BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7243_g1_i1 len=2384 path=[1:0-2059 2061:2060-2383]

Length=2384
                                                                      Score     E

ref|XP_011099957.1|  PREDICTED: probable rhamnogalacturonate lyase B    699   0.0      
ref|XP_009590660.1|  PREDICTED: rhamnogalacturonate lyase B-like        700   0.0      
ref|XP_009802086.1|  PREDICTED: rhamnogalacturonate lyase B-like        694   0.0      
ref|XP_009789095.1|  PREDICTED: probable rhamnogalacturonate lyase B    686   0.0      
ref|XP_004240256.1|  PREDICTED: rhamnogalacturonate lyase B-like        686   0.0      
ref|XP_011097518.1|  PREDICTED: probable rhamnogalacturonate lyase B    680   0.0      
gb|EYU30916.1|  hypothetical protein MIMGU_mgv1a002827mg                671   0.0      
ref|XP_006360390.1|  PREDICTED: rhamnogalacturonate lyase B-like        671   0.0      
ref|XP_009611897.1|  PREDICTED: uncharacterized protein LOC104105339    689   0.0      
gb|AES73960.2|  rhamnogalacturonate lyase B-like protein                661   0.0      
ref|XP_006856575.1|  hypothetical protein AMTR_s00046p00193590          657   0.0      
ref|XP_003603709.1|  Rhamnogalacturonate lyase                          656   0.0      
ref|XP_006346800.1|  PREDICTED: rhamnogalacturonate lyase B-like        657   0.0      
ref|XP_003526529.1|  PREDICTED: probable rhamnogalacturonate lyas...    653   0.0      
ref|XP_004501055.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    653   0.0      
ref|XP_010935282.1|  PREDICTED: probable rhamnogalacturonate lyase B    652   0.0      
ref|XP_009366370.1|  PREDICTED: probable rhamnogalacturonate lyas...    647   0.0      
gb|KDP41508.1|  hypothetical protein JCGZ_15915                         647   0.0      
ref|XP_011074280.1|  PREDICTED: probable rhamnogalacturonate lyas...    645   0.0      
ref|XP_009366369.1|  PREDICTED: probable rhamnogalacturonate lyas...    645   0.0      
ref|XP_010935280.1|  PREDICTED: probable rhamnogalacturonate lyase B    647   0.0      
ref|XP_007224652.1|  hypothetical protein PRUPE_ppa026307mg             645   0.0      
ref|XP_010244706.1|  PREDICTED: probable rhamnogalacturonate lyase B    645   0.0      
gb|KDP29802.1|  hypothetical protein JCGZ_18737                         646   0.0      
ref|XP_004287408.1|  PREDICTED: probable rhamnogalacturonate lyas...    645   0.0      
gb|KHN09024.1|  Rhamnogalacturonate lyase                               644   0.0      
ref|XP_008466141.1|  PREDICTED: rhamnogalacturonate lyase B             645   0.0      
ref|XP_008781312.1|  PREDICTED: probable rhamnogalacturonate lyas...    645   0.0      
ref|XP_003523772.1|  PREDICTED: rhamnogalacturonate lyase B-like        644   0.0      
ref|XP_002301112.2|  hypothetical protein POPTR_0002s11070g             643   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011019318.1|  PREDICTED: rhamnogalacturonate lyase B-like        644   0.0      
ref|XP_004288871.1|  PREDICTED: probable rhamnogalacturonate lyas...    642   0.0      
ref|XP_002527245.1|  lyase, putative                                    642   0.0      Ricinus communis
ref|XP_009418295.1|  PREDICTED: probable rhamnogalacturonate lyase B    642   0.0      
ref|XP_003526528.1|  PREDICTED: probable rhamnogalacturonate lyas...    641   0.0      
ref|XP_011099953.1|  PREDICTED: probable rhamnogalacturonate lyas...    642   0.0      
emb|CDP00944.1|  unnamed protein product                                641   0.0      
ref|XP_011074281.1|  PREDICTED: probable rhamnogalacturonate lyas...    640   0.0      
ref|XP_004238544.1|  PREDICTED: probable rhamnogalacturonate lyase B    641   0.0      
ref|XP_010254609.1|  PREDICTED: probable rhamnogalacturonate lyas...    641   0.0      
ref|XP_011099952.1|  PREDICTED: probable rhamnogalacturonate lyas...    642   0.0      
ref|XP_006338024.1|  PREDICTED: rhamnogalacturonate lyase B-like        642   0.0      
ref|XP_009595415.1|  PREDICTED: probable rhamnogalacturonate lyas...    640   0.0      
ref|XP_011098532.1|  PREDICTED: probable rhamnogalacturonate lyase B    641   0.0      
ref|XP_004136250.1|  PREDICTED: probable rhamnogalacturonate lyas...    640   0.0      
ref|XP_006433775.1|  hypothetical protein CICLE_v10000543mg             640   0.0      
ref|XP_004501056.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    639   0.0      
ref|XP_010683043.1|  PREDICTED: probable rhamnogalacturonate lyase B    640   0.0      
ref|XP_009789094.1|  PREDICTED: probable rhamnogalacturonate lyase B    640   0.0      
ref|XP_009595414.1|  PREDICTED: probable rhamnogalacturonate lyas...    639   0.0      
ref|XP_004288875.1|  PREDICTED: rhamnogalacturonate lyase-like          638   0.0      
gb|EYU36444.1|  hypothetical protein MIMGU_mgv1a002779mg                638   0.0      
ref|XP_008781370.1|  PREDICTED: probable rhamnogalacturonate lyase B    638   0.0      
ref|XP_006338026.1|  PREDICTED: probable rhamnogalacturonate lyas...    637   0.0      
ref|XP_004238021.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    637   0.0      
ref|XP_004136251.1|  PREDICTED: rhamnogalacturonate lyase B-like        637   0.0      
ref|XP_010060119.1|  PREDICTED: probable rhamnogalacturonate lyas...    637   0.0      
ref|XP_002308510.2|  hypothetical protein POPTR_0006s23510g             638   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010060118.1|  PREDICTED: probable rhamnogalacturonate lyas...    637   0.0      
ref|XP_004288494.1|  PREDICTED: rhamnogalacturonate lyase B-like        638   0.0      
ref|XP_010060117.1|  PREDICTED: probable rhamnogalacturonate lyas...    637   0.0      
ref|XP_009406080.1|  PREDICTED: probable rhamnogalacturonate lyase B    635   0.0      
ref|XP_006472411.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    636   0.0      
ref|XP_006364654.1|  PREDICTED: probable rhamnogalacturonate lyas...    635   0.0      
ref|XP_009795923.1|  PREDICTED: probable rhamnogalacturonate lyas...    635   0.0      
gb|KGN60275.1|  hypothetical protein Csa_3G892760                       635   0.0      
ref|XP_010320233.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    636   0.0      
ref|XP_008466137.1|  PREDICTED: probable rhamnogalacturonate lyas...    635   0.0      
ref|XP_008219222.1|  PREDICTED: probable rhamnogalacturonate lyase B    636   0.0      
ref|XP_006338025.1|  PREDICTED: rhamnogalacturonate lyase B-like        635   0.0      
ref|XP_006426234.1|  hypothetical protein CICLE_v10025074mg             636   0.0      
ref|XP_010935276.1|  PREDICTED: probable rhamnogalacturonate lyas...    635   0.0      
ref|XP_010320231.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    634   0.0      
ref|XP_008466140.1|  PREDICTED: probable rhamnogalacturonate lyase C    634   0.0      
ref|XP_007225130.1|  hypothetical protein PRUPE_ppa002544mg             634   0.0      
ref|XP_004161743.1|  PREDICTED: LOW QUALITY PROTEIN: rhamnogalact...    633   0.0      
ref|XP_002527353.1|  lyase, putative                                    634   0.0      Ricinus communis
emb|CDP01611.1|  unnamed protein product                                635   0.0      
ref|XP_010312903.1|  PREDICTED: probable rhamnogalacturonate lyase B    634   0.0      
gb|KDO81266.1|  hypothetical protein CISIN_1g042458mg                   633   0.0      
ref|XP_008444895.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    633   0.0      
gb|KDP32172.1|  hypothetical protein JCGZ_12633                         634   0.0      
ref|XP_009795928.1|  PREDICTED: probable rhamnogalacturonate lyas...    632   0.0      
gb|EYU29460.1|  hypothetical protein MIMGU_mgv1a002710mg                632   0.0      
ref|XP_006472412.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    632   0.0      
ref|XP_007225136.1|  hypothetical protein PRUPE_ppa002538mg             632   0.0      
ref|XP_009795927.1|  PREDICTED: probable rhamnogalacturonate lyas...    631   0.0      
ref|XP_004136417.1|  PREDICTED: rhamnogalacturonate lyase-like          630   0.0      
ref|XP_004287405.1|  PREDICTED: rhamnogalacturonate lyase-like          631   0.0      
ref|XP_002285626.2|  PREDICTED: probable rhamnogalacturonate lyas...    630   0.0      Vitis vinifera
ref|XP_009795926.1|  PREDICTED: probable rhamnogalacturonate lyas...    631   0.0      
gb|KCW66665.1|  hypothetical protein EUGRSUZ_F00441                     630   0.0      
ref|XP_004289511.1|  PREDICTED: probable rhamnogalacturonate lyas...    633   0.0      
gb|KHF97676.1|  Rhamnogalacturonate lyase                               630   0.0      
ref|XP_008440518.1|  PREDICTED: rhamnogalacturonate lyase B isofo...    629   0.0      
gb|KDP41513.1|  hypothetical protein JCGZ_15920                         631   0.0      
gb|KDP41512.1|  hypothetical protein JCGZ_15919                         629   0.0      
emb|CDY13740.1|  BnaA09g42420D                                          631   0.0      
ref|XP_004163448.1|  PREDICTED: rhamnogalacturonate lyase B-like        629   0.0      
ref|XP_010664440.1|  PREDICTED: probable rhamnogalacturonate lyas...    631   0.0      
ref|XP_010060116.1|  PREDICTED: probable rhamnogalacturonate lyase B    629   0.0      
ref|XP_008219219.1|  PREDICTED: probable rhamnogalacturonate lyase B    629   0.0      
ref|XP_008236572.1|  PREDICTED: probable rhamnogalacturonate lyase B    628   0.0      
ref|XP_010646859.1|  PREDICTED: rhamnogalacturonate lyase B-like        629   0.0      
ref|XP_007137657.1|  hypothetical protein PHAVU_009G144900g             628   0.0      
ref|XP_006466349.1|  PREDICTED: rhamnogalacturonate lyase B-like        627   0.0      
ref|XP_007137655.1|  hypothetical protein PHAVU_009G144800g             628   0.0      
ref|XP_002319997.2|  hypothetical protein POPTR_0014s01060g             627   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_009148302.1|  PREDICTED: probable rhamnogalacturonate lyase B    627   0.0      
ref|XP_002527229.1|  lyase, putative                                    629   0.0      Ricinus communis
ref|XP_008357559.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    627   0.0      
gb|KGN56316.1|  hypothetical protein Csa_3G115050                       629   0.0      
emb|CDX76902.1|  BnaC08g34880D                                          628   0.0      
ref|XP_011016984.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    648   0.0      
ref|XP_009597661.1|  PREDICTED: probable rhamnogalacturonate lyas...    626   0.0      
ref|XP_008440517.1|  PREDICTED: rhamnogalacturonate lyase B isofo...    629   0.0      
ref|XP_009112504.1|  PREDICTED: probable rhamnogalacturonate lyase B    628   0.0      
emb|CDX93466.1|  BnaA06g05820D                                          627   0.0      
ref|XP_010319233.1|  PREDICTED: probable rhamnogalacturonate lyase B    628   0.0      
ref|XP_004161760.1|  PREDICTED: probable rhamnogalacturonate lyas...    625   0.0      
ref|XP_004133752.1|  PREDICTED: probable rhamnogalacturonate lyas...    625   0.0      
ref|XP_010244707.1|  PREDICTED: probable rhamnogalacturonate lyas...    624   0.0      
ref|NP_179847.1|  rhamnogalacturonate lyase-like protein                626   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244708.1|  PREDICTED: probable rhamnogalacturonate lyas...    624   0.0      
ref|XP_006472413.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    624   0.0      
ref|XP_002527352.1|  lyase, putative                                    624   0.0      Ricinus communis
ref|XP_002306520.2|  hypothetical protein POPTR_0005s19450g             626   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010458304.1|  PREDICTED: probable rhamnogalacturonate lyase B    624   0.0      
gb|EYU30909.1|  hypothetical protein MIMGU_mgv1a002454mg                625   0.0      
ref|XP_011011722.1|  PREDICTED: probable rhamnogalacturonate lyas...    625   0.0      
ref|XP_006364644.1|  PREDICTED: probable rhamnogalacturonate lyas...    625   0.0      
ref|XP_009771422.1|  PREDICTED: probable rhamnogalacturonate lyas...    625   0.0      
ref|XP_011003640.1|  PREDICTED: rhamnogalacturonate lyase B-like        625   0.0      
ref|XP_008219198.1|  PREDICTED: rhamnogalacturonate lyase B-like        623   0.0      
ref|XP_006346801.1|  PREDICTED: probable rhamnogalacturonate lyas...    624   0.0      
ref|XP_009366368.1|  PREDICTED: probable rhamnogalacturonate lyas...    641   0.0      
ref|XP_009591965.1|  PREDICTED: probable rhamnogalacturonate lyas...    624   0.0      
ref|XP_010312681.1|  PREDICTED: probable rhamnogalacturonate lyase B    624   0.0      
ref|XP_002527357.1|  lyase, putative                                    622   0.0      Ricinus communis
ref|XP_006417521.1|  hypothetical protein EUTSA_v10007093mg             622   0.0      
ref|XP_009366367.1|  PREDICTED: probable rhamnogalacturonate lyas...    641   0.0      
ref|XP_008353960.1|  PREDICTED: probable rhamnogalacturonate lyase B    624   0.0      
gb|EYU30915.1|  hypothetical protein MIMGU_mgv1a003154mg                621   0.0      
ref|XP_006304407.1|  hypothetical protein CARUB_v10010965mg             621   0.0      
ref|XP_002892533.1|  hypothetical protein ARALYDRAFT_334271             621   0.0      
ref|XP_008368110.1|  PREDICTED: uncharacterized protein LOC103431713    642   0.0      
ref|XP_004152608.1|  PREDICTED: rhamnogalacturonate lyase B-like        621   0.0      
ref|XP_010671338.1|  PREDICTED: rhamnogalacturonate lyase B             622   0.0      
ref|XP_010544057.1|  PREDICTED: probable rhamnogalacturonate lyas...    620   0.0      
ref|XP_007018290.1|  Rhamnogalacturonate lyase family protein           620   0.0      
ref|XP_010104584.1|  hypothetical protein L484_025563                   639   0.0      
ref|XP_011098603.1|  PREDICTED: probable rhamnogalacturonate lyas...    620   0.0      
emb|CDP00942.1|  unnamed protein product                                622   0.0      
ref|XP_011098611.1|  PREDICTED: probable rhamnogalacturonate lyas...    620   0.0      
ref|XP_006404724.1|  hypothetical protein EUTSA_v10000697mg             619   0.0      
ref|XP_011016987.1|  PREDICTED: probable rhamnogalacturonate lyas...    619   0.0      
emb|CBI19298.3|  unnamed protein product                                619   0.0      
ref|XP_008384665.1|  PREDICTED: probable rhamnogalacturonate lyase B    620   0.0      
ref|XP_009397844.1|  PREDICTED: probable rhamnogalacturonate lyas...    617   0.0      
ref|XP_010935407.1|  PREDICTED: rhamnogalacturonate lyase B-like        620   0.0      
gb|AAS99719.1|  At2g22620                                               619   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544055.1|  PREDICTED: probable rhamnogalacturonate lyas...    617   0.0      
ref|XP_004143542.1|  PREDICTED: rhamnogalacturonate lyase B-like        619   0.0      
emb|CDX89492.1|  BnaC04g35110D                                          617   0.0      
ref|XP_010023418.1|  PREDICTED: uncharacterized protein LOC104414097    618   0.0      
ref|XP_010249437.1|  PREDICTED: probable rhamnogalacturonate lyase B    616   0.0      
ref|XP_004974168.1|  PREDICTED: probable rhamnogalacturonate lyas...    617   0.0      
gb|AES73961.2|  rhamnogalacturonate lyase B-like protein                617   0.0      
ref|XP_006660373.1|  PREDICTED: probable rhamnogalacturonate lyas...    617   0.0      
ref|XP_007208155.1|  hypothetical protein PRUPE_ppa022021mg             615   0.0      
ref|XP_010235392.1|  PREDICTED: probable rhamnogalacturonate lyase B    617   0.0      
gb|KFK43288.1|  hypothetical protein AALP_AA1G104600                    615   0.0      
ref|NP_172460.6|  rhamnogalacturonate lyase-like protein                614   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010429187.1|  PREDICTED: probable rhamnogalacturonate lyas...    616   0.0      
ref|XP_006293793.1|  hypothetical protein CARUB_v10022775mg             616   0.0      
ref|XP_007018292.1|  Rhamnogalacturonate lyase family protein           637   0.0      
ref|XP_008378659.1|  PREDICTED: probable rhamnogalacturonate lyase B    634   0.0      
ref|XP_010490435.1|  PREDICTED: probable rhamnogalacturonate lyas...    614   0.0      
ref|XP_011099951.1|  PREDICTED: probable rhamnogalacturonate lyas...    615   0.0      
ref|XP_003519207.1|  PREDICTED: rhamnogalacturonate lyase B-like        614   0.0      
ref|XP_002880453.1|  hypothetical protein ARALYDRAFT_481121             615   0.0      
ref|XP_010472252.1|  PREDICTED: probable rhamnogalacturonate lyas...    615   0.0      
ref|XP_007225686.1|  hypothetical protein PRUPE_ppa002905mg             613   0.0      
ref|XP_010458307.1|  PREDICTED: probable rhamnogalacturonate lyas...    614   0.0      
ref|XP_002445711.1|  hypothetical protein SORBIDRAFT_07g024560          614   0.0      Sorghum bicolor [broomcorn]
gb|AES98299.2|  rhamnogalacturonate lyase B-like protein                613   0.0      
ref|XP_010458305.1|  PREDICTED: probable rhamnogalacturonate lyas...    614   0.0      
emb|CDP01612.1|  unnamed protein product                                613   0.0      
ref|XP_004974169.1|  PREDICTED: probable rhamnogalacturonate lyas...    612   0.0      
ref|XP_007018291.1|  Rhamnogalacturonate lyase family protein           612   0.0      
ref|XP_006586511.1|  PREDICTED: rhamnogalacturonate lyase B-like        611   0.0      
ref|XP_009397836.1|  PREDICTED: probable rhamnogalacturonate lyas...    611   0.0      
ref|XP_002301114.1|  hypothetical protein POPTR_0002s11090g             611   0.0      Populus trichocarpa [western balsam poplar]
tpg|DAA48720.1|  TPA: hypothetical protein ZEAMMB73_778200              611   0.0      
dbj|BAK04420.1|  predicted protein                                      612   0.0      
dbj|BAD10227.1|  putative MYST1                                         610   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008664579.1|  PREDICTED: probable rhamnogalacturonate lyas...    610   0.0      
ref|XP_008781369.1|  PREDICTED: probable rhamnogalacturonate lyase B    609   0.0      
ref|XP_010417021.1|  PREDICTED: probable rhamnogalacturonate lyase B    610   0.0      
ref|NP_001062464.1|  Os08g0554100                                       609   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_009626140.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
gb|KHN08932.1|  Rhamnogalacturonate lyase                               607   0.0      
ref|XP_008664578.1|  PREDICTED: probable rhamnogalacturonate lyas...    610   0.0      
gb|EYU30914.1|  hypothetical protein MIMGU_mgv1a002612mg                608   0.0      
ref|XP_010490461.1|  PREDICTED: probable rhamnogalacturonate lyas...    609   0.0      
ref|XP_010530581.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
emb|CDX94932.1|  BnaC05g07390D                                          609   0.0      
ref|XP_009364825.1|  PREDICTED: probable rhamnogalacturonate lyase B    608   0.0      
gb|KHN24870.1|  Rhamnogalacturonate lyase                               608   0.0      
ref|XP_010490456.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
ref|XP_011099950.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
ref|XP_010475848.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
ref|XP_006472995.1|  PREDICTED: probable rhamnogalacturonate lyas...    606   0.0      
ref|XP_010027974.1|  PREDICTED: rhamnogalacturonate lyase B             609   0.0      
ref|XP_009771424.1|  PREDICTED: probable rhamnogalacturonate lyas...    605   0.0      
ref|XP_006495333.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
ref|XP_010475847.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
ref|XP_011016990.1|  PREDICTED: probable rhamnogalacturonate lyas...    606   0.0      
ref|XP_010555417.1|  PREDICTED: probable rhamnogalacturonate lyas...    608   0.0      
ref|XP_010671318.1|  PREDICTED: probable rhamnogalacturonate lyase B    606   0.0      
ref|XP_010255178.1|  PREDICTED: probable rhamnogalacturonate lyase B    606   0.0      
ref|XP_009148304.1|  PREDICTED: rhamnogalacturonate lyase B             607   0.0      
ref|XP_008219212.1|  PREDICTED: probable rhamnogalacturonate lyase B    605   0.0      
emb|CDX93464.1|  BnaA06g05840D                                          607   0.0      
ref|XP_006602438.1|  PREDICTED: probable rhamnogalacturonate lyas...    607   0.0      
ref|XP_006602439.1|  PREDICTED: probable rhamnogalacturonate lyas...    606   0.0      
ref|XP_002527356.1|  lyase, putative                                    608   0.0      Ricinus communis
ref|XP_006421506.1|  hypothetical protein CICLE_v10006424mg             605   0.0      
gb|KHN26157.1|  Rhamnogalacturonate lyase                               603   0.0      
ref|XP_007141289.1|  hypothetical protein PHAVU_008G183500g             603   0.0      
ref|XP_006433776.1|  hypothetical protein CICLE_v10003807mg             603   0.0      
ref|XP_003615341.1|  LG27/30-like gene                                  602   0.0      
gb|AET03356.2|  rhamnogalacturonate lyase B-like protein                603   0.0      
ref|XP_010060112.1|  PREDICTED: probable rhamnogalacturonate lyase B    603   0.0      
ref|XP_010555419.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    603   0.0      
ref|XP_007137654.1|  hypothetical protein PHAVU_009G144700g             602   0.0      
ref|XP_006472414.1|  PREDICTED: uncharacterized protein LOC102607...    602   0.0      
gb|KHN38895.1|  Rhamnogalacturonate lyase                               602   0.0      
ref|XP_003522745.2|  PREDICTED: rhamnogalacturonate lyase B-like        602   0.0      
gb|KDP41510.1|  hypothetical protein JCGZ_15917                         602   0.0      
ref|XP_008365246.1|  PREDICTED: probable rhamnogalacturonate lyase B    600   0.0      
ref|XP_006306941.1|  hypothetical protein CARUB_v10008508mg             601   0.0      
ref|XP_008219218.1|  PREDICTED: rhamnogalacturonate lyase B-like        600   0.0      
ref|XP_010104583.1|  hypothetical protein L484_025562                   617   0.0      
ref|XP_011098629.1|  PREDICTED: probable rhamnogalacturonate lyase B    600   0.0      
ref|XP_006366427.1|  PREDICTED: probable rhamnogalacturonate lyas...    598   0.0      
ref|NP_172462.2|  rhamnogalacturonate lyase-like protein                600   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX94934.1|  BnaC05g07370D                                          599   0.0      
ref|XP_011016991.1|  PREDICTED: probable rhamnogalacturonate lyas...    598   0.0      
ref|XP_003628880.1|  Rhamnogalacturonate lyase                          599   0.0      
ref|XP_010437156.1|  PREDICTED: probable rhamnogalacturonate lyase B    598   0.0      
ref|XP_008389040.1|  PREDICTED: probable rhamnogalacturonate lyase B    599   0.0      
ref|XP_006433777.1|  hypothetical protein CICLE_v10003131mg             597   0.0      
ref|XP_006364645.1|  PREDICTED: probable rhamnogalacturonate lyas...    597   0.0      
gb|KFK30410.1|  hypothetical protein AALP_AA7G257300                    597   0.0      
ref|XP_006433780.1|  hypothetical protein CICLE_v10000542mg             597   0.0      
ref|XP_006338131.1|  PREDICTED: rhamnogalacturonate lyase B-like        596   0.0      
gb|AES73958.2|  rhamnogalacturonate lyase B-like protein                596   0.0      
ref|NP_172459.1|  rhamnogalacturonate lyase-like protein                595   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148296.1|  PREDICTED: probable rhamnogalacturonate lyase B    598   0.0      
ref|XP_010490418.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    598   0.0      
ref|XP_003603710.1|  Rhamnogalacturonate lyase                          598   0.0      
ref|XP_010458297.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    597   0.0      
ref|XP_006472409.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    597   0.0      
ref|XP_002892532.1|  predicted protein                                  596   0.0      
ref|XP_006417519.1|  hypothetical protein EUTSA_v10007058mg             595   0.0      
ref|XP_004287322.1|  PREDICTED: rhamnogalacturonate lyase-like is...    596   0.0      
ref|XP_010490407.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    597   0.0      
gb|KHG10248.1|  Rhamnogalacturonate lyase                               596   0.0      
ref|XP_009801905.1|  PREDICTED: probable rhamnogalacturonate lyase B    595   0.0      
ref|XP_002301113.1|  hypothetical protein POPTR_0002s11080g             596   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010458296.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    597   0.0      
ref|XP_003628875.1|  Rhamnogalacturonate lyase                          596   0.0      
ref|NP_195516.2|  Rhamnogalacturonate lyase family protein              595   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892534.1|  hypothetical protein ARALYDRAFT_888241             595   0.0      
ref|XP_010106796.1|  hypothetical protein L484_009236                   593   0.0      
ref|XP_010935278.1|  PREDICTED: probable rhamnogalacturonate lyas...    591   0.0      
ref|XP_007156453.1|  hypothetical protein PHAVU_003G287200g             595   0.0      
gb|KFK43290.1|  hypothetical protein AALP_AA1G104800                    594   0.0      
gb|KFK43291.1|  hypothetical protein AALP_AA1G104800                    594   0.0      
ref|XP_007221968.1|  hypothetical protein PRUPE_ppa002258mg             595   0.0      
ref|XP_008338981.1|  PREDICTED: rhamnogalacturonate lyase B-like        595   0.0      
ref|XP_004238020.1|  PREDICTED: probable rhamnogalacturonate lyas...    593   0.0      
ref|XP_009626138.1|  PREDICTED: probable rhamnogalacturonate lyas...    593   0.0      
gb|EYU30911.1|  hypothetical protein MIMGU_mgv1a023316mg                592   0.0      
gb|KDO81267.1|  hypothetical protein CISIN_1g005706mg                   594   0.0      
ref|XP_004490462.1|  PREDICTED: rhamnogalacturonate lyase-like is...    593   0.0      
ref|XP_009626137.1|  PREDICTED: probable rhamnogalacturonate lyas...    593   0.0      
ref|XP_009803162.1|  PREDICTED: probable rhamnogalacturonate lyase B    593   0.0      
ref|XP_006572991.1|  PREDICTED: probable rhamnogalacturonate lyas...    593   0.0      
ref|XP_006472410.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    593   0.0      
emb|CDX93467.1|  BnaA06g05810D                                          594   0.0      
ref|XP_006664309.1|  PREDICTED: rhamnogalacturonate lyase B-like        591   0.0      
ref|XP_006585905.1|  PREDICTED: probable rhamnogalacturonate lyas...    593   0.0      
gb|KFK28989.1|  hypothetical protein AALP_AA7G074100                    592   0.0      
ref|XP_006663182.1|  PREDICTED: rhamnogalacturonate lyase B-like        591   0.0      
ref|XP_004501130.1|  PREDICTED: rhamnogalacturonate lyase B-like        593   0.0      
ref|XP_009346851.1|  PREDICTED: rhamnogalacturonate lyase B-like        592   0.0      
ref|XP_010475841.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    593   0.0      
ref|XP_006472416.1|  PREDICTED: rhamnogalacturonate lyase B-like        591   0.0      
gb|EEE69123.1|  hypothetical protein OsJ_28233                          613   0.0      
ref|XP_004252722.1|  PREDICTED: probable rhamnogalacturonate lyas...    590   0.0      
gb|KEH20099.1|  rhamnogalacturonate lyase B-like protein                592   0.0      
ref|XP_010555421.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    591   0.0      
ref|XP_010475840.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    592   0.0      
ref|XP_010555415.1|  PREDICTED: probable rhamnogalacturonate lyase B    590   0.0      
ref|XP_003603707.1|  Rhamnogalacturonate lyase                          589   0.0      
ref|XP_004509710.1|  PREDICTED: probable rhamnogalacturonate lyas...    590   0.0      
ref|XP_009797073.1|  PREDICTED: probable rhamnogalacturonate lyase B    590   0.0      
gb|KHN04903.1|  Rhamnogalacturonate lyase                               588   0.0      
ref|XP_011099955.1|  PREDICTED: probable rhamnogalacturonate lyase B    590   0.0      
ref|XP_009131413.1|  PREDICTED: rhamnogalacturonate lyase B             589   0.0      
ref|XP_009406069.1|  PREDICTED: uncharacterized protein LOC103989051    602   0.0      
ref|XP_006301664.1|  hypothetical protein CARUB_v10022113mg             589   0.0      
emb|CDX94935.1|  BnaC05g07360D                                          590   0.0      
gb|KHN08933.1|  Rhamnogalacturonate lyase                               589   0.0      
ref|XP_010446599.1|  PREDICTED: probable rhamnogalacturonate lyase B    588   0.0      
emb|CDX75691.1|  BnaA01g00110D                                          588   0.0      
ref|XP_006306951.1|  hypothetical protein CARUB_v10008518mg             588   0.0      
ref|XP_008389039.1|  PREDICTED: probable rhamnogalacturonate lyase B    588   0.0      
ref|XP_010060114.1|  PREDICTED: probable rhamnogalacturonate lyase B    589   0.0      
ref|XP_009591967.1|  PREDICTED: probable rhamnogalacturonate lyase B    586   0.0      
ref|XP_004305816.1|  PREDICTED: rhamnogalacturonate lyase-like          587   0.0      
ref|XP_002986362.1|  hypothetical protein SELMODRAFT_425248             588   0.0      
ref|XP_010496219.1|  PREDICTED: probable rhamnogalacturonate lyase B    587   0.0      
gb|KHN08233.1|  Rhamnogalacturonate lyase                               593   0.0      
gb|ABA96404.1|  LG27/30-like gene, putative, expressed                  587   0.0      
ref|XP_010683375.1|  PREDICTED: uncharacterized protein LOC104898066    608   0.0      
ref|XP_002866919.1|  hypothetical protein ARALYDRAFT_353036             585   0.0      
emb|CDY56577.1|  BnaC01g41550D                                          584   0.0      
ref|XP_004161761.1|  PREDICTED: probable rhamnogalacturonate lyas...    581   0.0      
ref|XP_010320230.1|  PREDICTED: probable rhamnogalacturonate lyas...    583   0.0      
ref|XP_007047727.1|  Rhamnogalacturonate lyase family protein, pu...    585   0.0      
ref|XP_010446606.1|  PREDICTED: probable rhamnogalacturonate lyase B    585   0.0      
gb|AES95929.2|  rhamnogalacturonate lyase B-like protein                584   0.0      
ref|XP_010490414.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    585   0.0      
ref|XP_008370921.1|  PREDICTED: probable rhamnogalacturonate lyase B    583   0.0      
ref|XP_004977458.1|  PREDICTED: probable rhamnogalacturonate lyas...    583   0.0      
ref|XP_006411824.1|  hypothetical protein EUTSA_v10024612mg             582   0.0      
emb|CDX69351.1|  BnaC01g01020D                                          582   0.0      
ref|XP_008444896.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    580   0.0      
dbj|BAO45869.1|  rhamnogalacturonate lyase                              583   0.0      
ref|XP_009338020.1|  PREDICTED: probable rhamnogalacturonate lyase B    582   0.0      
ref|XP_010432002.1|  PREDICTED: probable rhamnogalacturonate lyase B    582   0.0      
ref|XP_011100169.1|  PREDICTED: probable rhamnogalacturonate lyase B    582   0.0      
ref|XP_004250188.2|  PREDICTED: uncharacterized protein LOC101259106    602   0.0      
ref|XP_006283272.1|  hypothetical protein CARUB_v10004306mg             581   0.0      
gb|KFK43287.1|  hypothetical protein AALP_AA1G104400                    582   0.0      
emb|CBX24382.1|  hypothetical_protein                                   582   0.0      
emb|CDP00941.1|  unnamed protein product                                578   0.0      
ref|XP_002973439.1|  hypothetical protein SELMODRAFT_413798             579   0.0      
ref|XP_006433774.1|  hypothetical protein CICLE_v10003466mg             577   0.0      
ref|XP_007158341.1|  hypothetical protein PHAVU_002G144400g             578   0.0      
ref|NP_195508.2|  Rhamnogalacturonate lyase family protein              577   0.0      
ref|XP_010683372.1|  PREDICTED: probable rhamnogalacturonate lyase B    574   0.0      
ref|XP_009109407.1|  PREDICTED: probable rhamnogalacturonate lyase B    576   0.0      
emb|CAB37543.1|  LG127/30 like gene                                     575   0.0      
ref|XP_009397853.1|  PREDICTED: probable rhamnogalacturonate lyas...    572   0.0      
ref|NP_567703.4|  Rhamnogalacturonate lyase family protein              574   0.0      
ref|XP_002993615.1|  hypothetical protein SELMODRAFT_137340             575   0.0      
ref|XP_007018289.1|  Rhamnogalacturonate lyase family protein           574   0.0      
ref|XP_010436217.1|  PREDICTED: probable rhamnogalacturonate lyase B    576   0.0      
ref|XP_002886827.1|  hypothetical protein ARALYDRAFT_315485             572   0.0      
ref|XP_009801906.1|  PREDICTED: probable rhamnogalacturonate lyase B    573   0.0      
ref|XP_006413432.1|  hypothetical protein EUTSA_v10024647mg             572   0.0      
ref|XP_002869720.1|  hypothetical protein ARALYDRAFT_354330             572   0.0      
ref|XP_004288872.1|  PREDICTED: rhamnogalacturonate lyase B-like        572   0.0      
ref|XP_009109417.1|  PREDICTED: rhamnogalacturonate lyase B-like        573   0.0      
ref|XP_004287323.1|  PREDICTED: rhamnogalacturonate lyase-like is...    571   0.0      
emb|CDY52517.1|  BnaC03g61100D                                          571   0.0      
ref|XP_001763359.1|  predicted protein                                  570   0.0      
emb|CBI33189.3|  unnamed protein product                                569   0.0      
ref|XP_009109418.1|  PREDICTED: rhamnogalacturonate lyase B-like        570   0.0      
ref|XP_010320232.1|  PREDICTED: probable rhamnogalacturonate lyas...    568   0.0      
emb|CDX98350.1|  BnaC06g17110D                                          571   0.0      
gb|KFK29690.1|  hypothetical protein AALP_AA7G166000                    570   0.0      
ref|XP_002271814.3|  PREDICTED: probable rhamnogalacturonate lyase B    569   0.0      
ref|XP_009771423.1|  PREDICTED: probable rhamnogalacturonate lyas...    569   0.0      
gb|KHG04596.1|  Rhamnogalacturonate lyase                               570   0.0      
emb|CDY61006.1|  BnaA01g35120D                                          569   0.0      
ref|XP_006285725.1|  hypothetical protein CARUB_v10007197mg             570   0.0      
ref|XP_006286257.1|  hypothetical protein CARUB_v10007831mg             568   0.0      
ref|XP_010671350.1|  PREDICTED: probable rhamnogalacturonate lyase B    569   0.0      
ref|XP_003612971.1|  MYST1 protein                                      569   0.0      
ref|XP_009140666.1|  PREDICTED: probable rhamnogalacturonate lyase B    566   0.0      
gb|AET03352.2|  rhamnogalacturonate lyase B-like protein                568   0.0      
ref|XP_002988706.1|  hypothetical protein SELMODRAFT_447445             568   0.0      
ref|XP_003628876.1|  Rhamnogalacturonate lyase                          568   0.0      
gb|EYU30913.1|  hypothetical protein MIMGU_mgv1a018512mg                566   0.0      
ref|XP_006411832.1|  hypothetical protein EUTSA_v10027081mg             567   0.0      
ref|XP_010433770.1|  PREDICTED: probable rhamnogalacturonate lyase B    565   0.0      
ref|XP_001769727.1|  predicted protein                                  565   0.0      
ref|XP_010530582.1|  PREDICTED: probable rhamnogalacturonate lyas...    563   0.0      
gb|KDO81260.1|  hypothetical protein CISIN_1g0069272mg                  563   0.0      
ref|XP_010439043.1|  PREDICTED: probable rhamnogalacturonate lyase B    564   0.0      
ref|XP_004979331.1|  PREDICTED: rhamnogalacturonate lyase B-like        564   0.0      
emb|CDX67779.1|  BnaA07g18190D                                          565   0.0      
ref|NP_001066077.2|  Os12g0131900                                       585   0.0      
ref|XP_008466138.1|  PREDICTED: probable rhamnogalacturonate lyas...    559   0.0      
ref|XP_009110794.1|  PREDICTED: probable rhamnogalacturonate lyase B    564   0.0      
ref|XP_009105545.1|  PREDICTED: probable rhamnogalacturonate lyase B    563   0.0      
ref|XP_010671398.1|  PREDICTED: probable rhamnogalacturonate lyase B    570   0.0      
ref|XP_010544058.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    561   0.0      
ref|XP_002527358.1|  lyase, putative                                    558   0.0      
gb|ABI15897.1|  putative rhamnogalacturonate lyase                      557   0.0      
emb|CDY65730.1|  BnaCnng48490D                                          557   0.0      
ref|XP_008440004.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    556   0.0      
ref|XP_009109409.1|  PREDICTED: probable rhamnogalacturonate lyase B    556   0.0      
ref|XP_010451209.1|  PREDICTED: probable rhamnogalacturonate lyase B    555   0.0      
ref|XP_002301115.1|  hypothetical protein POPTR_0002s11100g             557   0.0      
ref|XP_008440001.1|  PREDICTED: rhamnogalacturonate lyase B-like ...    555   0.0      
gb|KDO81265.1|  hypothetical protein CISIN_1g037887mg                   552   0.0      
ref|XP_011008036.1|  PREDICTED: rhamnogalacturonate lyase B-like        553   0.0      
ref|XP_009597663.1|  PREDICTED: probable rhamnogalacturonate lyas...    547   0.0      
ref|XP_006433778.1|  hypothetical protein CICLE_v10003567mg             551   0.0      
ref|XP_004301125.1|  PREDICTED: rhamnogalacturonate lyase B-like        552   0.0      
ref|XP_002868957.1|  hypothetical protein ARALYDRAFT_912531             551   0.0      
emb|CBI23231.3|  unnamed protein product                                549   0.0      
ref|XP_006587583.1|  PREDICTED: probable rhamnogalacturonate lyas...    547   0.0      
gb|EMS62474.1|  Rhamnogalacturonate lyase                               551   0.0      
emb|CDY63550.1|  BnaC03g76550D                                          571   0.0      
ref|XP_006364652.1|  PREDICTED: probable rhamnogalacturonate lyas...    546   0.0      
emb|CDX90393.1|  BnaA08g15910D                                          571   0.0      
gb|EEC68814.1|  hypothetical protein OsI_37377                          549   0.0      
gb|AAB60743.1|  F21M12.30 gene product                                  551   0.0      
ref|XP_010655419.1|  PREDICTED: probable rhamnogalacturonate lyase B    548   0.0      
ref|XP_004960971.1|  PREDICTED: rhamnogalacturonate lyase B-like        548   0.0      
gb|KDO81262.1|  hypothetical protein CISIN_1g0389792mg                  546   0.0      
ref|XP_011098619.1|  PREDICTED: probable rhamnogalacturonate lyas...    545   0.0      
ref|XP_006389593.1|  hypothetical protein POPTR_0021s00440g             547   0.0      
ref|XP_011099954.1|  PREDICTED: probable rhamnogalacturonate lyas...    543   0.0      
gb|KCW54629.1|  hypothetical protein EUGRSUZ_I00574                     544   1e-180   
gb|KDO81264.1|  hypothetical protein CISIN_1g007269mg                   543   1e-180   
ref|XP_009597664.1|  PREDICTED: probable rhamnogalacturonate lyase B    541   2e-180   
ref|NP_001065674.2|  Os11g0134100                                       544   2e-180   
ref|NP_001062465.1|  Os08g0554300                                       543   2e-180   
gb|KEH36121.1|  rhamnogalacturonate lyase B-like protein                540   6e-180   
ref|XP_010278641.1|  PREDICTED: probable rhamnogalacturonate lyas...    542   9e-180   
ref|XP_008678147.1|  PREDICTED: probable rhamnogalacturonate lyas...    545   2e-179   
ref|XP_010236050.1|  PREDICTED: rhamnogalacturonate lyase B-like        545   2e-179   
ref|XP_009786814.1|  PREDICTED: probable rhamnogalacturonate lyase B    535   5e-179   
gb|KFK30409.1|  hypothetical protein AALP_AA7G257200                    540   8e-179   
ref|XP_007212351.1|  hypothetical protein PRUPE_ppa014556mg             540   8e-179   
ref|XP_004512558.1|  PREDICTED: probable rhamnogalacturonate lyas...    541   9e-179   
gb|KEH36119.1|  rhamnogalacturonate lyase B-like protein                537   1e-178   
ref|XP_004490463.1|  PREDICTED: rhamnogalacturonate lyase-like is...    538   1e-178   
ref|XP_010530576.1|  PREDICTED: uncharacterized protein LOC104807...    565   5e-178   
ref|XP_010530573.1|  PREDICTED: uncharacterized protein LOC104807...    567   5e-178   
ref|XP_010254611.1|  PREDICTED: probable rhamnogalacturonate lyas...    533   6e-178   
ref|XP_006449752.1|  hypothetical protein CICLE_v10017592mg             537   8e-178   
ref|XP_009618923.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    540   1e-177   
ref|XP_010530574.1|  PREDICTED: uncharacterized protein LOC104807...    565   3e-177   
ref|XP_009357586.1|  PREDICTED: probable rhamnogalacturonate lyase B    536   3e-177   
gb|KCW76995.1|  hypothetical protein EUGRSUZ_D01343                     535   5e-177   
ref|XP_009795925.1|  PREDICTED: probable rhamnogalacturonate lyas...    531   6e-177   
ref|XP_008679383.1|  PREDICTED: rhamnogalacturonate lyase B-like        537   7e-177   
ref|XP_006364646.1|  PREDICTED: probable rhamnogalacturonate lyas...    534   1e-176   
ref|XP_010094027.1|  hypothetical protein L484_018043                   534   2e-176   
ref|XP_009795924.1|  PREDICTED: probable rhamnogalacturonate lyas...    530   2e-176   
ref|XP_006364653.1|  PREDICTED: rhamnogalacturonate lyase B-like        533   2e-176   
ref|XP_008384247.1|  PREDICTED: probable rhamnogalacturonate lyase B    533   3e-176   
gb|KHN08234.1|  Rhamnogalacturonate lyase                               534   3e-176   
ref|XP_010530571.1|  PREDICTED: uncharacterized protein LOC104807...    564   4e-176   
ref|XP_010312902.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...    530   6e-176   
emb|CDP01610.1|  unnamed protein product                                526   3e-175   
ref|XP_010314591.1|  PREDICTED: probable rhamnogalacturonate lyas...    527   4e-175   
ref|XP_010319533.1|  PREDICTED: probable rhamnogalacturonate lyase B    527   9e-175   
gb|KDP29301.1|  hypothetical protein JCGZ_19404                         528   2e-174   
ref|XP_009591966.1|  PREDICTED: probable rhamnogalacturonate lyas...    526   4e-174   
ref|XP_010054599.1|  PREDICTED: probable rhamnogalacturonate lyase B    527   7e-174   
ref|XP_008440005.1|  PREDICTED: probable rhamnogalacturonate lyas...    525   1e-173   
ref|XP_010429186.1|  PREDICTED: probable rhamnogalacturonate lyas...    522   1e-173   
ref|XP_008678148.1|  PREDICTED: probable rhamnogalacturonate lyas...    530   1e-173   
gb|EMT33002.1|  Rhamnogalacturonate lyase                               531   2e-173   
ref|XP_006383567.1|  hypothetical protein POPTR_0005s19450g             523   3e-173   
ref|XP_004295276.1|  PREDICTED: probable rhamnogalacturonate lyas...    526   4e-173   
ref|XP_010472254.1|  PREDICTED: probable rhamnogalacturonate lyas...    520   1e-172   
ref|XP_011011723.1|  PREDICTED: probable rhamnogalacturonate lyas...    522   2e-172   
ref|XP_011016989.1|  PREDICTED: probable rhamnogalacturonate lyas...    520   4e-172   
gb|EYU40267.1|  hypothetical protein MIMGU_mgv1a0194411mg               520   7e-172   
gb|EPS67579.1|  hypothetical protein M569_07195                         518   8e-172   
ref|XP_002450784.1|  hypothetical protein SORBIDRAFT_05g018090          524   1e-171   
gb|EMT23951.1|  Rhamnogalacturonate lyase                               520   2e-171   
ref|XP_006472996.1|  PREDICTED: rhamnogalacturonate lyase B-like        519   2e-171   
ref|NP_001152385.1|  lyase precursor                                    523   4e-171   
gb|EYU33888.1|  hypothetical protein MIMGU_mgv1a019191mg                520   7e-171   
ref|XP_002441731.1|  hypothetical protein SORBIDRAFT_08g001440          523   9e-171   
gb|KHF97277.1|  Rhamnogalacturonate lyase                               515   9e-171   
ref|XP_003576350.1|  PREDICTED: probable rhamnogalacturonate lyase B    522   2e-170   
gb|KCW66661.1|  hypothetical protein EUGRSUZ_F00438                     515   8e-170   
gb|KDO78275.1|  hypothetical protein CISIN_1g047026mg                   514   2e-169   
ref|XP_008224746.1|  PREDICTED: probable rhamnogalacturonate lyase B    515   3e-169   
gb|KDO81268.1|  hypothetical protein CISIN_1g005706mg                   510   6e-169   
gb|KGN49102.1|  hypothetical protein Csa_6G513660                       513   2e-168   
ref|XP_009626141.1|  PREDICTED: uncharacterized protein LOC104116...    506   2e-167   
ref|XP_008781313.1|  PREDICTED: probable rhamnogalacturonate lyas...    507   3e-167   
ref|XP_010278642.1|  PREDICTED: probable rhamnogalacturonate lyas...    509   5e-167   
ref|XP_006490070.1|  PREDICTED: probable rhamnogalacturonate lyas...    508   2e-166   
ref|NP_001189578.1|  rhamnogalacturonate lyase-like protein             505   6e-166   
ref|XP_006490071.1|  PREDICTED: probable rhamnogalacturonate lyas...    508   9e-166   



>ref|XP_011099957.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=646

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/629 (53%), Positives = 447/629 (71%), Gaps = 5/629 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             +  P+KL V++  V MDNGI+K+ L+ P G + G+ Y+GV  NLLE  +K   RGYWD+ 
Sbjct  14    SSPPLKLHVSRRHVEMDNGIVKLTLTKPTGMLTGVAYKGVK-NLLEYRHKETRRGYWDIM  72

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             W T K+  S    +  T F+V+   E Q+EVSF KT+  S  + D+P+NIDKRF+ML G 
Sbjct  73    WTTSKKDRSFFDTLQGTGFRVVARTEDQIEVSFTKTWNVSNGENDVPLNIDKRFIMLRGV  132

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLN  927
             SGFY+YA+ +H  G  D+++D+ R+ FKL +++F ++A++D+ Q  MP+  +R  G  L+
Sbjct  133   SGFYSYAVLEHLHGWPDLNIDEARIAFKLRQNMFRYMAISDDRQRVMPTDHDRTVGHTLD  192

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y+EAV LT   N KLKG+VDDKYQY+ D+++  V+GWIS  PH+GFW+IT S+EFR GGP
Sbjct  193   YREAVLLTNPSNSKLKGEVDDKYQYSCDNKDNRVHGWISSHPHVGFWVITPSDEFRAGGP  252

