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  143

Query  314   FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  144   FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  203

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP H+GWRT++
Sbjct  204   NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMA  263

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGD VSIFG SH+W+DH SLS+C DGLVDA+ GSTAIT+SNN+ THHN+VMLLGHSD+Y 
Sbjct  264   DGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYT  323

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             +DK MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+
Sbjct  324   KDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRY  383

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
              AP DRF KEVTK  +   S+WK WNWRSEGDL+LNGA+F +     AS+SY +ASSL+A
Sbjct  384   AAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRS-SGEEASASYGRASSLAA  442

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             +PSS+V ++T  AGAL C+KG+ C
Sbjct  443   KPSSMVDTITSTAGALGCRKGRPC  466



>ref|NP_001147553.1| pectate lyase 8 [Zea mays]
 gb|ACG27904.1| pectate lyase 8 precursor [Zea mays]
Length=467

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/391 (71%), Positives = 319/391 (82%), Gaps = 16/391 (4%)
 Frame = +2

Query  113   PTCTFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQR  292
             P+   +    DPE +  +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W SNRQR
Sbjct  92    PSRAVTGAVEDPEAVANDVHVSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHSNRQR  150

Query  293   LADCAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIK  469
             LADC IGFG+ AIGGRDGK+YVVTD + DD VNP+ GTLR+  IQ+EPLWIIF RDMVI 
Sbjct  151   LADCGIGFGRNAIGGRDGKVYVVTDPSDDDPVNPREGTLRHAVIQEEPLWIIFKRDMVIT  210

Query  470   LKEELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEH  649
             L+EELIMNSFKTIDGRGA+VHIA G C+TIQYVTN+IIHGL+IHDC+  GNA VR SP H
Sbjct  211   LREELIMNSFKTIDGRGANVHIANGACVTIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSH  270

Query  650   YGWRTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLL  829
             YGWRT++DGDGVSIFG SHVWVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLL
Sbjct  271   YGWRTMADGDGVSIFGSSHVWVDHCSLSNCADGLIDAIMGSTAITLSNNYFTHHNEVMLL  330

Query  830   GHSDTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTI  1009
             GHSD+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTI
Sbjct  331   GHSDSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTI  390

Query  1010  NSQGNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssya  1189
             NSQGNR+LAP + F KEVTK  +  ++ WK WNWRSEGDL+LNGA+FT SG+  +     
Sbjct  391   NSQGNRYLAPTNPFAKEVTKRVETAQTVWKSWNWRSEGDLLLNGAYFTPSGAGAS-----  445

Query  1190  kasslsaRPSSLVGSLTGGAGALPCKKGKSC  1282
                      +S   ++T  AGAL C+KG +C
Sbjct  446   ---------ASYSRTITSDAGALSCRKGAAC  467



>ref|XP_007222160.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
 gb|ADD62392.1| pectase lyase [Prunus persica]
 gb|EMJ23359.1| hypothetical protein PRUPE_ppa005761mg [Prunus persica]
Length=445

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/381 (74%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V  V+  I N+T  RRKLGF SCGTGNPIDDCWRCD NW+ NR+RLADC IGFG+
Sbjct  67    DPEEVVAMVDMSIRNST-ERRKLGFFSCGTGNPIDDCWRCDSNWQKNRKRLADCGIGFGR  125

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNP+PGTLR+  IQ+EPLWI+F RDMVI+LK+ELIMNSF
Sbjct  126   NAIGGRDGRFYVVTDPGDDDPVNPRPGTLRHAVIQNEPLWIVFKRDMVIQLKQELIMNSF  185

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  186   KTIDGRGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNALVRSSPSHFGWRTMADGD  245

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN+ THHN+VMLLGHSD+Y +DK
Sbjct  246   AVSIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSYTRDK  305

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  306   AMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAP  365

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  + P +QWK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  366   TNPFAKEVTKRVETPTTQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  424

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             ++VG++T G+GALPC++G  C
Sbjct  425   AMVGAITSGSGALPCRRGHPC  445



>ref|XP_009382167.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=427

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/381 (75%), Positives = 322/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I N+T ARR LG+LSC TGNPIDDCWRCD  W  NR+RLADC IGFG+
Sbjct  49    DPELVASEVHMMIKNST-ARRALGYLSCSTGNPIDDCWRCDAEWHRNRKRLADCGIGFGR  107

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGR+G+ YVVTD+GDD  VNP+PGTLRY  IQ+EPLWI+F R MVI L++ELIMNSF
Sbjct  108   NAIGGREGRFYVVTDSGDDDPVNPRPGTLRYAVIQEEPLWIVFKRSMVITLEQELIMNSF  167

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  168   KTIDGRGAEVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHYGWRTIADGD  227

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDH SLSNC DGL+DAI GSTAITISNNY T+HN+V+LLGHSD+Y++DK
Sbjct  228   GVSIFGASHIWVDHNSLSNCADGLIDAIIGSTAITISNNYFTNHNEVILLGHSDSYVRDK  287

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  288   AMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  347

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D   S WK WNWRS+ DL+LNGA+FTT    G+S SYAKASSL A+ S
Sbjct  348   TNPFAKEVTKRVDTDSSVWKSWNWRSDDDLLLNGAYFTT-SGGGSSGSYAKASSLGAKSS  406

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL C+KG  C
Sbjct  407   SMVGSITSDAGALRCRKGSQC  427



>gb|EYU34765.1| hypothetical protein MIMGU_mgv1a023431mg [Erythranthe guttata]
Length=400

 Score =   576 bits (1485),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/386 (73%), Positives = 327/386 (85%), Gaps = 7/386 (2%)
 Frame = +2

Query  128   SSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCA  307
             SS   DP++ V+EV + I     +RR LG++SC TGNPIDDCWRCDPNWE+ R+RLADCA
Sbjct  21    SSFRHDPDITVREVQQSI---NASRRNLGYISCSTGNPIDDCWRCDPNWETRRRRLADCA  77

Query  308   IGFGKQAIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEEL  484
             IGFGK+A+GGRDG+ YVVTD+G DD VNPKPGTLR+ AIQ EPLWIIF  DMVIKLK+EL
Sbjct  78    IGFGKKAVGGRDGRTYVVTDSGNDDPVNPKPGTLRHAAIQFEPLWIIFRADMVIKLKQEL  137

Query  485   IMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRT  664
             ++NS KTIDGRGA+VHIAGG C+TI + TN+I+HG++IHDC + GNA +RDSP H GW  
Sbjct  138   VVNSHKTIDGRGATVHIAGGACVTIHHATNVILHGIHIHDCVKAGNAVIRDSPRHAGWWE  197

Query  665   LSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDT  844
              SDGDGV+IFGG  +W+DHCSLSNC DGL+DAI GST ITISNNY T+H+KVMLLGH+D 
Sbjct  198   ESDGDGVAIFGGRDIWIDHCSLSNCADGLIDAIHGSTGITISNNYFTNHDKVMLLGHNDG  257

Query  845   YIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGN  1024
             Y+QDK MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQGN
Sbjct  258   YVQDKNMQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQGN  317

Query  1025  RFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakassl  1204
             RFLAPN RF KEVTKHEDAPES+W+ WNWRSEGDLMLNGA+F     +G  S+YA+ASSL
Sbjct  318   RFLAPNLRFRKEVTKHEDAPESEWRRWNWRSEGDLMLNGAYF---QQSGTGSTYARASSL  374

Query  1205  saRPSSLVGSLTGGAGALPCKKGKSC  1282
             SARP SLVG++T  AGAL C+KG  C
Sbjct  375   SARPYSLVGTITTSAGALNCRKGTRC  400



>ref|XP_003555714.2| PREDICTED: probable pectate lyase 1-like [Glycine max]
Length=489

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/381 (75%), Positives = 326/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +PE +V  V   I N+T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  111   NPEEVVSMVEMSIQNST-ERRKLGFFSCGTGNPIDDCWRCDPNWQRNRKRLADCGIGFGR  169