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLW  1287
             +K DLT H GP +L++F S HY+G  +G++LR GE WK VFGPVFIY+NSD G   +TLW
Sbjct  253   VKPDLTSHAGPTSLAIFFSDHYAGPAFGVRLRDGEPWKKVFGPVFIYLNSDSGDKQRTLW  312

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             E AK+QM  ETK WPY FP  +D+P A +RGAV GRLL+HD        PAK A+VGLA+
Sbjct  313   EDAKEQMSRETKKWPYDFPLCKDFPHANERGAVRGRLLVHDKYINMDLVPAKSAYVGLAR  372

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG  GSWQ+D+  YQFWTRTD+ G F I  VRA  Y+LYAWVPG LG++KH +++ IKPG
Sbjct  373   PGAVGSWQDDAKGYQFWTRTDEMGYFMIKFVRADNYNLYAWVPGILGEYKHDSEVIIKPG  432

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
              +I++GDLV+ P + G T+WEIGIPDR+AAEF+IP+PAP+L N L  + TEKFRQYGLWD
Sbjct  433   SEIRIGDLVYDPPRTGPTLWEIGIPDRTAAEFYIPDPAPELTNKLYINHTEKFRQYGLWD  492

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+   DL+YTVG SD  K WFFA V RK  K +Y  T W ++F +  V   G YTL
Sbjct  493   RYTDLYPDEDLIYTVGVSDYRKHWFFAHVNRKINKDNYVPTTWKILFDVRNVIMAGQYTL  552

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             RIA+AS++ A + +W+N DP   +  FT++  G+DNAIARHGIHG Y      I G  +V
Sbjct  553   RIALASASLAEIQVWIN-DPHTQRPHFTTRRIGRDNAIARHGIHGRYWLYRVGISGFQLV  611

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              G+N LYLRQ++   PF G+MYDYIRLE 
Sbjct  612   NGKNTLYLRQARGSNPFIGVMYDYIRLEG  640



>ref|XP_009590660.1| PREDICTED: rhamnogalacturonate lyase B-like [Nicotiana tomentosiformis]
Length=681

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/634 (53%), Positives = 457/634 (72%), Gaps = 8/634 (1%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             +    PVKL +++  V+MDNGI++V L+NP G++AG+ Y G+D N+LE   K  +RGYWD
Sbjct  45    ISTTPPVKLLISRNYVVMDNGIVQVTLTNPTGAIAGVRYNGID-NVLEHDFKDTNRGYWD  103

Query  565   LDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK---SGDKTDIPINIDKRFVM  735
               W  P++K  T   +LAT+F+VI + E++VEVSF KT+    +    D+P+NIDKRFVM
Sbjct  104   TVWQRPEDKGHTFDMLLATNFRVIAQNENKVEVSFTKTWNPSINSSAHDLPLNIDKRFVM  163

Query  736   LPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG  915
             L GSSGFY+Y I++H KG   + +++ R+  KL R+LF ++A++D++Q  MP+ ++R  G
Sbjct  164   LRGSSGFYSYGIFEHLKGWPSLIIEEARIAIKLRRALFHYMAISDDMQRMMPTDEDRSAG  223

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFR  1095
             +VL+YKEAV LT   NPKLKG+VDDKYQY+ +++++ V+GW+   PH+GFW+IT+SNE+ 
Sbjct  224   QVLDYKEAVLLTHPSNPKLKGEVDDKYQYSFENKDIKVHGWVCNTPHVGFWVITSSNEYC  283

Query  1096  LGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH  1275
              GGP+KQDLT H GP +L++F S HY+G + G+ L+ GEAWK VFGPVF Y+NSD G +H
Sbjct  284   NGGPMKQDLTSHAGPTSLAVFFSGHYAGPELGVTLKKGEAWKKVFGPVFFYLNSDSGDNH  343

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
             +TLWE AK+QM EET  WPY FP+S DYP A +RG V G+L + D    K    AK A++
Sbjct  344   RTLWEDAKRQMQEETAKWPYDFPESLDYPHANERGIVRGQLFLRDRYINKDPFYAKSAYI  403

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG  GSWQ ++  YQFWT+TD TG+F+I+ VR+G YSLY+WVPG +GD+K+  DI 
Sbjct  404   GLALPGHVGSWQYETKGYQFWTQTDKTGQFKITGVRSGTYSLYSWVPGIIGDYKYNYDIN  463

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR-TEKFRQ  1812
             +K G DI +G LVF P +NG T+WEIGIPDR+ AEFF+P+P P L+N L ++  T+ FRQ
Sbjct  464   VKQGSDINLGHLVFYPPRNGPTLWEIGIPDRTGAEFFVPDPLPGLRNQLFNNNITQTFRQ  523

Query  1813  YGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AK  1986
             YGLWDRY++L+   DLVY VG SD  KDWFFA VTR+    +Y  T W ++F + +V  K
Sbjct  524   YGLWDRYTDLYPNKDLVYKVGVSDYKKDWFFAHVTRRTRSKNYIPTTWQILFGLPSVDPK  583

Query  1987  GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
             G YTLRIA+AS+T + L   +N DP K +  F     G+ NAIARHGIHGLY   SF+I 
Sbjct  584   GTYTLRIALASATYSHLQGRIN-DPSKPRPHFEIPAIGRSNAIARHGIHGLYRLFSFQIQ  642

Query  2167  GSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G  + KGEN +YL+Q K+G PFYG  YDYIRLE 
Sbjct  643   GYELQKGENIIYLKQIKSGNPFYGHHYDYIRLEG  676



>ref|XP_009802086.1| PREDICTED: rhamnogalacturonate lyase B-like [Nicotiana sylvestris]
 ref|XP_009802088.1| PREDICTED: rhamnogalacturonate lyase B-like [Nicotiana sylvestris]
Length=684

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/633 (53%), Positives = 455/633 (72%), Gaps = 9/633 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             +  PVKL +++  V++DNGI++V L+NP G++AG+ Y G+D N+LE   K  +RGYWD  
Sbjct  49    STPPVKLHISRNYVVIDNGIVQVTLTNPTGAIAGVRYNGID-NILEHDFKDTNRGYWDTV  107

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKT---DIPINIDKRFVMLP  741
             W  P++K  T   +L T+F+VI + E++VEVSF KT+   + +   D+P+NIDKRFVML 
Sbjct  108   WERPEDKGHTFDMLLGTNFRVIAQNENKVEVSFTKTWNPSNNSSAHDLPLNIDKRFVMLR  167

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV  921
             GSSGFY+Y I++H KG   + +++ R+  KL R+LF ++A++D++Q  MP+ ++R  G+V
Sbjct  168   GSSGFYSYGIFEHLKGWPTLIIEEARIAIKLRRALFHYMAISDDMQRMMPTDEDRSAGQV  227

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L+YKEAV LT   NPKLKG+VDDKYQY+ +++++ V+GW+   P +GFW+IT SNE+  G
Sbjct  228   LDYKEAVLLTHPSNPKLKGEVDDKYQYSFENKDIKVHGWVCNTPRVGFWVITPSNEYCNG  287

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT  1281
             GP+KQDLT H GP +L++F S HY+G + G+ L+ GEAWK VFGPVF Y+NSD   +H+T
Sbjct  288   GPMKQDLTSHAGPTSLAVFFSGHYAGPELGVTLKEGEAWKKVFGPVFFYLNSDSSDNHRT  347

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+QM EET  WPY FP+S DYP A +RG V G+L + D    K    AK A++GL
Sbjct  348   LWEDAKRQMQEETAKWPYDFPESLDYPHANERGIVRGQLFVRDRYINKDPMYAKSAYIGL  407

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ ++  YQFWT+TD TG+F+I+ VR G YSLY+WVPG +GD+K+  DI +K
Sbjct  408   ALPGDVGSWQYETKGYQFWTQTDKTGQFKITGVRPGTYSLYSWVPGIIGDYKYNYDINVK  467

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR--TEKFRQY  1815
              G DI +G LVF P +NG T+WEIGIPDR+AAEFF+P+P P L+N L ++   T+KFRQY
Sbjct  468   QGSDINLGHLVFDPPRNGPTLWEIGIPDRTAAEFFVPDPLPGLRNQLFNNNNITQKFRQY  527

Query  1816  GLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKG  1989
             GLWDRY++L+   DLVY VG SD  KDWFFA VTR+    +Y  T W ++F + +V  KG
Sbjct  528   GLWDRYTDLYPNKDLVYKVGVSDYQKDWFFAHVTRRTRSKNYIPTTWQILFGLPSVDPKG  587

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTL IA+AS+T + L   +N DP + K  F     G+ NAIARHGIHGLY   SF+I G
Sbjct  588   TYTLHIALASATYSHLQGRMN-DPSRPKPHFEIPAIGRSNAIARHGIHGLYRLFSFQIQG  646

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
               + KGEN +YL+Q K+G PFYG  YDYIRLE 
Sbjct  647   YELQKGENTIYLKQIKSGNPFYGHHYDYIRLEG  679



>ref|XP_009789095.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=670

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/625 (52%), Positives = 442/625 (71%), Gaps = 4/625 (1%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PVKL ++   V++DNGI+++ LSNP G +AG+ Y+G+D NL+E       RGYWD  W  
Sbjct  45    PVKLHISHHHVIIDNGIVQLTLSNPTGHIAGVSYKGID-NLMEKRFPESRRGYWDTMWKL  103

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             P++KAST     AT+F+VI +  ++VEVSF KT+      D+P+NIDKRFVML GSSGFY
Sbjct  104   PEDKASTFDTFFATNFRVIAKDNNKVEVSFTKTWNPNADHDLPLNIDKRFVMLRGSSGFY  163

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y I++ P+G  ++ LD+ R+  KL ++LF ++AV+D+ Q  MP+ ++R  G+VL ++EA
Sbjct  164   SYGIFERPEGMPELRLDEARIAMKLRQNLFLYMAVSDDRQRVMPTDQDRSSGKVLGFREA  223

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V++T   NPKLK +VDDKYQY+ D  ++ V+GWI  +PH+GFW+IT +NE+R GGP+KQD
Sbjct  224   VRITHPSNPKLKNEVDDKYQYSSDDNDIKVHGWICNRPHVGFWVITPTNEYRSGGPMKQD  283

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAK  1299
             LT H G  +L+ F S HY+G + G+ L+ GE WK VFGPVF Y+NSD G +H TLWE AK
Sbjct  284   LTSHAGATSLATFFSGHYAGPELGVSLKEGEPWKKVFGPVFFYLNSDSGNNHSTLWEDAK  343

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
             +QM EET  WPY FP+S+DYPKA +RG +SGRLL+ D         AK A++GLA PG+ 
Sbjct  344   RQMFEETAKWPYDFPESKDYPKANERGTISGRLLVDDRYISNDPIFAKSAYIGLALPGDT  403

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ D+  YQFWT+ D+TG F+I+ +  G Y+LY+WVPG +GD+K+   + I  G +I 
Sbjct  404   GSWQTDTKGYQFWTQADETGYFKITGIIPGTYNLYSWVPGVIGDYKYNQTLAITQGSEIN  463

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSE  1839
             +G L++ P +NG T+WEIGIPDR+AAEFF+P+P P   N +LS+ T+KFRQYGLWDRY++
Sbjct  464   LGHLIYNPPRNGPTLWEIGIPDRTAAEFFVPDPLPGFTNRVLSNSTQKFRQYGLWDRYTD  523

Query  1840  LH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAV  2013
             L+   DL+Y VG SD  KDWF+A VTR+     Y  T W + F + TV   G YTL +A+
Sbjct  524   LYPDEDLIYKVGVSDYTKDWFYAHVTRRTENKKYIPTTWQISFELPTVDPSGTYTLHVAL  583

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             AS+T + L   +N +P + +  F +   G+ NAIARHGIHGLYS  SF+IP   +  G+N
Sbjct  584   ASATYSHLQGRIN-NPDRPRPNFETPGIGRSNAIARHGIHGLYSLFSFQIPEYELQNGQN  642

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +YL+Q K G PF G+MYDYIRLE 
Sbjct  643   IIYLKQVKGGSPFNGVMYDYIRLEG  667



>ref|XP_004240256.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum lycopersicum]
Length=684

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/631 (52%), Positives = 447/631 (71%), Gaps = 7/631 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
                PVKL ++   V+MDNGI+KVNL+NP GS+AG+ Y G+D N+LE   K  +RGYWD  
Sbjct  51    TTPPVKLLISSNYVVMDNGIVKVNLTNPTGSIAGVSYNGID-NVLETDFKDTNRGYWDTV  109

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK---SGDKTDIPINIDKRFVMLP  741
             W  P +K  T   +L T F+VI   +++VEVSF KT+    +G   D+P+NIDKRFVML 
Sbjct  110   WERPGDKDHTFDMLLGTKFRVIASDKNKVEVSFTKTWNPSNNGTTHDLPLNIDKRFVMLR  169

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV  921
             GSSGFY+Y I++H KG   + L++ R+ FKL R+LF ++A++D+IQ  MP+ ++R +G++
Sbjct  170   GSSGFYSYGIFEHLKGWPSLILEEARIAFKLKRTLFHYMAISDDIQRMMPTDEDRSDGQI  229

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L+Y+EAV+LT   NPKLKG+VDDKYQY+ +++++ V+GW+   PH+GFW+IT S E R G
Sbjct  230   LDYREAVRLTNPSNPKLKGEVDDKYQYSFENKDIKVHGWVCNTPHVGFWVITPSYEDRNG  289

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT  1281
             GP K DLT H GP +L++F S HY+G + G+K++ GE WK VFGPVF Y+NS+ G +H T
Sbjct  290   GPTKLDLTSHAGPTSLAIFFSGHYAGPELGVKIKEGEPWKKVFGPVFFYLNSNSGNNHPT  349

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+QM +ET  WPY FP+S DYP A +RG + G+L + D    K    AK A++GL
Sbjct  350   LWEDAKRQMEDETAKWPYDFPESIDYPHANERGTIRGQLFVRDRYINKNPVYAKSAYIGL  409

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG  GSWQ ++  YQFW +TD+TG F I++VR G Y+LY+WVPG +GD+K+  DI +K
Sbjct  410   ALPGHVGSWQYETKGYQFWIQTDETGHFNITSVRPGTYNLYSWVPGIIGDYKYNYDIIVK  469

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
              G DI +G+L++ P + G T+WEIGIPDRSA EFF+P+P P L N L ++ T+KFRQYGL
Sbjct  470   QGSDINLGNLIYDPPRYGPTLWEIGIPDRSAGEFFVPDPLPALTNQLFNNTTQKFRQYGL  529

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCY  1995
             WDRY++L+   DL Y VG SD +KDWFFA VTR+    +Y  T W + F + +V  KG Y
Sbjct  530   WDRYTDLYPNKDLAYKVGVSDYSKDWFFAHVTRRTRSKNYIPTTWQISFKLPSVDPKGTY  589

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
             TLR+A+AS+T + L   +N +P +    F +   G+ NAIARHGIHGLY   +F+I G  
Sbjct  590   TLRVALASATYSHLQGRIN-NPSRTMPHFETPSIGRSNAIARHGIHGLYWLFNFKIQGLH  648

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + KGEN +YL+Q K G PFYG  YDYIRLE 
Sbjct  649   LQKGENTIYLKQIKGGNPFYGHQYDYIRLEG  679



>ref|XP_011097518.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=669

 Score =   680 bits (1754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/630 (53%), Positives = 444/630 (70%), Gaps = 8/630 (1%)
 Frame = +1

Query  388   GACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             G+  PVKL V    V +DNGI+K+ L  P G + GI Y+G++ N+LE  +K   RGYWD+
Sbjct  38    GSSPPVKLQVLDNHVEIDNGIVKLTLLKPSGMITGIGYKGIN-NVLEYRSKETQRGYWDI  96

Query  568   DWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPG  744
              W+ P+   S    +  T FKV+ + + QVEVSF KT+  S     +P+NIDKRF++L G
Sbjct  97    VWSRPEIGKSFFDTLQCTSFKVVAKTKDQVEVSFTKTWNVSLGNNVVPLNIDKRFIVLRG  156

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVL  924
              SGFY+YAI++H KG  D+++D+ R+ FKL + +F ++A++D+ Q  MPS ++R  G VL
Sbjct  157   VSGFYSYAIFEHLKGWPDLNVDEARIAFKLHQDMFHYMAISDDKQRIMPSDRDRTAGHVL  216

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
             +Y+EAV LT   NP LKG+VDDKYQY+ ++++  V+GWIS  P +GFW+IT S+EFR GG
Sbjct  217   DYREAVLLTNPGNPNLKGEVDDKYQYSCENKDNRVHGWISSNPRVGFWVITPSDEFRAGG  276

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTL  1284
             P+K DLT H GP +L++F S HY+G  +GI+LR GEAWK VFGPVFIY+NS  G+ +  L
Sbjct  277   PVKPDLTSHAGPTSLAIFFSGHYAGPSFGIRLRNGEAWKKVFGPVFIYLNS--GSTNNAL  334

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AKKQM EETK WPY FP S D+P A+QRG +SGRLL+ D    +   PAK A+VGLA
Sbjct  335   WEDAKKQMSEETKKWPYDFPMSVDFPHASQRGTISGRLLVRDRYISRELMPAKSAYVGLA  394

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG  GSWQ ++  YQFWTRTDD G F I  VRA  Y+LYA +PG +GD+KH  D+ I+P
Sbjct  395   PPGNAGSWQEETKGYQFWTRTDDKGYFTIQGVRADTYNLYASIPGIIGDYKHDIDVIIRP  454

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G  + +GDLV+ P ++G T+WEIGIPDRSAAEF+IP+PAP L N L  +  +KFRQYGLW
Sbjct  455   GSKVGIGDLVYDPPRHGPTLWEIGIPDRSAAEFYIPDPAPGLVNKLFINHKDKFRQYGLW  514

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYT  1998
             DRY++L+ T DLVYTVG SD  KDWFFA V R N   +Y  T W ++F +  V+ +G YT
Sbjct  515   DRYTDLYPTEDLVYTVGISDYRKDWFFAHVNR-NIDNNYTPTTWRILFDVRNVSRRGTYT  573

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  A + +W+N +P   +  FT++  G+DNAIARHGIHG Y   S  + G  +
Sbjct  574   LRLALASANFAEIQVWIN-NPYGHRPLFTTQRIGRDNAIARHGIHGQYRLYSINLSGFQL  632

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V G N +YL+Q++   PF G+MYDYIRLE 
Sbjct  633   VNGRNTIYLKQARGSSPFAGVMYDYIRLEG  662



>gb|EYU30916.1| hypothetical protein MIMGU_mgv1a002827mg [Erythranthe guttata]
Length=634

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/618 (51%), Positives = 444/618 (72%), Gaps = 8/618 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V +DNGI+K+ L+ P G +AG+ Y+GV  N+LE  NK   RGYWD+ W+ P +   + F 
Sbjct  13    VDIDNGIVKLTLTKPTGLMAGLAYKGVK-NILERRNKETQRGYWDIMWSRPDQHKKSRFD  71

Query  610   IL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
              + AT F+VI + E Q+EVSF  T++ S  +  +P+NID+RF++L G SGFY+Y+I++H 
Sbjct  72    TMQATRFRVIEQTEDQIEVSFSSTWRVSHGENLVPLNIDRRFIILRGVSGFYSYSIFEHE  131

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTK-TE  960
             +G   +++D+ R+ FKL + +F ++A++D+ Q  MP+  +R+ G  L+Y+EAV L+  T 
Sbjct  132   EGWPALNIDEARIAFKLDKDMFRYMAISDKRQRIMPTATDRKRGHELSYREAVLLSNSTS  191

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
             NP+LKG+VDDKYQY+ D+++  V+GWIS +PH+GFW+IT S+EFR  GP+K DLT H GP
Sbjct  192   NPRLKGEVDDKYQYSSDNKDSHVHGWISNRPHVGFWVITPSDEFRAAGPVKPDLTSHAGP  251

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAKKQMLEET  1320
              +L++F S HY+G ++GI+LR G+ WK VFGPVF+Y+NSD G +H TLWE AK++M EET
Sbjct  252   TSLAVFFSDHYAGANYGIRLRDGQPWKKVFGPVFVYVNSDSGNNHTTLWEDAKRKMSEET  311

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDS  1500
             + WPY FPKS+DYP A +RG + GRLL+ D    +   PAK A+VGLA+PG+ GSWQ+D 
Sbjct  312   EKWPYDFPKSKDYPHANERGTIRGRLLVRDRYIERDLMPAKSAYVGLARPGDVGSWQDDY  371

Query  1501  MSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFT  1680
               YQFWT+TD+TG F I  VR   Y+LYAWVPG +GDFKHK ++ ++ G +I +G++++ 
Sbjct  372   EGYQFWTKTDETGYFTIRGVRPDTYNLYAWVPGIIGDFKHKNEVIVRKGNEIHIGEIIYD  431

Query  1681  PLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDL  1857
             P +NG T+WEIGIPDR+A+EFFIP+PAP L N L  +  EKFRQYGLWDRY++L+   DL
Sbjct  432   PPRNGPTIWEIGIPDRTASEFFIPDPAPGLMNKLYIN-NEKFRQYGLWDRYTDLYPNKDL  490

Query  1858  VYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPI-ETVAKGCYTLRIAVASSTRAT  2034
             +YTVG+SD  KDWFFA VTRK  K +Y  T W + F + + +    YTLRIA+AS+  A 
Sbjct  491   IYTVGESDYRKDWFFAHVTRKINKKNYTGTTWQIQFDVRKVITTASYTLRIALASANFAE  550

Query  2035  LLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQS  2214
             + + VN  P + +  F++   GKDNA+ARHGIHG Y      +PG  +  G N +YLRQS
Sbjct  551   IQVRVNNPPAR-RPLFSTGRIGKDNAVARHGIHGRYYLYGVSLPGFQLQNGRNIIYLRQS  609

Query  2215  KAGYPFYGIMYDYIRLEA  2268
             +   PF G+MYDYIRLE 
Sbjct  610   RGLTPFVGVMYDYIRLEG  627



>ref|XP_006360390.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum tuberosum]
Length=684

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/631 (52%), Positives = 445/631 (71%), Gaps = 7/631 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
                PVKL ++   V++DNGI+KV L+NP GS+AG+ Y G+D N+LE   K  +RGYWD  
Sbjct  51    TTPPVKLLISSNYVVIDNGIVKVTLTNPTGSIAGVSYNGID-NVLETDFKDTNRGYWDTV  109

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK---SGDKTDIPINIDKRFVMLP  741
             W  P +K  T   +L T F+VI + +++VEVSF KT+    +G   D+P+NIDKRFVML 
Sbjct  110   WERPGDKDHTFDMLLGTKFRVIAQDKNKVEVSFTKTWNPSNNGTTHDLPLNIDKRFVMLR  169

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV  921
             GSSGFY+Y I++H KG   + L++ R+  KL R+LF ++A++D+IQ  MP+ ++R +G++
Sbjct  170   GSSGFYSYGIFEHLKGWPSLILEEARIAIKLKRTLFHYMAISDDIQRMMPTDEDRSDGQI  229

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L+Y+EAV+LT   NPKLKG+VDDKYQY+ +++++ V+GW+   PH+GFW+IT S E R G
Sbjct  230   LDYREAVRLTNPSNPKLKGEVDDKYQYSFENKDIKVHGWVCNTPHVGFWVITPSYEDRNG  289

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT  1281
             GP K DLT H GP +L++F S HY+G + G+K++ GE WK VFGPVF Y+NSD G +H T
Sbjct  290   GPTKLDLTSHAGPTSLAVFFSGHYAGPELGVKIKEGEPWKKVFGPVFFYLNSDSGDNHPT  349

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+QM EET  WPY FP+S DYP A  RG + G+L + D    K    AK A++GL
Sbjct  350   LWEDAKRQMEEETTKWPYDFPESIDYPHANARGTIRGQLFVRDRYINKNPVYAKSAYIGL  409

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ ++  YQFWT+T++TG F I  VR G Y+LY+WVPG +GD+K+  DI +K
Sbjct  410   ALPGDVGSWQYETKDYQFWTQTNETGHFNIIGVRPGTYNLYSWVPGIIGDYKYHYDIIVK  469

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
              G DI +G+L++ P +NG T+WEIGIPDRSA EFF+P+P P L N L ++ T+K+RQYGL
Sbjct  470   QGSDINLGNLIYDPPRNGPTLWEIGIPDRSAGEFFVPDPLPALTNQLFNNTTQKYRQYGL  529

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCY  1995
             WDRY++L+   DLVY VG SD  KDWFFA VTR+    +Y  T W + F + +V  KG Y
Sbjct  530   WDRYTDLYPNKDLVYKVGVSDYRKDWFFAHVTRRTRSKNYIPTTWQISFKLPSVDPKGTY  589

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
             TLR+A+AS+T + L   +N +P +    F +   G+ NAIARHGIHGLY   +F+I G  
Sbjct  590   TLRVALASATYSHLQGRIN-NPSRTMPHFETPSIGRSNAIARHGIHGLYWLFNFQIQGLQ  648

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +GEN +YL Q K G PFYG  YDYIRLE 
Sbjct  649   LQQGENTIYLMQIKGGNPFYGHQYDYIRLEG  679



>ref|XP_009611897.1| PREDICTED: uncharacterized protein LOC104105339, partial [Nicotiana 
tomentosiformis]
Length=1214

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/625 (52%), Positives = 446/625 (71%), Gaps = 4/625 (1%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PVKL ++   V++DNGI+++ LSNP G +AG+ Y+G+D NLLE       RGYWD  W  
Sbjct  589   PVKLHISHHHVIIDNGIVQLTLSNPTGHIAGVSYKGID-NLLEKRFPESRRGYWDTMWKL  647

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             P++K ST      T+F+VI + +++VEVSF KT+ S    D+P+NIDKRFVML GSSGFY
Sbjct  648   PEDKDSTFDTFFMTNFQVIAKDDNKVEVSFTKTWNSNADHDLPLNIDKRFVMLRGSSGFY  707

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y I++ P+G   + LD+ R+  KL ++LF ++AV+D+ Q  MP+ ++R  G+VL ++EA
Sbjct  708   SYGIFERPEGMPALRLDEARIAIKLRQNLFLYMAVSDDRQRVMPTDQDRSTGKVLGFREA  767

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             VK+T   NPKLK +VDDKYQY+ D +++ V+GWI  +PH+GFW+IT +NE+R GGP+KQD
Sbjct  768   VKITHPSNPKLKNEVDDKYQYSSDDKDIKVHGWICNRPHVGFWVITPTNEYRSGGPMKQD  827

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAK  1299
             LT H G  +L+ F S HY+G + G+ L+ GE WK VFGPVF Y+NSD G +H+TLWE AK
Sbjct  828   LTSHAGATSLATFFSGHYAGPELGVNLKEGEPWKKVFGPVFFYLNSDSGNNHRTLWEDAK  887

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
              QM EET  WPY FP+S+DYPKA +RG +SGRLL+ D         AK A++GLA PG+ 
Sbjct  888   TQMFEETAKWPYDFPESKDYPKANERGTISGRLLVDDRYISNDPIFAKSAYIGLALPGDI  947

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ ++  YQFWT+ ++TG F+I+ +  G Y+LY+WVPG +GD+K+   ++I  G DI 
Sbjct  948   GSWQKETKGYQFWTQANETGYFKITGIIPGTYNLYSWVPGVIGDYKYNQTLSITQGIDIN  1007

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSE  1839
             +G L++ P +NG T+WEIGIPDR+AAEFF+P+P PD  N +LS+ T+KFRQYGLWDRY++
Sbjct  1008  LGHLIYNPPRNGPTLWEIGIPDRTAAEFFVPDPFPDFTNRVLSNSTQKFRQYGLWDRYTD  1067

Query  1840  LH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAV  2013
             L+ K DLVY VG SD   DWF+A VTR+     Y  T W + F + TV   G YTL +A+
Sbjct  1068  LYPKEDLVYKVGVSDYRNDWFYAHVTRRTEDKEYIPTTWQISFELPTVDPMGTYTLHVAL  1127

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             AS+T + L   +N +P + +  F +   G+ NAIARHGIHGLYS  SF+IPG  +  GEN
Sbjct  1128  ASATYSHLQGRIN-NPDRRRPNFETPGIGRSNAIARHGIHGLYSLFSFQIPGYELQNGEN  1186

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +YL+Q+K G PF G+MYDY+RLE 
Sbjct  1187  IIYLKQAKGGSPFNGVMYDYLRLEG  1211


 Score =   503 bits (1296),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 254/483 (53%), Positives = 318/483 (66%), Gaps = 9/483 (2%)
 Frame = +1

Query  847   FTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMS  1026
             F ++A++DE Q  MP+ K+RE G  L+Y EAV LT   N  LKG+VDDKYQY+++ ++  
Sbjct  8     FPYMAISDERQRIMPTAKDREMGRELDYPEAVLLTSPTNSFLKGEVDDKYQYSVEDKDNR  67

Query  1027  VYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRG  1206
             V+GWISP P  GFW+IT SNEFR GGP+KQDLT H GP  LSM  S HY+GD   ++ R 
Sbjct  68    VHGWISPNPRTGFWMITPSNEFRTGGPVKQDLTSHTGPITLSMLFSTHYAGDILALRFRN  127

Query  1207  GEAWKMVFGPVFIYINSDKGTDHK--TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRG  1380
             GE WK VFGPV+IY+NS    D    TLW  AK+QML ET+ WPY FP S+D+  A QRG
Sbjct  128   GEPWKKVFGPVYIYLNSVSSDDEDILTLWTDAKEQMLIETENWPYDFPLSQDFVTADQRG  187

Query  1381  AVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAV  1560
              VSGRLLI D    K    A  A +GLA PG+ GSWQ ++  YQFWT+TD+ G F I  +
Sbjct  188   TVSGRLLISDSYVSKRFITANSAFIGLAAPGDVGSWQTENKGYQFWTQTDNEGYFLIKNI  247

Query  1561  RAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAE  1740
               G YSLYAWVPG +GD+K K  I I PG   ++  LV+ P +NG T+WEIGIP+R+AAE
Sbjct  248   IPGNYSLYAWVPGFIGDYKFKNYINITPGSRTRLQTLVYNPPRNGPTLWEIGIPERTAAE  307

Query  1741  FFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVT  1914
             FFIP P P L+N L +    EKFRQYGLWD Y++L+   DL+YTVG S+   DWFFA V 
Sbjct  308   FFIPNPQPRLQNQLYIEHYAEKFRQYGLWDSYTQLYPNDDLIYTVGSSNYQTDWFFAHVN  367

Query  1915  R----KNAKGSYEATIWTVVFPIETVAKGC-YTLRIAVASSTRATLLIWVNGDPKKDKAK  2079
             R         +Y  T W +VF ++ V K   YTL++A+AS   A L I VN         
Sbjct  368   RCTFNDEGNKTYIPTTWQIVFDLQEVEKSSNYTLQLALASINEAELQIRVNDQDADHVPH  427

Query  2080  FTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIR  2259
             FT+ L GKDN IARHGIHGLY   S  +PG L   G+N ++L+QS+   P+ G+MYDYIR
Sbjct  428   FTTGLIGKDNVIARHGIHGLYWLYSINVPGFLFATGKNVIFLKQSRGSSPWSGLMYDYIR  487

Query  2260  LEA  2268
             LE 
Sbjct  488   LEG  490



>gb|AES73960.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=648

 Score =   661 bits (1705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/631 (52%), Positives = 441/631 (70%), Gaps = 11/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L++    V+MDNGI++V LSNPEG V GI Y  +D NLLE+ N+  +RGYWDL W++P
Sbjct  6     VQLSIQDHHVVMDNGILRVTLSNPEGIVTGIQYSDID-NLLEVLNEESNRGYWDLVWSSP  64

Query  583   KEKASTS-FKIL-ATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
                 +T  F ++ AT FKVI+E E QVE+SF +T+ +  +   +P+NIDKRF+ML G SG
Sbjct  65    TSTGTTGKFDVIKATTFKVILEDEDQVELSFTRTWDASLEGKLVPLNIDKRFIMLRGCSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H +     +LD+TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYSYAIYEHLEDWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRVAPRGQALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR GGP
Sbjct  185   YPEAVLLVNPIEPELKGEVDDKYQYSCDNKDSQVHGWICMDPAVGFWLITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             +KQ+LT H GP  L++FLS HYSG+D   K + GEAWK VFGPVFIY+NS   G+D   L
Sbjct  245   VKQNLTSHVGPTTLAVFLSAHYSGEDLVPKFKAGEAWKKVFGPVFIYVNSPYDGSDPIKL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QML E + WPY+FP+S+D+PK  +RG V GRLL+ +         A CA+VGLA
Sbjct  305   WDDAKLQMLMEVQSWPYNFPESDDFPKWDERGNVCGRLLVKERYIDDDYLSANCAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PGE GSWQ +  +YQFW + DD G F IS +  G+Y+ YAWVPG +GD+K+   I+I  
Sbjct  365   TPGEVGSWQRECKNYQFWAKADDDGYFSISNIHVGDYNFYAWVPGFIGDYKYDVVISITE  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQYG+W
Sbjct  425   GCDIDIGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDKFRQYGIW  484

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYT  1998
             +RY+EL+   DL+YT+G SD  KDWFFAQVTRK    +Y+ T W + F ++ V  KG Y 
Sbjct  485   ERYAELYPDNDLIYTIGVSDFTKDWFFAQVTRKKEDNTYQGTTWQIKFNLDNVNRKGSYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T + L + VN DPK ++  F+S L GKDN+IARHGIHGLY   +  IPGSL+
Sbjct  545   LRVALASATYSELQVRVN-DPKTNRPLFSSGLIGKDNSIARHGIHGLYWLYNVNIPGSLL  603

Query  2179  VKGENK-LYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N  ++L Q++   PF  IMYDYIRLE 
Sbjct  604   VEGDNNTIFLTQARGNIPFQAIMYDYIRLEG  634



>ref|XP_006856575.1| hypothetical protein AMTR_s00046p00193590 [Amborella trichopoda]
 gb|ERN18042.1| hypothetical protein AMTR_s00046p00193590 [Amborella trichopoda]
Length=630

 Score =   657 bits (1694),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/621 (53%), Positives = 426/621 (69%), Gaps = 9/621 (1%)
 Frame = +1

Query  427   MVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF  606
             MV++DNGI++V LSNPEG V GI Y G+D NLLE+ N+  +RGYWDL W  P      +F
Sbjct  1     MVVLDNGILQVTLSNPEGIVTGIQYGGID-NLLEILNEEDNRGYWDLVWGDPGSSGRGTF  59

Query  607   KIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYDH  780
              ++  T F V++E + QVEVSF + +    K + +P+NIDKRF++L G SGFYTYAIY+H
Sbjct  60    DVIKGTKFCVVVENDDQVEVSFTRAWDPSLKGNFVPLNIDKRFILLRGCSGFYTYAIYEH  119

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTK  954
              +G  D  L +TRV FKL +  F ++A+ D  Q  MP   +R    G+ L Y EAV L  
Sbjct  120   LEGWPDFYLSETRVAFKLRKDKFQYMAIADNRQRIMPMPDDRLPPRGQKLAYPEAVLLVN  179

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
               NP LKG+VDDKYQY+ D++++  +GWI   P +GFW IT +NEFR GGPLKQ+LT H 
Sbjct  180   PINPDLKGEVDDKYQYSCDNKDIGAHGWICTDPLVGFWEITPTNEFRTGGPLKQNLTSHV  239

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQML  1311
             GP  L+MF S HY+GDD   K R GE WK VFGPVFIY+NS   G D   LWE AK+QM+
Sbjct  240   GPTTLAMFQSGHYAGDDLVPKFRNGEPWKKVFGPVFIYLNSALTGLDCSVLWEDAKEQMM  299

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSFP S DYP   +RG+VSGRLL+ D      D  A CA+VGLA PG+ GSWQ
Sbjct  300   TEVQSWPYSFPASMDYPTEEERGSVSGRLLVRDRFVSGDDLIANCAYVGLALPGDAGSWQ  359

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
              +   YQFWT+TD  G F I++VR G+Y+LYAWV G +GD+K+ A ITI  GCDI +G++
Sbjct  360   RECKGYQFWTKTDFEGCFTITSVRIGDYNLYAWVYGFIGDYKYDAKITISSGCDIDLGEI  419

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT  1851
             VF P ++G T+WEIGIPDRSAAEF++P+P P   N L  D  ++FRQYGLW+RY +L+  
Sbjct  420   VFEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYVNKLYVDHPDRFRQYGLWERYGDLYPN  479

Query  1852  -DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASST  2025
              DLVYTVG SD  KDWFFAQVTRK   G+Y+AT W + F +++V K G Y LR+A+AS+ 
Sbjct  480   EDLVYTVGASDYRKDWFFAQVTRKGENGTYQATTWQIKFNLDSVNKDGTYKLRVALASAA  539

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
              A L +  N DPK ++  FT+   G DNAIARHGIHGLY   S +IP + +V G N ++L
Sbjct  540   IAELQVRFN-DPKANRPHFTTGRIGMDNAIARHGIHGLYWLYSIDIPNTQLVVGVNTIFL  598

Query  2206  RQSKAGYPFYGIMYDYIRLEA  2268
              Q +   PF  I+YDYIRLE 
Sbjct  599   TQPRCTSPFQAILYDYIRLEG  619



>ref|XP_003603709.1| Rhamnogalacturonate lyase [Medicago truncatula]
Length=651

 Score =   656 bits (1693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/634 (52%), Positives = 441/634 (70%), Gaps = 14/634 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY---WDLDW  573
             V+L++    V+MDNGI++V LSNPEG V GI Y  +D NLLE+ N+  +RGY   WDL W
Sbjct  6     VQLSIQDHHVVMDNGILRVTLSNPEGIVTGIQYSDID-NLLEVLNEESNRGYTLYWDLVW  64

Query  574   NTPKEKASTS-FKIL-ATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPG  744
             ++P    +T  F ++ AT FKVI+E E QVE+SF +T+ +  +   +P+NIDKRF+ML G
Sbjct  65    SSPTSTGTTGKFDVIKATTFKVILEDEDQVELSFTRTWDASLEGKLVPLNIDKRFIMLRG  124

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
              SGFY+YAIY+H +     +LD+TR+ FKL +  F ++A+ D  Q  MP   +R    G+
Sbjct  125   CSGFYSYAIYEHLEDWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRVAPRGQ  184

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR 
Sbjct  185   ALAYPEAVLLVNPIEPELKGEVDDKYQYSCDNKDSQVHGWICMDPAVGFWLITPSNEFRS  244

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDH  1275
             GGP+KQ+LT H GP  L++FLS HYSG+D   K + GEAWK VFGPVFIY+NS   G+D 
Sbjct  245   GGPVKQNLTSHVGPTTLAVFLSAHYSGEDLVPKFKAGEAWKKVFGPVFIYVNSPYDGSDP  304

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
               LW+ AK QML E + WPY+FP+S+D+PK  +RG V GRLL+ +         A CA+V
Sbjct  305   IKLWDDAKLQMLMEVQSWPYNFPESDDFPKWDERGNVCGRLLVKERYIDDDYLSANCAYV  364

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PGE GSWQ +  +YQFW + DD G F IS +  G+Y+ YAWVPG +GD+K+   I+
Sbjct  365   GLATPGEVGSWQRECKNYQFWAKADDDGYFSISNIHVGDYNFYAWVPGFIGDYKYDVVIS  424

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  GCDI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQY
Sbjct  425   ITEGCDIDIGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDKFRQY  484

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KG  1989
             G+W+RY+EL+   DL+YT+G SD  KDWFFAQVTRK    +Y+ T W + F ++ V  KG
Sbjct  485   GIWERYAELYPDNDLIYTIGVSDFTKDWFFAQVTRKKEDNTYQGTTWQIKFNLDNVNRKG  544

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y LR+A+AS+T + L + VN DPK ++  F+S L GKDN+IARHGIHGLY   +  IPG
Sbjct  545   SYKLRVALASATYSELQVRVN-DPKTNRPLFSSGLIGKDNSIARHGIHGLYWLYNVNIPG  603

Query  2170  SLIVKGENK-LYLRQSKAGYPFYGIMYDYIRLEA  2268
             SL+V+G+N  ++L Q++   PF  IMYDYIRLE 
Sbjct  604   SLLVEGDNNTIFLTQARGNIPFQAIMYDYIRLEG  637



>ref|XP_006346800.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum tuberosum]
Length=683

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/625 (50%), Positives = 437/625 (70%), Gaps = 4/625 (1%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV L ++ + V++DNGI+++ L+NP G ++GI Y  +D NLLE S+    RGYWD+ W  
Sbjct  58    PVTLHISNQYVVIDNGIVQLTLTNPTGHISGISYNEID-NLLEKSDLEVRRGYWDVMWKL  116

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             PK+   T       +FKVI + +++VEVSF KT+ S    D+P+NIDKRFVML G+SGFY
Sbjct  117   PKDHGGTFDTFFMKNFKVISQDDNKVEVSFTKTWSSSADHDLPLNIDKRFVMLRGNSGFY  176

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y  ++H +G   + +D+ R+  KLS++LF ++AV+D+ Q  MP+ ++   G+VL YKEA
Sbjct  177   SYGKFEHSEGMPALRVDEARIAIKLSQNLFHYMAVSDDRQMVMPTNQDISHGKVLGYKEA  236

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
              ++T   N     +VDDKYQ++ D++++ V+GWI   PH+GFW+IT +NE+  GGP+KQD
Sbjct  237   TQITHPSNSPFNYEVDDKYQFSSDNKDIKVHGWICNNPHVGFWVITPTNEYTCGGPMKQD  296

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAK  1299
             LT H GP +L+ F S HY+G   G+ L+ GE+WK VFGPVF Y+NSD G +H+TLWE AK
Sbjct  297   LTSHSGPTSLATFFSGHYTGPQLGVDLQDGESWKKVFGPVFFYLNSDSGNNHQTLWEDAK  356

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
             +QM EETK WPY FP+S++Y KA +R  VSGRLL++D    +    AK A+VGLA PG+ 
Sbjct  357   RQMFEETKKWPYDFPQSKEYLKANERATVSGRLLVNDGYISEDPFYAKSAYVGLALPGDV  416

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ ++  YQFWT+TD++G F+I+ V  G Y+LY+WV G +GD+K+  + TI  G +  
Sbjct  417   GSWQTETKGYQFWTQTDESGYFKINGVIPGTYNLYSWVLGVIGDYKYNLNFTITQGSEYN  476

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSE  1839
             +GDLV+ P +NG T+WEIGIPDR+AAEFF+P+P P L N++  + T +FRQYGLWDRY++
Sbjct  477   LGDLVYNPPRNGPTLWEIGIPDRTAAEFFVPDPLPSLTNHVFINTTHRFRQYGLWDRYTD  536

Query  1840  LHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAV  2013
             L+   DLVY VG SD  KDWF+A VTR+     Y  T W ++F +  V   G YTL +A+
Sbjct  537   LYPNEDLVYRVGVSDYTKDWFYAHVTRRTVHKQYIPTTWQILFDLSNVDPSGTYTLHMAL  596

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             AS+T + LL  +N +P + +  F +   G+ NAIARHGIH LYS  +FEIPG  +  GEN
Sbjct  597   ASATSSHLLGRIN-NPIRPRPTFQTPGIGQSNAIARHGIHALYSLFTFEIPGYNLQIGEN  655

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +YL Q++ G PF G+MYDYIRLE 
Sbjct  656   IIYLTQARGGSPFNGVMYDYIRLEG  680



>ref|XP_003526529.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Glycine 
max]
Length=643

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/630 (53%), Positives = 439/630 (70%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+LT+    V+M+NGI+KV LSNP G V GI Y  +D NLLE+ N   +RGYWDL W++P
Sbjct  6     VQLTIQDNHVVMENGILKVTLSNPGGIVTGIQYNDID-NLLEVLNDESNRGYWDLVWSSP  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 ++ +F ++  T FKV++E E QVE+SF +T+  S +   +P+NIDKRFVML GSSG
Sbjct  65    TSTGTSGTFDVIKGTTFKVVVENEDQVELSFTRTWDVSREGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H +     +LD+TR+ FKL +  F ++A+ D  Q  MP   +R   +G+ L 
Sbjct  125   FYSYAIYEHLEEWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRLPPKGKALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR GGP
Sbjct  185   YPEAVLLVNPIEPELKGEVDDKYQYSCDNKDSQVHGWICMDPAVGFWLITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             LKQ+LT H GP  L++FLS HYSG+D   K   GEAWK VFGPVFIY+NS   GTD   L
Sbjct  245   LKQNLTSHVGPTTLAVFLSAHYSGEDLVPKFNSGEAWKKVFGPVFIYLNSPYDGTDPLKL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK QM  E + WPYSFP+SED+ K   RG VSGRLL+ +         AK A+VGLA
Sbjct  305   WEDAKLQMSVEVQSWPYSFPESEDFAKWDDRGNVSGRLLVRERYINDDYVSAKGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +  +YQFW R DD G F +S +RAG+Y++YAWVPG +GD+K+   I I  
Sbjct  365   PPGDVGSWQRECKNYQFWARADDDGYFSVSNIRAGDYNVYAWVPGFIGDYKYDVVINITE  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQYGLW
Sbjct  425   GCDIDLGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDKFRQYGLW  484

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DL+YT+G SD  KDWFFAQVTRK    +Y+ T W + F +++V K   Y 
Sbjct  485   ERYAELYPDKDLIYTIGVSDYTKDWFFAQVTRKKDDNTYQGTTWQIKFKLDSVNKSSSYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T + L + VN +PK  +  F+S L G+DN+IARHGIHGLY   +  IPG+ +
Sbjct  545   LRVALASATLSELQVRVN-NPKAPRPLFSSGLIGRDNSIARHGIHGLYWLYNVGIPGTQL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N ++L Q++   PF  IMYDYIRLEA
Sbjct  604   VEGDNTIFLTQTRGNGPFQAIMYDYIRLEA  633



>ref|XP_004501055.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Cicer 
arietinum]
Length=646

 Score =   653 bits (1685),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/632 (53%), Positives = 442/632 (70%), Gaps = 12/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L++    V+MDNGI++V LSNPEG V GI Y G+D NLLE+ N   +RGYWDL W++P
Sbjct  6     VQLSIQDHHVVMDNGILRVTLSNPEGIVTGIQYNGID-NLLEVLNDESNRGYWDLVWSSP  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T +F ++  + FKVI+E E QVE+SF +T+  S +   +P+NIDKRF+ML G SG
Sbjct  65    TSTGTTGNFDVIKGSTFKVILEDEDQVELSFTRTWDASMEGKLVPLNIDKRFIMLSGCSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAIY+H +     +LD+TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYAIYEHLEDWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRVPPRGQALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWIS  P +GFW+IT SNEFR GGP
Sbjct  185   YPEAVLLVNPIEPELKGEVDDKYQYSCDNKDSQVHGWISMDPAVGFWLITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             +KQ+LT H GP  L++FLS HYSG D   K + GEAWK VFGPVFIY+NS   G D   L
Sbjct  245   VKQNLTSHVGPTTLAVFLSAHYSGQDLVPKFKAGEAWKKVFGPVFIYLNSPYDGGDPIKL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTD-TPAKCAHVGL  1461
             W+ AK QML E + WPYSFP+S+D+PK  +RG VSGRLLI + C    D   AK A+VGL
Sbjct  305   WDDAKLQMLMEVQSWPYSFPESDDFPKWDERGYVSGRLLIKERCIDDDDYVSAKGAYVGL  364

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ +  +YQFW   D  G F IS +  G+Y++YAWVPG++GD+K+   I+I 
Sbjct  365   APPGDVGSWQRECKNYQFWATADYDGYFSISNIHVGDYNVYAWVPGYIGDYKYDVVISIT  424

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
              GCDI +GDLV+ PL++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQYG+
Sbjct  425   EGCDIDIGDLVYEPLRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDKFRQYGI  484

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCY  1995
             W+RY+EL+   DL+YTVG SD  KDWFFAQVTRK    +Y+ T W + F +++V +   Y
Sbjct  485   WERYAELYPDKDLIYTVGVSDYTKDWFFAQVTRKKDDNTYQGTTWQIKFKLDSVNRSSTY  544

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+T + L + VN DPK ++  F+S L GKDN+IARHGIHGL    S  I G+L
Sbjct  545   KLRVALASATYSELQVRVN-DPKANRPLFSSGLIGKDNSIARHGIHGLNWLYSVGISGNL  603

Query  2176  IVKGE-NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+G+ N ++L Q++   PF  IMYDYIRLE 
Sbjct  604   LVEGDYNTIFLTQARGNGPFQAIMYDYIRLEG  635