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDGK YVVTD   DD VNPKPGTLR+  IQD+PLWI+F RDMVI+LK+ELIMNSF
Sbjct  170   NAIGGRDGKFYVVTDPRDDDPVNPKPGTLRHAVIQDKPLWIVFKRDMVIQLKQELIMNSF  229

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  230   KTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPTHFGWRTMADGD  289

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+WVDH SLS+C DGLVDA+ GSTAITISNN+ THHN+V+LLGHSD+Y +DK
Sbjct  290   AISIFGSSHIWVDHNSLSHCADGLVDAVLGSTAITISNNHFTHHNEVILLGHSDSYTRDK  349

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  350   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAP  409

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              +RF KEVTK  +  ESQWKGWNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  410   TNRFAKEVTKRVETAESQWKGWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  468

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL CK+G  C
Sbjct  469   SMVGSMTSNAGALGCKRGSQC  489



>ref|XP_004289729.1| PREDICTED: probable pectate lyase 15-like [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   578 bits (1490),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/381 (73%), Positives = 328/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +P+ I   V+  I N+T  RRKLG+ SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  73    NPDEIAAMVDMSIRNST-ERRKLGYFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGR  131

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD   DD VNP+PGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  132   NAIGGRDGRFYVVTDPNDDDPVNPRPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  191

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA G CITIQ+VTN+I+HGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  192   KTIDGRGVNVHIANGACITIQFVTNVIVHGLHIHDCKPTGNALVRSSPSHFGWRTMADGD  251

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN++THHN+VMLLGHSD+Y +DK
Sbjct  252   AISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHLTHHNEVMLLGHSDSYTRDK  311

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+ AP
Sbjct  312   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYAAP  371

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++QW+GWNWRSEGDL+LNGAFFT    AGAS+ YA+ASSL A+ S
Sbjct  372   TNPFAKEVTKRVETSQTQWRGWNWRSEGDLLLNGAFFTP-SGAGASAVYARASSLGAKSS  430

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             ++VG++T GAGAL C++G++C
Sbjct  431   AMVGTITAGAGALGCRRGRTC  451



>ref|XP_011091390.1| PREDICTED: probable pectate lyase 8 [Sesamum indicum]
Length=452

 Score =   578 bits (1489),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/381 (75%), Positives = 319/381 (84%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE + + V     N+T  RR LGF SCGTGNPIDDCWRCD NW  NR+RLADC IGFG+
Sbjct  74    DPEEVARMVEMATRNST-ERRNLGFFSCGTGNPIDDCWRCDANWHKNRKRLADCGIGFGR  132

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+GDD  VNPKPGTLR+  IQD PLWI+F RDMVI LK+ELIMNSF
Sbjct  133   NAIGGRDGRFYVVTDSGDDDPVNPKPGTLRHAVIQDRPLWIVFKRDMVITLKQELIMNSF  192

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTID RG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  193   KTIDARGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPTHYGWRTMADGD  252

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  253   AISIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  312

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTINSQGNR+LAP
Sbjct  313   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTINSQGNRYLAP  372

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D  E QWKGWNWRSEGDLMLNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  373   TNPFAKEVTKRVDTAEGQWKGWNWRSEGDLMLNGAYFTP-SGAGASASYARASSLGAKSS  431

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V S+T GAG L C++G  C
Sbjct  432   SMVASITSGAGVLACRRGHQC  452



>gb|EMT28700.1| hypothetical protein F775_17439 [Aegilops tauschii]
Length=399

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/381 (74%), Positives = 322/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V +V+  I N+T ARR LG+LSCGTGNPIDDCWRCD +W +NRQRLADC IGF +
Sbjct  21    DPEAVVSQVHMSIRNST-ARRNLGYLSCGTGNPIDDCWRCDSDWHNNRQRLADCGIGFRR  79

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A   R+G +YVVTD GDD  VNP+ GTLR+  IQDEPLWIIF RDMVI L +ELIMNSF
Sbjct  80    NATSRREGTIYVVTDAGDDDPVNPRKGTLRHAVIQDEPLWIIFKRDMVITLSQELIMNSF  139

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW T++DGD
Sbjct  140   KTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGWSTMADGD  199

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SHVWVDHCSLSNC DGLVDAI GSTAIT+SNNY THHN+VMLLGHSD+Y++DK
Sbjct  200   AVSIFGASHVWVDHCSLSNCADGLVDAIMGSTAITVSNNYFTHHNEVMLLGHSDSYLKDK  259

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  260   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  319

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +  ++ WK WNWRSEGD++LNGAFFT    AGAS+SY++ASSL A+ S
Sbjct  320   TNPFAKEVTKRVETAQTTWKAWNWRSEGDMLLNGAFFTP-SGAGASASYSRASSLGAKSS  378

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+V ++T GAGAL C KG SC
Sbjct  379   SMVATITSGAGALSCHKGSSC  399



>ref|XP_008223974.1| PREDICTED: probable pectate lyase 8 [Prunus mume]
Length=445

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/381 (74%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V  V+  I N+T  RRKLGF SCGTGNPIDDCWRCDPNW+ NR+RLADC IGFG+
Sbjct  67    DPEEVVAMVDMSIRNST-ERRKLGFFSCGTGNPIDDCWRCDPNWQKNRKRLADCGIGFGR  125

Query  323   QAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD + DD VNP+PGTLR+  IQ+EPLWI+F RDMVI+LK+ELIMNSF
Sbjct  126   NAIGGRDGRFYVVTDPSDDDPVNPRPGTLRHAVIQNEPLWIVFKRDMVIQLKQELIMNSF  185

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA   CITIQ+VTNIIIHGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  186   KTIDGRGVNVHIANRACITIQFVTNIIIHGLHIHDCKPTGNALVRSSPSHFGWRTMADGD  245

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              VSIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNN+ THHN+VMLLGHSD+Y +DK
Sbjct  246   AVSIFGSSHIWVDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSYTRDK  305

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  306   AMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYAAP  365

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  + P +QWK WNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  366   TNPFAKEVTKRVETPTTQWKSWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  424

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             ++VG++T G+GALPC++G  C
Sbjct  425   TMVGAITSGSGALPCRRGHPC  445



>ref|XP_010450168.1| PREDICTED: probable pectate lyase 15 isoform X2 [Camelina sativa]
Length=461

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 323/384 (84%), Gaps = 5/384 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             DPE    EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  79    DPEKGADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  138

Query  314   FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  139   FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  198

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP H+GWRT++
Sbjct  199   NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMA  258

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGD VSIFG SH+W+DH SLS+C DGLVDA+ GSTAIT+SNN+ THHN+VMLLGHSD+Y 
Sbjct  259   DGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYT  318

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             +DK MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+
Sbjct  319   KDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRY  378

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
              AP DRF KEVTK  +   S+WK WNWRSEGDL+LNGA+F +     AS+SY +ASSL+A
Sbjct  379   AAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRS-SGEEASASYGRASSLAA  437

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             +PSS+V ++T  AGAL C+KG+ C
Sbjct  438   KPSSMVDTITSTAGALGCRKGRPC  461



>ref|XP_009384552.1| PREDICTED: probable pectate lyase 8 [Musa acuminata subsp. malaccensis]
Length=457

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/381 (76%), Positives = 325/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPEL+  EV+  I+N+T ARR LG+LSCGTGNPIDDCWRCD  W  +R+RLADC IGFG+
Sbjct  79    DPELVANEVHMAISNST-ARRALGYLSCGTGNPIDDCWRCDSEWHLHRKRLADCGIGFGR  137

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVV+D GDD  VNP+ GTLR+  IQDEPLWI+F RDMVI LK+ELIMNSF
Sbjct  138   NAIGGRDGRYYVVSDPGDDDPVNPRSGTLRHAVIQDEPLWIVFKRDMVITLKQELIMNSF  197

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP HYGWRT++DGD
Sbjct  198   KTIDGRGANVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHYGWRTMADGD  257

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             GVSIFG SH+WVDH SLSNC DGLVDA+ GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  258   GVSIFGASHIWVDHNSLSNCADGLVDAVMGSTAITISNNYFTHHNEVMLLGHSDSYVRDK  317