>ref|XP_010935282.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
 ref|XP_010935283.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
Length=655

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/629 (53%), Positives = 439/629 (70%), Gaps = 10/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V    V++DNGI+++ LSNP+G V G+ Y GVD NLLE+ NK  +RGYWDL WN  
Sbjct  26    VRLDVQDGHVIIDNGILQLTLSNPDGIVTGVRYNGVD-NLLEVLNKADNRGYWDLVWNG-  83

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K+     I  TDF+++ + E QVEVSF +T+  S + T +P+NIDKRFV+L G SGFY
Sbjct  84    TGKSGIFDVIKGTDFRILFQDEEQVEVSFTRTWTPSLEGTLVPLNIDKRFVVLRGCSGFY  143

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--LNYK  933
             TYAIY+H +G  D D+ +TR+ FKL +  F ++A++D+ Q  MP   +R  G    L Y 
Sbjct  144   TYAIYEHLEGWPDFDIGETRIAFKLRKDKFYYMAISDDRQRIMPMPDDRMPGRCQQLAYP  203

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV LT   NP LKG+VDDKYQY+ + Q++ V+GWIS  P +GFW IT S+EFR GGP+K
Sbjct  204   EAVLLTNPINPDLKGEVDDKYQYSCEDQDIKVHGWISFDPPVGFWQITPSDEFRAGGPVK  263

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWE  1290
             Q+LT H GP  LS+FLS HY+G D   K R GE WK VFGPVFIY+NS   G+D K LWE
Sbjct  264   QNLTSHVGPTTLSVFLSAHYAGQDVVPKFRNGEYWKKVFGPVFIYLNSSWDGSDPKMLWE  323

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM  E + WPY FP SED+ K  QRG+VSG+LL+ D      D  A  A+VGLA P
Sbjct  324   DAKIQMQVEVESWPYDFPVSEDFQKCLQRGSVSGKLLVRDRYIDGDDIYANGAYVGLALP  383

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ +   YQFWTR D+ G F I+ VR G+Y+LYAWVPG +GD+ + A IT+  G 
Sbjct  384   GEAGSWQREFKGYQFWTRADENGSFTITNVRTGDYNLYAWVPGFIGDYIYDAAITVTSGN  443

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWD  1827
             +I +GDLVF P ++G T+W+IGIPDRSAAEF+IP+P P   N L ++D  ++FRQYGLW+
Sbjct  444   NIDLGDLVFEPPRDGVTLWDIGIPDRSAAEFYIPDPNPTYVNRLYINDPADRFRQYGLWE  503

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+  TDLVYT+G SD  KDWFFAQVTRK  + SY+ T W + F +++V   G Y L
Sbjct  504   RYADLYPDTDLVYTIGDSDYKKDWFFAQVTRKTDQNSYQPTTWQIKFHLDSVYPSGSYKL  563

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L +  N D K + A FT+ L G+DNAIARHGIHGLY   +  +  + +V
Sbjct  564   RVALASATLSELQVRFN-DSKANPAHFTTGLIGRDNAIARHGIHGLYWLYNINVRSTWLV  622

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L QS++  PF GIMYDYIR+E 
Sbjct  623   QGDNTIFLTQSRSQGPFQGIMYDYIRMEG  651



>ref|XP_009366370.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X4 [Pyrus 
x bretschneideri]
Length=638

 Score =   647 bits (1669),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/628 (53%), Positives = 427/628 (68%), Gaps = 10/628 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V GI Y G+D NLLE  NK  +RGYWDL W+ P
Sbjct  6     VQLHIQGPHVMMDNGILQVTLSNPDGIVTGIRYNGID-NLLEPLNKETNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F+VI+E E QVE+SF KT+ +S +   +P+NIDKRFVML GSSGFY
Sbjct  65    GSKGIFDV-IKGTTFEVIVENEEQVELSFSKTWDRSLEGKYVPLNIDKRFVMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H K   D D+ +TR+ FKL +  F ++ V+D  Q  MP   +R  G  + L Y 
Sbjct  124   SYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMTVSDNRQRYMPLPDDRSSGRCQALAYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   +  +L G+VDDKYQY+ D+++  V+GWI   P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLVDPKMKELAGEVDDKYQYSCDNKDNKVHGWICTNPPVGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q+LT H GP  L+MFLS HY+G D   K RGG+ WK VFGPVFIY+NS    D    LWE
Sbjct  244   QNLTSHVGPTTLAMFLSSHYAGQDLVPKFRGGKPWKKVFGPVFIYLNSSTIKDDPFWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D    +  TPA  A+VGLA P
Sbjct  304   DAKIQMMTEVQSWPYSFPASEDFQKSGQRGNVSGRLLVLDRYISEEYTPANGAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR DD G F I+ VR G Y+LYAWVPG +GD+++ A I I  G 
Sbjct  364   GDAGSWQRECKDYQFWTRADDRGYFSINNVRTGTYNLYAWVPGFIGDYRYDAVINITSGS  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I++GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  D  ++FRQYGLW+R
Sbjct  424   FIEMGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPDPKYINRLFIDHPDRFRQYGLWNR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVY VG SD AKDWFFAQV RK   G +E T W + F ++ V + G Y LR
Sbjct  484   YAELYPDEDLVYIVGVSDYAKDWFFAQVPRKTDNG-HEGTTWQIKFELKNVDRNGSYKLR  542

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L + +N DP   +  FTS L G+DN++ARHGIHG+Y   +  +PG+ +V+
Sbjct  543   VAIASATLAELQVRIN-DPDSRRPLFTSGLIGRDNSVARHGIHGIYWLYNISVPGAQLVE  601

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G N  + RQ +   PF GIMYDYIR E 
Sbjct  602   GNNTFFFRQPRCTSPFQGIMYDYIRFEG  629



>gb|KDP41508.1| hypothetical protein JCGZ_15915 [Jatropha curcas]
Length=640

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/635 (51%), Positives = 442/635 (70%), Gaps = 11/635 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + VKL + +  V+M+NGI++V +S PEG V GI Y G+  NLLEL N   +RGYWDL 
Sbjct  2     SSQRVKLHIQERHVVMENGILQVTISKPEGIVTGIRYNGIS-NLLELKNDESNRGYWDLV  60

Query  571   WNTPKEKAST--SFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDI-PINIDKRFVML  738
             W+      +T  S+ I  T+F+VI+E E QVE+SF + +  S D+ ++ P+N+DKRF+ML
Sbjct  61    WSKEGSTGTTGISYVIKGTNFRVIVENEEQVELSFTRMWDPSVDEGNLAPLNLDKRFIML  120

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--E  912
               SSGFY+YAI++H K     +L QTR+VFKL +  F ++ V D  Q  MP   +R    
Sbjct  121   RNSSGFYSYAIFEHLKEWPAFNLPQTRIVFKLRKDKFHYMVVADNRQRYMPLPDDRSPPR  180

Query  913   GEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
             GE L++ EAV L     P+ KG+VDDKYQY+ D++N++V+GWI  +P +GFW IT SNEF
Sbjct  181   GEPLDFPEAVLLVNPVEPEFKGEVDDKYQYSCDNRNLNVHGWICFEPPVGFWQITPSNEF  240

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L+MFLS HY+G+D  +KL+  E WK VFGPVFIY+NS    +
Sbjct  241   RSGGPLKQNLTSHVGPVNLAMFLSAHYAGEDMVLKLKPDEPWKKVFGPVFIYLNSLLDES  300

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D + LWE AK+QML E + WPYSFP SED+P + QRG++SGRLL+ D  A   D PA  A
Sbjct  301   DPRLLWEDAKEQMLIEVQSWPYSFPTSEDFPSSDQRGSLSGRLLVRDRYASDYDMPANGA  360

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG+ GSWQ ++  YQFWT+ D  G F I+ +R G+Y+LY+WV G +GD+++ + 
Sbjct  361   YVGLAPPGDVGSWQTENKGYQFWTQADADGYFSINDIRTGDYNLYSWVTGFIGDYRYDSV  420

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             ITI  GCDI +G++V+ P ++G T+WEIGIPDRSAAEF+IP+P P+  N L  +  ++FR
Sbjct  421   ITITEGCDIDLGNIVYEPPRDGPTLWEIGIPDRSAAEFYIPDPNPNFINSLYVNHPDRFR  480

Query  1810  QYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIE-TVA  1983
             QYGLW+RY++L+   DL+YTVG SD +KDWFFA VTRK     Y+AT W + F ++ T  
Sbjct  481   QYGLWERYTDLYPDEDLIYTVGTSDFSKDWFFAHVTRKIDDNKYQATTWQIKFKLDNTNE  540

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
              G Y LR+A+A++  A L + +N DP  +   FT+   G DN IARHGIHGLY   S E+
Sbjct  541   NGIYKLRLALATANVAELQVRIN-DPGTNPPLFTTGEIGHDNTIARHGIHGLYRLYSIEV  599

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+L+V+G+N ++L Q+ A  P  GIMYDYIRLE 
Sbjct  600   PGALLVEGDNTIFLTQALATGPLQGIMYDYIRLEG  634



>ref|XP_011074280.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=635

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/631 (51%), Positives = 437/631 (69%), Gaps = 11/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             ++L V    V+MDNG+++V +S P+G V GI Y  +D NLLE++N   +RGYWDL W+ P
Sbjct  6     LRLQVRDHHVVMDNGVLRVTISKPDGIVTGIKYNHID-NLLEIANDESNRGYWDLVWSQP  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 +  +F+++  T+FKV+ E E QVE+SF  T+ +  +  + P+NIDKRFVML GSSG
Sbjct  65    GSTGTAGTFEVIHGTNFKVVTENEEQVELSFSTTWNASLQGKLAPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAIY+H +G    +LD+TR+VFKL +  F ++AV D  Q  MP   +R    G+ L+
Sbjct  125   FYTYAIYEHLEGWPGFNLDETRIVFKLRKDKFHYMAVADNRQRYMPLPDDRLPGRGQPLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPK-PHLGFWIITASNEFRLGG  1104
             Y EAV L     P+  G+VDDKYQY+ +++++ V+GWI    P +GFW I  SNEF+ GG
Sbjct  185   YPEAVLLVNPVEPEFTGEVDDKYQYSCENKDVKVHGWICTDIPAVGFWQIMPSNEFQTGG  244

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKT  1281
             P KQDLT H GP  L+MF+S HY G+D  +K   GEAWK VFGP+F+Y+NS   G+D   
Sbjct  245   PSKQDLTSHVGPTTLAMFVSAHYGGEDVVLKFEEGEAWKKVFGPIFMYLNSVTNGSDPFL  304

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+Q  E+   WPYSFP SED+P +A+RG VSGRLL+ D C    +     A++GL
Sbjct  305   LWEDAKEQATEQVVRWPYSFPASEDFPTSAERGNVSGRLLVRDRCVSDEEMVGNGAYIGL  364

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PGE GSWQ     YQFW + D+ G F I+ +R G+Y+LYAWVPG +GD+K +  I+I 
Sbjct  365   APPGEIGSWQTQGKGYQFWRKADEKGYFTINNIRTGDYNLYAWVPGFIGDYKLEEVISIT  424

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC+I +G+LV+ P ++G T+WEIGIPDRSA EF+IP+P     N L  +  ++FRQYGL
Sbjct  425   PGCNIDMGELVYEPPRDGPTLWEIGIPDRSAREFYIPDPDARYINKLYVNHPDRFRQYGL  484

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCY  1995
             W+RYSEL+ K DLVYTVG+S+ + DWFFAQVTRK    +Y+AT W + F + T+   G Y
Sbjct  485   WERYSELYPKGDLVYTVGESNYSTDWFFAQVTRKKDDNTYQATTWQIRFRLATIKPTGTY  544

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+ +A L + +N +P +D A FTS L GKDNAIARHGIHGLY   + E+P + 
Sbjct  545   KLRLALASAAQAELQVRIN-NPDQDPALFTSGLIGKDNAIARHGIHGLYWLFNVELPAAS  603

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+G+N +YL Q+    PF GIMYDYIRLE+
Sbjct  604   LVEGDNTIYLTQANTTSPFQGIMYDYIRLES  634



>ref|XP_009366369.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Pyrus 
x bretschneideri]
Length=639

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/629 (52%), Positives = 428/629 (68%), Gaps = 9/629 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V    V+MDNGI++V LS PEG V GI Y G+D NLLE+ N+  +RGYWDL WN+ 
Sbjct  6     VELLVQDHHVMMDNGILQVTLSKPEGIVTGIQYNGID-NLLEIRNEESNRGYWDLVWNSA  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
                 +  F ++  T F +IME E QVE+SF +T+  S +   +P+NIDKRF+ML GSSGF
Sbjct  65    ATGTTGIFDVIKGTSFTIIMETEEQVELSFTRTWDPSQEGKLVPLNIDKRFIMLRGSSGF  124

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNY  930
             Y+YAIY+H K     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y
Sbjct  125   YSYAIYEHLKDWPAFELGETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGQALAY  184

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV L     P+LKG+VDDKYQY+ D+++  V+GWI  +P +GFW IT S EFR GGP 
Sbjct  185   AEAVLLVNPVEPELKGEVDDKYQYSCDNKDNKVHGWICTEPPVGFWQITPSTEFRSGGPF  244

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP  L+MFLS HY+G+D   K   GE WK VFGPVF+Y+NS   G D  +LW
Sbjct  245   KQNLTSHVGPTTLAMFLSAHYAGEDLVPKFAAGEEWKKVFGPVFMYVNSSYDGNDPLSLW  304

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             E AK QM+ E + WPYSFP SE++PK+ +RG V GRLLI D            A+VGLA 
Sbjct  305   EDAKSQMMMEVQCWPYSFPASEEFPKSHERGNVRGRLLIQDRYVSNDYISVNGAYVGLAP  364

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG+ GSWQ +   YQFWT TD+ G F I+ +R G+Y+L A VPG +GD+ +   +TI  G
Sbjct  365   PGDIGSWQRECKDYQFWTTTDEDGYFCINGIRTGDYNLNASVPGFIGDYHYDVVMTITSG  424

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             CDI +GDLV+ P ++G T+WEIGIPDRSAAEF++PEP P   N L  +  ++FRQYGLW+
Sbjct  425   CDIDMGDLVYEPPRDGHTLWEIGIPDRSAAEFYVPEPNPKYINKLFVNHPDRFRQYGLWE  484

Query  1828  RYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RYSEL+   DLVYTVG SD +KDWFFAQVTRK     Y+ T W + F ++ V + G Y L
Sbjct  485   RYSELYSDQDLVYTVGVSDYSKDWFFAQVTRKKDDNKYQGTTWQIKFNLDNVDQTGSYKL  544

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L + VN DPK ++  FTS + G+DN+IARHGIHGLY   + ++P S +V
Sbjct  545   RVALASATFSELQVRVN-DPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLV  603

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N +YL Q ++  PF GIMYDY+R E 
Sbjct  604   EGDNIIYLTQPRSTGPFQGIMYDYLRFEG  632



>ref|XP_010935280.1| PREDICTED: probable rhamnogalacturonate lyase B [Elaeis guineensis]
Length=666

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/629 (53%), Positives = 436/629 (69%), Gaps = 10/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L V +  V++DNGI ++ LSNP+G V G+ Y GVD NLLE+ N   +RGYWDL WN  
Sbjct  26    VTLDVPEGHVIIDNGIFQLTLSNPDGIVTGVRYNGVD-NLLEVLNNEDNRGYWDLVWNGS  84

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                      I  TDF+++++ E QVEVSF +T+  S + T +P+NIDKRFV+L G SGFY
Sbjct  85    GRTGVFDV-IKGTDFRILLQDEEQVEVSFTRTWTPSLEGTLVPLNIDKRFVVLRGCSGFY  143

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             TYAIY+H +G  D D+ +TR+ FKL +  F ++A++D+ Q  MP   +R  E  + L Y 
Sbjct  144   TYAIYEHLEGWPDFDIGETRIAFKLRKDKFHYMAISDDRQRIMPMPDDRMPERCQQLAYP  203

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV LT   NP LKG+VDDKYQY+ + Q++ V+GWIS  P +GFW IT S+EFR GGP+K
Sbjct  204   EAVLLTNPINPDLKGEVDDKYQYSCEDQDIKVHGWISFDPPIGFWQITPSDEFRGGGPVK  263

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWE  1290
             QDLT H GP  L+MFLS HYSG D   K R GE WK +FGPVFIY+NS   G+D K LWE
Sbjct  264   QDLTSHVGPTTLAMFLSAHYSGQDVVPKFRNGEYWKKIFGPVFIYLNSSWDGSDPKMLWE  323

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM  E + WPY FP SED+ K  QRG+VSG LL+ D      D  A  A+VGLA P
Sbjct  324   DAKIQMQMEIESWPYDFPLSEDFQKCWQRGSVSGILLVRDRYIDGDDIYANGAYVGLALP  383

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ +   YQFWTR D+ G F I+ VR G+Y+LYAWVPG +GD+K+ A ITI  G 
Sbjct  384   GEEGSWQREFKGYQFWTRADENGSFTITNVRTGDYNLYAWVPGFIGDYKYDAAITITSGN  443

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWD  1827
             +I +GDLVF P ++G T+WEIGIPDRSAAEF+IPE  P   N L ++D  ++FRQYGLW+
Sbjct  444   NIDLGDLVFEPPRDGVTLWEIGIPDRSAAEFYIPESNPKYVNRLYVNDLADRFRQYGLWE  503

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+   DLVY +G SD  KDWFFAQV RK  + SY+ T W ++F +++V   G Y L
Sbjct  504   RYADLYPDNDLVYIIGDSDYKKDWFFAQVNRKTDQNSYQPTTWQIMFHLDSVDPSGSYKL  563

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L +  N D + + A FT+ L G+DNAIARHGIHGLY   + ++  + +V
Sbjct  564   RVALASATLSELQVRFN-DSEANPAHFTTGLIGRDNAIARHGIHGLYWLYNIDVRSTWLV  622

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L QS++  PF+GIMYDYIR+E 
Sbjct  623   EGDNTIFLTQSRSLSPFHGIMYDYIRMEG  651



>ref|XP_007224652.1| hypothetical protein PRUPE_ppa026307mg [Prunus persica]
 gb|EMJ25851.1| hypothetical protein PRUPE_ppa026307mg [Prunus persica]
Length=642

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/629 (52%), Positives = 433/629 (69%), Gaps = 9/629 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI + G+D NLLE+ N+  +RGYWDL W++ 
Sbjct  6     VKLLIQDRHVMMDNGIVQVTLSNPDGIVTGIRFNGID-NLLEIRNEEINRGYWDLVWSSA  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 +  F ++  T F+VIME E QVE+SF + +    +   +P+NIDKRF+ML GSSGF
Sbjct  65    STGTTGIFDVIKGTSFRVIMESEEQVELSFTRAWDPSQQGKLVPLNIDKRFIMLRGSSGF  124

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             Y+YAIY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L +
Sbjct  125   YSYAIYEHLREWPGFELGETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRLPSRGQALAF  184

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV L     P+ KG+VDDKYQY+ D+++  V+GWI  +P +GFW IT SNEFR GGP 
Sbjct  185   PEAVLLVNPVEPEFKGEVDDKYQYSCDNKDNKVHGWICTEPPVGFWQITPSNEFRSGGPF  244

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP  L+MFLS HYSG+D   K   GE WK VFGPVF+Y NS  +G D  +LW
Sbjct  245   KQNLTSHVGPTTLAMFLSAHYSGEDLVPKFAAGEQWKKVFGPVFMYANSAYEGDDPLSLW  304

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             E AK QM+ E + WPYSFP SED+PK+ QRG+VSGRLLI D         A+ A+VGLA 
Sbjct  305   EDAKSQMMMEVQCWPYSFPASEDFPKSHQRGSVSGRLLIRDRYISDDYIFAQGAYVGLAP  364

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
              G+ GSWQ +  +YQFWT  D+ G F I  +R G+Y+L A VPG +GD++++  +TI  G
Sbjct  365   QGDVGSWQRECKNYQFWTTADENGYFLIDGIRTGDYNLNATVPGFIGDYQYEVVLTITSG  424

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C++++GDLV+ P +NG T+WEIGIPDRSAAEF++P+P P   N L  D  ++FRQYGLW+
Sbjct  425   CEVEMGDLVYEPPRNGPTLWEIGIPDRSAAEFYVPDPNPKYINKLFVDHPDRFRQYGLWE  484

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RYS+L+ + DLVYTVG SD +KDWFFAQV RK     Y+ T W + F ++TV + G Y L
Sbjct  485   RYSDLYPEKDLVYTVGVSDYSKDWFFAQVNRKKDDNKYQGTTWQIKFNLDTVDQSGPYKL  544

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L + VN DPK     F+S + GKDN+IARHGIHGLY   + +IP S I+
Sbjct  545   RLAIASATLSELQVRVN-DPKAYPPLFSSGMIGKDNSIARHGIHGLYWLFNVDIPSSRII  603

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N +YL Q ++  PF GIMYDYIRLE 
Sbjct  604   EGDNIIYLTQPRSTSPFQGIMYDYIRLEG  632



>ref|XP_010244706.1| PREDICTED: probable rhamnogalacturonate lyase B [Nelumbo nucifera]
Length=637

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/630 (52%), Positives = 435/630 (69%), Gaps = 14/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNPEG V GI Y G+D NLLE+ N+  +RGYWD+ WN  
Sbjct  6     VQLQIQDRHVVMDNGILQVTLSNPEGIVTGIRYNGID-NLLEVHNEEDNRGYWDVVWN--  62

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSG--DKTDIPINIDKRFVMLPGSSG  753
                 S  F ++  T F+V+ + E QVE+SF +T+     DK  IP+NIDKRF+ML G SG
Sbjct  63    GANVSGKFDVIKGTSFRVVKQDEDQVELSFTRTWDPSLQDKI-IPLNIDKRFIMLRGCSG  121

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--LN  927
             FY+YAIY+H K   +  L +TR+ FKL +  F ++A+ D  Q  MP   +R  G    L 
Sbjct  122   FYSYAIYEHLKEWPEFSLGETRIAFKLRKDKFHYMAMADNRQRFMPHPDDRLRGRCQPLA  181

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV LT    P+LKG+VDDKYQY+ + ++  V+GWI   P +GFW IT S+EFR GGP
Sbjct  182   YPEAVLLTNPIEPQLKGEVDDKYQYSCEDKDNKVHGWICFDPPVGFWQITPSDEFRTGGP  241

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             LKQ+LT H GP  L++FLS HY+G D   K + GEAWK VFGPVFIY+NS   G D  +L
Sbjct  242   LKQNLTSHVGPTTLAVFLSSHYTGQDLVPKFQQGEAWKKVFGPVFIYLNSVFNGEDPLSL  301

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QML E + WPYSFP SED+P + QRG V GRL + D  AG+ D  A+ A+VGLA
Sbjct  302   WDDAKTQMLMEVQSWPYSFPTSEDFPSSGQRGTVRGRLFVRDRYAGEDDIVAESAYVGLA  361

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PGE GSWQ +   YQFWTR    G F I  VR G+Y+LYAWVPG +GD+K+   +TI  
Sbjct  362   LPGEVGSWQRECKGYQFWTRAGADGYFSIRDVREGDYNLYAWVPGFIGDYKYDVVLTITS  421

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G DI +GDLV+ P ++G T+WEIGIPDRSAAEF++PEP P+  N L  +  +KFRQYGLW
Sbjct  422   GSDIDLGDLVYKPPRDGPTLWEIGIPDRSAAEFYVPEPNPNYVNKLYVNHPDKFRQYGLW  481

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY EL+ + DL++ VG +D  KDWFFAQVTRK   G Y+AT W ++F +++V++ G Y 
Sbjct  482   ERYVELYPEGDLIFRVGVNDYRKDWFFAQVTRKKEDG-YQATTWQIIFKLDSVSQGGTYK  540

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             +R+A+AS+T + L +  N DPK +   FT+ L GKDN+IARHGIHGLY   + ++P + +
Sbjct  541   MRVALASATFSELQVRFN-DPKANPPHFTTGLIGKDNSIARHGIHGLYRLYNVDVPSTRL  599

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N ++L QS++  PF G+MYDYIRLE 
Sbjct  600   VEGDNTIFLTQSRSSSPFQGLMYDYIRLEG  629



>gb|KDP29802.1| hypothetical protein JCGZ_18737 [Jatropha curcas]
Length=667

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/628 (51%), Positives = 437/628 (70%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTK-EMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             V+L VTK + V++DNGI++V LS P G V GI Y+G+D N+LE+ N+  +RGYWD+ WN 
Sbjct  39    VQLQVTKHQRVVIDNGIVRVTLSIPGGDVTGIKYKGID-NVLEIDNEEDNRGYWDVVWNK  97

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
             P ++     ++ AT+F V+ME E QVEVSF K ++ S  ++ +P+N+DKR+++  GSSG 
Sbjct  98    PGDRIIYD-RLQATNFSVVMENEDQVEVSFSKRWRPSMGESTVPLNVDKRYILRRGSSGL  156

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKE  936
             Y Y I +  +G  DVD+DQ RVVFKL +  F  +AV+D+ Q  MP  ++R  G  L Y E
Sbjct  157   YLYTILEREEGWPDVDMDQIRVVFKLQKDKFHFMAVSDDRQRIMPMPEDRIRGSPLAYPE  216

Query  937   AVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQ  1116
             AV LT   NP L+G+VDDKYQY+ + ++  V+GWIS  P +GFW+IT ++EFR+GGP+KQ
Sbjct  217   AVLLTNPTNPDLRGEVDDKYQYSCEDKDNKVHGWISDDPPVGFWMITPTDEFRVGGPIKQ  276

Query  1117  DLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEG  1293
             DLT H GP  L+MF S HY+G D   + R GEAWK V GPVF+Y+NS     D +TLW+ 
Sbjct  277   DLTSHVGPTVLNMFTSTHYAGKDLNTQYRNGEAWKKVLGPVFVYLNSISPSEDRETLWQD  336

Query  1294  AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPG  1473
             AK+QM  E K WPY FP+SED+P + QRG +SG+L++ D    K    A  A+VGLA PG
Sbjct  337   AKQQMSTEVKSWPYDFPQSEDFPYSDQRGIISGQLIVRDRYINKRLMYASSAYVGLAAPG  396

Query  1474  EPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCD  1653
             + GSWQ ++  YQFWT+    G F I  VRAG YSLYAWVPG +GD+K+  +ITI+PG  
Sbjct  397   DLGSWQMEAKGYQFWTQASRKGNFLIKNVRAGNYSLYAWVPGIMGDYKYDFNITIQPGSS  456

Query  1654  IKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR-TEKFRQYGLWDR  1830
             IK+G L+  P +NG T+WEIGIPDR A+EF++PE  P L N L +   T++FRQYGLW+R
Sbjct  457   IKLGVLIHDPPRNGPTLWEIGIPDRKASEFYVPETYPTLMNKLYTKHPTDRFRQYGLWER  516

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y++L+ + DLVY VG ++  +DWFFA VTR+    +YEAT W ++F ++ V + G YTL+
Sbjct  517   YADLYPRNDLVYNVGVNNYFQDWFFAHVTREKGNNTYEATTWQIIFELKNVNQSGNYTLQ  576

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T + L +  N +   D+  FT+ L GKDNAIARHGIHGLY   S  +P   +V 
Sbjct  577   LALASATLSELQVRFN-NAGADQPFFTTGLVGKDNAIARHGIHGLYWSYSINVPNDQLVN  635

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G+N +YL QS+   PF+G+MYDYIRLE 
Sbjct  636   GDNTIYLTQSRDDGPFHGVMYDYIRLEG  663



>ref|XP_004287408.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Fragaria 
vesca subsp. vesca]
Length=638

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/633 (51%), Positives = 429/633 (68%), Gaps = 10/633 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + VKL +    V++DNGI++V LS P G + GI Y G+D NLLE+ NK  DRGYWDL 
Sbjct  2     SSQAVKLHIQDHHVILDNGILQVTLSKPGGIITGIQYNGID-NLLEIQNKESDRGYWDLV  60

Query  571   WNTPKEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPG  744
             W+      +T +F ++  T F VI+E E QVE+SF + +   +K  +P+NIDKRF+ML  
Sbjct  61    WSEAGSVGTTGTFDVIKGTKFTVIVESEEQVEISFTRNWNHKNK-HVPLNIDKRFIMLRN  119

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
             SSGFY+YAIY+H K     +L QTR+ FKL +  F ++A+ D  Q  MP   +R  +  E
Sbjct  120   SSGFYSYAIYEHLKEWPPFNLPQTRITFKLRKDKFQYMAIADNRQRNMPLPDDRLPDRSE  179

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
             VL++ EAV L     P+ KG+VDDKYQY+  +QN+ V+GWI   P +GFW IT SNEFR 
Sbjct  180   VLDFPEAVLLVNPIEPEFKGEVDDKYQYSSKNQNLQVHGWICMDPPVGFWQITPSNEFRS  239

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDH  1275
             GGPLKQ+L+ H GP  L+MFLS HYSG+D  +KL+  E WK VFGP+FIY+NS  +  D 
Sbjct  240   GGPLKQNLSSHVGPTCLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPIFIYLNSTPEAIDS  299

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
              +LWE AKKQM+ E + WPY FP S D+P + +RG +SGR+ + D     T   AK A+V
Sbjct  300   LSLWEDAKKQMVTEVQTWPYKFPASTDFPPSHERGNLSGRIQVQDRYLSDTYILAKGAYV  359

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+PGSWQ D   YQFWTR D+ G + I+ +R G Y LYAWVPG +GD+++   I 
Sbjct  360   GLAPPGDPGSWQRDCKGYQFWTRADENGYYTINDIREGAYDLYAWVPGFIGDYRYDETIN  419

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  GC+I +GD V+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQY
Sbjct  420   ITAGCNIDIGDTVYKPPRSGPTLWEIGIPDRSAAEFYVPDPNPKYLNKLYVNHPDRFRQY  479

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-  1989
             GLW+RY +L+ + DLVYTVG SD  KDWFFA VTRK   G Y+ T W + F ++ V +  
Sbjct  480   GLWERYEDLYPEEDLVYTVGVSDYTKDWFFAHVTRKQVDGKYQGTTWKIKFQLDHVNQTK  539

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTLRIA+A++  A L I VN D K D   FT+ + GKDN IARHGIHGLY   S +IPG
Sbjct  540   PYTLRIALATANVAELQIRVN-DSKTDSPLFTTGVIGKDNTIARHGIHGLYWLYSIDIPG  598

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +L+++G N ++L Q+ +  P  G+MYDYIRLE 
Sbjct  599   TLLLEGVNTVFLTQAMSSSPVQGLMYDYIRLEG  631



>gb|KHN09024.1| Rhamnogalacturonate lyase [Glycine soja]
Length=627

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/619 (53%), Positives = 432/619 (70%), Gaps = 10/619 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKAST-SFKI  612
             M+NGI+KV LSNP G V GI Y  +D NLLE+ N   +RGYWDL W++P    ++ +F +
Sbjct  1     MENGILKVTLSNPGGIVTGIQYNDID-NLLEVLNDESNRGYWDLVWSSPTSTGTSGTFDV  59

Query  613   L-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             +  T FKV++E E QVE+SF +T+  S +   +P+NIDKRFVML GSSGFY+YAIY+H +
Sbjct  60    IKGTTFKVVVENEDQVELSFTRTWDVSREGKLVPLNIDKRFVMLRGSSGFYSYAIYEHLE  119

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
                  +LD+TR+ FKL +  F ++A+ D  Q  MP   +R   +G+ L Y EAV L    
Sbjct  120   EWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRLPPKGKALAYPEAVLLVNPI  179

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
              P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR GGPLKQ+LT H GP
Sbjct  180   EPELKGEVDDKYQYSCDNKDSQVHGWICMDPAVGFWLITPSNEFRSGGPLKQNLTSHVGP  239

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQMLEE  1317
               L++FLS HYSG+D   K   GEAWK VFGPVFIY+NS   GTD   LWE AK QM  E
Sbjct  240   TTLAVFLSAHYSGEDLVPKFNSGEAWKKVFGPVFIYLNSPYDGTDPLKLWEDAKLQMSVE  299

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
              + WPYSFP+SED+ K   RG VSGRLL+ +         AK A+VGLA PG+ GSWQ +
Sbjct  300   VQSWPYSFPESEDFAKWDDRGNVSGRLLVRERYINDDYVSAKGAYVGLAPPGDVGSWQRE  359

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
               +YQFW R DD G F +S +RAG+Y++YAWVPG +GD+K+   I I  GCDI +GDLV+
Sbjct  360   CKNYQFWARADDDGYFSVSNIRAGDYNVYAWVPGFIGDYKYDVVINITEGCDIDLGDLVY  419

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTD  1854
              P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQYGLW+RY+EL+   D
Sbjct  420   EPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDKFRQYGLWERYAELYPDKD  479

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRA  2031
             L+YT+G SD  KDWFFAQVTRK    +Y+ T W + F +++V K   Y LR+A+AS+T +
Sbjct  480   LIYTIGVSDYTKDWFFAQVTRKKDDNTYQGTTWQIKFKLDSVNKSSSYKLRVALASATLS  539

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L + VN +PK  +  F+S L G+DN+IARHGIHGLY   +  IPG+ +V+G+N ++L Q
Sbjct  540   ELQVRVN-NPKAPRPLFSSGLIGRDNSIARHGIHGLYWLYNVGIPGTQLVEGDNTIFLTQ  598

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             ++   PF  IMYDYIRLEA
Sbjct  599   TRGNGPFQAIMYDYIRLEA  617



>ref|XP_008466141.1| PREDICTED: rhamnogalacturonate lyase B [Cucumis melo]
Length=642

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/633 (51%), Positives = 436/633 (69%), Gaps = 10/633 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A + ++L +    V+MDNGI++V LS P+G+V GI Y  +D N+LE+ +K   RGYWDL 
Sbjct  2     ANEILQLDIQDHHVVMDNGILQVTLSKPDGNVTGIKYNSID-NVLEVDDKETHRGYWDLV  60

Query  571   WNTPKEKASTSF-KILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGS  747
             WN+     + +F ++   +F+V+++ E Q+E+SFK+ Y   DK  +P+NIDKRF+ML  S
Sbjct  61    WNSGTSGTTGTFDEMRGKEFEVMVQNEEQIELSFKRNYSFKDKA-VPLNIDKRFIMLRNS  119

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFY+YAIY+H +     +L QTR+VFKL +  F ++A+ D+ Q  MP  ++R    G+ 
Sbjct  120   SGFYSYAIYEHMREWPPFNLPQTRIVFKLRKDKFHYMAIADDRQRFMPLPEDRLRHRGKP  179

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L++ EAV L   + P+ KG+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR G
Sbjct  180   LDFPEAVLLVNPKEPEFKGEVDDKYQYSCENKDLKVHGWISMDPPVGFWQITPSSEFRSG  239

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GPLKQ+LT H GP+AL+MFLS HYSG+D  +KL   E WK VFGPVF Y+NS   G D  
Sbjct  240   GPLKQNLTSHVGPYALAMFLSAHYSGEDLVLKLSPDEPWKKVFGPVFFYLNSVSDGGDPL  299

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             +LWE AK QM  E + WPYSFP SED+P   QRG ++G+L + D    +   PA  A+VG
Sbjct  300   SLWEDAKTQMSIEVQSWPYSFPASEDFPPPNQRGRLTGKLFVLDRYINEEKMPATDAYVG  359

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ ++  YQFWT+TD  G F I  VR G+Y+LYAWVPG +GD+++   I +
Sbjct  360   LAAPGEAGSWQTENKGYQFWTKTDADGSFSIEHVRIGDYNLYAWVPGFIGDYRYDVLINV  419

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG D+ VGDLV+ P +NG T+WEIGIPDRSAAEF+IP+P P   N L  +  ++FRQYG
Sbjct  420   SPGSDMDVGDLVYEPPRNGPTLWEIGIPDRSAAEFYIPDPDPKYINKLYVNHPDRFRQYG  479

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV--AKG  1989
             LW+RY+EL+   DLVY+VG SD  KDWFFA V RK   GS+ AT W + F ++ +    G
Sbjct  480   LWERYAELYPDADLVYSVGVSDYTKDWFFAHVNRKRNDGSHLATTWEIKFRVDNIIDKSG  539

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTLR+A+A++  A L I VN +P+   + FT+ + G DNAIARHGIHGLY   S +I G
Sbjct  540   TYTLRVALATANVAELQIQVN-NPEAKPSLFTTGMIGHDNAIARHGIHGLYRLYSVDILG  598

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             SL+V+GEN ++L Q      F G+MYDYIRLE 
Sbjct  599   SLLVEGENTIFLSQIINSSSFNGVMYDYIRLEG  631



>ref|XP_008781312.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Phoenix 
dactylifera]
Length=655

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/630 (53%), Positives = 436/630 (69%), Gaps = 12/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V    V++DNGI+++ LSNP+G V G+ Y GVD NLLE+ NK  +RGYWDL WN  
Sbjct  26    VRLVVQDRHVIIDNGILQLTLSNPDGIVTGVRYNGVD-NLLEVLNKEDNRGYWDLVWN--  82

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPINIDKRFVMLPGSSGF  756
                 S  F ++  TDF+++ + E QVEVSF +++    K T +P+NIDKRFV+L G SGF
Sbjct  83    DTGTSGIFDVIKGTDFRILCQNEEQVEVSFTRSWAPSLKGTLVPLNIDKRFVVLRGCSGF  142

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--LNY  930
             YTYAIY+H +G  D D+ +TR+ FKL +  F ++A++D  Q  MP   +R  G    L Y
Sbjct  143   YTYAIYEHLEGWPDFDIGETRIAFKLRKDKFHYMAISDNRQRIMPMPDDRMPGRCQQLAY  202

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV L    NP LKG+VDDKYQY+ + Q++ V+GWIS  P +GFW IT S+EFR GGP+
Sbjct  203   PEAVLLINPINPDLKGEVDDKYQYSCEDQDIKVHGWISFDPPIGFWQITPSDEFRAGGPV  262

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP  LS+F+S HY+G D   K R GE WK VFGPVFIY+NS    +D K LW
Sbjct  263   KQNLTSHVGPTTLSVFVSAHYAGQDVVPKFRNGEYWKKVFGPVFIYLNSAWDESDPKMLW  322

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             E AK QM  E + WPY+FP SED+ K  QRG+VSG+LL+ D      D  A  A+VGLA 
Sbjct  323   EDAKIQMQSEVESWPYNFPVSEDFQKCLQRGSVSGKLLVRDRYIDGDDIYANDAYVGLAL  382

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PGE GSWQ +   YQFWTR D  G F I+ VR G+Y+LYAWVPG +GD+K+ A ITI  G
Sbjct  383   PGEAGSWQRELKGYQFWTRADANGSFTITNVRTGDYNLYAWVPGFIGDYKYDATITITSG  442

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLW  1824
              +I +GDLVF P ++G T+WEIGIPDRSAAEF+IP+P P+  N L +SD  + FRQYGLW
Sbjct  443   NNIDLGDLVFEPPRDGVTLWEIGIPDRSAAEFYIPDPNPNYVNRLYISDPADGFRQYGLW  502

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY++L+  +DLVYTVG SD  KDWFFAQVTRK  + SY+ T W + F +++V + G Y 
Sbjct  503   ERYADLYPDSDLVYTVGDSDYKKDWFFAQVTRKTDQNSYQPTTWQIKFHLDSVDQSGSYK  562

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS T + L +  N D K + A F + L G+DNAIARHGIHGLY   + ++  + +
Sbjct  563   LRVALASVTLSELQVRFN-DSKANPAHFATGLIGRDNAIARHGIHGLYWLYNIDVRSTWL  621

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N ++L Q ++  PF GIMYDYIR+E 
Sbjct  622   VQGDNTIFLTQPRSQGPFQGIMYDYIRMEG  651



>ref|XP_003523772.1| PREDICTED: rhamnogalacturonate lyase B-like [Glycine max]
Length=643

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/630 (52%), Positives = 438/630 (70%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+LT+    V+M+NG++KV LSNPEG V GI Y  +D NLLE+ N   +RGYWDL W++P
Sbjct  6     VQLTIQDNHVVMENGMLKVTLSNPEGIVTGIQYNDID-NLLEVLNDESNRGYWDLVWSSP  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 ++ +F ++  T FKV++E E QVE+SF +T+  S +   +P+NIDKRFVML GSSG
Sbjct  65    TSTGTSGTFDVIKGTTFKVMVENEDQVELSFTRTWDVSLEGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H +     +LD+TR+ FKL +  F ++A+ D  Q  MP   +R   +G+ L 
Sbjct  125   FYSYAIYEHLEDWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRLPPKGKALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR GGP
Sbjct  185   YPEAVLLVNPIEPELKGEVDDKYQYSCDNKDSQVHGWICMDPAVGFWLITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-L  1284
             LKQ+LT H GP  L++FLS HYSG+D   K   GEAWK VFGPVFIY+NS     H   L
Sbjct  245   LKQNLTSHVGPTTLAVFLSAHYSGEDLVPKFYAGEAWKKVFGPVFIYLNSPYDGSHPLKL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK QML E + WPYSFP+SE++ K  +RG VSGRLL+ +         AK A+VGLA
Sbjct  305   WEDAKLQMLVEVQSWPYSFPESENFAKWDERGNVSGRLLVRERYINDDYVSAKGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +  +YQFW + DD G F IS +RAG+Y+++AWVPG +GD+K+   + I  
Sbjct  365   PPGDVGSWQRECKNYQFWAKADDDGYFSISNIRAGDYNVFAWVPGFIGDYKYDIVMKITE  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQYGLW
Sbjct  425   GCDIDLGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYFNHPDKFRQYGLW  484

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DL+YTVG SD  KDWFFAQVTRK    +Y+ T W + F ++ V K   Y 
Sbjct  485   ERYAELYPDKDLIYTVGVSDYTKDWFFAQVTRKKDDNTYQGTTWQIKFKLDNVNKSSSYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + VN +PK  +  F+S L G+DN+IARHGIHGLY   + ++PG+ +
Sbjct  545   LRVALASAALSELQVRVN-NPKAPRPLFSSGLIGRDNSIARHGIHGLYWLYNVDMPGTQL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N ++L Q++   PF  IMYDYIRLE 
Sbjct  604   VEGDNTIFLTQTRGNGPFQAIMYDYIRLEG  633



>ref|XP_002301112.2| hypothetical protein POPTR_0002s11070g [Populus trichocarpa]
 gb|EEE80385.2| hypothetical protein POPTR_0002s11070g [Populus trichocarpa]
Length=642

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/636 (53%), Positives = 432/636 (68%), Gaps = 16/636 (3%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             HLG    V+L V    V+MDNGI++V LSNP+G V GI Y G+D NLLE+ N   +RGYW
Sbjct  3     HLG----VQLLVQDRHVVMDNGILQVTLSNPDGIVTGIRYSGID-NLLEVQNDESNRGYW  57

Query  562   DLDWNTPKEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVM  735
             DL WNT     +  F ++    FKVI+E E QVEVSF +T+ S  +   +P+NIDKRFVM
Sbjct  58    DLVWNT--AGTTGIFDVIKGRSFKVIVETEEQVEVSFTRTWDSSQEGKLVPLNIDKRFVM  115

Query  736   LPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--E  909
             L GSSGFY+YAIY+H K     +L +TR+ FKL +  F ++   D  Q  MP   +R   
Sbjct  116   LRGSSGFYSYAIYEHLKEWPGFNLGETRIAFKLRKDKFHYMIAADNRQRYMPLPDDRLPP  175

Query  910   EGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNE  1089
              G+ L Y EAV+L     P  KG+VDDKYQY++++++  V+GWI   P +GFW IT S+E
Sbjct  176   RGQPLAYPEAVQLVNPVEPDFKGEVDDKYQYSIENKDNKVHGWICMDPAVGFWQITPSDE  235

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKG  1266
             FR GGP+KQ+LT H GP  L MFLS HYSG+D   K+  GEAWK VFGPVF+Y NS   G
Sbjct  236   FRSGGPVKQNLTSHVGPTTLVMFLSAHYSGEDLVPKIGAGEAWKKVFGPVFMYFNSVMDG  295

Query  1267  TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
              D  +LWE AK QML E + WPY FP SEDY K+ QRG VSGRLL+ D       TPA  
Sbjct  296   DDPLSLWEDAKLQMLIEVQSWPYGFPASEDYQKSDQRGNVSGRLLVRDRFVSDDYTPANG  355

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             A+VGLA PG+ GSWQ +   YQFW R D+ G F I+ VR G+Y+LYAWVPG +GD+++  
Sbjct  356   AYVGLALPGDVGSWQRECKDYQFWNRADEGGYFSINNVRTGDYNLYAWVPGVIGDYRYDV  415

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKF  1806
              ITI  GCDI++GDLV+ P ++G T+WEIGIPDRSA EF++P+P P   N L  +  ++F
Sbjct  416   SITITSGCDIEMGDLVYEPPRDGPTLWEIGIPDRSAEEFYVPDPNPKYINKLYVNHPDRF  475

Query  1807  RQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-  1980
             RQYGLW+RY+EL+   DLVYTVG SD  KDWF+AQVTRK    +Y+   W + F ++ V 
Sbjct  476   RQYGLWERYAELYPDGDLVYTVGVSDYRKDWFYAQVTRKKDDNTYQRATWQIKFNLDKVD  535

Query  1981  AKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
               G Y LR+A+AS+T + L + +N DPK  K  F+S L GKDN+IARHGIHGLY     +
Sbjct  536   HNGIYKLRVALASATVSELQVRIN-DPKA-KPLFSSGLIGKDNSIARHGIHGLYWLYGID  593

Query  2161  IPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +PG+ +V+G+N ++L Q ++  PF GIMYDYIRLE 
Sbjct  594   VPGARLVEGDNAVFLTQPRSISPFQGIMYDYIRLEG  629



>ref|XP_011019318.1| PREDICTED: rhamnogalacturonate lyase B-like [Populus euphratica]
Length=674

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/624 (51%), Positives = 435/624 (70%), Gaps = 9/624 (1%)
 Frame = +1

Query  412   TVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEK  591
             T  ++ V++DNG+++V  S+P+G V GI Y+G+D N+LE+ N   +RGYWD+ WN P + 
Sbjct  51    TKNRQRVVIDNGLVEVTFSSPDGDVTGIKYKGID-NVLEIVNDEDNRGYWDVVWNKPGDP  109

Query  592   ASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYA  768
                  K++ATDF+VIME E+QVEVSF KT+  S   + +P+N+DKR+++  G SG Y Y 
Sbjct  110   IIFD-KLVATDFRVIMEDENQVEVSFTKTWDLSMGNSTVPLNVDKRYIVRRGQSGLYLYT  168

Query  769   IYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKL  948
             I +  +G  DVD+DQ RVVFKL +  F ++A++D  +  MP  ++R  G+ L Y EAV L
Sbjct  169   ILERLEGWPDVDMDQIRVVFKLQKDKFHYMALSDSRKRIMPMPEDRVTGQPLAYPEAVLL  228

Query  949   TKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTC  1128
             TK  NPKL+G+VDDKYQY+ + ++  V+GWI+  P +GFW+IT SNEFR+GGP KQDLT 
Sbjct  229   TKPINPKLRGEVDDKYQYSCEDKDNKVHGWIAEDPPVGFWMITPSNEFRVGGPNKQDLTS  288

Query  1129  HCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQ  1305
             H GP  L+MF S HY+G D     R GE WK V GPVF+Y+NS     D   LWE AK+Q
Sbjct  289   HVGPVVLNMFTSTHYAGKDLNTAYRNGEPWKKVLGPVFVYLNSISPKEDSSILWEDAKEQ  348

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGS  1485
             M  E   WPY FP+SED+P + QRGAV+G+LL+ D    ++ T A  A+VGLA PG+ GS
Sbjct  349   MSIEVNRWPYDFPQSEDFPSSDQRGAVTGQLLVRDRYVNESLTYASFAYVGLAAPGDVGS  408

Query  1486  WQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVG  1665
             WQ +S  YQFW R D  G F I  VRAG YSLYAWVPG +GD+K+ A+ITI PG  I+ G
Sbjct  409   WQTESKGYQFWIRADRHGHFVIKNVRAGNYSLYAWVPGVIGDYKYDANITINPGSRIRFG  468