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNR+LAP
Sbjct  318   AMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRYLAP  377

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D   + WK WNWRSEGDL+LNGA+FT    AGAS+SYAKASSL A+ S
Sbjct  378   TNPFAKEVTKRVDTDSNMWKSWNWRSEGDLLLNGAYFTP-SGAGASASYAKASSLGAKSS  436

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AGAL C+K   C
Sbjct  437   SMVGSITSDAGALGCRKRSQC  457



>ref|NP_001052103.1| Os04g0137100 [Oryza sativa Japonica Group]
 dbj|BAF14017.1| Os04g0137100 [Oryza sativa Japonica Group]
Length=492

 Score =   578 bits (1491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/345 (78%), Positives = 301/345 (87%), Gaps = 2/345 (1%)
 Frame = +2

Query  122   TFSSPYPDPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLAD  301
             T      DPE +V +V+  I N+T ARRKLG+LSCGTGNPIDDCWRCDP+W  NRQRLAD
Sbjct  88    TVPGAVDDPEEVVSQVHMSIRNST-ARRKLGYLSCGTGNPIDDCWRCDPDWHKNRQRLAD  146

Query  302   CAIGFGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKE  478
             C IGFG+ AIGGRDGK+YVVTD + DDAVNPK GTLRY  I+DEPLWI+F RDMVI LK+
Sbjct  147   CGIGFGRNAIGGRDGKIYVVTDPSDDDAVNPKKGTLRYAVIRDEPLWIVFKRDMVITLKQ  206

Query  479   ELIMNSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGW  658
             ELIMNSFKTIDGRGA+VHIA G CITIQYVTN+IIHGL+IHDC+  GNA VR SP HYGW
Sbjct  207   ELIMNSFKTIDGRGANVHIANGACITIQYVTNVIIHGLHIHDCRPTGNAMVRSSPSHYGW  266

Query  659   RTLSDGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHS  838
             RT++DGD VSIFG SH+WVDHCSLSNC DGL+DAI GSTAIT+SNNY THHN+VMLLGHS
Sbjct  267   RTMADGDAVSIFGASHIWVDHCSLSNCADGLIDAIMGSTAITVSNNYFTHHNEVMLLGHS  326

Query  839   DTYIQDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQ  1018
             D+Y++DK MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQ
Sbjct  327   DSYVKDKAMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQ  386

Query  1019  GNRFLAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFT  1153
             GNR+LAP + F KEVTK  +  ++ WKGWNWRSEGDL+LNGAFFT
Sbjct  387   GNRYLAPTNPFAKEVTKRVETAQTIWKGWNWRSEGDLLLNGAFFT  431



>ref|XP_010450167.1| PREDICTED: probable pectate lyase 15 isoform X1 [Camelina sativa]
Length=465

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/384 (72%), Positives = 323/384 (84%), Gaps = 5/384 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANAT---IARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIG  313
             DPE    EV + +  +     ARRKLGF SCGTGNPIDDCWRCDPNW  NR+RLADC IG
Sbjct  83    DPEKGADEVAKLVQMSEQNRTARRKLGFFSCGTGNPIDDCWRCDPNWHKNRKRLADCGIG  142

Query  314   FGKQAIGGRDGKLYVVTD-TGDDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIM  490
             FG+ AIGGRDG+ YVVTD T +D VNPKPGTLR+  IQ+EPLWI+F RDMVI+LK+ELIM
Sbjct  143   FGRNAIGGRDGRFYVVTDPTDEDVVNPKPGTLRHAVIQEEPLWIVFKRDMVIELKQELIM  202

Query  491   NSFKTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLS  670
             NSFKTIDGRGA+VHIA G CITIQ++TN+IIHGL+IHDC+  GNA VR SP H+GWRT++
Sbjct  203   NSFKTIDGRGANVHIANGACITIQFITNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMA  262

Query  671   DGDGVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYI  850
             DGD VSIFG SH+W+DH SLS+C DGLVDA+ GSTAIT+SNN+ THHN+VMLLGHSD+Y 
Sbjct  263   DGDAVSIFGSSHIWIDHNSLSHCADGLVDAVMGSTAITVSNNHFTHHNEVMLLGHSDSYT  322