Query  1666  DLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLS-DRTEKFRQYGLWDRYSEL  1842
              L++ P +NG T+W+IGIPDR+AAEF++P+  P L N L + D +EKFRQYGLW+RYS+L
Sbjct  469   RLIYEPPRNGPTLWDIGIPDRTAAEFYVPDGYPTLMNKLYTIDPSEKFRQYGLWNRYSDL  528

Query  1843  HKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVA  2016
             +   DLVYT+G S+  +DWFFA VTR     +Y+ T W ++F +E V +   YTLR+A+A
Sbjct  529   YPIDDLVYTIGISN-VEDWFFAHVTRDAGNKTYDPTTWQIIFELENVNRNENYTLRLALA  587

Query  2017  SSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             S+T + + +  N  P  D+  FT+   GKDNAIARHGIHGLY     ++PGS +V+G+N 
Sbjct  588   SATASEIQVRFNY-PSSDRPLFTTGAVGKDNAIARHGIHGLYWLYGIDVPGSQLVEGKNT  646

Query  2197  LYLRQSKAGYPFYGIMYDYIRLEA  2268
             +YL Q+++  PF+G+MYDYIRLE 
Sbjct  647   IYLTQARSDGPFHGVMYDYIRLEG  670



>ref|XP_004288871.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Fragaria 
vesca subsp. vesca]
Length=624

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/620 (52%), Positives = 421/620 (68%), Gaps = 12/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF--K  609
             MDNGI++V LSNP G V GI Y+G+D NLLE+ N+  +RGYWDL W+      +T    +
Sbjct  1     MDNGIVQVTLSNPGGIVTGIQYKGID-NLLEVLNEEANRGYWDLVWSETGSIGTTGTYDR  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
             I+ T F VI+E E QVE+SF + +   D  ++P+NIDKRFVML  SSGFY+YAIY+H K 
Sbjct  60    IVGTKFTVIVESEEQVEISFTREWNH-DDMNVPLNIDKRFVMLRNSSGFYSYAIYEHLKE  118

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN--YKEAVKLTKT  957
                 +L QTR+ FKL + +F ++A+ D  Q  MP   +R  E  ++LN  + EAV L   
Sbjct  119   WPAFNLPQTRITFKLRKEMFQYMAIADNRQRNMPLPDDRLPERSQILNSDFPEAVLLVNP  178

Query  958   ENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
               P+ KG+VDDKYQY+ ++QN+ V+GWI   PH+GFW IT S+EFR GGPLKQ+LT H G
Sbjct  179   IEPQYKGEVDDKYQYSCENQNLRVHGWICKDPHVGFWQITPSDEFRSGGPLKQNLTSHVG  238

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DHKTLWEGAKKQMLE  1314
             P  L+MFLS HYSG+D  +KL+  E WK VFGPVFIY+NS     D   LWE AKKQM+ 
Sbjct  239   PICLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPVFIYLNSSSDEKDSSPLWEDAKKQMMT  298

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             E + WPY FP S D+P + QRG VSG +L+ D            A+VGLA PG+ GSWQ 
Sbjct  299   EVQSWPYEFPASSDFPTSKQRGNVSGGILVRDGFVSDHHILGDGAYVGLAPPGDVGSWQR  358

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
             D   YQFWTR D+ G + I  +R G Y+LYAWVPG +GD+++   I I PGCDI++GDLV
Sbjct  359   DCKGYQFWTRVDENGYYSIKNIREGNYNLYAWVPGFIGDYRYGVAINITPGCDIQLGDLV  418

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KT  1851
             + P ++G T+WEIG PDR+A  F++P+P P   N L  +  ++FRQ+GLW+RY+EL+ K 
Sbjct  419   YEPPRDGPTLWEIGFPDRTATGFYVPDPNPKYINKLYVNHPDRFRQWGLWERYAELYPKE  478

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTR  2028
             DLVYT+G SD +KDWFFAQVTRK   G+Y+ T W + F I+ V +   + LR+A+A++  
Sbjct  479   DLVYTIGTSDYSKDWFFAQVTRKKDDGTYQGTSWKINFQIDNVNQTKTHKLRVALATANI  538

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             A L I VN D   D   FT+ + G DNAI RHGIHGLY   S  +PG+L+ KG+N ++L 
Sbjct  539   AELQIRVN-DSNADTPLFTTGVIGHDNAICRHGIHGLYRLYSINVPGTLLAKGDNTVFLT  597

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q+ +  PF GIMYDYIRLEA
Sbjct  598   QAMSTSPFVGIMYDYIRLEA  617



>ref|XP_002527245.1| lyase, putative [Ricinus communis]
 gb|EEF35171.1| lyase, putative [Ricinus communis]
Length=621

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/620 (52%), Positives = 428/620 (69%), Gaps = 9/620 (1%)
 Frame = +1

Query  427   MVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF  606
             MV++DNGII+V LS+P+G+V GI Y+G+D N+LE  N+  +RGYWD+ WN P E +    
Sbjct  1     MVVIDNGIIEVTLSSPDGNVIGIKYRGID-NVLESLNEDDNRGYWDVVWNKPDE-SDIFD  58

Query  607   KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
             KI ATDF +IM  E QVEVSF K + S  DK+ +P+NIDKR+++  G SG Y YAI +  
Sbjct  59    KIQATDFSIIMADEDQVEVSFSKKWDSSRDKSMVPLNIDKRYIVRRGCSGLYVYAILERL  118

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTEN  963
             +G  DVD+DQ RVVFKL +  F  +AV+D+ Q  MP  ++R  G+ L Y EAV LT+  N
Sbjct  119   EGWPDVDMDQIRVVFKLRQEKFHFMAVSDDRQRIMPMPEDRATGQPLAYPEAVLLTRPTN  178

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPF  1143
             P+L+G+VDDKYQY+ + ++  V+GW S  P +GFW+IT SNEFR+GGP+KQDLT H GP 
Sbjct  179   PELRGEVDDKYQYSCEDEDNKVHGWTSDDPPVGFWMITPSNEFRVGGPMKQDLTSHVGPT  238

Query  1144  ALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT--LWEGAKKQMLEE  1317
              L+MF S HY+G D   + R GE WK V GPVF+Y+NS   TDH +  LWE AK QM  E
Sbjct  239   VLNMFTSNHYAGKDLNTEYRNGEPWKKVLGPVFVYLNSMSPTDHNSSALWEDAKAQMSVE  298

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
                WPY F +SE++P + QRG VSG+LL+ D    +    A+ A+VGLA PG  GSWQ D
Sbjct  299   VGSWPYDFVQSEEFPSSDQRGTVSGQLLVRDRYINERLLYARSAYVGLAPPGYAGSWQRD  358

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
             S  YQFWTR    G F I  VR G YSLYAWVPG +GD+K+  DITI PG  I++  L++
Sbjct  359   SKGYQFWTRASRKGIFSIKNVRPGNYSLYAWVPGVIGDYKYNVDITILPGSKIQLRVLIY  418

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR-TEKFRQYGLWDRYSELH-KT  1851
              P +NG T+WEIGIPDRSA+EF++P+  P L N L +D  TEKFRQYGLW RY++L+   
Sbjct  419   DPPRNGPTLWEIGIPDRSASEFYVPDTYPTLMNKLYTDHPTEKFRQYGLWARYADLYPNN  478

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTR  2028
             DLVYTVG S+  +DWFFA V R+    +Y AT W ++F +++V + G YTL++A+AS+T 
Sbjct  479   DLVYTVGVSNYVQDWFFAHVNREIGNKTYGATTWQIIFQLDSVKQGGNYTLQLALASATV  538

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             + +L+  N DP  ++  FT+ L G DNAIARHGIHGLY   +  +P   +  G+N +YL 
Sbjct  539   SEILVRFN-DPSSNRPLFTTGLIGTDNAIARHGIHGLYWLFTINVPSDQLRDGKNIIYLT  597

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q++   PF G+MYDYIRLE 
Sbjct  598   QARNDGPFRGVMYDYIRLEG  617



>ref|XP_009418295.1| PREDICTED: probable rhamnogalacturonate lyase B [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/629 (51%), Positives = 434/629 (69%), Gaps = 11/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V + V  + V++DNGI+++ LSNPEG + G+ Y GVD NLLE+ NK  +RGYWDL W+ P
Sbjct  6     VSIRVRDDHVVIDNGILQLTLSNPEGLITGVRYNGVD-NLLEVLNKEGNRGYWDLVWSEP  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
             +   S  F ++  T F++I E E+QVEVSF + +  S     +P+NIDKRF+ML G SGF
Sbjct  65    Q--GSGIFDVIQGTHFEIIHEDENQVEVSFTRNWDPSLQGKLVPLNIDKRFIMLRGCSGF  122

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             YTYAIY+H +G  D DL +TRV FKL +  F ++A+ D  Q  MP   +R     + L Y
Sbjct  123   YTYAIYEHREGWPDFDLAETRVAFKLRKDKFRYMAIADNRQRFMPMPDDRMPNRSQKLAY  182

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV LT   NP  KG+VDDKYQY+ D++++ V+GW+S +P +GFW IT S+EFR GGP+
Sbjct  183   PEAVLLTNPINPDQKGEVDDKYQYSCDNKDIKVHGWMSLEPPIGFWQITPSDEFRSGGPV  242

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP  L+MFLS HYSG+D   K R GE WK VFGPVFIY+NS   G D + LW
Sbjct  243   KQNLTSHVGPTTLAMFLSAHYSGEDLVPKFRNGEYWKKVFGPVFIYLNSTMDGPDRQLLW  302

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             + AK Q L E + WPY FP SED+ K  QRG+V+GRL++ D    + D     A VGLA 
Sbjct  303   DDAKLQTLTEVESWPYEFPVSEDFQKCDQRGSVNGRLMVRDKFIDEEDIIGDAAFVGLAL  362

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PGE GSWQ +   YQFWTR D+ G F I+ +R G+Y+LYAWVPG +GD++    +TI  G
Sbjct  363   PGEAGSWQRECKGYQFWTRADNKGNFTITNIRTGDYNLYAWVPGFIGDYRLDVTMTITSG  422

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
               I +GDLV+ P ++G T+WEIGIPDRSAAEFFIP+P P   N L  +  ++FRQYGLW+
Sbjct  423   NKINLGDLVYEPPRDGPTLWEIGIPDRSAAEFFIPKPNPIYVNKLYVNHPDRFRQYGLWE  482

Query  1828  RYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RY++L+  +DL+Y+VG+SD  KDWFFA VTRK  + SY+AT W + F ++ V + G Y L
Sbjct  483   RYADLYSDSDLIYSVGESDYKKDWFFAHVTRKTGENSYQATTWQIKFQVDYVNQTGAYKL  542

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L +  N D   +   FT++L G+DN+IARHGIHGLY   + ++  + ++
Sbjct  543   RVALASATISELQVRFN-DATVNPPHFTTRLIGRDNSIARHGIHGLYWLFNIDVQSTWLI  601

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N +YL Q+K+  PF GIMYDYIR+E 
Sbjct  602   QGDNTIYLTQTKSASPFQGIMYDYIRMEG  630



>ref|XP_003526528.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Glycine max]
 ref|XP_006581481.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X2 [Glycine max]
 gb|KHN09025.1| Rhamnogalacturonate lyase [Glycine soja]
Length=636

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/628 (53%), Positives = 423/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V GI Y GVD NLLE+ NK  +RGYWDL W+ P
Sbjct  6     VQLHIQDHHVVMDNGIVQVTLSNPDGIVTGIRYNGVD-NLLEVLNKETNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T FKVI++ E QVE+SF + +  S +   +P+NIDKRF+ML GSSGFY
Sbjct  65    GSKGMFDV-IKGTCFKVIVQNEEQVELSFARMWDHSLEGKFVPLNIDKRFIMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +Y IY+H  G  D D+ +TR+ FKL +  F ++A+ D  Q  MP  ++R  G  + L Y 
Sbjct  124   SYGIYEHLNGWPDFDISETRITFKLRKDKFQYMAMADNRQRVMPFPEDRLAGRCQTLGYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   ++P+LKG+VDDKYQY+  + N  V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLVNPKDPRLKGEVDDKYQYSCVNMNNRVHGWISFSPPVGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q+LT H GP  L+MFLS HY+G D   K RGGE+WK VFGPV+IY+NS    D+   LWE
Sbjct  244   QNLTSHVGPTTLAMFLSSHYAGQDLVPKFRGGESWKKVFGPVYIYLNSGAVGDNPLWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D        PA  A+VGLA P
Sbjct  304   DAKIQMMNEVQSWPYSFPASEDFLKSDQRGNVSGRLLVLDRYVCTDLIPANSAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR D+ G F I  VR G+Y+L+AWVPG +GD+K    + I  G 
Sbjct  364   GDAGSWQRECKDYQFWTRADENGFFTIKNVRPGDYNLFAWVPGFVGDYKFGDFMKITSGS  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I++G+LV+ P ++G T+WEIGIPDRSAAEF+ P+P+P   N L  +  ++FRQYGLWDR
Sbjct  424   YIELGELVYEPPRDGPTLWEIGIPDRSAAEFYAPDPSPQHINKLFINHPDRFRQYGLWDR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             YSEL+   DLVYT+G SD  KDWF+AQ  RK    + + T W + F I +V KG  Y LR
Sbjct  484   YSELYPDADLVYTIGVSDYTKDWFYAQAPRKKVDNTLQGTTWQIKFEICSVVKGSTYKLR  543

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L I VN DP   +  FTS L G+DN+IARHGI G+Y      IPGSL+V 
Sbjct  544   VAIASATLAELQIRVN-DPNARRPVFTSGLIGRDNSIARHGIQGIYWLYHVNIPGSLLVD  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G N +Y  Q +   PF GIMYDYIRLE 
Sbjct  603   GTNTIYFSQPRCTSPFQGIMYDYIRLEG  630



>ref|XP_011099953.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=676

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/633 (51%), Positives = 430/633 (68%), Gaps = 4/633 (1%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV+L + ++ V++DNGI+ V LS P G + GI Y G+D NLLE   K  +RGYWDL W+ 
Sbjct  43    PVQLHLLEDHVVLDNGILNVTLSTPGGMITGIEYNGID-NLLEYEYKENNRGYWDLVWSK  101

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             P  +A    K+  TD  VI E+++QVE+SF +T+ S   T +P+NIDKRFVML G SGFY
Sbjct  102   PDHQADVFDKLEGTDVYVITEEDNQVELSFVRTWDSSSDTGLPLNIDKRFVMLRGCSGFY  161

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +YAI++  +G  DV++ Q R+VFKL  +LF ++AV+D+ Q  MP+  +RE+G VL+Y EA
Sbjct  162   SYAIFERLEGWPDVNISQGRIVFKLQHNLFQYMAVSDDRQRIMPTTHDREKGLVLDYPEA  221

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT  +N  L+G+VDDKYQY+ D+++  V+GWI   P  GFW+IT SNEF+ GGP+KQD
Sbjct  222   VFLTNPDNSFLRGEVDDKYQYSSDNKDSRVHGWICTDPATGFWVITPSNEFKTGGPVKQD  281

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGA  1296
             LT H GP +LSMF S HY+G    I+ R GE WK VFGPV++Y+NS     D  TLW  A
Sbjct  282   LTSHAGPISLSMFFSTHYAGLPLIIEFRDGEPWKKVFGPVYMYLNSVLPDEDPLTLWADA  341

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             K+QML ET+ WPY FP S+D+P A QRG V+GRLL+ D    +    A  A++GLA  G+
Sbjct  342   KEQMLLETEKWPYDFPLSDDFPYADQRGTVTGRLLVRDNYINERLITANGAYIGLAPSGD  401

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
             PG WQ ++  YQFWT ++  G F I  +RAG YSLYAWVPG +GD+K+   IT+ PG  I
Sbjct  402   PGFWQRENKGYQFWTESNALGYFVIKNIRAGNYSLYAWVPGFIGDYKYNIQITVLPGSKI  461

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
             ++  LV+ P +NG T+WEI IPDR+A+EFF+P+P P L N L   + +KFRQYGLWDRY+
Sbjct  462   RLRTLVYDPPRNGPTLWEIDIPDRTASEFFVPDPNPMLMNQLYVSQPDKFRQYGLWDRYT  521

Query  1837  ELHKTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAV  2013
             +L+  DLVYT+  S    DW+FA V RK    +Y  T W +VF +  V +   YTL++A+
Sbjct  522   DLYPEDLVYTIESSIYQTDWYFAHVNRKVDNKTYVPTTWKIVFDLTYVDELSNYTLQLAL  581

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             AS+  A L + +N D   +   FT+ L G+DNAIARHGIHGLY   S ++PGSL+V   N
Sbjct  582   ASANEAELQVRIN-DETTEVPHFTTGLIGRDNAIARHGIHGLYWLYSVDVPGSLLVTSTN  640

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEApkkk*ppQ  2292
              ++L QS+   P+ GIMYDYIRLE P      Q
Sbjct  641   TIFLTQSRGLSPWRGIMYDYIRLEGPSSNNQTQ  673



>emb|CDP00944.1| unnamed protein product [Coffea canephora]
Length=638

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/633 (52%), Positives = 436/633 (69%), Gaps = 14/633 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT-  579
             V+L++    V+MDNGI++V LSNP+G V GI Y G+D NLLE+ N   +RGYWD+ WN  
Sbjct  6     VRLSIQDRYVVMDNGILQVTLSNPDGIVTGICYNGLD-NLLEVLNAESNRGYWDIVWNAL  64

Query  580   -PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 KA     I AT+FKVI E E QVE+SF + + +  +  + PINIDKRF++L G SG
Sbjct  65    DGSGKAGVFEVIKATEFKVIKETEEQVELSFLRPWDTSLQGKLAPINIDKRFILLRGCSG  124

Query  754   FYTYAIYDHPKGGVD---VDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
             FY+YAIY+H  G +D     L +TR+ FKL +  F ++AV+D  Q  MP   +R    G+
Sbjct  125   FYSYAIYEH-LGSMDWPAFSLGETRIAFKLRKDKFHYMAVSDSRQRFMPLPDDRLSGRGQ  183

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L     P+L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR 
Sbjct  184   PLAYPEAVLLLNPVEPELRGEVDDKYQYSCENKDLRVHGWISMDPPVGFWQITPSDEFRS  243

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DH  1275
             GGPLKQ+L+ H GP  L+M LS HY+GDD   K   GE WK VFGPVFIY+NS  G  D 
Sbjct  244   GGPLKQNLSSHVGPTTLAMCLSSHYAGDDLSPKFAKGEPWKKVFGPVFIYLNSVMGEEDP  303

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
              TLW+ AK QML E + WPYSFP SED+P   QRG V GRLL+ D         A  A+V
Sbjct  304   LTLWDDAKIQMLREVESWPYSFPASEDFPSCDQRGNVRGRLLVEDRYVSSDCILAAGAYV  363

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PGE GSWQ +   YQFWT+ D+ G F I  VR+ +Y+LYAWVPG +GD++++A IT
Sbjct  364   GLAPPGEVGSWQRECKDYQFWTKADEGGYFSIRNVRSADYNLYAWVPGFVGDYRNEALIT  423

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I PGCD+ +GD+++ P ++G T+WEIG PDRSAAEF++P+P P   N +L    E+FRQY
Sbjct  424   ITPGCDMDIGDILYEPPRDGPTLWEIGFPDRSAAEFYVPDPNPKYINKVLLSSPERFRQY  483

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-G  1989
             GLW+RYSE++ + DLVYTVG+SD  KDWF+AQVTRK    +Y+ T W + F ++ V K G
Sbjct  484   GLWERYSEIYSEGDLVYTVGESDYRKDWFYAQVTRKKEDNTYQGTTWQIKFKLDDVNKGG  543

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y LRIA+AS+T A L + +N +P  ++  F+S L G+DN+IARHGIHGLY   + +I G
Sbjct  544   IYKLRIALASATYAELQVRIN-NPGTNRPLFSSGLIGRDNSIARHGIHGLYWLYNVDIQG  602

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +L+V+G+N +YL Q +   PF G MYDYIRLEA
Sbjct  603   ALLVEGDNTVYLTQPRNNSPFQGFMYDYIRLEA  635



>ref|XP_011074281.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=619

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/620 (52%), Positives = 431/620 (70%), Gaps = 11/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKAST-SFKI  612
             MDNG+++V +S P+G V GI Y  +D NLLE++N   +RGYWDL W+ P    +  +F++
Sbjct  1     MDNGVLRVTISKPDGIVTGIKYNHID-NLLEIANDESNRGYWDLVWSQPGSTGTAGTFEV  59

Query  613   L-ATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFYTYAIYDHPK  786
             +  T+FKV+ E E QVE+SF  T+ +  +  + P+NIDKRFVML GSSGFYTYAIY+H +
Sbjct  60    IHGTNFKVVTENEEQVELSFSTTWNASLQGKLAPLNIDKRFVMLRGSSGFYTYAIYEHLE  119

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
             G    +LD+TR+VFKL +  F ++AV D  Q  MP   +R    G+ L+Y EAV L    
Sbjct  120   GWPGFNLDETRIVFKLRKDKFHYMAVADNRQRYMPLPDDRLPGRGQPLDYPEAVLLVNPV  179

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPK-PHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
              P+  G+VDDKYQY+ +++++ V+GWI    P +GFW I  SNEF+ GGP KQDLT H G
Sbjct  180   EPEFTGEVDDKYQYSCENKDVKVHGWICTDIPAVGFWQIMPSNEFQTGGPSKQDLTSHVG  239

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLE  1314
             P  L+MF+S HY G+D  +K   GEAWK VFGP+F+Y+NS   G+D   LWE AK+Q  E
Sbjct  240   PTTLAMFVSAHYGGEDVVLKFEEGEAWKKVFGPIFMYLNSVTNGSDPFLLWEDAKEQATE  299

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             +   WPYSFP SED+P +A+RG VSGRLL+ D C    +     A++GLA PGE GSWQ 
Sbjct  300   QVVRWPYSFPASEDFPTSAERGNVSGRLLVRDRCVSDEEMVGNGAYIGLAPPGEIGSWQT  359

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
                 YQFW + D+ G F I+ +R G+Y+LYAWVPG +GD+K +  I+I PGC+I +G+LV
Sbjct  360   QGKGYQFWRKADEKGYFTINNIRTGDYNLYAWVPGFIGDYKLEEVISITPGCNIDMGELV  419

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KT  1851
             + P ++G T+WEIGIPDRSA EF+IP+P     N L  +  ++FRQYGLW+RYSEL+ K 
Sbjct  420   YEPPRDGPTLWEIGIPDRSAREFYIPDPDARYINKLYVNHPDRFRQYGLWERYSELYPKG  479

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASSTR  2028
             DLVYTVG+S+ + DWFFAQVTRK    +Y+AT W + F + T+   G Y LR+A+AS+ +
Sbjct  480   DLVYTVGESNYSTDWFFAQVTRKKDDNTYQATTWQIRFRLATIKPTGTYKLRLALASAAQ  539

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             A L + +N +P +D A FTS L GKDNAIARHGIHGLY   + E+P + +V+G+N +YL 
Sbjct  540   AELQVRIN-NPDQDPALFTSGLIGKDNAIARHGIHGLYWLFNVELPAASLVEGDNTIYLT  598

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q+    PF GIMYDYIRLE+
Sbjct  599   QANTTSPFQGIMYDYIRLES  618



>ref|XP_004238544.1| PREDICTED: probable rhamnogalacturonate lyase B [Solanum lycopersicum]
Length=640

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/621 (52%), Positives = 431/621 (69%), Gaps = 9/621 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF-  606
             V+MDNGI++V LS P+G V GI Y GVD NLLE+ N   +RGYWD+ W++     +T   
Sbjct  16    VVMDNGILQVTLSVPDGIVTGITYNGVD-NLLEVLNDETNRGYWDVVWSSTGTTGTTGTF  74

Query  607   -KILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDH  780
              +++ T +KVI+E + Q+E+SF +T+  S     IP+NIDKRF+ML GSSGFY+YAIY+H
Sbjct  75    ERLICTTYKVILETDDQIELSFTRTWDVSLQDKLIPLNIDKRFIMLKGSSGFYSYAIYEH  134

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTK  954
              +G    +LD+TR+ FKL +  F ++A+ D  Q  MP   +R  + G+ L Y EAV L  
Sbjct  135   LEGWPGFNLDETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRLPDRGQPLAYPEAVLLVN  194

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
                P+ KG+VDDKYQY+ + +++ V+GWI   P LGFWII  S+EFR GGPLKQ+LT H 
Sbjct  195   PIEPEFKGEVDDKYQYSCEDKDLKVHGWICMDPSLGFWIIIPSDEFRSGGPLKQNLTSHV  254

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQML  1311
             GP ALS+FLS HY+G+D   K   GE WK VFGPVFIY+NS   G D  TLWE AKKQML
Sbjct  255   GPTALSVFLSAHYAGEDLVPKFGQGEPWKKVFGPVFIYLNSVTSGEDPLTLWEDAKKQML  314

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSFP SED+P ++QRG +SGRLL+ D         A  A +GLA PGE GSWQ
Sbjct  315   MEVQSWPYSFPASEDFPSSSQRGNISGRLLVLDRYFKDDKISASGAFIGLAPPGEAGSWQ  374

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
              +   YQFWTR D+ G + IS +RAG+Y+LYA+VPG +GD+K+  +ITI  GC I++ DL
Sbjct  375   RECKDYQFWTRADEEGNYVISNIRAGDYNLYAFVPGFIGDYKYDINITITSGCSIEMDDL  434

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT  1851
             VF P +NG T+WEIGIPDRSA EF+IP+P     N L  +  ++FRQYGLW+RY++L+  
Sbjct  435   VFEPPRNGPTLWEIGIPDRSAREFYIPDPDQKYVNKLFINHPDRFRQYGLWERYADLYPN  494

Query  1852  -DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASST  2025
              D+V+T+G+SD  KDWFF QVTRK  + +Y+ T W + F ++ V +   YTLR+A+AS+ 
Sbjct  495   GDIVFTIGESDYKKDWFFVQVTRKTDEKTYQGTTWQIKFKLDNVDQNEIYTLRLALASAA  554

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
             +A L + +N +   +   F+S + GKDNAIARHGIHGLY   +  + G+++V+GEN +YL
Sbjct  555   QAELQVRINDNSSTNTPLFSSGVIGKDNAIARHGIHGLYWLFNVNLQGTILVEGENTIYL  614

Query  2206  RQSKAGYPFYGIMYDYIRLEA  2268
              Q+ A  PF GIMYDYIRLE 
Sbjct  615   TQANATSPFQGIMYDYIRLEG  635



>ref|XP_010254609.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nelumbo 
nucifera]
 ref|XP_010254610.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nelumbo 
nucifera]
Length=640

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/629 (52%), Positives = 434/629 (69%), Gaps = 11/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNG+++V LS PEG V GI + G+D+ L  +  K    GYWD+ WN  
Sbjct  6     VRLQIQDRYVVMDNGLLQVTLSKPEGIVTGIQFNGIDNLLEVVDGKDNYGGYWDVVWN--  63

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
               KAS  F ++  T FKVI E E QVE+SF +T+  S +   IP+NIDKRF+ML G SGF
Sbjct  64    GAKASGIFDVIKGTSFKVIKEDEDQVELSFTRTWDPSLEDKVIPLNIDKRFIMLRGCSGF  123

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNY  930
             Y+YAIY+H     +  L +TR+ FKL +  F ++A+ D  Q  MP   +R +G  + L Y
Sbjct  124   YSYAIYEHLNEWPEFSLGETRIAFKLKKDKFHYMAIADNRQRPMPLPDDRTKGRCQSLAY  183

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV LT    P+ KG+VDDKYQY+ ++++  V+GWI   P +GFW IT S+EFR  GPL
Sbjct  184   AEAVLLTNPIEPEFKGEVDDKYQYSCENKDNKVHGWICMDPPVGFWQITPSDEFRTCGPL  243

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP  L+MF S HY+G D G K + GEAWK VFGPVFIY+NS   G D  +LW
Sbjct  244   KQNLTSHVGPTTLAMFHSTHYAGPDLGPKFQQGEAWKKVFGPVFIYLNSAFIGEDPLSLW  303

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
               AK QML E + WPYSFP SED+P + QRG VSGRLL+HD    +   PA  A+VGLA 
Sbjct  304   NDAKTQMLTEAQSWPYSFPASEDFPFSDQRGTVSGRLLVHDSYVDEEWVPANSAYVGLAL  363

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PGE GSWQ +   YQFWTR D+ G F IS +RAG+Y+LYAWVPG +GD+K++  +TI  G
Sbjct  364   PGEVGSWQRECKGYQFWTRADENGFFSISNIRAGDYNLYAWVPGFIGDYKYEVVLTITGG  423

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C + +G++V+ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYGLWD
Sbjct  424   CTVDLGEIVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPNYVNKLYVNHPDRFRQYGLWD  483

Query  1828  RYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RY+EL+   DLV+T+G SD  KDWFFAQV RK   G Y+AT W + F +++V + G Y L
Sbjct  484   RYTELYPDGDLVFTIGASDYMKDWFFAQVNRKKDNG-YQATTWQIKFKLDSVNRTGKYKL  542

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L +  N DPK ++  FT+ L G+DN+IARHGIHGLY   + ++PG+ +V
Sbjct  543   RLALASATLSELQVRFN-DPKANRPHFTTGLIGRDNSIARHGIHGLYWLYNVDVPGTRLV  601

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L Q ++  PF GIMYDYIRLE 
Sbjct  602   EGDNTIFLTQPRSSSPFQGIMYDYIRLEG  630



>ref|XP_011099952.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=687

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/633 (51%), Positives = 430/633 (68%), Gaps = 4/633 (1%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV+L + ++ V++DNGI+ V LS P G + GI Y G+D NLLE   K  +RGYWDL W+ 
Sbjct  54    PVQLHLLEDHVVLDNGILNVTLSTPGGMITGIEYNGID-NLLEYEYKENNRGYWDLVWSK  112

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             P  +A    K+  TD  VI E+++QVE+SF +T+ S   T +P+NIDKRFVML G SGFY
Sbjct  113   PDHQADVFDKLEGTDVYVITEEDNQVELSFVRTWDSSSDTGLPLNIDKRFVMLRGCSGFY  172

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +YAI++  +G  DV++ Q R+VFKL  +LF ++AV+D+ Q  MP+  +RE+G VL+Y EA
Sbjct  173   SYAIFERLEGWPDVNISQGRIVFKLQHNLFQYMAVSDDRQRIMPTTHDREKGLVLDYPEA  232

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT  +N  L+G+VDDKYQY+ D+++  V+GWI   P  GFW+IT SNEF+ GGP+KQD
Sbjct  233   VFLTNPDNSFLRGEVDDKYQYSSDNKDSRVHGWICTDPATGFWVITPSNEFKTGGPVKQD  292

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGA  1296
             LT H GP +LSMF S HY+G    I+ R GE WK VFGPV++Y+NS     D  TLW  A
Sbjct  293   LTSHAGPISLSMFFSTHYAGLPLIIEFRDGEPWKKVFGPVYMYLNSVLPDEDPLTLWADA  352

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             K+QML ET+ WPY FP S+D+P A QRG V+GRLL+ D    +    A  A++GLA  G+
Sbjct  353   KEQMLLETEKWPYDFPLSDDFPYADQRGTVTGRLLVRDNYINERLITANGAYIGLAPSGD  412

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
             PG WQ ++  YQFWT ++  G F I  +RAG YSLYAWVPG +GD+K+   IT+ PG  I
Sbjct  413   PGFWQRENKGYQFWTESNALGYFVIKNIRAGNYSLYAWVPGFIGDYKYNIQITVLPGSKI  472

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
             ++  LV+ P +NG T+WEI IPDR+A+EFF+P+P P L N L   + +KFRQYGLWDRY+
Sbjct  473   RLRTLVYDPPRNGPTLWEIDIPDRTASEFFVPDPNPMLMNQLYVSQPDKFRQYGLWDRYT  532

Query  1837  ELHKTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAV  2013
             +L+  DLVYT+  S    DW+FA V RK    +Y  T W +VF +  V +   YTL++A+
Sbjct  533   DLYPEDLVYTIESSIYQTDWYFAHVNRKVDNKTYVPTTWKIVFDLTYVDELSNYTLQLAL  592

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             AS+  A L + +N D   +   FT+ L G+DNAIARHGIHGLY   S ++PGSL+V   N
Sbjct  593   ASANEAELQVRIN-DETTEVPHFTTGLIGRDNAIARHGIHGLYWLYSVDVPGSLLVTSTN  651

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEApkkk*ppQ  2292
              ++L QS+   P+ GIMYDYIRLE P      Q
Sbjct  652   TIFLTQSRGLSPWRGIMYDYIRLEGPSSNNQTQ  684



>ref|XP_006338024.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum tuberosum]
Length=670

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/632 (51%), Positives = 431/632 (68%), Gaps = 13/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNG+++V LSNP+G V GI Y  VD NLLE  N   +RGYWD+ WN+P
Sbjct  39    VRLYIQDRHVMMDNGLVQVTLSNPDGIVTGIRYNDVD-NLLEGLNDESNRGYWDVVWNSP  97

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 +  F+++  T+FKVI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  98    DGGKTGVFEVIKGTNFKVIKETDDQVEISFTRPWDPSLQGKLVPLNIDKRFILLRGCSGF  157

Query  757   YTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--  921
             Y+YAIY+H   P+      + +TR+ FKL +  F ++AV D  Q  MP   +R       
Sbjct  158   YSYAIYEHVGSPEWPA-FSIGETRIAFKLRKDKFHYMAVADNRQRFMPLPDDRMPARCQR  216

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR G
Sbjct  217   LAYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSG  276

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD       GEAWK VFGPVFIY+NS   G D  
Sbjct  277   GPVKQNLTSHVGPTTLAMFLSSHYAGDDLTPNFAQGEAWKKVFGPVFIYLNSVMPGEDPV  336

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             TLW+ AK QM  E + WPYSFP SED+P A QRG+VSG+LL+ D        PA  A+VG
Sbjct  337   TLWDDAKIQMQHEVQSWPYSFPVSEDFPSADQRGSVSGKLLVQDKYISDDHIPANGAYVG  396

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW ++D+ G F I+ +R G+Y LYAWVPG +GD+ ++  I++
Sbjct  397   LAPPGEAGSWQKECKDYQFWAKSDNNGNFSINNIRPGDYKLYAWVPGFIGDYLYETPISV  456

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PGC I V ++V+ P ++G T+WEIGIPDR+AAEFF+PEP P   N L  +  ++FRQYG
Sbjct  457   TPGCSIDVDEIVYQPPRDGPTLWEIGIPDRTAAEFFVPEPNPKFINKLFVNHPDRFRQYG  516

Query  1819  LWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LWDRYSEL+ T DLVY  G+SD  KDWFFAQV R+   GSY+ T W + F +++V + G 
Sbjct  517   LWDRYSELYPTDDLVYVTGESDYTKDWFFAQVPRRKEDGSYQGTTWQIRFKLDSVNQGGT  576

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A + + VN +P  ++  F++ L G+DN+IARHGIHGLY   + +I G+
Sbjct  577   YKLRIAIASATLAEVQVRVN-NPSTNRPVFSTGLIGRDNSIARHGIHGLYWLYNIDIQGN  635

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  636   LLVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  667



>ref|XP_009595415.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
tomentosiformis]
Length=637

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/632 (51%), Positives = 432/632 (68%), Gaps = 13/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI Y GVD NLLE+ N   +RGYWD+ WN+ 
Sbjct  6     VKLYIQDRHVMMDNGIVQVTLSNPDGIVTGIRYNGVD-NLLEVLNDESNRGYWDVVWNSL  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 S  F+++  T+F+VI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  65    DGGRSGVFEVIKGTNFEVITETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGYSGF  124

Query  757   YTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             Y+YAIY+H   P+      L +TR+ FKL +  F ++AV D  Q  MP   +R     + 
Sbjct  125   YSYAIYEHVGSPEWPA-FSLGETRIAFKLRKDKFHYMAVADNRQRFMPLPDDRLPARCQR  183

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR G
Sbjct  184   LAYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSG  243

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD   K   GEAWK VFGPVFIY+NS  +G D  
Sbjct  244   GPVKQNLTSHVGPTTLAMFLSSHYAGDDLTPKFAQGEAWKKVFGPVFIYVNSVMQGEDPV  303

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ AK QM  E + WPY FP SED+P A QRG VSGRLL+ D        PA  A+VG
Sbjct  304   ALWDDAKIQMQVEVQSWPYCFPASEDFPSADQRGNVSGRLLVQDEYISDDYIPANGAYVG  363

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW + D  G F I+ +R G+Y+LYAWVPG +GD+ ++  I+I
Sbjct  364   LAPPGEAGSWQKECKDYQFWAKADSIGYFSINNIRPGDYNLYAWVPGFIGDYLYETPISI  423

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PGC + V ++V+ P ++G T+WEIGIPDR+AAE+F+PEP P   N L  +  ++FRQYG
Sbjct  424   TPGCSVDVDEIVYQPPRDGPTLWEIGIPDRTAAEYFVPEPNPRFINKLFINHPDRFRQYG  483

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RYSEL+ K DLVY  G+SD +KDWFFAQV R+   G+Y+ T W + F +++V + G 
Sbjct  484   LWERYSELYPKDDLVYVTGESDYSKDWFFAQVPRRKEDGTYQGTTWQIRFKLDSVNQVGT  543

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A + + VN DP  ++  F++ L G+DN+IARHGIHGLY   + +I G+
Sbjct  544   YKLRIAIASATLAEVQVRVN-DPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGN  602

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  603   LLVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  634



>ref|XP_011098532.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=673

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/633 (52%), Positives = 436/633 (69%), Gaps = 14/633 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT-  579
             V++ V    V++DNGI++V LSNPEG V GI Y GVD NLLE+ N   +RGYWD+ WNT 
Sbjct  41    VRVYVQDRHVVLDNGILQVTLSNPEGIVTGICYNGVD-NLLEVLNDESNRGYWDVVWNTL  99

Query  580   -PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 KA     I AT+FKVI E E QVEVSF + +  S     +P++IDKRF++L G SG
Sbjct  100   DGSSKAGVFEVIRATNFKVIKETEDQVEVSFSRPWDPSLQGKLVPLSIDKRFILLRGCSG  159

Query  754   FYTYAIYDHPKGGVD---VDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
             FY+YAIY+H  G +D     + +TR+ FKL +  F ++AV D  +  MP  ++R    G+
Sbjct  160   FYSYAIYEH-VGSMDWPAFSIGETRIAFKLRKDKFRYMAVADNRRRLMPLPEDRLPGRGQ  218

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L    +P+LKG+VDDKYQY+ D++++ V+GWIS  P +GFW IT S+EFR 
Sbjct  219   ALAYPEAVLLVNPVDPELKGEVDDKYQYSCDNKDLKVHGWISMDPPVGFWQITPSDEFRS  278

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-TDH  1275
             GGPLKQ+LT H GP  L++FLS HY+GDD   K   GE WK VFGPVFIY+NS  G  D 
Sbjct  279   GGPLKQNLTSHVGPTTLAVFLSAHYAGDDLVPKFGQGEPWKKVFGPVFIYVNSVMGGEDP  338

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
              TLW+ AK+QML E + WPYSFP SED+  A QRG VSG+LL+ D        PA  A V
Sbjct  339   LTLWDDAKRQMLVEVQSWPYSFPASEDFLSADQRGNVSGKLLVSDRYVNSDLIPANRAFV  398

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+ GSWQ +   YQFWT+ D+ G F I+ +R G Y+LYAWVPG +GD+++ + IT
Sbjct  399   GLAPPGDVGSWQRECKDYQFWTQADEMGYFSINNIRPGNYNLYAWVPGFIGDYRNDSAIT  458

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I PGC+I +GD+V+ P ++G T+WEIGI DRSA+E+F+P+P P   N L  +  ++FRQY
Sbjct  459   ITPGCEIDMGDIVYEPPRDGPTLWEIGITDRSASEYFVPDPNPKYVNKLYINHPDRFRQY  518

Query  1816  GLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-G  1989
             GLW++YSEL+   DLVYTVGKSD  KDW FAQV RK    +Y+ T W + F ++TV + G
Sbjct  519   GLWEKYSELYPNDDLVYTVGKSDYRKDWLFAQVNRKRDDNTYQGTTWQIKFALDTVNQSG  578

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y LR+A+AS+T A L + VN D   ++  F+S L G+DN+IARHGIHGLY   + +I G
Sbjct  579   TYKLRVAIASATLAELQVRVN-DRTTNRPLFSSGLIGRDNSIARHGIHGLYWLYNIDIDG  637

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +L+V+G+N +YL Q +   PF G+MYDYIRLEA
Sbjct  638   ALLVQGDNTIYLTQPRCQSPFQGLMYDYIRLEA  670



>ref|XP_004136250.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
 gb|KGN60276.1| hypothetical protein Csa_3G892770 [Cucumis sativus]
Length=633

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/632 (52%), Positives = 425/632 (67%), Gaps = 10/632 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + V+L +    V++DNGI+++ LS P+G + G+ Y GVD NLLE+ N   +RGYWDL 
Sbjct  2     SSRAVRLQIRDHHVVVDNGILQLTLSKPDGIITGVRYNGVD-NLLEVLNPESNRGYWDLV  60

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN+P  K      I  + F+VI+E E QVE+SF + +  S +   +P+NIDKRF++L GS
Sbjct  61    WNSPGSKGVFDV-IKGSRFRVIVENEEQVELSFVRMWDPSLEGKFVPLNIDKRFIVLRGS  119

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EV  921
             SGFY+YAIY+H K   D D+ +TR+ FKL +  F ++AV D  Q  MP   +R  G  + 
Sbjct  120   SGFYSYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMAVADNRQRVMPLPDDRLSGRCQT  179

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV LT  +NP LKG+VDDKYQY+ ++ N+ V+GWIS  P  GFW IT S+EFR G
Sbjct  180   LAYPEAVLLTNPKNPALKGEVDDKYQYSCENNNLKVHGWISTNPPTGFWQITPSDEFRSG  239

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK-GTDHK  1278
             GPLKQ LT H GP  L++FLS HY+G D   K R GE WK VFGPVF+Y+NS   G D  
Sbjct  240   GPLKQSLTSHVGPTTLAIFLSTHYAGQDLVPKFRAGEPWKKVFGPVFLYLNSTSVGDDPF  299

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E   WPYSFP SED+PK  QRG VSGRLL+ D    +   PA  A VG
Sbjct  300   WLWEDAKIQMMAEVDSWPYSFPASEDFPKKDQRGIVSGRLLVFDRYVDQDYLPACGAFVG  359

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             L+ PGE GSWQ +   YQFWTR DD G F I+ V  GEY+LYAWVPG +GD++  A I +
Sbjct  360   LSAPGEAGSWQRECKGYQFWTRADDGGYFTINHVHTGEYNLYAWVPGFIGDYRCDALINV  419

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G  I++GDLV+ P ++G T+WEIGIPDRSA+EF++P+P P   N L  D  ++FRQYG
Sbjct  420   SQGSCIEMGDLVYEPPRDGPTLWEIGIPDRSASEFYVPDPNPIHINKLFVDHPDRFRQYG  479

Query  1819  LWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGC  1992
             LW+RY+EL+   DLVYTVG SD  KDWFFA V RK    S+E T W + F ++ V  K  
Sbjct  480   LWNRYAELYPNEDLVYTVGTSDYRKDWFFAHVPRK-TNNSHEGTTWQIKFKLDRVDHKSM  538

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTLR+A+AS+T A L + VN DP+  +  FTS L G+DN+IARHGIHG+Y      + G 
Sbjct  539   YTLRVAIASATLAELQVRVN-DPRSKRPLFTSGLIGRDNSIARHGIHGIYWVYGVGVAGC  597

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+GEN ++L Q +   PF GIMYDYIRLE 
Sbjct  598   HLVEGENTIFLTQPRCTSPFQGIMYDYIRLEG  629



>ref|XP_006433775.1| hypothetical protein CICLE_v10000543mg [Citrus clementina]
 gb|ESR47015.1| hypothetical protein CICLE_v10000543mg [Citrus clementina]
Length=649

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/630 (51%), Positives = 422/630 (67%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V++DNGI++V  SNP G V GI Y  +D NLLE+ N   +RGYWDL WNTP
Sbjct  6     VNLLIQDRHVVLDNGILEVTFSNPGGIVTGIRYNDID-NLLEVLNDELNRGYWDLVWNTP  64

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
                 +      I  T F VI+E E QVE+SF +T+ S  +   +P+NIDKRFVML GSSG
Sbjct  65    GSTGTRGIFDVIQGTSFDVIVENEDQVEISFTRTWDSSLEGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTY+IY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYSIYEHLEEWPGFNLGETRIAFKLRKDKFHYMAIADNRQRYMPLPDDRVPPRGQPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P  KG+VDDKYQY+ D+++++V+GWI   P +GFW IT S EFR GGP
Sbjct  185   YPEAVLLVNPVEPDFKGEVDDKYQYSCDNKDINVHGWICTDPPVGFWHITPSAEFRTGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
              KQ+LT H GP  LS+F+S HYSG+D   K   GEAWK VFGPVF+Y NS   G D  +L
Sbjct  245   QKQNLTSHVGPTTLSVFVSAHYSGEDLVPKFNAGEAWKKVFGPVFVYCNSAFDGDDPLSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QM  ET+ WPYSFP S+D+PK+ QRG VSGRLL+ D         A  A+VGLA
Sbjct  305   WDDAKMQMSVETESWPYSFPASDDFPKSDQRGNVSGRLLVQDEYISDDYISASGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT  D+ G F I+AVRAG+Y+LYAWVPG +GD+++   + I P
Sbjct  365   LPGDAGSWQRECKDYQFWTSADEDGYFSITAVRAGDYNLYAWVPGFIGDYRYDVVVNITP  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G DI +GDLV+ P +NG T+WEIGIPDRSAAEF++P+P P   N L  D  ++FRQYGLW
Sbjct  425   GFDIDMGDLVYEPPRNGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYLDHPDRFRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYT  1998
             +RY+EL+   DLVYTVG SD  KDWFF QVTRK    SY+ T W + F ++ V +   Y 
Sbjct  485   ERYAELYPDGDLVYTVGSSDYTKDWFFGQVTRKKDNNSYQGTTWQIKFELDNVNQNSTYI  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + +N DP  ++  F+S L G+DN+IARHGIHGLY   + ++PG+ +
Sbjct  545   LRVAIASANLSELQVRIN-DPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V G+N ++  Q ++  PF GIMYDYIR E 
Sbjct  604   VSGDNTIFFIQPRSTSPFQGIMYDYIRFEG  633



>ref|XP_004501056.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Cicer 
arietinum]
Length=639

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/631 (52%), Positives = 438/631 (69%), Gaps = 17/631 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L++    V+MDNGI++V LSNPEG V GI Y G+D NLLE+ N   +RGYWDL W++P
Sbjct  6     VQLSIQDHHVVMDNGILRVTLSNPEGIVTGIQYNGID-NLLEVLNDESNRGYWDLVWSSP  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T +F ++  + FKVI+E E QVE+SF +T+  S +   +P+NIDKRF+ML G SG
Sbjct  65    TSTGTTGNFDVIKGSTFKVILEDEDQVELSFTRTWDASMEGKLVPLNIDKRFIMLSGCSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAIY+H +     +LD+TR+ FK     F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYAIYEHLEDWPAFNLDETRIAFK-----FHYMAMADNRQRNMPLPDDRVPPRGQALA  179

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWIS  P +GFW+IT SNEFR GGP
Sbjct  180   YPEAVLLVNPIEPELKGEVDDKYQYSCDNKDSQVHGWISMDPAVGFWLITPSNEFRSGGP  239

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             +KQ+LT H GP  L++FLS HYSG D   K + GEAWK VFGPVFIY+NS   G D   L
Sbjct  240   VKQNLTSHVGPTTLAVFLSAHYSGQDLVPKFKAGEAWKKVFGPVFIYLNSPYDGGDPIKL  299

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QML E + WPYSFP+S+D+PK  +RG VSGRLLI +         AK A+VGLA
Sbjct  300   WDDAKLQMLMEVQSWPYSFPESDDFPKWDERGYVSGRLLIKERYDDDY-VSAKGAYVGLA  358

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +  +YQFW   D  G F IS +  G+Y++YAWVPG++GD+K+   I+I  
Sbjct  359   PPGDVGSWQRECKNYQFWATADYDGYFSISNIHVGDYNVYAWVPGYIGDYKYDVVISITE  418

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI +GDLV+ PL++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFRQYG+W
Sbjct  419   GCDIDIGDLVYEPLRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDKFRQYGIW  478