Query  851   QDKGMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRF  1030
             +DK MQVTIA+NHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+
Sbjct  323   KDKLMQVTIAYNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRY  382

Query  1031  LAPNDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsa  1210
              AP DRF KEVTK  +   S+WK WNWRSEGDL+LNGA+F +     AS+SY +ASSL+A
Sbjct  383   AAPMDRFAKEVTKRVETDASEWKKWNWRSEGDLLLNGAYFRS-SGEEASASYGRASSLAA  441

Query  1211  RPSSLVGSLTGGAGALPCKKGKSC  1282
             +PSS+V ++T  AGAL C+KG+ C
Sbjct  442   KPSSMVDTITSTAGALGCRKGRPC  465



>gb|KDP33375.1| hypothetical protein JCGZ_12924 [Jatropha curcas]
Length=449

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/381 (74%), Positives = 327/381 (86%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +V  V   I N+T  RR+LG+ SCGTGNPIDDCWRCDPNW+ NR+RLA+C IGFG+
Sbjct  71    DPEEVVAMVEMSIRNST-ERRQLGYFSCGTGNPIDDCWRCDPNWQKNRKRLAECGIGFGR  129

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD GDD  VNPKPGTLR+  IQDEPLWI+F RDMVI+LK+ELIMNSF
Sbjct  130   NAIGGRDGRFYVVTDAGDDDPVNPKPGTLRHAVIQDEPLWIVFKRDMVIQLKQELIMNSF  189

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRG +VHIA G CITIQ+VTN+IIHGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  190   KTIDGRGVNVHIANGACITIQFVTNVIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGD  249

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+WVDH SLS+C DGLVDA+ GSTAITISNN+ THHN+VMLLGHSD+Y +DK
Sbjct  250   AISIFGSSHIWVDHNSLSHCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSYTRDK  309

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  310   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYNAP  369

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  D   SQWKGWNWRSEGDL+LNGA+FT    AGAS+SYA+ASSL A+ S
Sbjct  370   FNPFAKEVTKRVDTATSQWKGWNWRSEGDLLLNGAYFTP-SGAGASASYARASSLGAKSS  428

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             ++VG++T  AGALPC++G+ C
Sbjct  429   AMVGTMTANAGALPCRRGREC  449



>ref|XP_010038352.1| PREDICTED: probable pectate lyase 8 [Eucalyptus grandis]
 gb|KCW50165.1| hypothetical protein EUGRSUZ_K03600 [Eucalyptus grandis]
Length=444

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 321/381 (84%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             DPE +   V+  I N+T ARR LGF SCGTGNPIDDCWRCDP W   R+RLADCAIGFG+
Sbjct  66    DPEEVASMVDMSIRNST-ARRNLGFFSCGTGNPIDDCWRCDPKWYLRRKRLADCAIGFGR  124

Query  323   QAIGGRDGKLYVVTDTGDD-AVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              A+GGRDGK YVV+D GDD  VNP+PGTLR+  IQD PLWI+F RDMVI LK+EL+MNSF
Sbjct  125   NAVGGRDGKYYVVSDPGDDDPVNPRPGTLRHAVIQDRPLWIVFKRDMVITLKQELLMNSF  184

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTIDGRGA+VHIA G CITIQY+TN+IIHG+++HDC+  G A VR SP HYGWRT++DGD
Sbjct  185   KTIDGRGANVHIANGACITIQYITNVIIHGVHVHDCKSTGKAMVRSSPSHYGWRTMADGD  244

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
             G+S+FG SHVW+DH SLSNC DGL+DAI GSTAITISNNY THHN+VMLLGHSD+Y++DK
Sbjct  245   GISLFGASHVWIDHNSLSNCADGLIDAIMGSTAITISNNYFTHHNEVMLLGHSDSYVKDK  304

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+LAP
Sbjct  305   TMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSAEPTINSQGNRYLAP  364

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              + F KEVTK  +   S WK WNWRSEGDLMLNGAFFT    AGA + Y++ASSL A+ S
Sbjct  365   TNPFAKEVTKRVETSTSMWKSWNWRSEGDLMLNGAFFTP-SGAGAGAGYSRASSLGAKSS  423

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             SLVG+LT  +G L C++G++C
Sbjct  424   SLVGTLTSDSGVLVCRRGRAC  444



>ref|XP_004156698.1| PREDICTED: putative pectate lyase 11-like [Cucumis sativus]
Length=418

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/380 (77%), Positives = 331/380 (87%), Gaps = 5/380 (1%)
 Frame = +2

Query  146   PELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGKQ  325
             P L+V+EV   I  +   RR LG+LSCGTGNPIDDCWRCD NWE+NR+RLADCAIGFGK 
Sbjct  43    PHLVVEEVQRSINGS---RRNLGYLSCGTGNPIDDCWRCDSNWETNRKRLADCAIGFGKN  99

Query  326   AIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSFK  502
             AIGG++G+ YVVTD+G DD +NP+PGTLR+  IQ+EPLWIIF RDMVIKL +EL+MNSFK
Sbjct  100   AIGGKNGRFYVVTDSGNDDPLNPRPGTLRHAVIQNEPLWIIFKRDMVIKLAQELVMNSFK  159

Query  503   TIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGDG  682
             TIDGRGASVH+AGGPCI I Y TNIIIHG++IHDC++GGNAN+RDSP+H GW T SDGDG
Sbjct  160   TIDGRGASVHLAGGPCIKIHYATNIIIHGIHIHDCKRGGNANIRDSPQHAGWWTASDGDG  219

Query  683   VSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDKG  862
             VSI GG  +W+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD++ QDK 
Sbjct  220   VSILGGKQIWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSFTQDKN  279

Query  863   MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAPN  1042
             MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQGNRF+AP 
Sbjct  280   MQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQGNRFVAPY  339

Query  1043  DRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPSS  1222
             +RF KEVTKHEDAPES+W+ WNWRSEGDL+LNGA+F     AGASSSYA+A SLSARPSS
Sbjct  340   NRFRKEVTKHEDAPESEWRHWNWRSEGDLLLNGAYFRQ-SGAGASSSYARAYSLSARPSS  398

Query  1223  LVGSLTGGAGALPCKKGKSC  1282
             LVG +T  AGAL C++G  C
Sbjct  399   LVGDITITAGALNCRRGSRC  418



>ref|XP_004142773.1| PREDICTED: putative pectate lyase 11-like [Cucumis sativus]
 gb|KGN51335.1| hypothetical protein Csa_5G517820 [Cucumis sativus]
Length=418

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/380 (77%), Positives = 331/380 (87%), Gaps = 5/380 (1%)
 Frame = +2

Query  146   PELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGKQ  325
             P L+V+EV   I  +   RR LG+LSCGTGNPIDDCWRCD NWE+NR+RLADCAIGFGK 
Sbjct  43    PHLVVEEVQRSINGS---RRNLGYLSCGTGNPIDDCWRCDSNWETNRKRLADCAIGFGKN  99

Query  326   AIGGRDGKLYVVTDTG-DDAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSFK  502
             AIGG++G+ YVVTD+G DD +NP+PGTLR+  IQ+EPLWIIF RDMVIKL +EL+MNSFK
Sbjct  100   AIGGKNGRFYVVTDSGNDDPLNPRPGTLRHAVIQNEPLWIIFKRDMVIKLAQELVMNSFK  159

Query  503   TIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGDG  682
             TIDGRGASVH+AGGPCI I Y TNIIIHG++IHDC++GGNAN+RDSP+H GW T SDGDG
Sbjct  160   TIDGRGASVHLAGGPCIKIHYATNIIIHGIHIHDCKRGGNANIRDSPQHAGWWTASDGDG  219

Query  683   VSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDKG  862
             VSI GG  +W+DHCSLSNC DGL+DAI GSTAITISNNYMTHH+KVMLLGHSD++ QDK 
Sbjct  220   VSILGGKQIWIDHCSLSNCNDGLIDAIHGSTAITISNNYMTHHDKVMLLGHSDSFTQDKN  279