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DL+YTVG SD  KDWFFAQVTRK    +Y+ T W + F +++V +   Y 
Sbjct  479   ERYAELYPDKDLIYTVGVSDYTKDWFFAQVTRKKDDNTYQGTTWQIKFKLDSVNRSSTYK  538

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T + L + VN DPK ++  F+S L GKDN+IARHGIHGL    S  I G+L+
Sbjct  539   LRVALASATYSELQVRVN-DPKANRPLFSSGLIGKDNSIARHGIHGLNWLYSVGISGNLL  597

Query  2179  VKGE-NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+ N ++L Q++   PF  IMYDYIRLE 
Sbjct  598   VEGDYNTIFLTQARGNGPFQAIMYDYIRLEG  628



>ref|XP_010683043.1| PREDICTED: probable rhamnogalacturonate lyase B [Beta vulgaris 
subsp. vulgaris]
Length=669

 Score =   640 bits (1650),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/625 (50%), Positives = 425/625 (68%), Gaps = 14/625 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL-DWNT  579
             V++  T + V++DNGI++V L  PEG V  I Y G++ N+L+++N++ DRGYWD+    T
Sbjct  51    VRVNATAKQVVLDNGIVQVTLQVPEGYVTAIRYGGLE-NILDITNRVSDRGYWDIASATT  109

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
                  S   ++  T FK+I + E Q E+SF     S     +P+ ID R+++L G SGFY
Sbjct  110   GDNDGSDEIRLAGTSFKIIKQTEDQAEISFLCPKTS----SLPLQIDYRYILLRGRSGFY  165

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +YAI+   KG   +D+DQ R V+KL    F ++AV+D++Q EMP  ++RE G+ L YKEA
Sbjct  166   SYAIFGRDKGMAPMDVDQIRTVYKLHTEKFRYMAVSDKLQREMPMMRDRETGQPLAYKEA  225

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT   NPK+KG+VDDKYQYA + ++  ++GW+   P +G W+IT S+EFR+GGP KQD
Sbjct  226   VHLTNPTNPKIKGQVDDKYQYACEDKDNKLHGWVCTDPSVGIWVITPSDEFRMGGPHKQD  285

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAK  1299
             LT H GP  LSMF S HY+G +  +K   GE WK VFGP  +++NS KG D + LW+ AK
Sbjct  286   LTSHVGPNMLSMFHSTHYTGTELVMKFANGEPWKKVFGPYLVHLNSGKG-DPRALWQEAK  344

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
              Q+ EE K WPY FP SED+PKA QRG+V G+LL+ D    K   PA    VGLA+PGE 
Sbjct  345   NQLQEELKSWPYEFPVSEDFPKANQRGSVVGKLLVKD--GSKPPVPANLGWVGLAQPGEA  402

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ +   YQFW +TD  GKF I  V  G+Y+LYAW PG +GD+K  + I I PG  I 
Sbjct  403   GSWQREMKGYQFWVQTDGEGKFTIPNVHVGKYNLYAWAPGFIGDYKSASVIDIAPGKQIN  462

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSE  1839
             +GD V+TP ++G T+WEIG PDRSAAEFF+P+P+PDL N +L+D+  K+RQYGLWDRYSE
Sbjct  463   LGDQVYTPPRSGETLWEIGFPDRSAAEFFVPDPSPDLANPVLNDQENKYRQYGLWDRYSE  522

Query  1840  LH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPI-ETVAKGCYTLRIAV  2013
             ++ K DL YT+G S+  KDWF+AQV RK    +Y+ T+W VVFP+ + V  G YTL+IA+
Sbjct  523   IYPKEDLTYTIGVSNHTKDWFYAQVLRKTGD-TYQPTVWQVVFPLKDVVPNGNYTLQIAL  581

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             A++ +A L + VN      K  F++ L GKDNAIARHGIHGLY   S  IPG+L+  G+N
Sbjct  582   AAANQAELQVRVNN--PDSKVLFSTLLIGKDNAIARHGIHGLYRLYSVGIPGNLLKSGQN  639

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEA  2268
              ++ RQS+    F G+MYDY+RLE 
Sbjct  640   TIFFRQSRNNEKFRGVMYDYVRLEG  664



>ref|XP_009789094.1| PREDICTED: probable rhamnogalacturonate lyase B [Nicotiana sylvestris]
Length=685

 Score =   640 bits (1651),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/632 (52%), Positives = 428/632 (68%), Gaps = 10/632 (2%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV+L      VL+DNG+  +  S P G V  I Y G+D NLLE  NK+ +RGYWD+ WN 
Sbjct  50    PVQLHKLNNHVLVDNGLFNITFSVPGGMVIAIQYNGID-NLLENENKLNNRGYWDIVWNK  108

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
              ++      K+  T+F+VI++ E+QVE+SF +T+KS + + + +N+DKRF++L G SGFY
Sbjct  109   AEKPGIIYDKLEGTNFEVILQDENQVELSFTRTWKSLNSSSLSMNVDKRFIILRGISGFY  168

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +YAI +  +G  D+D+ Q R+ FKL+  LF ++A++DE Q  MP+ K+RE G  L+Y EA
Sbjct  169   SYAILERLEGWPDIDVYQGRMAFKLNAKLFPYMAISDERQRIMPTAKDREMGRELDYPEA  228

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT   N  LKG+VDDKYQY+L+ ++  V+GWISP P  GFW+IT SNEFR GGP+KQD
Sbjct  229   VLLTSPTNSFLKGEVDDKYQYSLEDKDNRVHGWISPNPRNGFWMITPSNEFRTGGPVKQD  288

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK--TLWEG  1293
             LT H GP  LSMF S HY GD   ++ R GE WK VFGPVFIY+NS    D    TLW  
Sbjct  289   LTSHTGPITLSMFFSTHYGGDILALRFRNGEPWKKVFGPVFIYLNSVSSDDEDILTLWTD  348

Query  1294  AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPG  1473
             AK+QML ET+ WPY FP S+D+ +A QRG VSGRLL+ D    K    A  A +GLA PG
Sbjct  349   AKEQMLIETENWPYDFPLSQDFVQADQRGTVSGRLLVSDSYVSKRLITANSAFIGLAAPG  408

Query  1474  EPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCD  1653
             + GSWQ ++  YQFWT+TD+ G F I ++  G YSLYAWVPG +GD+K+K  I I PG  
Sbjct  409   DVGSWQTENKGYQFWTQTDNEGYFLIKSIIPGNYSLYAWVPGFIGDYKYKNYINITPGSR  468

Query  1654  IKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDR  1830
              ++  L++ P +NG T+WEIGIPDR+AAEFFIP P P L+N L +   +EKFRQYGLWDR
Sbjct  469   TRLQTLMYNPPRNGPTLWEIGIPDRTAAEFFIPNPQPKLQNQLYIEHYSEKFRQYGLWDR  528

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRK--NAKG--SYEATIWTVVFPIETVAKGC-  1992
             Y+EL+   DL+YTVG S+   DWFFA V R   N +G  +Y  T W + F ++ V K   
Sbjct  529   YTELYPNDDLIYTVGSSNYQTDWFFAHVNRYTFNDEGNKTYIPTTWQIAFDLQEVEKSSN  588

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTL++A+AS+  A L I VN         FT+ L GKDNAIARHGIHGLY   S ++PGS
Sbjct  589   YTLQLALASTNEAELQIRVNDQDADHVPNFTTGLIGKDNAIARHGIHGLYWLYSIDVPGS  648

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +   G+N ++L+QS+   P+ G+MYDYIRLE 
Sbjct  649   VFATGKNVIFLKQSRGSSPWSGLMYDYIRLEG  680



>ref|XP_009595414.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=670

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/632 (51%), Positives = 432/632 (68%), Gaps = 13/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI Y GVD NLLE+ N   +RGYWD+ WN+ 
Sbjct  39    VKLYIQDRHVMMDNGIVQVTLSNPDGIVTGIRYNGVD-NLLEVLNDESNRGYWDVVWNSL  97

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 S  F+++  T+F+VI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  98    DGGRSGVFEVIKGTNFEVITETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGYSGF  157

Query  757   YTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             Y+YAIY+H   P+      L +TR+ FKL +  F ++AV D  Q  MP   +R     + 
Sbjct  158   YSYAIYEHVGSPEWPA-FSLGETRIAFKLRKDKFHYMAVADNRQRFMPLPDDRLPARCQR  216

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR G
Sbjct  217   LAYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSG  276

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD   K   GEAWK VFGPVFIY+NS  +G D  
Sbjct  277   GPVKQNLTSHVGPTTLAMFLSSHYAGDDLTPKFAQGEAWKKVFGPVFIYVNSVMQGEDPV  336

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ AK QM  E + WPY FP SED+P A QRG VSGRLL+ D        PA  A+VG
Sbjct  337   ALWDDAKIQMQVEVQSWPYCFPASEDFPSADQRGNVSGRLLVQDEYISDDYIPANGAYVG  396

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW + D  G F I+ +R G+Y+LYAWVPG +GD+ ++  I+I
Sbjct  397   LAPPGEAGSWQKECKDYQFWAKADSIGYFSINNIRPGDYNLYAWVPGFIGDYLYETPISI  456

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PGC + V ++V+ P ++G T+WEIGIPDR+AAE+F+PEP P   N L  +  ++FRQYG
Sbjct  457   TPGCSVDVDEIVYQPPRDGPTLWEIGIPDRTAAEYFVPEPNPRFINKLFINHPDRFRQYG  516

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RYSEL+ K DLVY  G+SD +KDWFFAQV R+   G+Y+ T W + F +++V + G 
Sbjct  517   LWERYSELYPKDDLVYVTGESDYSKDWFFAQVPRRKEDGTYQGTTWQIRFKLDSVNQVGT  576

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A + + VN DP  ++  F++ L G+DN+IARHGIHGLY   + +I G+
Sbjct  577   YKLRIAIASATLAEVQVRVN-DPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGN  635

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  636   LLVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  667



>ref|XP_004288875.1| PREDICTED: rhamnogalacturonate lyase-like [Fragaria vesca subsp. 
vesca]
Length=640

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/630 (52%), Positives = 429/630 (68%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNG ++V LS PEG V GI Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     VQLLIQDRHVMMDNGFVQVTLSKPEGIVTGIRYNGLD-NLLEIRNEETNRGYWDLVWSEA  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
                 +  F ++  T+F VI+E + QVE+SFK+T+  S +   +P+NIDKRFVM+ GSSGF
Sbjct  65    STGTTGIFDVIKGTEFDVIVENDDQVELSFKRTWDPSQEGKLVPLNIDKRFVMVRGSSGF  124

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNY  930
             Y+YAIY+H +      L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y
Sbjct  125   YSYAIYEHLQEWPAFQLGETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRLPLRGQPLAY  184

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV LT    P+LKG+VDDKYQY+ D+++  V+GWI   P +G W IT SNEFR GGP+
Sbjct  185   PEAVLLTNPIEPELKGEVDDKYQYSCDNKDNRVHGWICTDPPVGLWQITPSNEFRSGGPV  244

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK--TL  1284
             KQ+LT H GP  L+MFLS HY+G+D   K   GE WK VFGPVF+Y+NS+   +    +L
Sbjct  245   KQNLTSHVGPTTLAMFLSAHYTGEDLVPKFTTGEYWKKVFGPVFMYVNSEYAGNDPLVSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK QM+ E + WPYSFP SED+PK+ QRG +SGRLLI D         A  A+VGLA
Sbjct  305   WEDAKLQMMIEVQSWPYSFPASEDFPKSGQRGNISGRLLIQDRYISDDYVSANGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PGE GSWQ +   YQFWT TD+ G F I+ +R G Y+L AWVPG +GD+++   ITI  
Sbjct  365   PPGEVGSWQRECKDYQFWTTTDEDGYFSINDIRTGAYNLNAWVPGFIGDYQYDDVITITS  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GC+I +G+LV+ P ++G T+WEIGIPDRSAAEF++P+P     N L  +  ++FRQYGLW
Sbjct  425   GCEIYMGELVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNSKYINSLFVNHPDRFRQYGLW  484

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             DRY+EL+   DLVYTVG SD +KDWFFAQVTRK     Y+ T W + F ++ V + G Y 
Sbjct  485   DRYTELYPDADLVYTVGVSDYSKDWFFAQVTRKKGDNKYQGTTWQIKFKLDDVDQNGTYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T + L + VN +PK +   FTS L GKDN+IARHGIHGLY     +IP S +
Sbjct  545   LRVAIASATLSELQVRVN-NPKANPPLFTSGLIGKDNSIARHGIHGLYWLYKVDIPNSQL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N ++L Q ++  PF GIMYDYIRLE 
Sbjct  604   VQGDNTIFLTQPRSTGPFQGIMYDYIRLEG  633



>gb|EYU36444.1| hypothetical protein MIMGU_mgv1a002779mg [Erythranthe guttata]
Length=638

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/631 (51%), Positives = 428/631 (68%), Gaps = 10/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             ++L +    V+++NGI+KV +S P G V  I Y  +D NLLE+SN   +RGYWDL W+ P
Sbjct  8     LRLHIQNHHVVLENGILKVTISKPGGIVTSIEYNNID-NLLEVSNDESNRGYWDLVWSPP  66

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 +T +F+++ AT FKV+++ + Q+E+SF  T+ +  +  + P+NIDKRFVML G+SG
Sbjct  67    GSTGTTGTFQVIHATHFKVVVKTDEQIELSFSITWDTSLQGKLAPLNIDKRFVMLRGASG  126

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAIY+H +     +LD+TR VFKLS+  F ++A+ D  Q  MP   +R     + L 
Sbjct  127   FYTYAIYEHLEAWPGFNLDETRTVFKLSKDKFKYMAMADNRQRYMPLPDDRLPNRSQPLE  186

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+ KG+VDDKYQY+ +++++ V+GWI  +  +GFW IT SNEFR GGP
Sbjct  187   YPEAVLLVNPIEPEFKGEVDDKYQYSGENKDVKVHGWICMEHGVGFWQITPSNEFRTGGP  246

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTL-  1284
              KQDLT H GP  L+MF+S HY G+D  +K   GE+WK VFGPVF Y+NS    D  TL 
Sbjct  247   TKQDLTSHVGPITLAMFVSAHYGGEDVVLKFGEGESWKKVFGPVFFYLNSAAQDDDITLS  306

Query  1285  -WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
              WE AK+Q  E+ + WPYSFP SED+PK  +RG V+GRLLI D C          A++GL
Sbjct  307   LWEDAKRQASEQVESWPYSFPASEDFPKVEERGNVTGRLLIRDRCMSDDCIMGNGAYIGL  366

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PGE GSW+ +   YQFWTR D+TG F I  +RAG Y+LYAW+PG +GD+K++  I+I 
Sbjct  367   APPGEVGSWEREGKGYQFWTRADETGNFTIGNIRAGNYNLYAWMPGFIGDYKYEDSISIF  426

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC+I  G+LV+ P ++G T+WEIGIPDRSA EF+IP+P P L N L  D  ++FRQYGL
Sbjct  427   PGCNIDTGELVYEPPRDGPTLWEIGIPDRSAGEFYIPDPNPKLVNKLYVDHPDRFRQYGL  486

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCY  1995
             W+RY+EL+   DLVYTVG+S+ A DWFFAQV RK  K +Y+AT W + F ++ V   G Y
Sbjct  487   WERYAELYPDGDLVYTVGESNYATDWFFAQVNRKTVKNTYKATTWQIKFKLDAVEPSGTY  546

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+ +A L + VN   +   A F++ L GKDNAI RHGIHGLY   S EI GS 
Sbjct  547   KLRLALASAAQAELQVRVNNPDRNIPAIFSTGLIGKDNAIGRHGIHGLYWLFSVEILGSS  606

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V G N +YL Q+ A  P  GIMYDYIR E 
Sbjct  607   LVTGNNTIYLTQADATGPLQGIMYDYIRFEG  637



>ref|XP_008781370.1| PREDICTED: probable rhamnogalacturonate lyase B [Phoenix dactylifera]
Length=657

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/629 (52%), Positives = 433/629 (69%), Gaps = 12/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L V    V++DNGI+++ LS  EG + G+ Y GVD NL+E+ N+   RGYWDL W+  
Sbjct  30    VSLAVRNGYVIIDNGILQLKLSKHEGMMTGVRYNGVD-NLMEVHNREDSRGYWDLVWDGT  88

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
             K       KI  T F++I + E QVEVSF +T+  S + T +P+NIDKRFVML GSSGFY
Sbjct  89    KAYGIFD-KIKGTKFRIIFQSEEQVEVSFTRTWTPSLNGTLVPLNIDKRFVMLRGSSGFY  147

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             TYAI++H KG  D D+ + RVVF+L++  F ++A++D  Q  MP  ++R  E  + L Y 
Sbjct  148   TYAIFEHQKGWPDFDIAEIRVVFRLNKDKFHYMAISDNKQRIMPMPEDRTPERCQQLAYP  207

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV LT   NP+LKG VDDKYQY+ + Q+  V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  208   EAVLLTNPINPQLKGDVDDKYQYSCEDQDNKVHGWISFDPPIGFWQITPSDEFRTGGPLK  267

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWE  1290
             QDLT H GP  L+MF+S HYSG+   +K R GE WK VFGPVF+Y+NS   G + K LW+
Sbjct  268   QDLTSHVGPTTLAMFVSSHYSGE--VLKFRYGEYWKKVFGPVFVYLNSASDGKNPKALWQ  325

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM  E K WPYSFP S+D+ K+++RG+VSG+LL+ D      D  A  ++VGLA P
Sbjct  326   DAKMQMQREVKSWPYSFPGSKDFQKSSERGSVSGKLLVRDRYIHGEDIDANGSYVGLALP  385

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ +   YQFWTR D  G F I  VR G+Y+LYAWVPG +GD+K+ A ITI  G 
Sbjct  386   GEAGSWQRECKGYQFWTRADANGSFSIRNVRTGQYNLYAWVPGFIGDYKYNATITITSGN  445

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWD  1827
             ++ +GDLVF P ++G T+WEIGIPDRSAAEF+IP P     N L ++D  ++FRQYGLW+
Sbjct  446   NVDLGDLVFEPPRDGVTLWEIGIPDRSAAEFYIPNPNLKYVNRLYINDSADRFRQYGLWE  505

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+   DLVYT+G+SD   DWFFAQVTRK  + SY+ T W + F +++V   G Y L
Sbjct  506   RYADLYPNRDLVYTIGESDYKNDWFFAQVTRKTDQNSYKPTTWQIKFHLDSVNPSGSYNL  565

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L +  + + K +   FT++L GKDNAIARHGIHGLY   +  I  + +V
Sbjct  566   RVALASATHSKLQVHFS-NLKANPPHFTAELNGKDNAIARHGIHGLYWLYNINIQNNWLV  624

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L Q  +  PF GIMYDYIR+E 
Sbjct  625   QGDNTIFLTQPNSQSPFQGIMYDYIRMEG  653



>ref|XP_006338026.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=623

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/619 (52%), Positives = 427/619 (69%), Gaps = 9/619 (1%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF--K  609
             MDNGI++V LS P+G V GI Y GVD NLLE+ N   +RGYWD+ W++     +T    +
Sbjct  1     MDNGILQVTLSVPDGIVTGITYNGVD-NLLEVLNDETNRGYWDVVWSSTGTTGTTGTFER  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             ++ T  KVI+E + Q+E+SF +T+    + + IP+NIDKRF+ML GSSGFY+YAIY+H +
Sbjct  60    LICTTHKVILETDDQIELSFSRTWDVSFQDELIPLNIDKRFIMLKGSSGFYSYAIYEHLE  119

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
             G    +LD+TR+ FKL +  F ++A+ D  Q  MP   +R  + G+ L Y EAV L    
Sbjct  120   GWPGFNLDETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRLPDRGQPLAYPEAVLLVNPI  179

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
              P+ KG+VDDKYQY+ +  ++ V+GWI   P LGFWII  S+EFR GGPLKQ+LT H GP
Sbjct  180   EPEFKGEVDDKYQYSCEDNDLKVHGWICMDPSLGFWIIIPSDEFRSGGPLKQNLTSHVGP  239

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEE  1317
              ALS+FLS HY+G+D   K   GE WK VFGPVFIY+NS   G D  TLWE AKKQML E
Sbjct  240   TALSVFLSAHYAGEDLVPKFGQGEPWKKVFGPVFIYLNSVTSGEDPITLWEDAKKQMLME  299

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
              + WPYSFP SED+P ++QRG +SGRLL+ D         A  A+VGLA PGE GSWQ +
Sbjct  300   VQSWPYSFPASEDFPSSSQRGNISGRLLVLDRYFKDDKISASGAYVGLAPPGEAGSWQRE  359

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
                YQFWTR D+ G + IS +RAG+Y+LYA+VPG +GD+K+   ITI  GC I++ DLVF
Sbjct  360   CKDYQFWTRADEEGNYVISNIRAGDYNLYAYVPGFIGDYKYDIKITITSGCSIEMDDLVF  419

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-D  1854
              P +NG T+WEIGIPDRSA EF+IP+P P   N L  +  ++FRQYGLW+RY++L+   D
Sbjct  420   EPPRNGPTLWEIGIPDRSAREFYIPDPDPKYVNKLFINHPDRFRQYGLWERYADLYPNGD  479

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTRA  2031
             +V+T+G+SD  KDWFF QVTRK  + +Y+ T W + F ++ V +   YTLR+A+AS+ +A
Sbjct  480   IVFTIGESDYKKDWFFVQVTRKTDEKTYQGTTWQIKFKLDNVDQNEIYTLRLALASAAQA  539

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L + VN     +   F+S + GKDNAIARHGIHGL    +  + G+++++GEN +YL Q
Sbjct  540   ELQVRVNDSSSMNTPLFSSGVIGKDNAIARHGIHGLNWLFNVNLQGTILIEGENTIYLTQ  599

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             + A  PF GIMYDYIRLE 
Sbjct  600   ANATSPFQGIMYDYIRLEG  618



>ref|XP_004238021.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Solanum 
lycopersicum]
 ref|XP_010320234.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Solanum 
lycopersicum]
Length=637

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/631 (51%), Positives = 427/631 (68%), Gaps = 11/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNG+++V LSNP+G V GI Y  VD NLLE  N   +RGYWD+ WN+P
Sbjct  6     VRLYIQDRHVMMDNGLVQVTLSNPDGIVTGIRYNDVD-NLLEGLNDESNRGYWDVVWNSP  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 +  F+++  T+FKVI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  65    DGGKTGVFEVIKGTNFKVIKETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGCSGF  124

Query  757   YTYAIYDHPKGG--VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--L  924
             Y+YAIY+H          + +TR+ FKL +  F ++AV D  Q  MP   +R       L
Sbjct  125   YSYAIYEHVGSSEWPAFSIGETRIAFKLRKDKFHYMAVADNKQRFMPLPDDRMPARCQRL  184

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
              Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR GG
Sbjct  185   AYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSGG  244

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-TDHKT  1281
             P+KQ+LT H GP  L+MFLS HY+GDD       GEAWK VFGPVFIY+NS     D  T
Sbjct  245   PVKQNLTSHVGPTTLAMFLSSHYAGDDLTPNFAQGEAWKKVFGPVFIYLNSVMPWEDPVT  304

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LW+ AK QM  E + WPYSFP SED+P A QRG+VSG+LL+ D        PA  A+VGL
Sbjct  305   LWDDAKIQMQREVQSWPYSFPVSEDFPSADQRGSVSGKLLVQDKYISDDHIPANGAYVGL  364

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PGE GSWQ +   YQFW ++D+ G F I+ +  G+Y LYAWVPG +GD+ ++  I+I 
Sbjct  365   APPGEAGSWQKECKDYQFWAKSDNNGNFSINNICPGDYKLYAWVPGFIGDYLYETPISIT  424

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC I V ++V+ P ++G T+WEIGIPDR+AAEFF+PEP P   N L  +  ++FRQYGL
Sbjct  425   PGCSIDVDEIVYQPPRDGPTLWEIGIPDRTAAEFFVPEPNPKFVNKLFVNHPDRFRQYGL  484

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCY  1995
             WDRYSEL+ T DLVY  G+SD  KDWFFAQV R+   GSY+ T W + F +++V + G Y
Sbjct  485   WDRYSELYPTDDLVYVTGESDYTKDWFFAQVPRRKEDGSYQGTTWQIRFKLDSVNQGGTY  544

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LRIA+AS+T A + + VN +P  ++  F++ L G+DN+IARHGIHGLY   + +I G+L
Sbjct  545   KLRIAIASATLAEVQVRVN-NPSTNRPVFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNL  603

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  604   LVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  634



>ref|XP_004136251.1| PREDICTED: rhamnogalacturonate lyase B-like [Cucumis sativus]
 gb|KGN60274.1| hypothetical protein Csa_3G892750 [Cucumis sativus]
Length=642

 Score =   637 bits (1643),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/633 (51%), Positives = 436/633 (69%), Gaps = 10/633 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A + ++L +    V+MDNGI++V LS P+G+V GI Y  +D N+LE+ +K   RGYWDL 
Sbjct  2     ANEILQLDIQDHHVVMDNGILQVTLSKPDGNVTGIKYNSID-NVLEVDDKEAHRGYWDLV  60

Query  571   WNTPKEKASTSF-KILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGS  747
             WN+     + +F ++   +F+V+++ E Q+E+SFK+ Y   DK  +P+NIDKRF+ML  S
Sbjct  61    WNSGTPGTTGTFDEMRGREFEVMVQNEEQIELSFKRNYSFKDKA-VPLNIDKRFIMLRNS  119

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFY+YAIY+H +     +L QTR+VFKL +  F ++A+ D+ Q  MP  ++R    G+ 
Sbjct  120   SGFYSYAIYEHMREWPPFNLPQTRIVFKLRKDKFHYMAIADDRQRFMPLPEDRLRHRGKP  179

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L++ EAV L   + P+ KG+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR G
Sbjct  180   LDFPEAVLLVNPKEPEFKGEVDDKYQYSCENKDLKVHGWISMDPPVGFWQITPSSEFRSG  239

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GPLKQ+LT H GP+AL+MFLS HYSG+D  +K+   E WK VFGPVF Y+NS   G D  
Sbjct  240   GPLKQNLTSHVGPYALAMFLSAHYSGEDLVLKVSPDEPWKKVFGPVFFYLNSVSDGGDPL  299

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             +LWE AK QM +E + WPYSFP SED+P   QRG ++G+L + D    +   PA  A+VG
Sbjct  300   SLWEDAKTQMSKEVQSWPYSFPASEDFPPPNQRGRLTGKLFVLDRYVNEEKMPATDAYVG  359

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG+ GSWQ +   YQFWT+TD  G F I  VR G+Y+LYAWVPG +GD+++   I +
Sbjct  360   LAAPGDVGSWQTEKKGYQFWTKTDADGSFSIEHVRIGDYNLYAWVPGFIGDYRYDVLINV  419

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G D+ VGDLV+ P +NG T+WEIGIPDRSAAEF+IP+P P   N L  +  ++FRQYG
Sbjct  420   SSGSDMDVGDLVYEPPRNGPTLWEIGIPDRSAAEFYIPDPDPKYINKLYINHPDRFRQYG  479

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGC  1992
             LW++Y+ELH   DLVY+VG SD  KDWFFA V RK   GS+ AT W + F ++ +  KG 
Sbjct  480   LWEKYAELHPDADLVYSVGVSDYTKDWFFAHVNRKRNDGSHLATTWEIKFRLDNIIDKGV  539

Query  1993  -YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTLR+A+A++  A L I VN +P+   + FT+ + G DNAIARHGIHGLY   S +I G
Sbjct  540   SYTLRVALATANVAELQIQVN-NPEAKPSLFTTGVIGHDNAIARHGIHGLYRLYSVDILG  598

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             SL+V+GEN ++L Q      F GIMYDYIRLE 
Sbjct  599   SLLVEGENTIFLSQIINNSSFNGIMYDYIRLEG  631



>ref|XP_010060119.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Eucalyptus 
grandis]
 gb|KCW66667.1| hypothetical protein EUGRSUZ_F00442 [Eucalyptus grandis]
Length=631

 Score =   637 bits (1642),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/628 (51%), Positives = 423/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V+MDNGI++V LS P+G V G+ Y GVD NLLE+ N+  +RGYWDL WN P
Sbjct  6     VHLHIRHNQVIMDNGIVQVTLSKPDGIVIGVRYNGVD-NLLEICNQESNRGYWDLVWNAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F VI+E E QVE+SF +T+  S +   +P+NIDKRF+ML GSSGFY
Sbjct  65    GSKGIFDV-IKGTCFNVIVENEEQVELSFVRTWDFSLEGKYVPLNIDKRFIMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIYDH       ++ +TR+ FKL +  F ++A+ D+ Q +MP   +R  G  + L Y 
Sbjct  124   SYAIYDHLADWPSFEIGETRITFKLRKDKFHYMAIADDRQRKMPLPDDRLPGRCQTLAYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L    +P+L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLVNPVDPELRGEVDDKYQYSCNNKDIQVHGWISSDPAIGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH-KTLWE  1290
             Q LT H GP  L++FLS HY+G D   K   GE WK VFGPVFIY+NS    D  + LWE
Sbjct  244   QSLTSHVGPTTLAIFLSAHYAGKDLVPKFGPGEPWKKVFGPVFIYLNSASARDDPRFLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPY+FP SED+PK+ QRG V GRLL+ D         AK A+VGLA P
Sbjct  304   DAKIQMMNEVERWPYNFPASEDFPKSHQRGNVRGRLLVQDRYVSNDYISAKRAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT+ D+ G F I+ VR+G+Y+LYAWVPG +GD++H   ITI  G 
Sbjct  364   GDAGSWQRECKGYQFWTQADNDGYFSINNVRSGDYNLYAWVPGFIGDYRHDNIITISSGL  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             D  +GDLV+ P + G T+WEIGIPDRSAAEF++P+P     N L     ++FRQYGLW R
Sbjct  424   DHDMGDLVYEPPREGATLWEIGIPDRSAAEFYVPDPDASYINRLYVHHPDRFRQYGLWSR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             Y EL+ + DLVYT+G SD  KDWFFAQV R+   GS+E T W + F +  V +   + LR
Sbjct  484   YGELYPEKDLVYTIGVSDHTKDWFFAQVPRRKQDGSHEGTTWQIKFNLSYVERSKSHKLR  543

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             IA+AS+T A L + VN DPK  +  FTS L G+DN+IARHGI GLY   +  +PG+L+ +
Sbjct  544   IAIASATLAELQVRVN-DPKARRPLFTSGLIGRDNSIARHGIQGLYWLFNVNVPGTLLNE  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q +   PF G+MYDY+RLE 
Sbjct  603   GENTIFLTQPRCDSPFQGLMYDYLRLEG  630



>ref|XP_002308510.2| hypothetical protein POPTR_0006s23510g [Populus trichocarpa]
 gb|EEE92033.2| hypothetical protein POPTR_0006s23510g [Populus trichocarpa]
Length=678

 Score =   638 bits (1646),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/628 (51%), Positives = 435/628 (69%), Gaps = 10/628 (2%)
 Frame = +1

Query  403   VKLTV-TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             V+L +  ++ V++DNG+++V  S+P+G V GI Y+G+D N+LE+ N   +RGYWD+ WN 
Sbjct  51    VQLNIKNRQRVVIDNGLVEVTFSSPDGDVTGIKYKGID-NVLEIGNDEDNRGYWDVVWNK  109

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
             P +      K++ATDFKVIME E+QVEVSF KT+  S   + +P+N+DKR+++  G SG 
Sbjct  110   PGDPIIFD-KLVATDFKVIMEDENQVEVSFTKTWDLSMGNSTVPLNVDKRYIVRRGQSGL  168

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKE  936
             Y Y I +  +G  DVD+DQ RVVFKL +  F ++A++D  +  MP  ++R  G+ L Y E
Sbjct  169   YLYTILERLEGWPDVDMDQIRVVFKLQKDKFHYMALSDSRKRTMPMPEDRVSGQPLAYPE  228

Query  937   AVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQ  1116
             AV LTK  N KL+G+VDDKYQY+ + ++  V+GW +  P +GFW+IT SNEFR+GGP KQ
Sbjct  229   AVLLTKPINLKLRGEVDDKYQYSCEDKDNKVHGWTAEDPPVGFWMITPSNEFRVGGPNKQ  288

Query  1117  DLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWEG  1293
             DLT H GP  L+MF S HY+G D     R GE WK V GPVF+Y+NS    ++ + LWE 
Sbjct  289   DLTSHVGPVVLNMFTSTHYAGKDLNTAYRNGEPWKKVLGPVFVYLNSISPKENSSMLWED  348

Query  1294  AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPG  1473
             AK+QM  E   WPY FP+SED+P + QRGAV+G+LL+ D    +  T A  A+VGLA PG
Sbjct  349   AKEQMSIEVNRWPYDFPQSEDFPSSDQRGAVTGQLLVRDRYVNQRLTYASSAYVGLAAPG  408

Query  1474  EPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCD  1653
             + GSWQ +S  YQFW R D  G F I  VRAG YSLYAWVPG +GD+K+ A+ITI PG  
Sbjct  409   DVGSWQTESKGYQFWIRADRHGHFVIKNVRAGNYSLYAWVPGVIGDYKYGANITINPGSR  468

Query  1654  IKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLS-DRTEKFRQYGLWDR  1830
             I+ G L++ P +NG T+W+IGIPDR+AAEF++P+  P L N L + +  EKFRQYGLW+R
Sbjct  469   IRFGHLIYEPPRNGPTLWDIGIPDRTAAEFYVPDGYPTLMNTLYTREPAEKFRQYGLWNR  528

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             YS+L+   DLVYT+G S+  KDWFFA VTR     +Y+ T W ++F +E V +   YTLR
Sbjct  529   YSDLYPNDDLVYTIGISN-VKDWFFAHVTRDAGNKTYDPTTWQIIFELENVNRNENYTLR  587

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T + + +  N +P  D+  FT+   GKDNAIARHGIHGLY     ++PGS +V+
Sbjct  588   LALASATASEIQVRFN-NPSSDRPLFTTGAVGKDNAIARHGIHGLYWLYGIDVPGSQLVE  646

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G+N +YL Q+++  PF G+MYDYIR E 
Sbjct  647   GKNTIYLTQARSDGPFQGVMYDYIRFEG  674



>ref|XP_010060118.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Eucalyptus 
grandis]
Length=655

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/628 (51%), Positives = 423/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V+MDNGI++V LS P+G V G+ Y GVD NLLE+ N+  +RGYWDL WN P
Sbjct  30    VHLHIRHNQVIMDNGIVQVTLSKPDGIVIGVRYNGVD-NLLEICNQESNRGYWDLVWNAP  88

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F VI+E E QVE+SF +T+  S +   +P+NIDKRF+ML GSSGFY
Sbjct  89    GSKGIFDV-IKGTCFNVIVENEEQVELSFVRTWDFSLEGKYVPLNIDKRFIMLRGSSGFY  147

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIYDH       ++ +TR+ FKL +  F ++A+ D+ Q +MP   +R  G  + L Y 
Sbjct  148   SYAIYDHLADWPSFEIGETRITFKLRKDKFHYMAIADDRQRKMPLPDDRLPGRCQTLAYP  207

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L    +P+L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  208   EAVLLVNPVDPELRGEVDDKYQYSCNNKDIQVHGWISSDPAIGFWQITPSDEFRSGGPLK  267

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH-KTLWE  1290
             Q LT H GP  L++FLS HY+G D   K   GE WK VFGPVFIY+NS    D  + LWE
Sbjct  268   QSLTSHVGPTTLAIFLSAHYAGKDLVPKFGPGEPWKKVFGPVFIYLNSASARDDPRFLWE  327

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPY+FP SED+PK+ QRG V GRLL+ D         AK A+VGLA P
Sbjct  328   DAKIQMMNEVERWPYNFPASEDFPKSHQRGNVRGRLLVQDRYVSNDYISAKRAYVGLAPP  387

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT+ D+ G F I+ VR+G+Y+LYAWVPG +GD++H   ITI  G 
Sbjct  388   GDAGSWQRECKGYQFWTQADNDGYFSINNVRSGDYNLYAWVPGFIGDYRHDNIITISSGL  447

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             D  +GDLV+ P + G T+WEIGIPDRSAAEF++P+P     N L     ++FRQYGLW R
Sbjct  448   DHDMGDLVYEPPREGATLWEIGIPDRSAAEFYVPDPDASYINRLYVHHPDRFRQYGLWSR  507

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             Y EL+ + DLVYT+G SD  KDWFFAQV R+   GS+E T W + F +  V +   + LR
Sbjct  508   YGELYPEKDLVYTIGVSDHTKDWFFAQVPRRKQDGSHEGTTWQIKFNLSYVERSKSHKLR  567

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             IA+AS+T A L + VN DPK  +  FTS L G+DN+IARHGI GLY   +  +PG+L+ +
Sbjct  568   IAIASATLAELQVRVN-DPKARRPLFTSGLIGRDNSIARHGIQGLYWLFNVNVPGTLLNE  626

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q +   PF G+MYDY+RLE 
Sbjct  627   GENTIFLTQPRCDSPFQGLMYDYLRLEG  654



>ref|XP_004288494.1| PREDICTED: rhamnogalacturonate lyase B-like [Fragaria vesca subsp. 
vesca]
Length=686

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/641 (50%), Positives = 440/641 (69%), Gaps = 18/641 (3%)
 Frame = +1

Query  403   VKLTV-TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             V LT   +  V++DNGI+K+  SNPEG+V GI Y+G+D  +LE+ N+  +RGYWDL W  
Sbjct  52    VSLTAKNRNRVVLDNGIVKLIFSNPEGNVIGIQYKGLD--ILEMGNEEDNRGYWDLVW--  107

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKS--GDKTDI-PINIDKRFVMLPGSS  750
                K +T+ K+ AT FKVI  +  Q E+SF +TY    G+ T+I P+ +DKR+++  G+S
Sbjct  108   ---KKNTTDKLQATKFKVITARPDQAEISFLRTYDVSLGNGTNIIPLTVDKRYILRRGAS  164

Query  751   GFYTYAIYDHPKGGVDV-DLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLN  927
             GFY Y I++  +G   V D+DQ R+VFKL ++ F ++A++D  Q  MP+  +R  GE L 
Sbjct  165   GFYAYGIFERLEGWPGVQDMDQIRMVFKLEQAKFDYMALSDTRQRMMPTAADRGNGEQLA  224

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             YKEAV LT   NP+ +G+VDDKYQY+++ ++  V+GWIS    +GFW+IT S+EFR GGP
Sbjct  225   YKEAVLLTDPSNPEFRGEVDDKYQYSIEDKDNKVHGWISTDESVGFWMITPSDEFRTGGP  284

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT--  1281
              KQDLT H GP  LSMF+S HY+G D GIK   GEAWK VFGPVF+Y+NS   + + T  
Sbjct  285   FKQDLTSHVGPTTLSMFVSTHYAGKDLGIKFEEGEAWKKVFGPVFVYLNSAPSSKNSTSI  344

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LW  AK+Q+ +E ++WPY+F +SED+P + QRG+VSG+L IHD    ++  PA   +VGL
Sbjct  345   LWNNAKQQLFKEVEIWPYNFTQSEDFPSSDQRGSVSGQLQIHDRYINESLLPASSGYVGL  404

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PGE GSWQ ++  YQFW + D+ G+F +  VR G YSLYAWVPG +GD+K++ADITI 
Sbjct  405   AAPGEVGSWQRENKGYQFWNQADEEGRFILKDVRPGNYSLYAWVPGVVGDYKYEADITII  464

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-RTEKFRQYG  1818
             PGC+IK+ +L F P + G T+WEIGIPDR+AAEF++P+P P L N L +   +E FRQYG
Sbjct  465   PGCNIKLDNLTFEPPRTGPTLWEIGIPDRTAAEFYVPDPYPTLLNNLYNHIPSENFRQYG  524

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW RY E +  +DLVYTVG ++    WF+AQVT+     +Y  T W VVF +  V   G 
Sbjct  525   LWARYGERYPHSDLVYTVGVNNYTDHWFYAQVTKITGDETYVGTTWEVVFELHNVTNPGI  584

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTL++A+AS+  A L + +N     ++  F++KL G DNAIARHGIHGLY   S EIP S
Sbjct  585   YTLQLALASAHSAELQVRINSQ-SDERPLFSTKLIGGDNAIARHGIHGLYWLFSVEIPSS  643

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEApkkk*ppQI  2295
             L+ +G N +YL Q++ G  F G+MYDYIRLEAP      Q+
Sbjct  644   LLKEGNNSVYLSQTRGGETFQGVMYDYIRLEAPSSHTDSQV  684



>ref|XP_010060117.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Eucalyptus 
grandis]
 gb|KCW66666.1| hypothetical protein EUGRSUZ_F00442 [Eucalyptus grandis]
Length=675

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/628 (51%), Positives = 423/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V+MDNGI++V LS P+G V G+ Y GVD NLLE+ N+  +RGYWDL WN P
Sbjct  50    VHLHIRHNQVIMDNGIVQVTLSKPDGIVIGVRYNGVD-NLLEICNQESNRGYWDLVWNAP  108

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F VI+E E QVE+SF +T+  S +   +P+NIDKRF+ML GSSGFY
Sbjct  109   GSKGIFDV-IKGTCFNVIVENEEQVELSFVRTWDFSLEGKYVPLNIDKRFIMLRGSSGFY  167

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIYDH       ++ +TR+ FKL +  F ++A+ D+ Q +MP   +R  G  + L Y 
Sbjct  168   SYAIYDHLADWPSFEIGETRITFKLRKDKFHYMAIADDRQRKMPLPDDRLPGRCQTLAYP  227

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L    +P+L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  228   EAVLLVNPVDPELRGEVDDKYQYSCNNKDIQVHGWISSDPAIGFWQITPSDEFRSGGPLK  287

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH-KTLWE  1290
             Q LT H GP  L++FLS HY+G D   K   GE WK VFGPVFIY+NS    D  + LWE
Sbjct  288   QSLTSHVGPTTLAIFLSAHYAGKDLVPKFGPGEPWKKVFGPVFIYLNSASARDDPRFLWE  347

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPY+FP SED+PK+ QRG V GRLL+ D         AK A+VGLA P
Sbjct  348   DAKIQMMNEVERWPYNFPASEDFPKSHQRGNVRGRLLVQDRYVSNDYISAKRAYVGLAPP  407

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT+ D+ G F I+ VR+G+Y+LYAWVPG +GD++H   ITI  G 
Sbjct  408   GDAGSWQRECKGYQFWTQADNDGYFSINNVRSGDYNLYAWVPGFIGDYRHDNIITISSGL  467

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             D  +GDLV+ P + G T+WEIGIPDRSAAEF++P+P     N L     ++FRQYGLW R
Sbjct  468   DHDMGDLVYEPPREGATLWEIGIPDRSAAEFYVPDPDASYINRLYVHHPDRFRQYGLWSR  527

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             Y EL+ + DLVYT+G SD  KDWFFAQV R+   GS+E T W + F +  V +   + LR
Sbjct  528   YGELYPEKDLVYTIGVSDHTKDWFFAQVPRRKQDGSHEGTTWQIKFNLSYVERSKSHKLR  587

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             IA+AS+T A L + VN DPK  +  FTS L G+DN+IARHGI GLY   +  +PG+L+ +
Sbjct  588   IAIASATLAELQVRVN-DPKARRPLFTSGLIGRDNSIARHGIQGLYWLFNVNVPGTLLNE  646

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q +   PF G+MYDY+RLE 
Sbjct  647   GENTIFLTQPRCDSPFQGLMYDYLRLEG  674



>ref|XP_009406080.1| PREDICTED: probable rhamnogalacturonate lyase B [Musa acuminata 
subsp. malaccensis]
Length=639

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/628 (52%), Positives = 432/628 (69%), Gaps = 12/628 (2%)
 Frame = +1

Query  409   LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKE  588
             LT  +  VL+DNGI+++ LS P GS+ G+ Y G+D N+ E+  K   RGYWDL WN P +
Sbjct  3     LTEVELEVLLDNGIVQLTLSKPGGSITGVRYHGLD-NVNEVKEKEDGRGYWDLVWN-PSD  60

Query  589   KASTSF-KILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYT  762
             + S  F KIL T+F V  +  + VEVSF+  +    +   +P+NIDKRFVML GSSGFYT
Sbjct  61    RDSGIFQKILGTEFDVAQQDANHVEVSFRTKWDPSHRGKFVPLNIDKRFVMLRGSSGFYT  120

Query  763   YAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--LNYKE  936
             YAIY+H +G  D +L +TRVVFKL +  F H+A+ D  Q  MP   +R +G    L Y E
Sbjct  121   YAIYEHLQGWPDFNLGETRVVFKLRKDKFHHMAIADNRQRIMPMPDDRRDGRSHKLGYPE  180

Query  937   AVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQ  1116
             AV+L    N  L+G+VDDKYQY+ ++++  V+GWIS  P +GFW+IT SNEF+ GGP++Q
Sbjct  181   AVRLIDPTNAALRGEVDDKYQYSSENKDSLVHGWISSDPSVGFWVITPSNEFKSGGPVRQ  240

Query  1117  DLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWE  1290
             DLT H GP ALSMF+S HYSG D   K R GE WK VFGPVFIY+NS  DK +D K LWE
Sbjct  241   DLTSHVGPTALSMFVSSHYSGVDTVPKFRNGEYWKKVFGPVFIYLNSAPDK-SDPKLLWE  299

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              A+KQM  E + WPY FP SED+ K+ QRG+VSGRLL+ D    K       A VGLA P
Sbjct  300   DAQKQMQVEVEKWPYEFPASEDFHKSEQRGSVSGRLLVLDKHISKEYINGNAAFVGLASP  359

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ +S  YQFW + D  G F I  VR G Y+LYAWVPG +GD+K   +IT+  G 
Sbjct  360   GEAGSWQRESKGYQFWVKADVNGNFFIKNVRTGVYNLYAWVPGFIGDYKSSLNITVTSGN  419

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I +G LV+ P ++G T+WEIGIPDRSAAEFF+P+P P   N L  D +++FRQYGLW+R
Sbjct  420   HINLGSLVYNPPRDGPTLWEIGIPDRSAAEFFVPDPDPKHTNRLYVDHSDRFRQYGLWER  479

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLR  2004
             Y++L+   DL+YT+G SD  KDWF+AQVTRK+ +GS++AT W + F +++V   G Y LR
Sbjct  480   YADLYPDGDLIYTIGVSDYRKDWFYAQVTRKDGQGSHQATTWQIRFRLDSVHPNGPYKLR  539

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+A++  + L +  N +P+   A FT++L G+DN+IAR GIHGLY   S ++  S +++
Sbjct  540   VALAAAHLSELQVRFN-NPRVQPAHFTTRLIGRDNSIARQGIHGLYWLFSVDVESSWLLE  598

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G+N ++L Q++   PF G+MYDYIR+EA
Sbjct  599   GDNIIFLTQTRCQSPFQGVMYDYIRMEA  626



>ref|XP_006472411.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Citrus 
sinensis]
Length=650

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/630 (51%), Positives = 422/630 (67%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V++DNGI++V  S P G V GI Y  +D NLLE+ N   +RGYWDL WN P
Sbjct  6     VNLLIQDRHVVLDNGILEVTFSYPGGIVTGIRYNDID-NLLEVLNDELNRGYWDLVWNAP  64

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
                 +      I  T F VI+E E QVE+SF +T+ S  +   +P+NIDKRFVML GSSG
Sbjct  65    GSTGTRGIFDVIQGTSFNVIVENEDQVEISFTRTWDSSLEGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTY+IY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYSIYEHLEEWPGFNLGETRIAFKLRKDKFHYMAIADNRQRYMPLPDDRVPPRGQPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P  KG+VDDKYQY+ D+++++V+GWI   P +GFW IT S EFR GGP
Sbjct  185   YPEAVLLVNPVEPDFKGEVDDKYQYSCDNKDINVHGWICTDPPVGFWHITPSAEFRTGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
              KQ+LT H GP  LS+F+S HYSG+D   K   GEAWK VFGPVF+Y NS   G D  +L
Sbjct  245   QKQNLTSHVGPTTLSVFVSAHYSGEDLVPKFNAGEAWKKVFGPVFVYCNSAFDGDDPLSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QM  ET+ WPYSFP S+D+PK+ QRG VSGRLL+ D         A  A+VGLA
Sbjct  305   WDDAKMQMSVETESWPYSFPASDDFPKSDQRGNVSGRLLVQDEYISDDYISASGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT  D+ G F I+AVRAG+Y+LYAWVPG +GD+++   + I P
Sbjct  365   PPGDAGSWQRECKDYQFWTSADEDGYFSITAVRAGDYNLYAWVPGFIGDYRYDVVVNITP  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G DI +GDLV+ P +NG T+WEIGIPDRSAAEF++P+P P   N L  D+ ++FRQYGLW
Sbjct  425   GFDIDMGDLVYEPPRNGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYLDQPDRFRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DLVYTVG SD  KDWFF QVTRK    +Y+ + W + F ++ V +   Y 
Sbjct  485   ERYAELYPDGDLVYTVGSSDYTKDWFFVQVTRKKDNNTYQGSTWQIKFELDDVNQSSTYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + +N DP  ++  F+S L G+DN+IARHGIHGLY   + ++PG+ +
Sbjct  545   LRVAIASANLSELQVRIN-DPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V G+N ++L Q ++  PF GIMYDYIR E 
Sbjct  604   VSGDNTIFLTQPRSTSPFQGIMYDYIRFEG  633



>ref|XP_006364654.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=649

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/608 (51%), Positives = 421/608 (69%), Gaps = 12/608 (2%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV LTVT + V++DNGI++++L+NP GS+ G+ Y G+D NLLE   + + RGYWD  WN 
Sbjct  51    PVTLTVTSQYVVIDNGIVQLSLTNPTGSIFGVKYNGID-NLLEPLQETQ-RGYWDTMWNG  108

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
               +       +LA+ F VI + +++VEVSF+K +   +  + P+N+DKR+VML GSSGFY
Sbjct  109   KFDT------LLASKFSVIAQDDNKVEVSFQKIHDPLNGNNPPLNVDKRYVMLRGSSGFY  162

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y I+ H KG   V+LD+ R+  KLS+SLF  +A++D+ Q  MP+ ++R  G+ L+Y+EA
Sbjct  163   SYGIFQHLKGWPAVNLDEARIAIKLSKSLFHFMAISDDRQRIMPTEEDRASGQTLDYREA  222

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             VK+T   NP+LK +VDDKYQY  + +N+ V+GWIS  PH+GFW+I+ S E+  GGP+KQD
Sbjct  223   VKITNPSNPRLKDEVDDKYQYTDEIKNIKVHGWISDTPHMGFWVISPSYEYCNGGPMKQD  282

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAK  1299
             LT H GP +++MF S HY+G   G+ L  GEAW  VFGPVF Y+NSD   DH  LWE AK
Sbjct  283   LTSHVGPTSMAMFFSGHYAGPQLGVSLTNGEAWTKVFGPVFFYVNSDSSNDHTILWEDAK  342

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
             +QM EET  WPY FP S DY  A QRG+VSG+L++HD        PA  A++GLA+PG  
Sbjct  343   RQMNEETNKWPYDFPASIDYLHANQRGSVSGQLMVHDWYINVDPLPALNAYIGLAEPGLV  402

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ+++  YQFWT+TDD+G F I+ VR G Y +Y+WVPG +GD+K  + IT+  G D  
Sbjct  403   GSWQSETKGYQFWTQTDDSGNFNINNVRPGIYGVYSWVPGVMGDYKFSSYITVTQGKDTN  462

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRT-EKFRQYGLWDRYS  1836
             +G ++F   +NG  +WEIG PDR+A EFFIP+P P L+NYL ++ T  KFRQYGLWDRY+
Sbjct  463   LGQIIFEAPRNGPPLWEIGFPDRTANEFFIPDPLPGLQNYLYTNTTIHKFRQYGLWDRYT  522

Query  1837  ELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIA  2010
             +L+   DLVY +G SD  KDWFFA V R+N   S+ AT W +VF ++ V + G Y L IA
Sbjct  523   DLYPNGDLVYKIGVSDFRKDWFFAHVNRRNKDRSFSATTWQIVFDVKNVDSSGTYHLHIA  582

Query  2011  VASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGE  2190
             +AS++ A LL+W+N  P K +  F S   G  NAIARHGIHGLY     E PG+ +  GE
Sbjct  583   LASASYAHLLVWIN-TPSKPRPWFDSSPIGMSNAIARHGIHGLYMTFDIEFPGTQLYIGE  641

Query  2191  NKLYLRQS  2214
             N +YL+Q+
Sbjct  642   NIIYLKQA  649



>ref|XP_009795923.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
sylvestris]
Length=640

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/621 (52%), Positives = 430/621 (69%), Gaps = 10/621 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF-  606
             V+MDNGI++V LS P+G V GI Y GVD NLLE+ N   +RGYWD+ W+      +T   
Sbjct  17    VVMDNGIVQVTLSVPDGIVTGIDYNGVD-NLLEILNNETNRGYWDVVWSPAGTTGTTGTF  75

Query  607   -KILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDH  780
              +++ T +KVI+E++ Q+E+SF +T+  S     IP+NIDKRF+ML GSSGFY+YAIY+H
Sbjct  76    ERLICTTYKVILERDDQIELSFSRTWDVSLQDKLIPLNIDKRFIMLKGSSGFYSYAIYEH  135

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTK  954
              +     +LD+TR+ FKL +  F ++A+TD  Q  MP   +R  + G  L Y EAV L  
Sbjct  136   LEVWPGFNLDETRIAFKLRKDKFHYMAMTDNRQRYMPLPDDRLPDRGRPLAYPEAVLLVN  195

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
                P+ KG+VDDKYQY+ + +++ V+GWI   P LGFWII  S+EFR GGPLKQ+LT H 
Sbjct  196   PVEPEFKGEVDDKYQYSCEDKDLKVHGWICMDPPLGFWIIIPSDEFRSGGPLKQNLTSHV  255

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYIN-SDKGTDHKTLWEGAKKQML  1311
             GP ALSMFLS HY+G+D   K   GE WK VFGPVF+Y+N  ++G D   LWE AK+QML
Sbjct  256   GPTALSMFLSAHYAGEDLVAKFGKGEPWKKVFGPVFVYLNYVNEGEDPLILWEDAKEQML  315

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSFP SED+P ++QRG +SGRLL+ D         A  A+VGLA PGE GSWQ
Sbjct  316   VEVQSWPYSFPASEDFPSSSQRGNISGRLLVQDRYFKDDKIYASGAYVGLAPPGEAGSWQ  375

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
              +   YQFWT+ D+ G + IS +RAG+Y+LYA+VPG +GD+K    +TI  GC I++ DL
Sbjct  376   RECKDYQFWTKADEEGYYVISDIRAGDYNLYAFVPGFIGDYKSDTKVTITSGCSIEMDDL  435

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT  1851
             VF P +NG T+WEIGIPDRSA EF+IP+P P   N L  +  +KFRQYGLW+RY++L+  
Sbjct  436   VFEPPRNGPTLWEIGIPDRSAREFYIPDPDPKYINKLFVNHPDKFRQYGLWERYTDLYPN  495

Query  1852  -DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASST  2025
              D+V+T+G+SD  KDWFFAQVTRK  + +Y  T W + F +++V +   Y+LR+A+AS  
Sbjct  496   GDIVFTIGESDYKKDWFFAQVTRKKDEKTYTGTTWQIKFKLDSVNRNETYSLRLALASVA  555

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
             +A L + +N D   +   F+S L GKDNAIARHGIHGLY   +  + G ++V+GEN +YL
Sbjct  556   QAELQVRIN-DSSMNTPLFSSGLIGKDNAIARHGIHGLYWLFNVNLQGDMLVEGENTIYL  614

Query  2206  RQSKAGYPFYGIMYDYIRLEA  2268
              Q++A  PF GIMYDYIRLE 
Sbjct  615   TQARATSPFQGIMYDYIRLEG  635



>gb|KGN60275.1| hypothetical protein Csa_3G892760 [Cucumis sativus]
Length=652

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/631 (51%), Positives = 423/631 (67%), Gaps = 12/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             ++L +  + V+MDNGIIKVNLSNP+G V GI Y+G++ NLL L N   +RGYWD+ WN  
Sbjct  17    LQLHILDQHVVMDNGIIKVNLSNPKGMVNGIEYEGIE-NLLSLDNDEDNRGYWDIVWNLK  75

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDKTD---IPINIDKRFVMLPGS  747
                 +     ++ ATDFKVI+E E Q+E+SF +TY +   T    IP+NIDKRFVML  S
Sbjct  76    GSSGTKGIFDRLEATDFKVIVENEEQIELSFSRTYNNNSSTGGNLIPLNIDKRFVMLRNS  135

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEV  921
             SGFYTYAIY+H K     +LD TR+ FK  +  F ++AV D+ Q  MP   +R+   G+ 
Sbjct  136   SGFYTYAIYEHLKEWPAFNLDNTRIAFKPRKDKFHYMAVADKRQRLMPLPDDRKPPRGQA  195

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P  KG+VDDKYQY  +S++  V+GWIS  P +GFW I  + EFR G
Sbjct  196   LAYPEAVLLVDPIEPDFKGEVDDKYQYGCESKDSRVHGWISTDPPIGFWQIAPTEEFRSG  255

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GPLKQ LT H GP  L++F S HY+G+D  IK    E WK V+GP+FI++NS  +G D  
Sbjct  256   GPLKQFLTSHVGPTTLTVFHSTHYAGEDMVIKFGDNEPWKKVYGPIFIHLNSLPEGEDPL  315

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ AK+QM+ E + WPYSF  SED+PK+ QRG VSG++LI +        PA  A+VG
Sbjct  316   RLWQNAKQQMMAEVQSWPYSFIASEDFPKSDQRGTVSGKILIRERYVSDESVPASGAYVG  375

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQN+S  YQFWTR D  G F ++ VR+G YSLY WVP  +G++++ A I +
Sbjct  376   LALPGELGSWQNESKGYQFWTRADQNGSFSLNNVRSGNYSLYGWVPNFIGNYQYSAFIVV  435

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG DIKVG+LVF P ++G T+WEIGIPDR+AAEF+IP+P P   N L  + +++FRQYG
Sbjct  436   TPGSDIKVGELVFEPPRDGPTLWEIGIPDRTAAEFYIPDPNPKYINKLYVNHSDRFRQYG  495

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGC  1992
             LW+RY+EL+   DLVYTVG SD  KDWFF+QVTRK     Y  T W + F +++    G 
Sbjct  496   LWERYAELYPDEDLVYTVGLSDYRKDWFFSQVTRKIGDNKYAGTTWKIKFQLDSPDTNGT  555

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LR+A+A++  A L + +N D +     FT+ L GKDN +ARHGIHGLY   + +IPG 
Sbjct  556   YRLRLALATAHGAELQVRLN-DAQALPPLFTTGLIGKDNTVARHGIHGLYRLYTVDIPGG  614

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
              +V G N + L Q+ +  PF GIMYDYIRLE
Sbjct  615   ELVVGNNTILLTQASSNSPFVGIMYDYIRLE  645



>ref|XP_010320233.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Solanum 
lycopersicum]
Length=670

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/631 (51%), Positives = 427/631 (68%), Gaps = 11/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNG+++V LSNP+G V GI Y  VD NLLE  N   +RGYWD+ WN+P
Sbjct  39    VRLYIQDRHVMMDNGLVQVTLSNPDGIVTGIRYNDVD-NLLEGLNDESNRGYWDVVWNSP  97

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 +  F+++  T+FKVI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  98    DGGKTGVFEVIKGTNFKVIKETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGCSGF  157

Query  757   YTYAIYDHPKGG--VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--L  924
             Y+YAIY+H          + +TR+ FKL +  F ++AV D  Q  MP   +R       L
Sbjct  158   YSYAIYEHVGSSEWPAFSIGETRIAFKLRKDKFHYMAVADNKQRFMPLPDDRMPARCQRL  217

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
              Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR GG
Sbjct  218   AYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSGG  277

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-TDHKT  1281
             P+KQ+LT H GP  L+MFLS HY+GDD       GEAWK VFGPVFIY+NS     D  T
Sbjct  278   PVKQNLTSHVGPTTLAMFLSSHYAGDDLTPNFAQGEAWKKVFGPVFIYLNSVMPWEDPVT  337

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LW+ AK QM  E + WPYSFP SED+P A QRG+VSG+LL+ D        PA  A+VGL
Sbjct  338   LWDDAKIQMQREVQSWPYSFPVSEDFPSADQRGSVSGKLLVQDKYISDDHIPANGAYVGL  397

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PGE GSWQ +   YQFW ++D+ G F I+ +  G+Y LYAWVPG +GD+ ++  I+I 
Sbjct  398   APPGEAGSWQKECKDYQFWAKSDNNGNFSINNICPGDYKLYAWVPGFIGDYLYETPISIT  457

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC I V ++V+ P ++G T+WEIGIPDR+AAEFF+PEP P   N L  +  ++FRQYGL
Sbjct  458   PGCSIDVDEIVYQPPRDGPTLWEIGIPDRTAAEFFVPEPNPKFVNKLFVNHPDRFRQYGL  517

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCY  1995
             WDRYSEL+ T DLVY  G+SD  KDWFFAQV R+   GSY+ T W + F +++V + G Y
Sbjct  518   WDRYSELYPTDDLVYVTGESDYTKDWFFAQVPRRKEDGSYQGTTWQIRFKLDSVNQGGTY  577

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LRIA+AS+T A + + VN +P  ++  F++ L G+DN+IARHGIHGLY   + +I G+L
Sbjct  578   KLRIAIASATLAEVQVRVN-NPSTNRPVFSTGLIGRDNSIARHGIHGLYWLYNIDIQGNL  636

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  637   LVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  667



>ref|XP_008466137.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Cucumis 
melo]
Length=634

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/632 (52%), Positives = 422/632 (67%), Gaps = 9/632 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + K V+L +    V++DNGI+++ LS P+G + GI Y GVD NLLE+ N   +RGYWDL 
Sbjct  2     SSKAVRLQIRDHHVVVDNGILQLTLSKPDGIITGIRYNGVD-NLLEVLNPESNRGYWDLV  60

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN+P  K      I  + F VI+E E QVE+SF + +  S +   +P+NIDKRF++L GS
Sbjct  61    WNSPGSKGIFDV-IKGSRFSVIVENEEQVELSFVRMWDPSLEGKFVPLNIDKRFIVLRGS  119

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EV  921
             SGFY+YAIY+H K   D D+ +TR+ FKL +  F ++AV D  Q  MP   +R  G  + 
Sbjct  120   SGFYSYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMAVADNRQRVMPLPDDRLSGRCQT  179

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV LT  +N  LKG+VDDKYQY+ ++ N+ V+GWIS  P  GFW IT S+EFR G
Sbjct  180   LAYPEAVLLTDPKNSALKGEVDDKYQYSCENNNLKVHGWISTNPPTGFWQITPSDEFRSG  239

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK-GTDHK  1278
             GPLKQ LT H GP  L++FLS HY+G D   K R GE WK VFGPVF+Y+NS   G D  
Sbjct  240   GPLKQSLTSHVGPTTLAIFLSAHYAGQDLVPKFRAGEPWKKVFGPVFLYLNSTSVGDDPF  299

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E + WPYSFP SED+ K  QRG VSGRLL+ D    +   P   A VG
Sbjct  300   WLWEDAKIQMMAEVESWPYSFPASEDFSKKDQRGMVSGRLLVFDRYVDQDYLPGSGAFVG  359

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             L+ PGE GSWQ +   YQFWTR DD G F I+ V  G+Y+LYAWVPG +GD++  A + +
Sbjct  360   LSAPGEVGSWQRECKGYQFWTRADDGGYFTINHVLTGDYNLYAWVPGFIGDYRCDALVNV  419

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G  I++GDLV+ P ++G T+WEIGIPDRSA+EF++P+P P   N L  +  ++FRQYG
Sbjct  420   SQGSCIEMGDLVYEPPRDGPTLWEIGIPDRSASEFYVPDPNPIYINKLFVNHPDRFRQYG  479

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGC  1992
             LWDRY+EL+   DLVYTVG SD  KDWFFA V RK    S+E T W + F ++ V  K  
Sbjct  480   LWDRYAELYPDEDLVYTVGTSDYRKDWFFAHVPRKTNSNSHEGTTWQIKFQLDRVDRKSM  539

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LR+A+AS+T A L + VN DP+  +  FTS L G+DN+IARHGIHG+Y   S  + G 
Sbjct  540   YMLRVAIASATLAELQVRVN-DPRSKRPLFTSGLIGRDNSIARHGIHGIYWVYSVSVAGC  598

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+GEN ++L Q +   PF GIMYDYIRLE 
Sbjct  599   HLVEGENTIFLTQPRCTSPFQGIMYDYIRLEG  630



>ref|XP_008219222.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=660

 Score =   636 bits (1640),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/639 (50%), Positives = 433/639 (68%), Gaps = 15/639 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + V+L +    V+MDNGI++V LS P+G V  I Y G+D NLLE+ +   DRGYWDL 
Sbjct  2     SSQRVQLDIQDNHVVMDNGILQVTLSKPDGIVTRIQYNGID-NLLEVLSDEVDRGYWDLV  60

Query  571   WNTPKEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLP  741
             W+      +T +F ++  T+FKVI+E E QVEVSF + +    K   +P+NIDKRF+ML 
Sbjct  61    WSEAGSVGTTGTFDVIKGTEFKVIVESEEQVEVSFTRKWNPSQKGKLVPLNIDKRFIMLR  120

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
              SSGFY+YAIYDH K     +L QTR+VFKL +  F ++A+ D  Q  MP   +R  E  
Sbjct  121   NSSGFYSYAIYDHLKEWPPFNLPQTRIVFKLRKEKFQYMAIADNRQRYMPLPDDRLQERS  180

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFR  1095
             +VL+  EAV L     P+ KG+VDDKY+Y+ ++QN+ V+GWI   P +GFW IT S+EFR
Sbjct  181   KVLDVPEAVLLVNPIEPEFKGEVDDKYEYSSENQNLRVHGWICMDPPVGFWQITPSDEFR  240

Query  1096  LGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS---DKG  1266
              GGPLKQ+LT H GP+ L+MFLS HYSG+D  +KL+  E WK VFGPVFIY+NS   +  
Sbjct  241   SGGPLKQNLTSHVGPYCLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPVFIYLNSLTSNAN  300

Query  1267  TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
              D   LWE AK QM+ E + WPY FP S ++P + QRG VSGR+ + D    +   P K 
Sbjct  301   DDPSPLWEDAKHQMMTEVQKWPYDFPASSEFPPSDQRGNVSGRIQVRDRYVSEDCIPGKG  360

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             A+VGLA PG+ GS+Q D   YQFWTR D+ G + I  +R G+Y+LYAWVPG +GD+++ A
Sbjct  361   AYVGLAPPGDAGSFQRDCKGYQFWTRADEHGYYSIKNIREGQYNLYAWVPGFIGDYRYDA  420

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKF  1806
              I I  GCDI +G+LV+ P + G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++F
Sbjct  421   AINITSGCDIDMGELVYEPPREGPTLWEIGIPDRSAAEFYVPDPNPNYINKLYVNHPDRF  480

Query  1807  RQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA  1983
             RQYGLW+RY++L+   DL+YT+G SD AKDWFFAQVTRK    +YE T W + F ++ V 
Sbjct  481   RQYGLWERYADLYPDQDLIYTIGTSDYAKDWFFAQVTRKKDDDTYEGTTWQIKFQLDNVN  540

Query  1984  K-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
             + G + L+I++A++  A L I +N DP+ D   FT+ + GKDN I RHGIHGLY   S +
Sbjct  541   QSGTFKLQISLATANIAELQIRIN-DPQADTPLFTTGVIGKDNTILRHGIHGLYWLYSID  599

Query  2161  IPGSLIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
             IP +L+V+G N L+L Q  +  P   F+G+MYDYIRLE 
Sbjct  600   IPATLLVEGNNTLFLTQPISNSPLAAFHGLMYDYIRLEG  638



>ref|XP_006338025.1| PREDICTED: rhamnogalacturonate lyase B-like [Solanum tuberosum]
Length=632

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/619 (52%), Positives = 427/619 (69%), Gaps = 10/619 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI+KV +S P+G V GI Y GV+ NLLE  N  ++RGYWD+ W++     ++ F+
Sbjct  15    VVMDNGILKVTISVPDGIVTGIRYNGVN-NLLEARNPEENRGYWDVVWSS--TGTTSKFE  71

Query  610   IL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
              L  T++KVI++ + Q+E+SF + +  S     IP+NIDKRF+ML GSSGFY+YAIY+H 
Sbjct  72    RLKCTNYKVILKTKDQIELSFSRKWDVSLQNKLIPLNIDKRFIMLKGSSGFYSYAIYEHL  131

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKT  957
             +G  D  LD+TR+ FKL +  F ++A+ D  +  MP   +R    GE L Y EAV L   
Sbjct  132   EGWRDFHLDETRIAFKLRKDKFHYMAMADNRRRYMPLPDDRLPPRGERLAYPEAVLLVDP  191

Query  958   ENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
               P+ KG+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR GGP+KQ LT H G
Sbjct  192   IEPEFKGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSGGPVKQSLTSHVG  251

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAKKQMLEE  1317
             P  L+ FLS HY+G D   K   GEAWK VFGPVFIYINS K  D   LW+ AK QM  E
Sbjct  252   PTNLATFLSTHYAGADLIPKFAQGEAWKKVFGPVFIYINSVKKADPVALWDDAKIQMQHE  311

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
              + WPY F  S+D+P A QRG VSGRLL+ D        PA  A+VGLA+PGE GSWQ +
Sbjct  312   VQSWPYGFLASKDFPSANQRGNVSGRLLVQDKYMSDGRIPANGAYVGLARPGEAGSWQRE  371

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
                YQFW ++D+ G F I+ +R G+Y+LYAWVPG +GD+ +   I+I  GC I V ++V+
Sbjct  372   CKDYQFWAKSDNNGYFSINNIRCGDYNLYAWVPGFIGDYVYGTPISITSGCKINVHEIVY  431

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-D  1854
              P ++G T+WEIGIPDR+AAE+F+PEP P   N +  +  ++FRQYGLWDRYSEL+ T D
Sbjct  432   QPPRDGPTLWEIGIPDRTAAEYFVPEPNPKFINKVFVNHPDRFRQYGLWDRYSELYPTDD  491

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRA  2031
             LVY +GKSD  KDWFFAQV R+   G+Y+ T W + F +++V + G Y LRIA+AS+T A
Sbjct  492   LVYVIGKSDYRKDWFFAQVPRRKEDGTYQGTTWQIRFKLDSVNQGGTYKLRIAIASATLA  551

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              + + VN +P  ++  FT+ L G+DN+IARHGIHGLY   + +I G+L+V+G+N +YL Q
Sbjct  552   EVQVRVN-NPSTNRPLFTTGLFGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLGQ  610

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
              +   PF GIMYDYIRLEA
Sbjct  611   PRHQSPFQGIMYDYIRLEA  629



>ref|XP_006426234.1| hypothetical protein CICLE_v10025074mg [Citrus clementina]
 gb|ESR39474.1| hypothetical protein CICLE_v10025074mg [Citrus clementina]
Length=670

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/623 (50%), Positives = 427/623 (69%), Gaps = 7/623 (1%)
 Frame = +1

Query  412   TVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEK  591
             T  + +V+MDNG+++V LSNPEG V GI Y  +D N+LE  N+  +RGYWD+ W  P+++
Sbjct  47    TKHRRLVVMDNGLVQVTLSNPEGEVIGIKYNEID-NVLETQNEEDNRGYWDVVWYEPEKQ  105

Query  592   ASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFYTYA  768
              S   K++ATDFKVIM+ E+QVEVSF +T+    +  + P+N+DKR++M  G SGFY YA
Sbjct  106   GSYD-KLIATDFKVIMQDENQVEVSFTRTWNISLRGSLAPLNVDKRYIMRRGVSGFYFYA  164

Query  769   IYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKL  948
             I +  +G  DVD+DQ R VFKL ++ F  +A++++ Q  MP  ++R  G+ L Y EAV L
Sbjct  165   IMERKEGWPDVDMDQIRTVFKLQQNKFHFMAISNDRQRIMPMPEDRATGQPLAYPEAVLL  224

Query  949   TKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTC  1128
             T   NP L+G+VDDKYQY+ + +++ V+GWIS  P +GFW+IT S+EFR GGP KQDLT 
Sbjct  225   TDPINPDLRGEVDDKYQYSSEDKDIRVHGWISSDPPVGFWMITPSDEFRSGGPNKQDLTS  284

Query  1129  HCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQ  1305
             H GP  LSMF S HY+G +   + R GE WK VFGP  +Y+NS    +    LWE AK+Q
Sbjct  285   HVGPVVLSMFTSTHYAGKEINTEFRNGEPWKKVFGPALVYLNSVSSEEKPLNLWEDAKRQ  344

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGS  1485
             M+ E + WPY+FP+S D+PK  QRG V G+L +HD         A  A+VGLA PG  GS
Sbjct  345   MMVEVRKWPYNFPESVDFPKRNQRGGVFGQLRVHDRYISNRLMWADSAYVGLAAPGGVGS  404

Query  1486  WQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVG  1665
             W+ DS  YQFWT+ +  G F I  VR G+Y+LYAW+PG +GD+K+ A+IT++ G +I +G
Sbjct  405   WERDSKGYQFWTKANKRGYFSIKNVRQGDYNLYAWIPGIVGDYKYSANITVRAGSNINLG  464

Query  1666  DLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH  1845
              LV+ P + G T+WEIGIPDRSAAEFF+P+P P L N L ++  EKFRQYGLW+RY +L+
Sbjct  465   VLVYEPPRKGPTLWEIGIPDRSAAEFFVPDPYPTLANQLYTNHPEKFRQYGLWERYVDLY  524

Query  1846  KT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVAS  2019
             +  DL YTVG S  AKDWFFA VTR     +Y+ T W ++F ++ +   G YTL++A+AS
Sbjct  525   RNDDLEYTVGDSYHAKDWFFAHVTRDVGNRTYKPTTWRIIFELKHLNNNGHYTLQLALAS  584

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +T + L +  N +P  D   F +   GKDNAIARHGIHGLY   S ++P  L+ +G N +
Sbjct  585   ATDSDLHVRFN-NPNADPPHFATGTIGKDNAIARHGIHGLYRLYSIDVPSVLLNRGRNTI  643

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL QS++  PF G++YDYIRLE 
Sbjct  644   YLTQSRSRSPFQGVLYDYIRLEG  666



>ref|XP_010935276.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Elaeis 
guineensis]
 ref|XP_010935277.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Elaeis 
guineensis]
Length=662

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/634 (51%), Positives = 435/634 (69%), Gaps = 13/634 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             AC  V++ V  + V++DNGI+++ LSNP G V G+ Y GVD NL+E+ N   +RGYW+L 
Sbjct  30    ACSSVRIDVQDKYVIIDNGILQLTLSNPGGIVTGVGYSGVD-NLMEVGNGEDNRGYWNLV  88

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             W+  ++ A T  +I  T+FK+I + E QVEVSF +T+  S + T IP+NIDKRFV+L GS
Sbjct  89    WSGNRD-ARTFDRIEGTNFKIIFQSEEQVEVSFTRTWTPSLNGTLIPLNIDKRFVVLQGS  147

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTYAI++H +G  + D+   RV FKL    F ++A++D+ Q  MP  ++R  E  + 
Sbjct  148   SGFYTYAIFEHQEGWPEFDIGVLRVAFKLRNDKFHYMALSDKRQRIMPMPEDRMPERCQQ  207

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV LT   NP LKG+VDDKYQY+++ Q+  V+GWIS  P +GFW I+ S+E R G
Sbjct  208   LAYPEAVLLTNPINPDLKGEVDDKYQYSIEDQDNKVHGWISFDPPIGFWQISPSDEARTG  267

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQDLT H GP  L++F+S HYSG+    K   GE WK VFGPVFIY+NS   G D K
Sbjct  268   GPVKQDLTSHVGPTTLAIFVSSHYSGE--APKFGNGEYWKKVFGPVFIYLNSASNGKDPK  325

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             TLW+ AK QM  E + WPYSFP SED+ K +QRG+VSG+LL+ D      D  A  A+VG
Sbjct  326   TLWQDAKMQMQREVESWPYSFPVSEDFQKRSQRGSVSGKLLVRDRLIHGEDIYANGAYVG  385

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFWTR D  G F I  VR G+Y+LYAWVPG +GD+K+   ITI
Sbjct  386   LALPGEAGSWQRECKGYQFWTRADANGSFSIKNVRTGQYNLYAWVPGFVGDYKYDEMITI  445

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQY  1815
               G +I  GDL++ P +   T WEIGIPDRSAAEF+IP+P P   N L + D   +FRQY
Sbjct  446   TSGNNIDFGDLIYEPPRQNVTFWEIGIPDRSAAEFYIPDPNPKYVNRLYVDDPVNRFRQY  505

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK--  1986
             GLW+RY++L+  +DLVYT+GKSD  KDWFFA VTRK  + SY+ T W + F +++V+   
Sbjct  506   GLWERYADLYPDSDLVYTIGKSDYKKDWFFAHVTRKIGQNSYQPTTWQIKFHLDSVSNQS  565

Query  1987  GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
             G Y LR+A+AS+  + L +  N D K + A FT++L G+DNAIARHGIHGLY   + ++ 
Sbjct  566   GSYKLRLALASAAHSELQVRFN-DLKANPAHFTAELNGRDNAIARHGIHGLYWFYNIDVQ  624

Query  2167  GSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              + +V+G N ++L Q+ +  PF G+MYDYIR+E 
Sbjct  625   NTWLVQGANTIFLTQANSQGPFQGVMYDYIRMEG  658



>ref|XP_010320231.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Solanum 
lycopersicum]
Length=633

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/620 (52%), Positives = 429/620 (69%), Gaps = 11/620 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI+KV +S P+G V GI Y GVD NLLE  N  ++RGYWD+ W++    +++ F+
Sbjct  15    VVMDNGILKVTISVPDGIVTGIRYNGVD-NLLEARNPEENRGYWDVVWSS--TGSTSKFE  71

Query  610   IL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
              L  T +KVI++ + Q+E+SF + +  S     IP+NIDKRF+ML GSSGFY+YAIY+H 
Sbjct  72    RLKCTTYKVILKTKDQIELSFSRKWDVSLQNKLIPLNIDKRFIMLKGSSGFYSYAIYEHL  131

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKT  957
             +G  D  LD+TR+ FKL +  F ++A+ D  +  MP   +R    G+ L Y EAV L   
Sbjct  132   EGWPDFHLDETRIAFKLRKDKFHYMAMADNRRRYMPLPDDRLPPRGQRLAYPEAVLLVDP  191

Query  958   ENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
               P+ KG+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR GGP+KQ LT H G
Sbjct  192   IEPEFKGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSGGPVKQSLTSHVG  251

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLE  1314
             P  L+ FLS HY+G D   K   GEAWK VFGPVF+Y+NS  KG D   LW+ AK QM  
Sbjct  252   PTNLATFLSPHYAGADLIPKFAQGEAWKKVFGPVFLYVNSVKKGEDPVALWDDAKIQMQH  311

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             E + WPYSFP S+D+P A QRG VSG LL+ D        PA  A+VGLA+PGE GSWQ 
Sbjct  312   EVQSWPYSFPASKDFPSANQRGNVSGILLVQDKYTSDGRIPANGAYVGLARPGEAGSWQR  371

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
             +   YQFW ++D+ G F I  +R G+Y+LYAWVPG +GD+ +   I+I  GC I V ++V
Sbjct  372   ECKGYQFWAKSDNNGYFSIKNIRRGDYNLYAWVPGFIGDYVYGTPISITSGCKINVHEIV  431

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-  1851
             + P ++G T+WEIGIPDR+AAE+F+PEP P   N +  +  ++FRQYGLWDRYSEL+ T 
Sbjct  432   YQPPRDGPTLWEIGIPDRTAAEYFVPEPNPKFINNVFINHPDRFRQYGLWDRYSELYPTD  491

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTR  2028
             DLVY +GKSD  KDWFFAQVTR+   G+Y+ T W + F +++V + G Y LRIA+AS+T 
Sbjct  492   DLVYVIGKSDYRKDWFFAQVTRRKENGTYQGTTWQIRFKLDSVHQGGTYKLRIAIASATL  551

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             A + + VN +P  ++  FT+ L G+DN+IARHGIHGLY   + +I G+L+V+G+N +YL 
Sbjct  552   AEVQVRVN-NPSTNQPLFTTGLFGRDNSIARHGIHGLYWLYNIDIQGNLLVQGDNTIYLG  610

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q +   PF GIMYDYIRLEA
Sbjct  611   QPRHQSPFQGIMYDYIRLEA  630



>ref|XP_008466140.1| PREDICTED: probable rhamnogalacturonate lyase C [Cucumis melo]
Length=651

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/632 (51%), Positives = 419/632 (66%), Gaps = 11/632 (2%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             P++L +  + V+MDNGIIKVNLSNP+G V GI Y G++ NLL   N   DRGYWD+ WN 
Sbjct  16    PLQLHIIDQHVVMDNGIIKVNLSNPKGMVNGIEYGGIE-NLLSTDNDEDDRGYWDIVWNL  74

Query  580   PKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDKTD--IPINIDKRFVMLPGS  747
                  +     ++  TDFKVI+E E Q+E+SF +TY +       IP+NIDKRFVML  S
Sbjct  75    EGSSGTKGILDRLETTDFKVIVENEEQIELSFSRTYNNSSTGGKLIPLNIDKRFVMLRNS  134

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEV  921
             SGFYTYAIY+H K     +LD TR+ FK  +  F ++AV D+ Q  MP   +R+   G+ 
Sbjct  135   SGFYTYAIYEHLKEWPAFNLDNTRIAFKPRKDKFHYMAVADKRQRLMPLPDDRKPPRGQA  194

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+ KG+VDDKYQY  +S++  V+GWIS  P +G W I+ + EFR G
Sbjct  195   LAYPEAVLLVDPIEPQFKGEVDDKYQYGCESKDSRVHGWISTDPPIGLWQISPTEEFRSG  254

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GPLKQ LT H GP  L++F S HY+G+D  IK    E WK VFGP+FI++NS  +G D  
Sbjct  255   GPLKQFLTSHVGPTTLTVFHSTHYAGEDMVIKFGDNEPWKKVFGPIFIHLNSLPEGEDPL  314

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ AK+QM+ E + WPY F  SED+PK+ QRG VSGR LI +  A     PA  A+VG
Sbjct  315   RLWQNAKEQMMAEVQSWPYGFIASEDFPKSDQRGTVSGRFLIRERYASDESVPASGAYVG  374

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQN+S  YQFWTR D  G F ++ VR+G YSLY WVP  +G++++ A I +
Sbjct  375   LALPGELGSWQNESKGYQFWTRADQNGSFSLNNVRSGNYSLYGWVPNFIGNYQYSAFIVV  434

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG DI VG+LVF P ++G T+WEIGIPDR+AAEF+IP+P P   N L  + +++FRQYG
Sbjct  435   TPGSDINVGELVFEPPRDGPTLWEIGIPDRTAAEFYIPDPNPKYINKLYVNHSDRFRQYG  494

Query  1819  LWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGC  1992
             LW+RY+EL+   DLVYTVG SD  KDWFFAQVTRK     Y  T W + F +++    G 
Sbjct  495   LWERYAELYPNEDLVYTVGLSDYKKDWFFAQVTRKIGDNKYAGTTWKIKFQLDSPDTHGT  554

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LR+A+A++  A L + +N D +     FT+ L GKDN +ARHGIHGLY   + +IPG 
Sbjct  555   YRLRLALATAHAAELQVRLN-DAQALPPLFTTGLIGKDNTVARHGIHGLYRLYTVDIPGG  613

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V G N + L Q+ +  PF GIMYDYIRLE 
Sbjct  614   ELVVGNNTILLTQASSNSPFVGIMYDYIRLEG  645



>ref|XP_007225130.1| hypothetical protein PRUPE_ppa002544mg [Prunus persica]
 gb|EMJ26329.1| hypothetical protein PRUPE_ppa002544mg [Prunus persica]
Length=660

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/635 (51%), Positives = 429/635 (68%), Gaps = 15/635 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LS P+G V  I Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     VKLDIQDHHVVMDNGILQVTLSKPDGIVTRIQYNGID-NLLEVLNEEVNRGYWDLVWSEA  64

Query  583   KEKASTS--FKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSG  753
                 +T   + I  T F+VI+E + QVEVSF + +    K   +P+NIDKRF+ML  SSG
Sbjct  65    GSVGTTGTFYVIKGTKFEVIVESDEQVEVSFTRKWNPSQKGKLVPLNIDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIYDH K     +L QTR+VFKL +  F ++A+ D  Q  MP   +R  E  +VL+
Sbjct  125   FYSYAIYDHLKEWPPFNLPQTRIVFKLRKEKFQYMAIADNRQRYMPLPDDRLQERSKVLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
               EAV L     P+ KG+VDDKY+Y+ ++QN+ V+GWI   P +GFW IT S+EFR GGP
Sbjct  185   VPEAVLLVNPIEPEFKGEVDDKYEYSSENQNLRVHGWICMDPPVGFWQITPSDEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS---DKGTDHK  1278
             LKQ+LT H GP  L+MFLS HYSG+D  +KL+  E WK VFGPVFIY+NS   +   D  
Sbjct  245   LKQNLTSHVGPTCLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPVFIYLNSVTSNANDDPS  304

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E + WPY FP S ++P + QRG VSGR+ + D    +   P K A+VG
Sbjct  305   PLWEDAKSQMMTEVQKWPYDFPASIEFPPSDQRGNVSGRIQVRDRYVSEDCIPGKGAYVG  364

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG+ GS+Q D   YQFWTR D+ G + I  +R G+Y+LYAWVPG +GD+++ A ITI
Sbjct  365   LAPPGDAGSFQRDCKGYQFWTRADEHGYYSIKNIREGQYNLYAWVPGFIGDYRYDAAITI  424

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               GCDI VG+LV+ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYG
Sbjct  425   TAGCDIDVGELVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPNYINKLYVNHPDRFRQYG  484

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RY++L+   DL+YT+G SD AKDWFFAQVTRK    +YE T W + F ++ V + G 
Sbjct  485   LWERYADLYPDQDLIYTIGTSDYAKDWFFAQVTRKKDDDTYEGTTWQIKFQLDNVNQSGT  544

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             + L+I++A++  A L I +N DPK D   FT+ + GKDN I RHGIHGLY   S  IP +
Sbjct  545   FKLQISLATANIAELQIRIN-DPKADPPLFTTGVIGKDNTILRHGIHGLYWLYSIGIPAT  603

Query  2173  LIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
             L+V+G N L+L Q  +  P   F+G+MYDYIRLE 
Sbjct  604   LLVEGNNTLFLTQPISNSPLAAFHGLMYDYIRLEG  638



>ref|XP_004161743.1| PREDICTED: LOW QUALITY PROTEIN: rhamnogalacturonate lyase B-like 
[Cucumis sativus]
Length=635

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/633 (51%), Positives = 435/633 (69%), Gaps = 10/633 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A + ++L +    V+MDNGI++V LS P+G+V GI Y  +D N+LE+ +K   RGYWDL 
Sbjct  2     ANEILQLDIQDHHVVMDNGILQVTLSKPDGNVTGIKYNSID-NVLEVDDKEAHRGYWDLV  60

Query  571   WNTPKEKASTSF-KILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGS  747
             WN+     + +F ++   +F+V+++ E Q+E+SFK+ Y   DK  +P+NIDKRF+ML  S
Sbjct  61    WNSGTPGTTGTFDEMRGREFEVMVQNEEQIELSFKRNYSFKDKA-VPLNIDKRFIMLRNS  119

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFY+YAIY+H +     +L QTR+VFKL +  F ++A+ D+ Q  MP  ++R    G+ 
Sbjct  120   SGFYSYAIYEHMREWPPFNLPQTRIVFKLRKDKFHYMAIADDRQRFMPLPEDRLRHRGKP  179

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L++ EAV L   + P+ KG+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR G
Sbjct  180   LDFPEAVLLVNPKEPEFKGEVDDKYQYSCENKDLKVHGWISMDPPVGFWQITPSSEFRSG  239

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GPLKQ+LT H GP+AL+MFLS HYSG+D  +K+   E WK VFGPVF Y+NS   G D  
Sbjct  240   GPLKQNLTSHVGPYALAMFLSAHYSGEDLVLKVSPDEPWKKVFGPVFFYLNSVSDGGDPL  299

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             +LWE AK QM +E + WPYSFP SED+    QRG ++G+L + D    +   PA  A+VG
Sbjct  300   SLWEDAKTQMSKEVQSWPYSFPASEDFXPPNQRGRLTGKLFVLDRYVNEEKMPATDAYVG  359

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG+ GSWQ +   YQFWT+TD  G F I  VR G+Y+LYAWVPG +GD+++   I +
Sbjct  360   LAAPGDVGSWQTEKKGYQFWTKTDADGSFSIEHVRIGDYNLYAWVPGFIGDYRYDVLINV  419

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G D+ VGDLV+ P +NG T+WEIGIPDRSAAEF+IP+P P   N L  +  ++FRQYG
Sbjct  420   SSGSDMDVGDLVYEPPRNGPTLWEIGIPDRSAAEFYIPDPDPKYINKLYINHPDRFRQYG  479

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGC  1992
             LW++Y+ELH   DLVY+VG SD  KDWFFA V RK   GS+ AT W + F ++ +  KG 
Sbjct  480   LWEKYAELHPDADLVYSVGVSDYTKDWFFAHVNRKRNDGSHLATTWEIKFRLDNIIDKGV  539

Query  1993  -YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTLR+A+A++  A L I VN +P+   + FT+ + G DNAIARHGIHGLY   S +I G
Sbjct  540   SYTLRVALATANVAELQIQVN-NPEAKPSLFTTGVIGHDNAIARHGIHGLYRLYSVDILG  598

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             SL+V+GEN ++L Q      F GIMYDYIRLE 
Sbjct  599   SLLVEGENTIFLSQIINNSSFNGIMYDYIRLEG  631



>ref|XP_002527353.1| lyase, putative [Ricinus communis]
 gb|EEF35025.1| lyase, putative [Ricinus communis]
Length=642

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/629 (52%), Positives = 428/629 (68%), Gaps = 11/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V++DNGI++V LSNPEG V GI Y G+  NLLE+ N   +RGYWDL W+TP
Sbjct  6     VQLNIQDNHVMLDNGILQVTLSNPEGIVTGIQYNGIG-NLLEVLNDESNRGYWDLVWSTP  64

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T     I  T FKVI+E E QVE+SF +++  S +   IP+NIDKRFVML GSSG
Sbjct  65    GSTGTTGIFDVIKGTSFKVIVETEEQVELSFTRSWDPSLEGKLIPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAI++H K     +L + R+ FKL +  F ++AV D  Q  MP   +R    G+ L 
Sbjct  125   FYSYAIFEHLKEWPGFNLAEARIAFKLRKEKFHYMAVADNRQRYMPLPDDRLSPRGQALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L      + KG++DDKYQY+ +++++ V+GWI   P +GFW IT SNEFR GGP
Sbjct  185   YPEAVLLVNPVESEFKGELDDKYQYSCENKDIRVHGWICMDPSVGFWQITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             +KQ+LT H GP  LS+FLS HYSG+D   K   GEAWK VFGPVF+Y+NS   G D  +L
Sbjct  245   VKQNLTSHVGPTTLSVFLSAHYSGEDLVPKFVAGEAWKKVFGPVFMYLNSVLVGDDPLSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK+Q   E + WPY FP SEDYPK+ QRG+VSGRLL+ D         A  A+VGLA
Sbjct  305   WEDAKEQTEIEVQSWPYFFPASEDYPKSEQRGSVSGRLLVKDRFVSDDYISANGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
               G+ GSWQ +   YQFW++ D+ G F I+++R G+Y+LYAWVPG +GD++    ITI  
Sbjct  365   PQGDVGSWQRECKDYQFWSKADENGYFSINSIRTGDYNLYAWVPGFIGDYRCDVAITITS  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI + DLV+ P ++G T+WEIGIPDRSAAEF+IP+P P   N L  +  ++FRQYGLW
Sbjct  425   GCDINMHDLVYEPPRDGPTLWEIGIPDRSAAEFYIPDPNPMYINKLYVNHPDRFRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             DRY+EL+   DLVYTVG SD  KDWFFAQV RK    +Y+ T W + F ++ V K G Y 
Sbjct  485   DRYAELYPDGDLVYTVGVSDYRKDWFFAQVNRKKDDNTYQRTTWQIKFKLDNVDKNGIYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T A L + +N DPK +   F+S + GKDN+IARHGIHGLY   + ++PG  +
Sbjct  545   LRVAIASATVAELQVRIN-DPKAN-IIFSSGMIGKDNSIARHGIHGLYWLYNVDVPGVRL  602

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             V+G N ++L Q ++  PF GIMYDYIRLE
Sbjct  603   VQGGNTVFLTQPRSSSPFQGIMYDYIRLE  631



>emb|CDP01611.1| unnamed protein product [Coffea canephora]
Length=674

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/619 (51%), Positives = 418/619 (68%), Gaps = 8/619 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNG++ V LS PEG V GI Y G+  NLLE  NK  DRGYWD+ WN P+   +   K
Sbjct  53    VVMDNGLVNVTLSVPEGMVTGIQYNGIA-NLLEERNKENDRGYWDIVWNLPEAHGNIFDK  111

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             + AT   V++E E+ +E+SF +TY  S  +T + +NIDKRF++L G  GFYTY I++  +
Sbjct  112   LAATSLNVVLEDENGIELSFTRTYDDSIYETQLSLNIDKRFILLRGYPGFYTYGIFERLE  171

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G  D+++ Q R VFKL   LF ++AV+DE Q  MP+  +R  G++L+Y EAV LT   N 
Sbjct  172   GWPDINVYQGRTVFKLQEKLFEYMAVSDERQRIMPTADDRARGQILDYPEAVLLTNPANT  231

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
              L+G+VDDKYQY+ D+++  V+GWI P P  GFW+IT SNEF+ GGP+KQDLT H GP  
Sbjct  232   FLRGEVDDKYQYSSDNKDNRVHGWICPDPPTGFWMITPSNEFKTGGPVKQDLTSHVGPTT  291

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQMLEET  1320
             LSM+ S HY+G+   +  R GE W+ VFGPVF+Y+N+  +  T+  +LW  AK+QML ET
Sbjct  292   LSMYFSTHYAGEPLALTFRDGEPWRKVFGPVFVYLNTLQENDTEPLSLWADAKEQMLIET  351

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDS  1500
             + WPYSFP SEDY    QRG+ SGRLLI D    +       A VGLA PG+ GSWQ ++
Sbjct  352   ESWPYSFPLSEDYSFDYQRGSASGRLLIQDSYISERLITGNSACVGLAAPGDAGSWQTEN  411

Query  1501  MSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFT  1680
              +YQFW   D  G F I  VR G YSLYAWVPG++GD+K+   + I+PG  I +G L + 
Sbjct  412   KAYQFWAVADSEGYFLIKNVRPGNYSLYAWVPGYIGDYKYDFYVNIRPGNRITLGALTYN  471

Query  1681  PLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLS-DRTEKFRQYGLWDRYSELHKT-D  1854
             P +NG T+WEIGIPDR+A EFF+PEP+P L N L S ++ EKFRQYGLWDRYSEL+ + D
Sbjct  472   PPRNGPTLWEIGIPDRTAIEFFVPEPSPRLMNQLYSVNQAEKFRQYGLWDRYSELYPSED  531

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYTLRIAVASSTRA  2031
             LV+TVG ++   DWFFA V R     +Y  T W + F ++ +   G Y L+IA+AS+  A
Sbjct  532   LVFTVGVNNYQTDWFFAHVNRNVGNKTYVPTTWQIAFDLDNIDFFGTYMLQIALASANEA  591

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L + +N +P ++   FT+   GKDNAIARHGIHGLY   S EIPGS ++ G N +YL Q
Sbjct  592   ELQVRIN-NPDEEAPYFTTGTIGKDNAIARHGIHGLYRLYSLEIPGSQLLFGRNIIYLTQ  650

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             S+   P+ GIMYDY+RLE 
Sbjct  651   SRGSSPWRGIMYDYVRLEG  669



>ref|XP_010312903.1| PREDICTED: probable rhamnogalacturonate lyase B [Solanum lycopersicum]
Length=659