Query  863   MQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAPN  1042
             MQVTIAFNHFGEGL+QRMPRCRHGYFHVVNNDYTHWEMYAIGGSA PTI SQGNRF+AP 
Sbjct  280   MQVTIAFNHFGEGLVQRMPRCRHGYFHVVNNDYTHWEMYAIGGSASPTIYSQGNRFVAPY  339

Query  1043  DRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPSS  1222
             +RF KEVTKHEDAPES+W+ WNWRSEGDL+LNGA+F     AGASSSYA+A SLSARPSS
Sbjct  340   NRFRKEVTKHEDAPESEWRHWNWRSEGDLLLNGAYFRQ-SGAGASSSYARAYSLSARPSS  398

Query  1223  LVGSLTGGAGALPCKKGKSC  1282
             LVG +T  AGAL C++G  C
Sbjct  399   LVGDITITAGALNCRRGSRC  418



>ref|XP_004171543.1| PREDICTED: probable pectate lyase 15-like [Cucumis sativus]
Length=444

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/381 (73%), Positives = 325/381 (85%), Gaps = 3/381 (1%)
 Frame = +2

Query  143   DPELIVQEVNEKIANATIARRKLGFLSCGTGNPIDDCWRCDPNWESNRQRLADCAIGFGK  322
             +P+ I   V   I N+T  RRKLGF SCGTGNPIDDCWRCD NW  NR+RLA+C IGFG+
Sbjct  66    NPDEIAASVEMSIRNST-ERRKLGFFSCGTGNPIDDCWRCDSNWHRNRKRLAECGIGFGR  124

Query  323   QAIGGRDGKLYVVTDTGD-DAVNPKPGTLRYGAIQDEPLWIIFARDMVIKLKEELIMNSF  499
              AIGGRDG+ YVVTD+ D D VNPKPGTLR+  IQ++PLWI+F RDMVI+LK+ELIMNSF
Sbjct  125   NAIGGRDGRFYVVTDSSDNDPVNPKPGTLRHAVIQEKPLWIVFKRDMVIRLKQELIMNSF  184

Query  500   KTIDGRGASVHIAGGPCITIQYVTNIIIHGLNIHDCQQGGNANVRDSPEHYGWRTLSDGD  679
             KTID RG +VHIA G CITIQ+VTNIIIHGL+IHDC+  GNA VR SP H+GWRT++DGD
Sbjct  185   KTIDARGVNVHIANGACITIQFVTNIIIHGLHIHDCKPTGNAMVRSSPSHFGWRTMADGD  244

Query  680   GVSIFGGSHVWVDHCSLSNCRDGLVDAIRGSTAITISNNYMTHHNKVMLLGHSDTYIQDK  859
              +SIFG SH+W+DH SLSNC DGLVDA+ GSTAITISNN+ THHN+VMLLGHSD+Y +DK
Sbjct  245   AISIFGSSHIWIDHNSLSNCADGLVDAVMGSTAITISNNHFTHHNEVMLLGHSDSYTKDK  304

Query  860   GMQVTIAFNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSADPTINSQGNRFLAP  1039
              MQVTIA+NHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSA+PTINSQGNR+ AP
Sbjct  305   QMQVTIAYNHFGEGLIQRMPRCRHGYFHVVNNDYTHWEMYAIGGSANPTINSQGNRYAAP  364

Query  1040  NDRFNKEVTKHEDAPESQWKGWNWRSEGDLMLNGAFFTTsgsagasssyakasslsaRPS  1219
              +RF KEVTK  + PES+WKGWNWRSEGD++LNGA+FT    AGAS+SYA+ASSL A+ +
Sbjct  365   TNRFAKEVTKRVETPESEWKGWNWRSEGDMLLNGAYFTP-SGAGASASYARASSLGAKSA  423

Query  1220  SLVGSLTGGAGALPCKKGKSC  1282
             S+VGS+T  AG+LPC++G  C
Sbjct  424   SMVGSITSSAGSLPCRRGHPC  444



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4436604669000