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/626 (50%), Positives = 422/626 (67%), Gaps = 24/626 (4%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV LTVT   V++DNGI++++L+NP GS+ G+ Y G+D NLLE                 
Sbjct  51    PVTLTVTSRYVVIDNGIVQLSLTNPTGSIFGVKYNGID-NLLE-----------------  92

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
                   T   +LA+ F VI +  ++VEVSF+K Y   +  + P+NIDKR+VML GSSGFY
Sbjct  93    --PLPETQRGLLASKFSVIAQDANKVEVSFQKLYNPLNGNNPPLNIDKRYVMLRGSSGFY  150

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y I+ H KG   V+LD+ R+  KLS+SLF  +A++D+ Q  MP+ ++R  G+ L+Y+EA
Sbjct  151   SYGIFQHLKGWPAVNLDEARIAIKLSKSLFHFMAISDDRQRIMPTEEDRASGQTLDYREA  210

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             VK+T   NP+LK +VDDKYQY  + +N+ V+GWIS  PH+GFW+I+ S E+  GGP+KQD
Sbjct  211   VKITNPSNPRLKNEVDDKYQYTDEIRNIKVHGWISDNPHMGFWVISPSYEYCNGGPMKQD  270

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAK  1299
             LT H GP ++++F S HY+G   G+ L  GEAW  VFGPVF Y+NSD   DH  LWE AK
Sbjct  271   LTSHVGPTSMAIFFSGHYAGPQLGVSLTNGEAWTKVFGPVFFYVNSDSSNDHTILWEDAK  330

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
             +QM EET  WPY FP S+ Y  A QRG+VSG+L++HD        PA  A++GLA+PG  
Sbjct  331   RQMNEETNKWPYDFPASKYYLHANQRGSVSGQLMVHDWYINVDVFPALNAYIGLAEPGLV  390

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ+++  YQFWT+TDD+G F+I  VR G Y +Y+WVPG +GD+K  + IT+  G    
Sbjct  391   GSWQSETKGYQFWTQTDDSGNFKIKNVRPGIYGVYSWVPGVMGDYKFSSYITVTQGKVTN  450

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRT-EKFRQYGLWDRYS  1836
             +G ++F   +NG  +WEIG PDR+A EFFIP+P P L+NYL ++ T  KFRQYGLW+RY+
Sbjct  451   LGQIIFEVPRNGPPLWEIGFPDRTANEFFIPDPLPGLQNYLYTNTTIHKFRQYGLWNRYT  510

Query  1837  ELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIA  2010
             +L+   DLVY VG SD  KDWFFA V R+N   S+ AT W +VF ++ V + G Y L IA
Sbjct  511   DLYPNGDLVYKVGVSDFRKDWFFAHVNRRNKDKSFSATTWQIVFDVKNVDSSGTYHLHIA  570

Query  2011  VASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGE  2190
             +AS++ A LL+W+N  P K +  F S   G  NAIARHGIHGLY  +  E PG+ +  GE
Sbjct  571   LASASYAHLLVWIN-TPSKPRPWFDSSPIGMSNAIARHGIHGLYMTLDIEFPGTQLHIGE  629

Query  2191  NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             N +YL+Q+    PF G+MYDYIRLE 
Sbjct  630   NIIYLKQASVYGPFTGLMYDYIRLEG  655



>gb|KDO81266.1| hypothetical protein CISIN_1g042458mg [Citrus sinensis]
Length=649

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/630 (51%), Positives = 421/630 (67%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V++DNGI++V  S P G V GI Y  +D NLLE+ N   +RGYWDL WN P
Sbjct  6     VNLLIQDRHVVLDNGILEVTFSYPGGIVTGIRYNDID-NLLEVLNDELNRGYWDLVWNAP  64

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
                 +      I  T F VI+E E QVE+SF +T+ S  +   +P+NIDKRFVML GSSG
Sbjct  65    GSTGTRGIFDVIQGTSFNVIVENEDQVEISFTRTWDSSLEGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTY+IY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYSIYEHLEEWPGFNLGETRIAFKLRKDKFHYMAIADNRQRYMPLPDDRVPPRGQPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P  KG+VDDKYQY+ D+++++V+GWI   P +GFW IT S EFR GGP
Sbjct  185   YPEAVLLVNPVEPDFKGEVDDKYQYSCDNKDINVHGWICTDPPVGFWHITPSAEFRTGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
              KQ+LT H GP  LS+F+S HYSG+D   K   GEAWK VFGPVF+Y NS   G D  +L
Sbjct  245   QKQNLTSHVGPTTLSVFVSAHYSGEDLVPKFNAGEAWKKVFGPVFVYCNSAFDGDDPLSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QM  ET+ WPYSFP S+D+PK+ QRG VSGRLL+ D         A  A+VGLA
Sbjct  305   WDDAKMQMSVETESWPYSFPASDDFPKSDQRGNVSGRLLVQDEYISDDYISASGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT  D+ G F I+AVRAG+Y+LYAWVPG +GD+++   + I P
Sbjct  365   PPGDAGSWQRECKDYQFWTSADEDGYFSITAVRAGDYNLYAWVPGFIGDYRYDVVVNITP  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G DI +GDLV+ P +NG T+WEIGIPDRSAAEF++P+P P   N L  D+ ++FRQYGLW
Sbjct  425   GFDIDMGDLVYEPPRNGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYLDQPDRFRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DLVYTVG SD  KDWFF QVTRK    +Y+ + W + F ++ V +   Y 
Sbjct  485   ERYAELYPDGDLVYTVGSSDYTKDWFFVQVTRKKDNNTYQGSTWQIKFELDDVNQSSTYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + +N DP  ++  F+S L G+DN+IARHGIHGLY   + ++PG+ +
Sbjct  545   LRVAIASANLSELQVRIN-DPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V G+N ++  Q ++  PF GIMYDYIR E 
Sbjct  604   VSGDNTIFFIQPRSTSPFQGIMYDYIRFEG  633



>ref|XP_008444895.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X1 [Cucumis 
melo]
Length=643

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/628 (51%), Positives = 430/628 (68%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +T+  V MDNGI++V LSNP+G V GI Y GVD N+LE+ N   +RGYWDL W++ 
Sbjct  6     VQLFITERQVTMDNGIVQVTLSNPDGIVTGIRYNGVD-NVLEVLNDETNRGYWDLVWSSS  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                      I AT FKVI+E E QVE+SF +T+  S +   +P+ IDKRF+ML GSSGFY
Sbjct  65    SSSTGLFDVIKATGFKVIVENEEQVELSFTRTWDLSLEGKLVPLEIDKRFIMLRGSSGFY  124

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYK  933
             +YAIY H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G  L Y 
Sbjct  125   SYAIYQHLEEWPGFNLGETRLAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGRALAYP  184

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV+L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW+I+ SNEFR GGP+K
Sbjct  185   EAVRLIDPIEPELQGEVDDKYQYSCDNKDSGVHGWISTDPTVGFWLISPSNEFRSGGPVK  244

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DHKTLWE  1290
             Q+LT H GP  L++F+S HY+G+D   K+  GEAWK VFGPVFIY+NS   + D   LWE
Sbjct  245   QNLTSHVGPTTLAVFISAHYAGEDLVPKIGAGEAWKKVFGPVFIYLNSTYDSFDALQLWE  304

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK Q   E + WPYSFP S+D+P++ QRG++SG+LL+ D    +   PA  A VGLA P
Sbjct  305   DAKAQAAVEVQSWPYSFPASDDFPRSNQRGSISGKLLVKDSYVDEDLIPAGGAFVGLAPP  364

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +S  YQFW+R D++G F I  VR G+Y+LYAWVPG +GD+++ A I +K G 
Sbjct  365   GDVGSWQRESKGYQFWSRADESGNFFIDGVRPGDYNLYAWVPGFIGDYRYDALINLKEGS  424

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             ++ +GD+ + P + G T+WEIGIPDRSAAEF++P+P P+  N L  +  +KFRQYGLW+R
Sbjct  425   EVDMGDITYEPPRQGATLWEIGIPDRSAAEFYVPDPNPNYINKLYLNHPDKFRQYGLWER  484

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLR  2004
             YSEL   +DLVY VG SD  KDWFFAQV RK   G+Y+ T W V F ++ V  +  Y LR
Sbjct  485   YSELFPDSDLVYNVGVSDYTKDWFFAQVPRKIENGTYKGTTWQVKFELDNVDNQATYKLR  544

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS++ A L + VN    K KA F+S L G+DN+IARHGIHGLY   + +IPG+ +V 
Sbjct  545   VALASASLAELQVGVN--EAKAKAVFSSGLIGRDNSIARHGIHGLYWLYNIDIPGNRLVT  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G N ++  Q ++  PF  IMYDYIRLEA
Sbjct  603   GNNTIFFTQPRSTGPFQAIMYDYIRLEA  630



>gb|KDP32172.1| hypothetical protein JCGZ_12633 [Jatropha curcas]
Length=679

 Score =   634 bits (1634),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/619 (51%), Positives = 431/619 (70%), Gaps = 10/619 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             +++DNG+++V LSNP G +  I Y  ++ N+L   N+  +RGYWD+ WN P  + +   +
Sbjct  54    IVIDNGLVQVTLSNPNGDINEIQYNEME-NVLSTKNREGNRGYWDIVWNKPGSRTAYD-R  111

Query  610   ILATDFKVIMEKESQVEVSFKKTYKS--GDKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
             + A+ F VIME E+QVEVSF +T+ +  GD T +P+N+DKR+++  GSSG Y YAI +  
Sbjct  112   LKASKFSVIMEDENQVEVSFTRTWNASIGDNT-VPLNVDKRYILRRGSSGIYMYAILERL  170

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTEN  963
             +G  D+D+DQ R+VFKL    F  + V+D+ Q  MPS  +   G+ L Y EA+ LT   N
Sbjct  171   EGWPDIDIDQIRIVFKLQNDKFQLMIVSDDRQRIMPSRTDFRNGKRLAYPEAILLTNPVN  230

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPF  1143
             P+L+G+V+DKYQY+ D+++  V+GWIS    +GFW+IT S+E+R GGPLKQDLT H GP 
Sbjct  231   PQLRGQVEDKYQYSCDNKDNRVHGWISEDTPVGFWMITPSDEYRAGGPLKQDLTSHVGPT  290

Query  1144  ALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEET  1320
              LSMF S HY+G D   + R G+ WK VFGPV+IY+NS     D   LWE AK+QM  E 
Sbjct  291   VLSMFTSTHYAGKDLNTQFRNGKPWKKVFGPVYIYLNSISTQEDPLLLWEDAKQQMSMEV  350

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDS  1500
             + WPY FP+SED+P +A+RGAVSG+LL+ D  A K  T    A+VGLA PGE GSWQ DS
Sbjct  351   ENWPYDFPRSEDFPSSARRGAVSGQLLLLDRYASKRLTWGAFAYVGLAAPGEVGSWQTDS  410

Query  1501  MSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFT  1680
               YQFWTR +  G F I  VRAG Y+LYAWVPG +GD+K+ A+ITI+ G ++++G LV+ 
Sbjct  411   QGYQFWTRANKKGYFLIENVRAGNYNLYAWVPGIIGDWKYDANITIQQGYEMELGVLVYE  470

Query  1681  PLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR-TEKFRQYGLWDRYSELHKT-D  1854
             P +NG T+WEIGIPDR+AAEFF+P+  P L+N L ++  T+KFRQYGLWDRY++L+ T D
Sbjct  471   PPRNGPTLWEIGIPDRTAAEFFVPDTYPTLENKLYTNHPTQKFRQYGLWDRYTDLYPTQD  530

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRA  2031
             L+YTVG S+  +DWFFAQV R     +Y+AT W + F +E V + G YTL++A+ASS  +
Sbjct  531   LIYTVGVSNYHQDWFFAQVPRNIGNQNYQATTWEIKFELENVNQNGNYTLQVALASSAAS  590

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L +  N D + +K  FT+KL G+DNAIARHGIHGLY   S  +   L+ +G N +YL Q
Sbjct  591   ELQVRFN-DERANKPHFTTKLIGRDNAIARHGIHGLYRLYSINVQSYLLKRGNNTIYLTQ  649

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             +++  PF GIMYDYIR E 
Sbjct  650   TRSIGPFRGIMYDYIRFEG  668



>ref|XP_009795928.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Nicotiana 
sylvestris]
Length=637

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/632 (51%), Positives = 429/632 (68%), Gaps = 13/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI Y G+D NLLE+ N   +RGYWD+ WN+ 
Sbjct  6     VKLYIQDRHVMMDNGIVQVTLSNPDGIVTGIHYNGID-NLLEVLNDESNRGYWDVVWNSL  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 S  F+++  T+FKVI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  65    DGGRSGVFEVIKGTNFKVITETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGCSGF  124

Query  757   YTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             Y+YAIY+H   P+      L +TR+ FKL +  F ++AV D  Q  MP   +R     + 
Sbjct  125   YSYAIYEHVGSPEWPA-FSLGETRIAFKLRKDKFHYMAVADNRQRFMPLPDDRLPARCQR  183

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR G
Sbjct  184   LAYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSG  243

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD   K   GEAWK VFGP+FIY+NS  +G D  
Sbjct  244   GPVKQNLTSHVGPTTLAMFLSSHYAGDDLTPKFAQGEAWKKVFGPIFIYVNSVMQGEDPV  303

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ A  QM  E   WPY FP SED+P A QRG VSGRLL+ D         A  A+VG
Sbjct  304   ALWDDANIQMQVEVLSWPYCFPASEDFPSADQRGNVSGRLLVQDKYINDDYIAANGAYVG  363

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW   D+ G F I+ +R G+Y+LYAWVPG +GD+ ++  I+I
Sbjct  364   LAPPGEAGSWQKECKDYQFWATADNDGYFSINNIRPGDYNLYAWVPGFIGDYLYETPISI  423

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG ++ V ++V+ P ++G T+WEIGIPDR+AAEFF+PEP P   N L  +  ++FRQYG
Sbjct  424   SPGRNVDVDEIVYQPPRDGPTLWEIGIPDRTAAEFFVPEPNPRFINKLFVNHPDRFRQYG  483

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RYSEL+ K DLVY  G+SD +KDWFFAQV R+   G+Y+ T W + F +++V + G 
Sbjct  484   LWERYSELYPKDDLVYVTGESDYSKDWFFAQVPRRKEDGTYQGTTWQIRFKLDSVNQGGT  543

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A + + VN DP  ++  F++ L G+DN+IARHGIHGLY   + +I G+
Sbjct  544   YKLRIAIASATLAEVQVRVN-DPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGN  602

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  603   LLVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  634



>gb|EYU29460.1| hypothetical protein MIMGU_mgv1a002710mg [Erythranthe guttata]
Length=644

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/637 (51%), Positives = 442/637 (69%), Gaps = 18/637 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT-  579
             V+L V +  V++DNGI++V LSNPEG V GI Y GVD NLLE+ N   +RGYWD+ WN  
Sbjct  6     VRLNVQEHHVVIDNGIVEVALSNPEGIVTGIRYNGVD-NLLEVLNDETNRGYWDVVWNAI  64

Query  580   --PKEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
                 + A   F+++ AT F+VI E E +VEVSF + +  S +   +P+NIDKRFV++ G 
Sbjct  65    DGSGKVAGGVFEVIKATKFEVITESEEKVEVSFSRPWDPSLENKLVPLNIDKRFVVVRGC  124

Query  748   SGFYTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EE  912
             SG Y+YA+Y+H   P+     +L +TR+ FKL +  F ++AV D  Q  MP   +R    
Sbjct  125   SGLYSYAVYEHVGSPEWPA-FNLGETRIAFKLRKDRFQYMAVADNRQRYMPLPDDRLPGR  183

Query  913   GEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWIS--PKPHLGFWIITASN  1086
             G+ L Y EAV L    +P+L+G+VDDKYQY+ D++++ V+GWIS  P+P +GFW IT S+
Sbjct  184   GQPLAYPEAVLLVNPVDPRLRGEVDDKYQYSCDNKDIKVHGWISMNPQPAVGFWQITPSD  243

Query  1087  EFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-K  1263
             EFR GGPLKQ+LT H GP +LS+FLS HY+GDD   K   GEAWK VFGPVFIY+NS   
Sbjct  244   EFRSGGPLKQNLTSHVGPTSLSVFLSAHYAGDDLVPKFGKGEAWKKVFGPVFIYLNSAMD  303

Query  1264  GTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAK  1443
             G D  TLW+ AK+QML + + WPYSF  SED+  A +RG +SG+LL+ D        PA 
Sbjct  304   GEDPLTLWDDAKRQMLVQVESWPYSFLASEDFQSANERGNLSGKLLVSDRYVSGDYIPAS  363

Query  1444  CAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHK  1623
              A+VGLA PG+ GSWQ +   YQFWTR D+ G F I+ VR+G Y+L AWVPG +GD++++
Sbjct  364   GAYVGLAPPGDVGSWQRECKGYQFWTRADEMGYFTINNVRSGNYNLNAWVPGFIGDYQNE  423

Query  1624  ADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEK  1803
               ITI  GC I +G++V+ P ++G T+WEIGIPDRSAAE+++P+P P   N L  +  ++
Sbjct  424   VAITITSGCGIYMGEIVYEPPRDGPTLWEIGIPDRSAAEYYVPDPDPKYINKLYLNHPDR  483

Query  1804  FRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV  1980
             FRQYGLWDRY+EL+   DLVYTVGKSD  KDWFFAQV RK    +Y+ T W + F +E +
Sbjct  484   FRQYGLWDRYAELYPHEDLVYTVGKSDYTKDWFFAQVNRKKEDNTYQGTTWQIKFTLENL  543

Query  1981  AK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSF  2157
              + G Y LR+A+AS++ A L + VN +PK ++  F+S L G+DN+IARHGIHGL+   + 
Sbjct  544   NRNGIYKLRVALASASLAELQVRVN-NPKANRPLFSSGLIGRDNSIARHGIHGLHWLYNI  602

Query  2158  EIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             EI G L+V+G+N +YL Q ++  PF G+MYDYIRLEA
Sbjct  603   EINGDLLVEGDNTIYLSQPRSQSPFQGLMYDYIRLEA  639



>ref|XP_006472412.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Citrus 
sinensis]
Length=647

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/630 (51%), Positives = 422/630 (67%), Gaps = 13/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V++DNGI++V  S P G V GI Y  +D NLLE+ N   +RGYWDL WN P
Sbjct  6     VNLLIQDRHVVLDNGILEVTFSYPGGIVTGIRYNDID-NLLEVLNDELNRGYWDLVWNAP  64

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
                 +      I  T F VI+E E QVE+SF +T+ S  +   +P+NIDKRFVML GSSG
Sbjct  65    GSTGTRGIFDVIQGTSFNVIVENEDQVEISFTRTWDSSLEGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTY+IY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYSIYEHLEEWPGFNLGETRIAFKLRKDKFHYMAIADNRQRYMPLPDDRVPPRGQPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P  KG+VDDKYQY+ D+++++V+GWI   P +GFW IT S EFR GGP
Sbjct  185   YPEAVLLVNPVEPDFKGEVDDKYQYSCDNKDINVHGWICTDPPVGFWHITPSAEFRTGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
              KQ+LT H GP  LS+F+S HYSG+D   K   GEAWK VFGPVF+Y NS   G D  +L
Sbjct  245   QKQNLTSHVGPTTLSVFVSAHYSGEDLVPKFNAGEAWKKVFGPVFVYCNSAFDGDDPLSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QM  ET+ WPYSFP S+D+PK+ QRG VSGRLL+ D         A  A+VGLA
Sbjct  305   WDDAKMQMSVETESWPYSFPASDDFPKSDQRGNVSGRLLVQD---DDDYISASGAYVGLA  361

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT  D+ G F I+AVRAG+Y+LYAWVPG +GD+++   + I P
Sbjct  362   PPGDAGSWQRECKDYQFWTSADEDGYFSITAVRAGDYNLYAWVPGFIGDYRYDVVVNITP  421

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G DI +GDLV+ P +NG T+WEIGIPDRSAAEF++P+P P   N L  D+ ++FRQYGLW
Sbjct  422   GFDIDMGDLVYEPPRNGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYLDQPDRFRQYGLW  481

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DLVYTVG SD  KDWFF QVTRK    +Y+ + W + F ++ V +   Y 
Sbjct  482   ERYAELYPDGDLVYTVGSSDYTKDWFFVQVTRKKDNNTYQGSTWQIKFELDDVNQSSTYK  541

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + +N DP  ++  F+S L G+DN+IARHGIHGLY   + ++PG+ +
Sbjct  542   LRVAIASANLSELQVRIN-DPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARL  600

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V G+N ++L Q ++  PF GIMYDYIR E 
Sbjct  601   VSGDNTIFLTQPRSTSPFQGIMYDYIRFEG  630



>ref|XP_007225136.1| hypothetical protein PRUPE_ppa002538mg [Prunus persica]
 gb|EMJ26335.1| hypothetical protein PRUPE_ppa002538mg [Prunus persica]
Length=660

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/635 (50%), Positives = 431/635 (68%), Gaps = 15/635 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LS P+G V  I Y G+D NLLE+ ++  +RGYWDL W+  
Sbjct  6     VQLDIQDHHVVMDNGILQVTLSKPDGIVTRIQYNGID-NLLEVLSEEVERGYWDLVWSEA  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSG  753
                 +T +F ++  T F+VI+E + QVEVSF + +    K   +P+NIDKRF+ML  SSG
Sbjct  65    GSVGTTGTFDVIKGTKFEVIVESDEQVEVSFTRKWNPSQKGKLVPLNIDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIYDH K     +L QTR+VFKL +  F ++A+ D  Q  MP   +R  E  +VL+
Sbjct  125   FYSYAIYDHLKEWPPFNLPQTRIVFKLRKEKFQYMAIADNRQRYMPLPDDRLQERSKVLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
               EAV L     P+ KG+VDDKY+Y+ ++QN+ V+GWI   P +GFW IT S+EFR GGP
Sbjct  185   VPEAVLLVNPIEPEFKGEVDDKYEYSSENQNLRVHGWICMDPPVGFWQITPSDEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS---DKGTDHK  1278
             LKQ+LT H GPF L+MFLS HYSG+D  +KL+  E WK VFGPVFIY+NS   +   D  
Sbjct  245   LKQNLTSHVGPFCLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPVFIYLNSLTSNANEDPS  304

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E + WPY FP S ++P + QRG VSGR+ + D    +   P K A+VG
Sbjct  305   PLWEDAKHQMMTEVQKWPYDFPASSEFPPSDQRGNVSGRIQVRDRYVSEDCIPGKGAYVG  364

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG+ GS+Q D   YQFWTR D+ G + I  +R G+Y+LYAWVPG +GD+++ A I I
Sbjct  365   LAPPGDAGSFQRDCKGYQFWTRADEHGYYSIKNIREGQYNLYAWVPGFIGDYRYDAAINI  424

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               GC I VG+LV+ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYG
Sbjct  425   TAGCVIDVGELVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPNYINKLYVNHPDRFRQYG  484

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RY++L+   DL+YT+G SD AKDWFFAQVTRK    +YE T W + F ++ V + G 
Sbjct  485   LWERYADLYPDQDLIYTIGTSDYAKDWFFAQVTRKKDDDTYEGTTWQIKFQLDNVNQSGT  544

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             + L+I++A++  A L I +N DPK D   FT+ + GKDN I RHGIHGLY   S +IP +
Sbjct  545   FKLQISLATANIAELQIRIN-DPKADPPLFTTGVIGKDNTILRHGIHGLYWLYSIDIPAT  603

Query  2173  LIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
             L+V+G N L+L Q  +  P   F+G+MYDYIRLE 
Sbjct  604   LLVEGNNTLFLTQPISNSPLAAFHGLMYDYIRLEG  638



>ref|XP_009795927.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nicotiana 
sylvestris]
Length=650

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/632 (51%), Positives = 429/632 (68%), Gaps = 13/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI Y G+D NLLE+ N   +RGYWD+ WN+ 
Sbjct  19    VKLYIQDRHVMMDNGIVQVTLSNPDGIVTGIHYNGID-NLLEVLNDESNRGYWDVVWNSL  77

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 S  F+++  T+FKVI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  78    DGGRSGVFEVIKGTNFKVITETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGCSGF  137

Query  757   YTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             Y+YAIY+H   P+      L +TR+ FKL +  F ++AV D  Q  MP   +R     + 
Sbjct  138   YSYAIYEHVGSPEWPA-FSLGETRIAFKLRKDKFHYMAVADNRQRFMPLPDDRLPARCQR  196

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR G
Sbjct  197   LAYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSG  256

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD   K   GEAWK VFGP+FIY+NS  +G D  
Sbjct  257   GPVKQNLTSHVGPTTLAMFLSSHYAGDDLTPKFAQGEAWKKVFGPIFIYVNSVMQGEDPV  316

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ A  QM  E   WPY FP SED+P A QRG VSGRLL+ D         A  A+VG
Sbjct  317   ALWDDANIQMQVEVLSWPYCFPASEDFPSADQRGNVSGRLLVQDKYINDDYIAANGAYVG  376

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW   D+ G F I+ +R G+Y+LYAWVPG +GD+ ++  I+I
Sbjct  377   LAPPGEAGSWQKECKDYQFWATADNDGYFSINNIRPGDYNLYAWVPGFIGDYLYETPISI  436

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG ++ V ++V+ P ++G T+WEIGIPDR+AAEFF+PEP P   N L  +  ++FRQYG
Sbjct  437   SPGRNVDVDEIVYQPPRDGPTLWEIGIPDRTAAEFFVPEPNPRFINKLFVNHPDRFRQYG  496

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RYSEL+ K DLVY  G+SD +KDWFFAQV R+   G+Y+ T W + F +++V + G 
Sbjct  497   LWERYSELYPKDDLVYVTGESDYSKDWFFAQVPRRKEDGTYQGTTWQIRFKLDSVNQGGT  556

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A + + VN DP  ++  F++ L G+DN+IARHGIHGLY   + +I G+
Sbjct  557   YKLRIAIASATLAEVQVRVN-DPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGN  615

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  616   LLVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  647



>ref|XP_004136417.1| PREDICTED: rhamnogalacturonate lyase-like [Cucumis sativus]
Length=625

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/620 (52%), Positives = 416/620 (67%), Gaps = 12/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF--K  609
             MDNGIIKVNLSNP+G V GI Y+G++ NLL L N   +RGYWD+ WN      +     +
Sbjct  1     MDNGIIKVNLSNPKGMVNGIEYEGIE-NLLSLDNDEDNRGYWDIVWNLKGSSGTKGIFDR  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTD---IPINIDKRFVMLPGSSGFYTYAIYDH  780
             + ATDFKVI+E E Q+E+SF +TY +   T    IP+NIDKRFVML  SSGFYTYAIY+H
Sbjct  60    LEATDFKVIVENEEQIELSFSRTYNNNSSTGGNLIPLNIDKRFVMLRNSSGFYTYAIYEH  119

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYKEAVKLTK  954
              K     +LD TR+ FK  +  F ++AV D+ Q  MP   +R+   G+ L Y EAV L  
Sbjct  120   LKEWPAFNLDNTRIAFKPRKDKFHYMAVADKRQRLMPLPDDRKPPRGQALAYPEAVLLVD  179

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
                P  KG+VDDKYQY  +S++  V+GWIS  P +GFW I  + EFR GGPLKQ LT H 
Sbjct  180   PIEPDFKGEVDDKYQYGCESKDSRVHGWISTDPPIGFWQIAPTEEFRSGGPLKQFLTSHV  239

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQML  1311
             GP  L++F S HY+G+D  IK    E WK V+GP+FI++NS  +G D   LW+ AK+QM+
Sbjct  240   GPTTLTVFHSTHYAGEDMVIKFGDNEPWKKVYGPIFIHLNSLPEGEDPLRLWQNAKQQMM  299

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSF  SED+PK+ QRG VSG++LI +        PA  A+VGLA PGE GSWQ
Sbjct  300   AEVQSWPYSFIASEDFPKSDQRGTVSGKILIRERYVSDESVPASGAYVGLALPGELGSWQ  359

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
             N+S  YQFWTR D  G F ++ VR+G YSLY WVP  +G++++ A I + PG DIKVG+L
Sbjct  360   NESKGYQFWTRADQNGSFSLNNVRSGNYSLYGWVPNFIGNYQYSAFIVVTPGSDIKVGEL  419

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-K  1848
             VF P ++G T+WEIGIPDR+AAEF+IP+P P   N L  + +++FRQYGLW+RY+EL+  
Sbjct  420   VFEPPRDGPTLWEIGIPDRTAAEFYIPDPNPKYINKLYVNHSDRFRQYGLWERYAELYPD  479

Query  1849  TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASST  2025
              DLVYTVG SD  KDWFF+QVTRK     Y  T W + F +++    G Y LR+A+A++ 
Sbjct  480   EDLVYTVGLSDYRKDWFFSQVTRKIGDNKYAGTTWKIKFQLDSPDTNGTYRLRLALATAH  539

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
              A L + +N D +     FT+ L GKDN +ARHGIHGLY   + +IPG  +V G N + L
Sbjct  540   GAELQVRLN-DAQALPPLFTTGLIGKDNTVARHGIHGLYRLYTVDIPGGELVVGNNTILL  598

Query  2206  RQSKAGYPFYGIMYDYIRLE  2265
              Q+ +  PF GIMYDYIRLE
Sbjct  599   TQASSNSPFVGIMYDYIRLE  618



>ref|XP_004287405.1| PREDICTED: rhamnogalacturonate lyase-like [Fragaria vesca subsp. 
vesca]
Length=668

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/627 (51%), Positives = 426/627 (68%), Gaps = 10/627 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L      V+MDNGI++V LSNP+G + GI Y G+D NLLE  N   +RGYWDL W+ P
Sbjct  36    VRLHNQGRHVVMDNGIVQVTLSNPDGIITGIRYNGID-NLLEPLNAEHNRGYWDLVWSGP  94

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K +    I  TDF+VI+E E  VE+SF +T+  S +   +P+NIDKRFVML GSSG Y
Sbjct  95    GVKGTFDV-IKGTDFRVIVENEELVELSFMRTWDPSLEGKCVPLNIDKRFVMLRGSSGIY  153

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--LNYK  933
             +YAIY+H K   D ++ +TR+ FKLS+  F ++A+ D  Q  MP   +R  G    L + 
Sbjct  154   SYAIYEHLKDWPDFEIGETRITFKLSKDKFQYMAIADNRQRCMPLPDDRMSGRCQPLAFA  213

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   +N +L G+VDDKYQY+  ++++ V+GW+   P +GFW IT S+EFR GGPLK
Sbjct  214   EAVLLLDPKNKELAGEVDDKYQYSCMNKDIQVHGWVCNDPPVGFWQITPSDEFRSGGPLK  273

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q LT H GP  L++FLS HY+G D   K RGGE WK VFGPVFIY+NS    D    LWE
Sbjct  274   QSLTSHVGPTTLAIFLSSHYAGQDLNPKFRGGEPWKKVFGPVFIYLNSAPIRDDPFFLWE  333

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D    +  TPA  A+VGLA P
Sbjct  334   DAKRQMMAEVQSWPYSFPASEDFQKSNQRGNVSGRLLVLDRYVSEDITPANDAYVGLAPP  393

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR D+ G F I  +R+G Y+LYAWVPG++GD++ +A I I  GC
Sbjct  394   GDVGSWQRECKDYQFWTRADNRGYFSIKNIRSGTYNLYAWVPGYIGDYRCEAVININSGC  453

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
               ++GDLV  P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW R
Sbjct  454   FTEMGDLVHEPPRDGPTLWEIGIPDRSAAEFYVPDPDPKYINKLYVNHPDRFRQYGLWSR  513

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVYTVG SD +KDWFFAQV R+    ++E T W + F +  V + G Y LR
Sbjct  514   YTELYPDADLVYTVGVSDYSKDWFFAQVPRQK-DNTHEGTTWQIKFKLNIVHRNGTYKLR  572

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A + + +N DP   +  FT+ L G+DN+IARHGIHG+Y   +  +PG  +V+
Sbjct  573   VAIASATLAEMQVRIN-DPNSRRPLFTTGLIGRDNSIARHGIHGIYRLFNINVPGVQLVE  631

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G+N ++L Q +   PF G+MYDYIRLE
Sbjct  632   GDNTIFLTQPRCTSPFQGLMYDYIRLE  658



>ref|XP_002285626.2| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Vitis 
vinifera]
Length=643

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/628 (52%), Positives = 424/628 (68%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP G V GI Y  +D NLLE+ N   +RGYWDL W+ P
Sbjct  6     VQLYIQDRHVVMDNGILQVTLSNPGGIVTGIRYSAID-NLLEVLNDETNRGYWDLVWSVP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                A     I  T+F+VI+E E QVE+SF + +  S +   +P+NIDKRF+ML GSSGFY
Sbjct  65    G-SAGIFDVIKGTNFRVIVENEEQVEISFTRMWDPSLEGKLVPLNIDKRFIMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             +YAIY+H K      L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y 
Sbjct  124   SYAIYEHLKEWPAFTLAETRIAFKLRKDKFHYMAMADNRQRFMPLPDDRLPGRGQPLAYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L     P+ KG+VDDKYQY+ D+++  V+GW+  +P +GFW IT S+EFR GGP+K
Sbjct  184   EAVLLVNPVEPEFKGEVDDKYQYSCDNKDNRVHGWVCLEPPVGFWQITPSDEFRTGGPVK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DHKTLWE  1290
             Q+LT H GP  L+MF S HY+G+    K    E WK VFGPVFIY+NS  G  D   LWE
Sbjct  244   QNLTSHVGPTTLAMFHSAHYAGEPLVPKFGPDEPWKKVFGPVFIYVNSVFGDGDPFWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QM  E + WPYSFP SED+P + QRG VSGRLL+ D         A CA+VGLA P
Sbjct  304   DAKEQMTIEVQSWPYSFPASEDFPSSDQRGNVSGRLLVQDGYISDDYILASCAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT+ D  G F I+ +R G+Y+LYAWVPG +GD+K  A ITI PGC
Sbjct  364   GDVGSWQRECKDYQFWTQADLGGYFCINDIRPGDYNLYAWVPGFIGDYKLDAVITITPGC  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             D+ VGDL++ P ++G T+WEIGIPDRSAAEF+ P+P P   N L     ++FRQYGLW+R
Sbjct  424   DVFVGDLLYEPPRDGPTLWEIGIPDRSAAEFYSPDPNPTYVNKLFIGHPDRFRQYGLWER  483

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVYT+G SD  KDWFFAQVTRK    +Y+ T W + F ++TV + G Y LR
Sbjct  484   YAELYPDGDLVYTIGVSDYTKDWFFAQVTRKKDNNTYQGTTWQIKFTLDTVDQIGTYKLR  543

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T + L + VN DPK +   FTS L G+DN IARHGIHGLY   S  + G+L+V+
Sbjct  544   VAIASATLSELQVRVN-DPKANPPHFTSGLIGRDNTIARHGIHGLYWLYSVNVLGNLLVE  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q ++  PF GI+YDYIRLE 
Sbjct  603   GENTIFLTQPRSTSPFQGILYDYIRLEG  630



>ref|XP_009795926.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
sylvestris]
Length=669

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/632 (51%), Positives = 429/632 (68%), Gaps = 13/632 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI Y G+D NLLE+ N   +RGYWD+ WN+ 
Sbjct  38    VKLYIQDRHVMMDNGIVQVTLSNPDGIVTGIHYNGID-NLLEVLNDESNRGYWDVVWNSL  96

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 S  F+++  T+FKVI E + QVE+SF + +    +   +P+NIDKRF++L G SGF
Sbjct  97    DGGRSGVFEVIKGTNFKVITETDDQVEISFSRPWDPSLQGKLVPLNIDKRFILLRGCSGF  156

Query  757   YTYAIYDH---PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             Y+YAIY+H   P+      L +TR+ FKL +  F ++AV D  Q  MP   +R     + 
Sbjct  157   YSYAIYEHVGSPEWPA-FSLGETRIAFKLRKDKFHYMAVADNRQRFMPLPDDRLPARCQR  215

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW IT S+EFR G
Sbjct  216   LAYAEAVLLNNPVEPELRGEVDDKYQYSCDNKDNKVHGWISMDPPVGFWQITPSDEFRSG  275

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD   K   GEAWK VFGP+FIY+NS  +G D  
Sbjct  276   GPVKQNLTSHVGPTTLAMFLSSHYAGDDLTPKFAQGEAWKKVFGPIFIYVNSVMQGEDPV  335

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ A  QM  E   WPY FP SED+P A QRG VSGRLL+ D         A  A+VG
Sbjct  336   ALWDDANIQMQVEVLSWPYCFPASEDFPSADQRGNVSGRLLVQDKYINDDYIAANGAYVG  395

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW   D+ G F I+ +R G+Y+LYAWVPG +GD+ ++  I+I
Sbjct  396   LAPPGEAGSWQKECKDYQFWATADNDGYFSINNIRPGDYNLYAWVPGFIGDYLYETPISI  455

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG ++ V ++V+ P ++G T+WEIGIPDR+AAEFF+PEP P   N L  +  ++FRQYG
Sbjct  456   SPGRNVDVDEIVYQPPRDGPTLWEIGIPDRTAAEFFVPEPNPRFINKLFVNHPDRFRQYG  515

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RYSEL+ K DLVY  G+SD +KDWFFAQV R+   G+Y+ T W + F +++V + G 
Sbjct  516   LWERYSELYPKDDLVYVTGESDYSKDWFFAQVPRRKEDGTYQGTTWQIRFKLDSVNQGGT  575

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A + + VN DP  ++  F++ L G+DN+IARHGIHGLY   + +I G+
Sbjct  576   YKLRIAIASATLAEVQVRVN-DPNTNRPLFSTGLIGRDNSIARHGIHGLYWLYNIDIQGN  634

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V+G+N +YL Q +   PF GIMYDYIRLEA
Sbjct  635   LLVQGDNTIYLGQPRNQSPFQGIMYDYIRLEA  666



>gb|KCW66665.1| hypothetical protein EUGRSUZ_F00441 [Eucalyptus grandis]
Length=646

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/627 (51%), Positives = 423/627 (67%), Gaps = 9/627 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LS PEG V GI Y G+D NLLE+ N   +RGYWDL WN P
Sbjct  6     VQLHIQDRHVVMDNGIVQVTLSKPEGIVTGIRYNGID-NLLEVLNDESNRGYWDLVWNAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                      I  T F V+++ + QVE+SF +TY  S +   +P+NIDKRF+ML GSSGFY
Sbjct  65    GSSTGIFDVIKGTSFSVVVQSDDQVELSFTRTYDPSLEGKLVPLNIDKRFIMLRGSSGFY  124

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYK  933
             +YAIY+H K      L +TR+ FKL +  F ++A+ D  Q  +P   +R    G+ L Y 
Sbjct  125   SYAIYEHLKDWPGFSLGETRIAFKLRKDKFHYMAMADNRQRNLPLPDDRTPPRGQPLAYP  184

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR GGP+K
Sbjct  185   EAVLLVDPIEPELKGEVDDKYQYSCDNKDSKVHGWICSDPPVGFWLITPSNEFRTGGPVK  244

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWE  1290
             Q+LT H GP  L++FLS HY+GDD   K + GE WK VFGPVF+Y NS     D   LWE
Sbjct  245   QNLTSHVGPTTLAVFLSAHYTGDDLVPKFQAGEEWKKVFGPVFLYFNSVSDPVDPLFLWE  304

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
             GAK QM+ E + WPYSF  SED+P + QRG V GRLL+ D         A  A+VGLA P
Sbjct  305   GAKSQMMVEVESWPYSFLASEDFPPSDQRGNVHGRLLVSDRYVSDDYISANGAYVGLAPP  364

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT  D+ G F I+  R G+Y+LYAWVP  +GD+K+   I+I PG 
Sbjct  365   GDVGSWQRECKLYQFWTTADEDGYFSINNARPGDYNLYAWVPRCIGDYKYGVPISIMPGS  424

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             ++ VGDL++ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYGLW+R
Sbjct  425   NMDVGDLIYKPPRDGPTMWEIGIPDRSAAEFYVPDPNPNYINKLYVNHPDRFRQYGLWER  484

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVYTVG SD +KDWFFAQVTRK    +Y  T W + F +  V K G Y LR
Sbjct  485   YAELYPDGDLVYTVGTSDYSKDWFFAQVTRKKDDKTYLGTTWQIKFALANVDKNGVYKLR  544

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             IA+AS+T + L + VN +PK +   F++ L G+DN+IARHGIHGLY   S +I G+L+ +
Sbjct  545   IALASATLSELQVRVN-NPKSNPV-FSTGLIGRDNSIARHGIHGLYWLYSVDIKGTLLSE  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G+N ++L Q ++  PF GIMYDYIRLE
Sbjct  603   GDNIVFLTQPRSSSPFQGIMYDYIRLE  629



>ref|XP_004289511.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Fragaria 
vesca subsp. vesca]
Length=736

 Score =   633 bits (1632),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/630 (50%), Positives = 426/630 (68%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V +  ++  + +DNG++++ +S P G V GI Y+G  DNLLE  N   +RGYWD+ WN P
Sbjct  101   VSMLRSQSQIRLDNGLVQLTVSRPGGDVIGIKYKG-SDNLLEHKNLRNNRGYWDVVWNKP  159

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTD---IPINIDKRFVMLPGSSG  753
              E      K+ AT F+VIM    QVE+SF K Y    +     +P+++DKR++M  G SG
Sbjct  160   GENLHYVDKLQATKFRVIMATADQVEISFVKIYNVSQQHSAHVVPLDVDKRYIMRRGRSG  219

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYK  933
             FY YAI++  +G  ++ ++Q R+V+KL    F ++ ++D  Q  MP  ++R+ GE L Y 
Sbjct  220   FYAYAIFECREGWPEMKMEQIRMVYKLQHEKFQYMVLSDTRQTFMPKDRDRKNGEQLAYP  279

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV+LTK  N   KG+VDDKYQY+++ ++  V+GWIS    LGFW+IT S+EFR  GP+K
Sbjct  280   EAVRLTKPSNRAFKGQVDDKYQYSMEDKDNKVHGWISIDNSLGFWMITPSDEFRSAGPMK  339

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT--LW  1287
             Q LT H GP  LSMFLS HY+G   GI+L+ GEAWK VFGPVF+Y+NS   +++ T  LW
Sbjct  340   QGLTSHVGPTTLSMFLSTHYAGKQAGIELKRGEAWKKVFGPVFVYLNSAPRSNNSTGTLW  399

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
               AK+QM EE K WPY+F +SED+P + QRG+VSGRL++HD    ++   A  A++GLA 
Sbjct  400   NDAKEQMAEEVKRWPYNFTQSEDFPPSDQRGSVSGRLIVHDRYMSESLLSASSAYMGLAA  459

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PGE GSWQ +S  YQFWTR D  G F I  VR G YSLY WVPG +GD+K++ADI IKPG
Sbjct  460   PGEVGSWQKESKGYQFWTRADKQGHFLIKDVRPGNYSLYGWVPGIVGDYKYEADIEIKPG  519

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLL-SDRTEKFRQYGLW  1824
               I + +L + P +NG T+WEIGIPDRSAAEF++P+P P L N L  +D ++KFRQYGLW
Sbjct  520   SKIHLANLTYEPQRNGPTLWEIGIPDRSAAEFYVPDPYPTLMNKLYNNDHSDKFRQYGLW  579

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYT  1998
              RY EL+   DL+YT+G +D   DWF+A VTR   K  Y  T W + F + +V ++G YT
Sbjct  580   KRYEELYPDHDLIYTIGVNDYRHDWFYAHVTRSTGKERYVGTTWQIRFKLNSVMSQGNYT  639

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             L++A+AS+T + + +  N DP   +  F++ L G DNAIARHGIHGLY   S  +P SL+
Sbjct  640   LQLALASATSSEIQVRFN-DPSVKQPHFSTGLIGGDNAIARHGIHGLYWFFSVNVPSSLL  698

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +G N +YL QS+ G PF G+MYDYIRLE 
Sbjct  699   QEGTNTIYLTQSRGGAPFRGVMYDYIRLEG  728



>gb|KHF97676.1| Rhamnogalacturonate lyase [Gossypium arboreum]
 gb|KHF97785.1| Rhamnogalacturonate lyase [Gossypium arboreum]
Length=675

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/636 (50%), Positives = 428/636 (67%), Gaps = 14/636 (2%)
 Frame = +1

Query  394   CKP-----VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY  558
             C P     V+L +    V+MDNGII+V+LS P G V GI Y G+D NLLE+ NK  +RGY
Sbjct  38    CDPMLTQGVRLHIQDRYVVMDNGIIQVSLSKPGGIVTGIWYNGID-NLLEVRNKETNRGY  96

Query  559   WDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVM  735
             WDL WN    K      I  T F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+M
Sbjct  97    WDLHWNEIGGKGIFDV-IQGTSFRVIVENEEQVEISFTRTWNHSLEGKYIPLNIDKRFIM  155

Query  736   LPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG  915
             L GSSGFY+YAIY+H +     +L +TR+ FKL +  F ++AV D  Q  MP   ++  G
Sbjct  156   LRGSSGFYSYAIYEHFREWPGFELGETRITFKLRKDKFQYMAVADNRQRYMPFPDDQSNG  215

Query  916   E--VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNE  1089
                 L Y EAV L    + +L G+VDDKYQY+ +++++ V+GWI   P +GFW IT S+E
Sbjct  216   RGVPLAYPEAVLLVNPLDQRLTGEVDDKYQYSCENKDLRVHGWICFDPPVGFWQITPSDE  275

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK-G  1266
             FR GGPLKQ+L+ H GP  L+MFLS HY+G     +   GE WK VFGP+F+Y NS   G
Sbjct  276   FRSGGPLKQNLSSHVGPTTLAMFLSSHYAGKYMVPQFEAGEPWKKVFGPIFMYFNSAAYG  335

Query  1267  TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
              D   LWE AK +M+ E + WPYSFP SED+PK+ QRG  +GR+LI D         A  
Sbjct  336   NDPLLLWEDAKIKMMVEVQSWPYSFPASEDFPKSEQRGNANGRILIQDRYISNYCVIASG  395

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             A+VGLA PG+ GSWQ +S +YQFWT+ ++ G F I  +R G+Y+LYAWVPG +GD++H+A
Sbjct  396   AYVGLAPPGDAGSWQMESKNYQFWTQANEDGFFSIRNIRPGDYNLYAWVPGFIGDYRHEA  455

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKF  1806
              ITI  GC+I++GD+++ P ++G T+WEIGIPDRSAAEF+IP+P P   N L  +  ++F
Sbjct  456   VITIISGCNIEMGDVIYEPPRDGPTLWEIGIPDRSAAEFYIPDPDPKYINRLFVNHPDRF  515

Query  1807  RQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA  1983
             RQYGLW+RY+EL+ + DLVY +G SD  KDWFFAQV RK    +Y+ T W + F ++ V 
Sbjct  516   RQYGLWERYTELYPEGDLVYKIGVSDYRKDWFFAQVVRKIGDNAYQGTTWQIKFELDNVD  575

Query  1984  K-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
             + G Y LR+A+AS+T A L + V  DP  ++  FT+ L G+DNAIARHGIHG+Y   + +
Sbjct  576   RNGIYKLRVALASATLAELQVRVK-DPNSNRPLFTTGLIGRDNAIARHGIHGIYKLYNVD  634

Query  2161  IPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             IPG+  VKGEN ++ +Q +   PF G MYDYIRLE 
Sbjct  635   IPGTRFVKGENTIFFKQPRCNSPFQGFMYDYIRLEG  670



>ref|XP_008440518.1| PREDICTED: rhamnogalacturonate lyase B isoform X2 [Cucumis melo]
Length=624

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/624 (50%), Positives = 420/624 (67%), Gaps = 14/624 (2%)
 Frame = +1

Query  427   MVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF  606
             MV++DNGI++V  S P+G+V  + Y+GVD NLLE+ N   +RGYWD+ WN P  KAS + 
Sbjct  1     MVIIDNGIVRVTFSRPDGNVIALKYKGVD-NLLEIHNVHYNRGYWDVVWNRPN-KASATD  58

Query  607   KILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             ++ AT+FKVI   + QVE+SF KT+   D + +P+NIDKR+++  G SGFY+Y I++   
Sbjct  59    RVRATNFKVITANDDQVELSFTKTWDPSDASSLPLNIDKRYIVRRGDSGFYSYGIFERLN  118

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G   +D+DQ R+ +KL    F ++AV+D+ Q  MP+ ++R  G+ L+Y EAV LT+  +P
Sbjct  119   GWPQIDVDQIRIAYKLLGDKFHYMAVSDDRQRMMPTAEDRLAGKPLDYPEAVLLTRPADP  178

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
               +G+VDDKYQY+L++    V+GW S  PH+GFW+IT S+EFR  GP+KQDLT H GP  
Sbjct  179   SFQGEVDDKYQYSLENMENRVHGWESSDPHVGFWMITPSDEFRTAGPVKQDLTSHVGPIT  238

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK-TLWEGAKKQMLEET  1320
             LSMF+S HY+G D  ++ R GEAWK VFGPVF Y+NSD  GTD+  +LWE AK QM  ET
Sbjct  239   LSMFVSTHYAGKDVSMRFREGEAWKKVFGPVFTYLNSDPTGTDNPGSLWEDAKNQMTIET  298

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDS  1500
               WPY+F +S ++P + QRG++ G+LL+ D  A      A  A+VGLA PGE GSWQ +S
Sbjct  299   SRWPYNFVESREFPSSDQRGSLRGQLLVRDRYAKYPQMWADSAYVGLAAPGELGSWQRES  358

Query  1501  MSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFT  1680
               YQFWTR D+ G F I  +R+G Y+LYAWVPG LGD+K+  +ITI P     +  LVF 
Sbjct  359   KGYQFWTRADEHGYFSIDNIRSGTYNLYAWVPGVLGDYKYDKEITITPRSSTNLNLLVFD  418

Query  1681  PLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-----RTEKFRQYGLWDRYSELH  1845
             P + G T+WEIGIPDR AAEF+IP P P L N   +D       + FRQYGLW+RY+EL+
Sbjct  419   PPRQGPTLWEIGIPDRKAAEFYIPSPRPTLMNRFYNDSKIHIHDDNFRQYGLWERYAELY  478

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
                DLVY V   D  ++WFFA VTR    G YEAT W +VF ++   K G Y LR+A+AS
Sbjct  479   PHQDLVYNVDTDDYRRNWFFAHVTRATNSGIYEATTWQIVFRLQRPKKIGNYMLRLALAS  538

Query  2020  STRATLLIWVNGDPKKDKAKFTSKL--GGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             ST A + I  N +P   +  FT+     GKDNAIARHGIHGLY   +F++P   +V+GEN
Sbjct  539   STEAVIDIRFN-NPSTKRTHFTTGYWSSGKDNAIARHGIHGLYWLFNFKVPSQYLVEGEN  597

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLE  2265
              +YL Q +    F G+MYDYIR E
Sbjct  598   VIYLTQRRHTGAFQGVMYDYIRFE  621



>gb|KDP41513.1| hypothetical protein JCGZ_15920 [Jatropha curcas]
Length=686

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/628 (51%), Positives = 425/628 (68%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI+++ LS PEG V GI Y G+D NLLE+ N+  +RGYWDL WN P
Sbjct  59    VRLHIQDRHVVMDNGIVQITLSKPEGIVTGIRYNGID-NLLEVLNRETNRGYWDLFWNPP  117

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F+VI+E E QVE+SF + +  S +   IP+NIDKRF++L GSSGFY
Sbjct  118   GGKGIFDV-ISGTSFRVIIENEEQVELSFIRMWDHSLEGKYIPLNIDKRFILLRGSSGFY  176

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H +     +L +TR+ FKL +  F ++AV D  Q  MP   +R  G  + L Y 
Sbjct  177   SYAIYEHLQEWPGFELGETRITFKLRKDKFQYMAVADNRQRLMPLPDDRMPGRCQTLAYP  236

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV+L   ++P LKG+VDDKYQY+  +++  V+GWIS  P +GFW IT SNEFR  GPLK
Sbjct  237   EAVQLVNPKHPGLKGEVDDKYQYSCKNEDNQVHGWISFNPPVGFWQITPSNEFRTAGPLK  296

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK-GTDHKTLWE  1290
             Q+LT H GP  L+MF S HY+G D   +   GE WK VFGPVFIY+NS   G D   LWE
Sbjct  297   QNLTSHVGPTTLAMFHSSHYAGKDLVPRFNPGEYWKKVFGPVFIYVNSAATGHDPLFLWE  356

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP  ED+ K+ QRG ++GRLL+HD    K    A+ A+VGLA P
Sbjct  357   DAKIQMMAEVQSWPYSFPAYEDFQKSEQRGNIAGRLLVHDRYMSKDYIVARGAYVGLAPP  416

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR D++G F I  VR G+Y+LYAWVPG +GD++ +  IT+  GC
Sbjct  417   GDVGSWQRECKDYQFWTRADESGCFSIKNVRTGDYNLYAWVPGFIGDYRCEVAITLTSGC  476

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             +I++GDLVF P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW R
Sbjct  477   NIEMGDLVFGPPRDGPTLWEIGIPDRSAAEFYVPDPDPMHVNRLFINHPDRFRQYGLWAR  536

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPI-ETVAKGCYTLR  2004
             Y +L+   DLVYTVG SD +KDWFFAQV R+   G++  T W + F + E   K  + LR
Sbjct  537   YVDLYPDADLVYTVGVSDYSKDWFFAQVVRQKDDGTHVGTTWQIKFKLAEIDHKSTFKLR  596

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L + VN D    +  FT+ L G+DN+IARHGIHGLY   +  IPG+ +V+
Sbjct  597   VALASATLAELQVRVN-DQNAPRPLFTTGLIGRDNSIARHGIHGLYWLYNVNIPGARLVE  655

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q +   PF G+MYDY+RLE 
Sbjct  656   GENTIFLTQPRCTSPFQGLMYDYLRLEG  683



>gb|KDP41512.1| hypothetical protein JCGZ_15919 [Jatropha curcas]
Length=626

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/618 (52%), Positives = 422/618 (68%), Gaps = 10/618 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V  SNPEG V GI Y G+D NLLE+ N   +RGYWDL W+TP    +  F ++
Sbjct  1     MDNGILQVTFSNPEGIVTGIRYNGID-NLLEVLNDESNRGYWDLVWSTPGTGTTGIFDVI  59

Query  616   -ATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
               TDFKVI+E E QVE+SF +T+ S  +   +P+NIDKRFVML GSSGFY+YAIY+H K 
Sbjct  60    KGTDFKVIVETEEQVEISFTRTWDSSLEGKLVPLNIDKRFVMLRGSSGFYSYAIYEHSKE  119

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTEN  963
                 +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y EAV L     
Sbjct  120   WPGFNLGETRIAFKLRKDKFHYMAIADNRQRYMPLPDDRLPPRGQALAYPEAVLLVNPVE  179

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPF  1143
             P+ KG+VDDKYQY+ +++++ V+GWI   P +GFW IT SNEFR GGP KQ+LT H GP 
Sbjct  180   PEFKGEVDDKYQYSCENKDIKVHGWICMDPPVGFWHITPSNEFRTGGPHKQNLTSHVGPT  239

Query  1144  ALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQMLEET  1320
              LS+FLS HYSG+D   K   GE WK VFGPVFIY+NS   G D  +LWE AK+QM  E 
Sbjct  240   TLSVFLSAHYSGEDLVPKFEAGEEWKKVFGPVFIYLNSAMPGDDPLSLWEDAKQQMEIEV  299

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDS  1500
             + WPY FP SEDY K  QRG VSGRLL+ D         A  A+VGLA PG+ GSWQ + 
Sbjct  300   QSWPYFFPASEDYQKPDQRGNVSGRLLVKDRFISADYISANGAYVGLATPGDVGSWQREC  359

Query  1501  MSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFT  1680
              +YQFW+R D+ G F I+ +R G+Y+LYAWVPG +GD+++   ITI  GCDI  GDLV+ 
Sbjct  360   KNYQFWSRADENGYFSINNIRTGDYNLYAWVPGFIGDYRYDVVITITSGCDIDTGDLVYE  419

Query  1681  PLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDL  1857
             P ++G T+WEIGI DRSAAEF++P+P     N L  +  ++FRQYGLW+RY+EL+ + DL
Sbjct  420   PPRDGPTLWEIGISDRSAAEFYVPDPNLMFINKLYLNHPDRFRQYGLWERYAELYPQGDL  479

Query  1858  VYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRAT  2034
             +YT+G SD +KDW FAQVTRK    +Y+ + W + F +E V +   Y LR+A+AS+T + 
Sbjct  480   IYTIGVSDYSKDWLFAQVTRKKDDNTYQRSTWQIKFKLENVDQNNIYKLRVALASATISE  539

Query  2035  LLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQS  2214
             L + +N +PK +   F+S + GKDN+IARHGIHGLY   +  +  +L+V+G+N ++L Q 
Sbjct  540   LQVRIN-NPKANPV-FSSGVIGKDNSIARHGIHGLYWLYNINVAATLLVEGDNIIFLTQP  597

Query  2215  KAGYPFYGIMYDYIRLEA  2268
             ++  PF GIMYDYIR E 
Sbjct  598   RSNSPFQGIMYDYIRFEG  615



>emb|CDY13740.1| BnaA09g42420D [Brassica napus]
Length=695

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/623 (51%), Positives = 426/623 (68%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ E V++DNGII+V  S+P+G + GI Y G+D+    L ++I DRGYWD+ W  P EKA
Sbjct  75    VSNEKVVVDNGIIQVTFSSPQGLITGIKYNGIDN---VLDDEIDDRGYWDVVWYEP-EKA  130

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  T F++I + E QVE+SF +T+    + + +P+N+DKR+++  G SG Y Y I
Sbjct  131   LEIDKLEGTKFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRYIIRTGVSGIYMYGI  190

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+  ++L YKEAV LT
Sbjct  191   LERLEGWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRDNAKILAYKEAVLLT  250

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
               +NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  251   NPKNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  310

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPV  Y+NS    D    LW+ AK+QM
Sbjct  311   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLAYLNSVSPKDSTLRLWKDAKRQM  370

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
              EE + WPY F  SEDYP + QRG + G+L I D    + +   K A VGLA  GE GSW
Sbjct  371   AEEVRSWPYDFVNSEDYPLSHQRGTIEGQLYIKDRYVSRLNIYGKFAFVGLAPCGEAGSW  430

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG  + VG 
Sbjct  431   QTESKGYQFWTKADRKGRFIIENVRAGNYSLYAWGYGFIGDYKYEQNITITPGSQMNVGP  490

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             LV+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  491   LVYEPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  550

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYTVG SD  +DWFFA VTR     +Y++T W ++F +E V + G YTLRIA+AS
Sbjct  551   PQNDLVYTVGVSDYKRDWFFAHVTRNVGNNTYDSTTWQIIFNLENVNRVGLYTLRIALAS  610

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L + VN +PK D   FT+ L GKDNAIARHGIHGLY   S  + G L+  G+N +
Sbjct  611   AADSELQVRVN-NPKSDHI-FTTGLIGKDNAIARHGIHGLYRLYSINVAGDLLSVGDNTI  668

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL QS++  PF G+MYDYIRLE+
Sbjct  669   YLTQSRSVGPFQGVMYDYIRLES  691



>ref|XP_004163448.1| PREDICTED: rhamnogalacturonate lyase B-like [Cucumis sativus]
 gb|KGN62737.1| hypothetical protein Csa_2G370370 [Cucumis sativus]
Length=641

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/627 (51%), Positives = 426/627 (68%), Gaps = 9/627 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +T+  V MDNGI++V LSNP+G V GI Y GVD N+LE+ N   +RGYWDL W++ 
Sbjct  6     VQLFITERQVTMDNGIVQVTLSNPDGIVTGIRYGGVD-NVLEVLNDESNRGYWDLVWSSS  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                      I AT F+VI+E E QVE+SF +T+  S +   +P+ IDKRF+ML GSSGFY
Sbjct  65    SSTTGLFDVIKATGFEVIVENEEQVELSFTRTWDLSLEGKLVPLEIDKRFIMLRGSSGFY  124

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYK  933
             +YAIY H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G  L Y 
Sbjct  125   SYAIYQHLEEWPGFNLGETRLAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGRALAYP  184

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L     P+L+G+VDDKYQY+ D+++  V+GWIS  P +GFW+I+ SNEFR GGP+K
Sbjct  185   EAVLLVDPIEPELQGEVDDKYQYSCDNKDSGVHGWISTDPAVGFWLISPSNEFRSGGPVK  244

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DHKTLWE  1290
             Q+LT H GP  L++F+S HY+G+D   K+  GEAWK VFGPVFIY+NS   + D   LWE
Sbjct  245   QNLTSHVGPTTLAVFISAHYAGEDLVPKIGAGEAWKKVFGPVFIYLNSTYDSFDALQLWE  304

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK Q + E + WPYSFP S+D+P++ QR ++SG+LL+ D    +   PA  A VGLA P
Sbjct  305   DAKAQAVIEVQSWPYSFPASDDFPRSNQRSSISGKLLVKDSYVNEDLIPADGAFVGLAPP  364

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +S  YQFW+R D++G F I  VR G+Y+LYAWVPG +GD+++ A I +  G 
Sbjct  365   GDVGSWQRESKGYQFWSRADESGNFSIDGVRPGDYNLYAWVPGFIGDYRYDALINLTEGS  424

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             ++ +GD+ + P + G T+WEIGIPDRSAAEF++P+P P+  N L  +  +KFRQYGLW+R
Sbjct  425   EVDMGDITYEPPRQGATLWEIGIPDRSAAEFYVPDPNPNYVNKLYLNHPDKFRQYGLWER  484

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLR  2004
             YSEL   +DLVYTVG SD  KDWFFAQV RK   G+Y+ T W V F ++ V  +  Y LR
Sbjct  485   YSELFPDSDLVYTVGVSDYTKDWFFAQVPRKMENGTYKGTTWQVKFELDDVDNQATYKLR  544

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS + A L + VN    K KA F+S L G+DN+IARHGIHGLY   + +IPG+ +V 
Sbjct  545   VALASVSLAELQVGVN--EAKAKAVFSSGLIGRDNSIARHGIHGLYWVYNIDIPGNRLVT  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G N ++  Q +   PF  IMYDYIRLE
Sbjct  603   GNNTIFFTQPRCTGPFQAIMYDYIRLE  629



>ref|XP_010664440.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Vitis 
vinifera]
Length=694

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/628 (52%), Positives = 424/628 (68%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP G V GI Y  +D NLLE+ N   +RGYWDL W+ P
Sbjct  57    VQLYIQDRHVVMDNGILQVTLSNPGGIVTGIRYSAID-NLLEVLNDETNRGYWDLVWSVP  115

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
                A     I  T+F+VI+E E QVE+SF + +  S +   +P+NIDKRF+ML GSSGFY
Sbjct  116   G-SAGIFDVIKGTNFRVIVENEEQVEISFTRMWDPSLEGKLVPLNIDKRFIMLRGSSGFY  174

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             +YAIY+H K      L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y 
Sbjct  175   SYAIYEHLKEWPAFTLAETRIAFKLRKDKFHYMAMADNRQRFMPLPDDRLPGRGQPLAYP  234

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L     P+ KG+VDDKYQY+ D+++  V+GW+  +P +GFW IT S+EFR GGP+K
Sbjct  235   EAVLLVNPVEPEFKGEVDDKYQYSCDNKDNRVHGWVCLEPPVGFWQITPSDEFRTGGPVK  294

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DHKTLWE  1290
             Q+LT H GP  L+MF S HY+G+    K    E WK VFGPVFIY+NS  G  D   LWE
Sbjct  295   QNLTSHVGPTTLAMFHSAHYAGEPLVPKFGPDEPWKKVFGPVFIYVNSVFGDGDPFWLWE  354

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QM  E + WPYSFP SED+P + QRG VSGRLL+ D         A CA+VGLA P
Sbjct  355   DAKEQMTIEVQSWPYSFPASEDFPSSDQRGNVSGRLLVQDGYISDDYILASCAYVGLAPP  414

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT+ D  G F I+ +R G+Y+LYAWVPG +GD+K  A ITI PGC
Sbjct  415   GDVGSWQRECKDYQFWTQADLGGYFCINDIRPGDYNLYAWVPGFIGDYKLDAVITITPGC  474

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             D+ VGDL++ P ++G T+WEIGIPDRSAAEF+ P+P P   N L     ++FRQYGLW+R
Sbjct  475   DVFVGDLLYEPPRDGPTLWEIGIPDRSAAEFYSPDPNPTYVNKLFIGHPDRFRQYGLWER  534

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVYT+G SD  KDWFFAQVTRK    +Y+ T W + F ++TV + G Y LR
Sbjct  535   YAELYPDGDLVYTIGVSDYTKDWFFAQVTRKKDNNTYQGTTWQIKFTLDTVDQIGTYKLR  594

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T + L + VN DPK +   FTS L G+DN IARHGIHGLY   S  + G+L+V+
Sbjct  595   VAIASATLSELQVRVN-DPKANPPHFTSGLIGRDNTIARHGIHGLYWLYSVNVLGNLLVE  653

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q ++  PF GI+YDYIRLE 
Sbjct  654   GENTIFLTQPRSTSPFQGILYDYIRLEG  681



>ref|XP_010060116.1| PREDICTED: probable rhamnogalacturonate lyase B [Eucalyptus grandis]
Length=654

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/627 (51%), Positives = 423/627 (67%), Gaps = 9/627 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LS PEG V GI Y G+D NLLE+ N   +RGYWDL WN P
Sbjct  14    VQLHIQDRHVVMDNGIVQVTLSKPEGIVTGIRYNGID-NLLEVLNDESNRGYWDLVWNAP  72

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                      I  T F V+++ + QVE+SF +TY  S +   +P+NIDKRF+ML GSSGFY
Sbjct  73    GSSTGIFDVIKGTSFSVVVQSDDQVELSFTRTYDPSLEGKLVPLNIDKRFIMLRGSSGFY  132

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYK  933
             +YAIY+H K      L +TR+ FKL +  F ++A+ D  Q  +P   +R    G+ L Y 
Sbjct  133   SYAIYEHLKDWPGFSLGETRIAFKLRKDKFHYMAMADNRQRNLPLPDDRTPPRGQPLAYP  192

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT SNEFR GGP+K
Sbjct  193   EAVLLVDPIEPELKGEVDDKYQYSCDNKDSKVHGWICSDPPVGFWLITPSNEFRTGGPVK  252

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWE  1290
             Q+LT H GP  L++FLS HY+GDD   K + GE WK VFGPVF+Y NS     D   LWE
Sbjct  253   QNLTSHVGPTTLAVFLSAHYTGDDLVPKFQAGEEWKKVFGPVFLYFNSVSDPVDPLFLWE  312

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
             GAK QM+ E + WPYSF  SED+P + QRG V GRLL+ D         A  A+VGLA P
Sbjct  313   GAKSQMMVEVESWPYSFLASEDFPPSDQRGNVHGRLLVSDRYVSDDYISANGAYVGLAPP  372

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT  D+ G F I+  R G+Y+LYAWVP  +GD+K+   I+I PG 
Sbjct  373   GDVGSWQRECKLYQFWTTADEDGYFSINNARPGDYNLYAWVPRCIGDYKYGVPISIMPGS  432

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             ++ VGDL++ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYGLW+R
Sbjct  433   NMDVGDLIYKPPRDGPTMWEIGIPDRSAAEFYVPDPNPNYINKLYVNHPDRFRQYGLWER  492

Query  1831  YSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVYTVG SD +KDWFFAQVTRK    +Y  T W + F +  V K G Y LR
Sbjct  493   YAELYPDGDLVYTVGTSDYSKDWFFAQVTRKKDDKTYLGTTWQIKFALANVDKNGVYKLR  552

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             IA+AS+T + L + VN +PK +   F++ L G+DN+IARHGIHGLY   S +I G+L+ +
Sbjct  553   IALASATLSELQVRVN-NPKSNPV-FSTGLIGRDNSIARHGIHGLYWLYSVDIKGTLLSE  610

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G+N ++L Q ++  PF GIMYDYIRLE
Sbjct  611   GDNIVFLTQPRSSSPFQGIMYDYIRLE  637



>ref|XP_008219219.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=668

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/636 (50%), Positives = 431/636 (68%), Gaps = 16/636 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LS P+G V  I Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     VQLDIQDHHVVMDNGILQVTLSKPDGIVTRIQYNGID-NLLEVLNEEVNRGYWDLVWSEA  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSG  753
                 +T +F ++  T FKVI+E + QVEVSF + +    K   +P+NIDKRF+ML  SSG
Sbjct  65    GSVGTTGTFDVIKGTKFKVIVESDEQVEVSFTRKWNPSQKGKLVPLNIDKRFIMLCNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIYDH K     +L QTR+VFKL +  F ++A+ D  Q  MP   +R  E  +VL+
Sbjct  125   FYSYAIYDHLKEWPPFNLPQTRIVFKLRKEKFQYMAIADNRQRYMPLPDDRLPERSKVLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
               EAV L     P+ KG+VDDKY+Y+ ++QN+ V+GWI   P +GFW IT S+EFR GGP
Sbjct  185   VPEAVLLVNPIEPEFKGEVDDKYEYSSENQNLRVHGWICMDPPVGFWQITPSDEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKT  1281
             LKQ+LT H GP  L+MFLS HYSG+D  +KL+  E WK VFGPVFIY+NS      D  +
Sbjct  245   LKQNLTSHVGPTCLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPVFIYLNSLTSNANDDPS  304

Query  1282  --LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
               LWE AK QM+ E + WPY FP S ++P + QRG V+GR+ + D    +   P K A+V
Sbjct  305   PPLWEDAKHQMMTEVQKWPYDFPASSEFPPSDQRGNVNGRIQVRDRYVSEDCIPGKGAYV  364

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+ GS+Q D   YQFWTR D+ G + I  +R G+Y+LYAWVPG +GD+++ A I 
Sbjct  365   GLAPPGDAGSFQRDCKGYQFWTRADEHGYYSIKNIREGQYNLYAWVPGFIGDYRYDAAIN  424

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  GCDI VG+LV+ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQY
Sbjct  425   ITAGCDIDVGELVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPNYINKLYVNHPDRFRQY  484

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-G  1989
             GLW+RY++L+   DL+YT+G SD AKDWFFAQVTRK    +YE T W + F ++ V + G
Sbjct  485   GLWERYADLYPDQDLIYTIGTSDYAKDWFFAQVTRKKDDDTYEGTTWQIKFQLDNVNQSG  544

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              + L+I++A++  A L I +N DPK D   FT+ + GKDN I RHGIHGLY   S +IP 
Sbjct  545   TFKLQISLATANIAELQIRIN-DPKADPPLFTTGVIGKDNTILRHGIHGLYWLYSIDIPA  603

Query  2170  SLIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
             +L+V+G N L+L Q  +  P   F+G+MYDYIRLE 
Sbjct  604   TLLVEGNNILFLTQPISNSPLAAFHGLMYDYIRLEG  639



>ref|XP_008236572.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=626

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/624 (50%), Positives = 426/624 (68%), Gaps = 7/624 (1%)
 Frame = +1

Query  409   LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKE  588
             L+ T   V+++NG++++  S P G V GI Y+G+D NLL++ N+  +RGYWDL WN P E
Sbjct  2     LSKTDNQVVLNNGLVQLTFSYPGGDVIGIKYKGID-NLLDIKNQPSNRGYWDLVWNKPGE  60

Query  589   KASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTY  765
             K S   K+  T FKVI     Q+E+SF KTY  S     +P+N+DKR++M  G SGFY Y
Sbjct  61    KGSVD-KLQGTRFKVISATADQIEISFTKTYSPSLGNATVPLNVDKRYIMQRGRSGFYAY  119

Query  766   AIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVK  945
             AI++  KG  +VD+DQ R+V+KL +  F ++A++D+ +  MP+  +R  G+ L Y EAV 
Sbjct  120   AIFERLKGWPEVDMDQIRIVYKLQQDKFRYMAISDDRKRVMPTADDRANGQPLAYPEAVL  179

Query  946   LTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLT  1125
             LT   NP+ +G+VDDKYQY+ + ++ +V+GWI   P +GFWIIT S+EFR  GP KQDLT
Sbjct  180   LTNPSNPEFRGEVDDKYQYSSEDKDNNVHGWICKDPAVGFWIITPSDEFRTAGPFKQDLT  239

Query  1126  CHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTD-HKTLWEGAKK  1302
              H GP ALSMF+S HY+G + G+    GEAWK VFGPVFI++NS   ++ + TLWE AK+
Sbjct  240   SHVGPTALSMFVSTHYAGKEVGMTFEDGEAWKKVFGPVFIHLNSAPSSNEYLTLWENAKE  299

Query  1303  QMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPG  1482
             Q++EE + WPY+F +S+D+  + QRG+V+G+LL+ D    K    A  A+VGLA PG  G
Sbjct  300   QLVEEVQRWPYNFTQSKDFLSSDQRGSVAGQLLVRDRYRNKRLIWASSAYVGLAAPGNAG  359

Query  1483  SWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKV  1662
             SWQ +S  YQFWT+ +  G F I  VR G YSLYA VPG +GD+K++A+I I+PG +IK+
Sbjct  360   SWQKESKGYQFWTQANKQGYFLIKDVRPGNYSLYATVPGFIGDYKYEANIIIEPGSEIKL  419

Query  1663  GDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSEL  1842
              DL + P +NG T+WEIGIPDRSAAEF +P+P+P L N L ++ TEKFRQYGLW+RYS+L
Sbjct  420   ADLTYEPPRNGPTLWEIGIPDRSAAEFNVPDPSPTLMNQLYTNHTEKFRQYGLWERYSDL  479

Query  1843  HKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVA  2016
             +   DL+YTVG  +   DWFFA VTR     +YE T W + F +   A  G YTL++A+A
Sbjct  480   YPNHDLIYTVGTDNYPDDWFFAHVTRNTGNQTYEPTTWQIRFQLNKGANPGSYTLQLALA  539

Query  2017  SSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             S+T A + + VN D   +   FT+ L GKDNAIARHGIHGLY   S  +    + +G N 
Sbjct  540   SATNAEVQVRVN-DWSANPPHFTTGLIGKDNAIARHGIHGLYWLFSVGLQSDRLQEGNNT  598

Query  2197  LYLRQSKAGYPFYGIMYDYIRLEA  2268
             +YL QS+    F G+MYDY+RLE 
Sbjct  599   IYLTQSRHKTTFDGVMYDYLRLEG  622



>ref|XP_010646859.1| PREDICTED: rhamnogalacturonate lyase B-like [Vitis vinifera]
Length=668

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/625 (51%), Positives = 423/625 (68%), Gaps = 11/625 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +  + V+MDNGII++ L+ PEGSV GI Y+GV+ NLL    K   RGYWD  W   
Sbjct  49    VQLQIDDDKVVMDNGIIQLTLAKPEGSVVGIKYKGVE-NLLSHRYKESSRGYWDCVW---  104

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYT  762
               + +  +  L   F+VI + ESQVEVSFK+ +   D +   +++DKRF+ML GSSGFY 
Sbjct  105   --QENGQWVFLGNSFRVINQNESQVEVSFKRPWDPSDDSGPRLSVDKRFIMLRGSSGFYA  162

Query  763   YAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAV  942
             YAIY+  +G     L QTR+VFKL   LF ++A++D  Q  MP+ ++R  G+ L Y EAV
Sbjct  163   YAIYERLQGWHGTSLWQTRLVFKLQEDLFDYMAISDTRQRVMPTAEDRARGKPLAYPEAV  222

Query  943   KLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDL  1122
              LT   NP LKG+VDDKYQYA DS++  V+GWIS K  +GFWIIT S+EFR+ GPLKQ+L
Sbjct  223   LLTNPSNPDLKGEVDDKYQYASDSKDNKVHGWISQKSGVGFWIITPSDEFRISGPLKQEL  282

Query  1123  TCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAK  1299
             T H GP +LS+F S HY G       + GEAWK VFGP+FIY+NS     +  +LW  AK
Sbjct  283   TSHAGPVSLSVFTSSHYVGKPEEEIFKDGEAWKKVFGPIFIYLNSVSNKKEALSLWNDAK  342

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
             +QML+E   WPYSFP S+D+PK+ QRG+V GRLL+ D    +T TPA  A+VGL+ PGE 
Sbjct  343   QQMLKEVDSWPYSFPLSQDFPKSHQRGSVEGRLLVLDKYINQTPTPASLAYVGLSLPGEA  402

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ ++  YQFWT+ D  G F I AVRAG Y+L+AWVPG +GD+K+ A ITIKPG  IK
Sbjct  403   GSWQTETKGYQFWTQADKEGNFSIRAVRAGTYNLFAWVPGIMGDYKYDAIITIKPGLKIK  462

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSE  1839
             +G++VF P ++G T+WEIGIPDR+AAEFF+P+  P   N L   + +KFRQYGLWDRY++
Sbjct  463   LGNIVFEPPRHGPTLWEIGIPDRTAAEFFVPDVDPKFNNKLYV-KQDKFRQYGLWDRYAD  521

Query  1840  LH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAV  2013
             ++   DLVYTVGKSD  KDWFFA V R     ++  T W +VF +  V     Y  ++ +
Sbjct  522   IYPNQDLVYTVGKSDYRKDWFFAHVNRHVTDDTFLGTTWQIVFDLPVVDMAATYKFQLVL  581

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             A ++ A L + +N DP   +   ++KL G++N IARHGIHGL    + +IPG L V+G N
Sbjct  582   AGASLAQLQVRLN-DPNATRPLLSTKLIGRENLIARHGIHGLLRSYTADIPGFLFVEGCN  640

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +YL Q++A   F G+MYDYIRLE 
Sbjct  641   TIYLTQTRASNSFQGVMYDYIRLEG  665



>ref|XP_007137657.1| hypothetical protein PHAVU_009G144900g [Phaseolus vulgaris]
 ref|XP_007137658.1| hypothetical protein PHAVU_009G144900g [Phaseolus vulgaris]
 gb|ESW09651.1| hypothetical protein PHAVU_009G144900g [Phaseolus vulgaris]
 gb|ESW09652.1| hypothetical protein PHAVU_009G144900g [Phaseolus vulgaris]
Length=636

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/628 (51%), Positives = 422/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP G V GI Y GVD NLLE+ NK  +RGYWDL W+ P
Sbjct  6     VRLHIQDHHVVMDNGIVQVTLSNPGGIVTGIRYNGVD-NLLEVLNKESNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T FKVI++ E QVE+SF + +  S +   +P+NIDKRF+ML GSSGFY
Sbjct  65    GTKGIFDV-IQGTCFKVIVQNEEQVELSFTRMWDPSLEGKFVPLNIDKRFIMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +Y IY+H  G  D DL +TR+ FKL +  F ++A+ D  +  +P  ++R  G  + L Y 
Sbjct  124   SYGIYEHLNGWPDFDLSETRITFKLRKDKFQYMAMADNRRRILPYPEDRLPGRCQTLGYA  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV LT  ++P+L+G+VDDKYQY+  + +  V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLTNPKDPQLQGEVDDKYQYSCANMDNRVHGWISFNPPVGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q+LT H GP  L+MFLS HY+G D   K+RGGE+WK VFGPV+IY+NS   +D    LWE
Sbjct  244   QNLTSHVGPTTLAMFLSSHYAGQDLVPKIRGGESWKKVFGPVYIYLNSAAVSDDPLWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPY FP SED+ K+ QRG +SGRLL+ D         A  A+VGLA P
Sbjct  304   DAKIQMMNEVQSWPYYFPASEDFLKSDQRGNISGRLLVLDKYICTDLISANGAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR D+ G F I  VR G+Y+L+AWVPG +GD+K    + I PG 
Sbjct  364   GDAGSWQRECKDYQFWTRADENGFFTIRNVRPGDYNLFAWVPGFVGDYKFVDFMKITPGS  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
               ++G+LV+ P ++G T+WEIGIPDRSAAEF+ P+P P   N L  +  ++FRQYGLWDR
Sbjct  424   YTELGELVYEPPRDGPTLWEIGIPDRSAAEFYAPDPNPQYMNRLFINHPDRFRQYGLWDR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             Y+EL+  TDLVYTVG +D  KDWF+AQ  RK    + + T W + F +  V +G  Y LR
Sbjct  484   YTELYPATDLVYTVGVNDYRKDWFYAQAPRKKEDNTLQGTTWQIKFELSGVVRGSTYKLR  543

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L + VN DP   +  FTS L G+DN+IAR GIHG+Y   +  IPGSL++ 
Sbjct  544   VAIASATLAELQVRVN-DPNAGRPLFTSGLIGRDNSIARLGIHGIYWLYNVSIPGSLLID  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G N +Y  Q +   PF GIMYDYIRLE 
Sbjct  603   GTNTIYFTQPRCTSPFQGIMYDYIRLEG  630



>ref|XP_006466349.1| PREDICTED: rhamnogalacturonate lyase B-like [Citrus sinensis]
Length=616

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/615 (51%), Positives = 422/615 (69%), Gaps = 7/615 (1%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNG+++V LSNPEG V GI Y  +D N+LE  N+  +RGYWD+ W  P+++ S   K++
Sbjct  1     MDNGLVQVTLSNPEGEVIGIKYNEID-NVLETQNEEDNRGYWDVVWYEPEKQGSYD-KLI  58

Query  616   ATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
             ATDFKVI++ E+QVEVSF +T+    +  + P+N+DKR++M  G SGFY YAI +  +G 
Sbjct  59    ATDFKVIVQDENQVEVSFTRTWNISLRGSLAPLNVDKRYIMRRGVSGFYFYAIMERKEGW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKL  972
              DVD+DQ R VFKL ++ F  +A++++ Q  MP  ++R  G+ L Y EAV LT   NP L
Sbjct  119   PDVDMDQIRTVFKLQQNKFHFMAISNDRQRIMPMPEDRATGQPLAYPEAVLLTDPINPDL  178

Query  973   KGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALS  1152
             +G+VDDKYQY+ + +++ V+GWIS  P +GFW+IT S+EFR GGP KQDLT H GP  LS
Sbjct  179   RGEVDDKYQYSSEDKDIRVHGWISSDPPVGFWMITPSDEFRSGGPNKQDLTAHVGPVVLS  238

Query  1153  MFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQMLEETKLW  1329
             MF S HY+G +   + R GE WK VFGP  +Y+NS    +    LWE AK+QM+ E + W
Sbjct  239   MFTSTHYAGKEINTEFRNGEPWKKVFGPALVYLNSVSSEEKPLNLWEDAKRQMMVEVRKW  298

Query  1330  PYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSY  1509
             PY+FP+S D+PK  QRG V G+L +HD         A  A+VGLA PG  GSW+ DS  Y
Sbjct  299   PYNFPESVDFPKRNQRGGVFGQLRVHDRYMSNRLMWADSAYVGLAAPGGVGSWERDSKGY  358

Query  1510  QFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLK  1689
             QFWT+ +  G F I  VR G+Y+LYAWVPG +GD+K+ A+IT++ G +I +G LV+ P +
Sbjct  359   QFWTKANKRGYFSIKNVRQGDYNLYAWVPGIVGDYKYSANITVRAGSNINLGVLVYEPPR  418

Query  1690  NGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-DLVYT  1866
              G T+WEIGIPDRSAAEFF+P+P P L N L ++  EKFRQYGLW+RY +L++  DL YT
Sbjct  419   KGPTLWEIGIPDRSAAEFFVPDPYPTLANQLYTNHPEKFRQYGLWERYVDLYRNDDLEYT  478

Query  1867  VGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASSTRATLLI  2043
             VG S  AKDWFFA VTR     +Y+ T W ++F ++ +   G YTL++A+AS+T + L +
Sbjct  479   VGDSYHAKDWFFAHVTRDVGNRTYKPTTWRIIFELKHLNNNGHYTLQLALASATDSDLHV  538

Query  2044  WVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSKAG  2223
               N +P  D   F +   GKDNAIARHGIHGLY   S ++P  L+  G+N +YL QS++ 
Sbjct  539   RFN-NPNADPPHFATGTIGKDNAIARHGIHGLYRLYSIDVPSVLLNGGKNTIYLTQSRSR  597

Query  2224  YPFYGIMYDYIRLEA  2268
              PF G++YDYIRLE 
Sbjct  598   SPFQGVLYDYIRLEG  612



>ref|XP_007137655.1| hypothetical protein PHAVU_009G144800g [Phaseolus vulgaris]
 gb|ESW09649.1| hypothetical protein PHAVU_009G144800g [Phaseolus vulgaris]
Length=643

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/630 (51%), Positives = 437/630 (69%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+LT+    V+M+NGI+KV LSNP G V GI Y  +D NLLE+ N   +RGYWDL W++P
Sbjct  6     VQLTIQDNHVVMENGILKVTLSNPGGIVTGIQYNNID-NLLEVLNDESNRGYWDLVWSSP  64

Query  583   KEKASTS-FKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                +++  F ++  T F+V++E E QVE+SF +T+  S +   +P+NIDKRF+ML G SG
Sbjct  65    TSTSTSGTFDVIKGTKFQVMVENEDQVELSFTRTWDISLEGKLVPLNIDKRFIMLRGCSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H +     +LD+TR+ FKL +  F ++A+ D  Q  MP   +R   +G+ L 
Sbjct  125   FYSYAIYEHLEEWPAFNLDETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRLPPKGKALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWI   P +GFW+IT ++EFR GGP
Sbjct  185   YPEAVLLLNPIQPELKGEVDDKYQYSCDNKDNKVHGWICMDPAVGFWLITPTDEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
             +KQ+LT H GP  L+MFLS HY+G+D   K   GEAWK VFGPVFIY+NS   G D   L
Sbjct  245   VKQNLTSHVGPTTLAMFLSAHYAGEDLVPKFNAGEAWKKVFGPVFIYLNSSYDGGDPLKL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK+QML E + WPYSFP+SED+ K  +RG VSGRLL+ +         AK A+VGLA
Sbjct  305   WDDAKQQMLVEVQSWPYSFPESEDFAKWDERGNVSGRLLVRERFINDDYISAKGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +  +YQFW + DD G F I+ V AG+Y++YAWVPG +GD+K+   + I  
Sbjct  365   PPGDVGSWQRECKNYQFWAKADDDGYFTITNVCAGDYNVYAWVPGFIGDYKYDVVMNITK  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI +G+LV+ P ++G T+WEIGIPDR+AAEF++P+P P   N L  +  +KFRQYGLW
Sbjct  425   GCDIDLGELVYEPPRDGPTLWEIGIPDRTAAEFYVPDPNPKYINKLYVNHPDKFRQYGLW  484

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DL+YT+G SD  KDWFFAQVTRK    +++ T W + F ++ V K   Y 
Sbjct  485   ERYAELYPDKDLIYTIGVSDYTKDWFFAQVTRKKDDNTFQGTTWQIKFELDKVNKSSSYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T +   + VN +PK  +  F+S L G+DN+IARHGIHGLY   + +IPG+  
Sbjct  545   LRVALASATLSEFQVRVN-NPKGPRPLFSSGLIGRDNSIARHGIHGLYWLYNVDIPGTQF  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N ++L Q++   PF  IMYDYIRLEA
Sbjct  604   VEGDNTIFLTQTRGNSPFQAIMYDYIRLEA  633



>ref|XP_002319997.2| hypothetical protein POPTR_0014s01060g [Populus trichocarpa]
 gb|EEE98312.2| hypothetical protein POPTR_0014s01060g [Populus trichocarpa]
Length=625

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/619 (51%), Positives = 420/619 (68%), Gaps = 9/619 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             ++MDNG+++V LS+P G + GI Y G+  N+LE  N+  +RGYWD+ WN P    +   +
Sbjct  1     MVMDNGLVQVTLSSPGGDITGIQYNGIH-NVLETRNREGNRGYWDVVWNLPGNHIAYD-R  58

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             +  TDF VIME E QVE+SFKK++  +   +  P+N+DKR++M  GSSG Y YAI +  +
Sbjct  59    LKGTDFNVIMEDEDQVELSFKKSWNFTHGGSSAPLNVDKRYIMRRGSSGVYLYAILERLE  118

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G  D+D+DQ R+VFKL    F  +A++D+ Q  MP  ++R  GE L Y EAV LT   NP
Sbjct  119   GWPDMDMDQIRIVFKLQNDKFHFMAISDDRQRIMPMPRDRISGEPLAYPEAVLLTNPTNP  178

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
             +L G+VDDKY Y+ ++++  V+GWIS  P +GFW+ITAS+EFR GGPLKQDLT H GP  
Sbjct  179   QLGGEVDDKYHYSCENKDNRVHGWISENPTVGFWMITASDEFRAGGPLKQDLTSHVGPTV  238

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-TDHKTLWEGAKKQMLEETK  1323
             LSMF S HYSG D   K R G+ WK V GPVF+Y+NS     D  TLWE AK QM  E  
Sbjct  239   LSMFTSTHYSGKDLNTKYRNGKPWKKVLGPVFVYLNSISSLEDPTTLWEDAKDQMSIEVN  298

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY+FP+SED+P + +RG VSG+LL+ D         A  A+VGLA PG  GSW+ D+M
Sbjct  299   SWPYNFPQSEDFPSSDRRGTVSGQLLVGDKYISDKPMWASYAYVGLAAPGGVGSWERDAM  358

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFW + ++ G F I  +RAG Y+LYAWVPG +GD ++   I I+PGCD+K+G LV+ P
Sbjct  359   GYQFWVQANEEGHFLIENIRAGHYNLYAWVPGIVGDCRYDVIIHIQPGCDVKLGVLVYEP  418

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH-KTDL  1857
              +NG T+WEIGIPDR+AAEFF+P+  P L N L ++  T KFRQYGLW+RYS+L+ K DL
Sbjct  419   PRNGPTLWEIGIPDRTAAEFFVPDTYPTLMNKLFINQSTHKFRQYGLWERYSDLYPKHDL  478

Query  1858  VYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIE--TVAKGCYTLRIAVASSTRA  2031
             +YT G S+  +DWFFAQV R     +Y+AT W + F IE  T   G YTL++A+AS++ +
Sbjct  479   IYTTGISNYHQDWFFAQVPRNMGNHTYQATTWQIKFEIENATPRTGNYTLQVALASASAS  538

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L +  N D +  +  F ++L G+DNAIARHGIHGLY   S  +P  L+ +G N +YL Q
Sbjct  539   ELQVRFN-DRRAKRPHFRTRLIGRDNAIARHGIHGLYWFYSINVPSRLLRQGNNTVYLTQ  597

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             S++  P  GIMYDYIRLE 
Sbjct  598   SRSKSPVGGIMYDYIRLEG  616



>ref|XP_009148302.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
Length=633

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/621 (52%), Positives = 423/621 (68%), Gaps = 12/621 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+ P   A T   
Sbjct  15    VVMDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEESNRGYWDLVWSGPG-TAGTFDV  72

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I  T F+VIME E Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H K
Sbjct  73    IKGTKFEVIMETEEQIEISFTRKWDPSQEGKAVPLNIDKRFVMLRGSSGFYTYAIYEHLK  132

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
                   + +TR+ FKL +  F ++A+TD+ Q  MP   +R  + G+ L Y EAV L    
Sbjct  133   EWPAFSIAETRIAFKLRKDKFHYMAITDDRQRFMPLPDDRLPDRGQALAYPEAVLLVNPV  192

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
              P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H G
Sbjct  193   EPQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHVG  252

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQML  1311
             P AL++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM 
Sbjct  253   PTALAVFMSAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAKSQMN  312

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSFP S+DY KA QRG V GRLL+ D    K    A   +VGLA PG  GSWQ
Sbjct  313   VEVESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDKDFIAANRGYVGLALPGAAGSWQ  372

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
              +   YQFWTRTD+ G F I+ VR G+Y+LYAW+PG +GD+K+   ITI PGC + + DL
Sbjct  373   RECKDYQFWTRTDEEGFFYINGVRPGQYNLYAWIPGFIGDYKYDDIITITPGCYMYMEDL  432

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-K  1848
             V+ P +NG T+WEIG PDRSAAEF+ P+P P   N L  +  ++FRQYGLW+RY+EL+  
Sbjct  433   VYQPPRNGATLWEIGFPDRSAAEFYAPDPNPKYINKLYQNHPDRFRQYGLWERYAELYPD  492

Query  1849  TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASST  2025
              DLVY VG SD +KDWF+AQVTRK    +Y+ T W + F ++ + K   YTLR+A+AS+T
Sbjct  493   KDLVYVVGSSDYSKDWFYAQVTRKKDSKTYQGTTWQIKFELKNIDKDHTYTLRVAIASAT  552

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
              A L + VN         FTS L G+DN+IARHGIHGLY   + E+ GS +V GEN L+L
Sbjct  553   FAELQVRVND--ANASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVGGENTLFL  610

Query  2206  RQSKAGYPFYGIMYDYIRLEA  2268
              Q ++  PF GIMYDYIR EA
Sbjct  611   TQPRSISPFQGIMYDYIRFEA  631



>ref|XP_002527229.1| lyase, putative [Ricinus communis]
 gb|EEF35155.1| lyase, putative [Ricinus communis]
Length=676

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/622 (51%), Positives = 429/622 (69%), Gaps = 10/622 (2%)
 Frame = +1

Query  418   TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKAS  597
              +  +++DNGI+++ L NP G V GI Y G+D N+L   N   +RGYWD+ WN P    S
Sbjct  50    NQRRMVIDNGILQITLLNPTGDVIGIKYNGID-NVLGTQNGEGNRGYWDVVWNIPGTHVS  108

Query  598   TSFKILATDFKVIMEKESQVEVSFKKTYKS--GDKTDIPINIDKRFVMLPGSSGFYTYAI  771
                ++  T+F V+ME E+QVEVSF +T+ +  G+ T  P+N+DKR+++  GSS  Y Y I
Sbjct  109   YD-RLKGTNFSVVMEDENQVEVSFTRTWNASVGNWT-APLNVDKRYIVRRGSSRIYMYTI  166

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  D+D+DQ R+VFKL    F  + V+D+    MP+ K+   G+ L YKEAV LT
Sbjct  167   LERLEGWPDIDMDQIRIVFKLQNDKFHWMVVSDDRHRIMPTPKDCHNGQRLAYKEAVLLT  226

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
                NPKL+G+V+DKYQY+ +++   V+GWIS  P +GFW+IT S+EFR GGPLKQDLT H
Sbjct  227   NPANPKLRGEVEDKYQYSSENREDRVHGWISEDPPVGFWMITPSDEFRAGGPLKQDLTAH  286

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQM  1308
              GP  L+MF S HY+G D   K R G+ WK VFGPV +Y+NS     D   LWE AK+QM
Sbjct  287   VGPTVLNMFTSTHYTGKDLNTKYRDGKPWKKVFGPVCVYLNSILDDEDPLLLWEDAKEQM  346

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
             L E + WPY+FP+SED P + +RG VSG+LL+ D    +    A  A+VGLA PGE GSW
Sbjct  347   LIEFESWPYNFPESEDLPTSDERGTVSGQLLVSDRYINQRLMWAASAYVGLAPPGEVGSW  406

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q ++  YQFWT+ +  G F I  VRAG Y+LYAWVPG +GD+K+  D+ +KPG +I++G 
Sbjct  407   QRETQGYQFWTKANREGFFFIENVRAGNYNLYAWVPGIIGDWKYDVDVLVKPGSEIELGV  466

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-  1845
             LV+ P +NG T+WEIGIPDR+AAEFF+P+  P L+N L S+  +KFRQYGLWDRY++L+ 
Sbjct  467   LVYKPPRNGPTLWEIGIPDRTAAEFFVPDTCPTLENKLYSNHPDKFRQYGLWDRYTDLYP  526

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASS  2022
             + DL+YTVG S+ ++DWFFA  +RK    +YEAT W + F +E V + G YTL++A+AS+
Sbjct  527   EHDLIYTVGISNYSQDWFFAHFSRKTENNTYEATTWQIKFALENVKRDGTYTLQMALASA  586

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLY  2202
             T + L +  N DP K +  FT+KL G+DNAIARHGIHGLY   S  +PGSL+ +  N +Y
Sbjct  587   TASELQVRFN-DPSKKRPHFTTKLIGRDNAIARHGIHGLYWLYSINVPGSLL-RQNNTIY  644

Query  2203  LRQSKAGYPFYGIMYDYIRLEA  2268
             L QS+   PF G+MYDYIRLEA
Sbjct  645   LTQSRGSGPFRGVMYDYIRLEA  666



>ref|XP_008357559.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnogalacturonate 
lyase B [Malus domestica]
Length=646

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/633 (50%), Positives = 424/633 (67%), Gaps = 13/633 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V  I Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     VRLIIQDRYVVMDNGILQVTLSNPDGIVTRIQYSGID-NLLEVLNEEVNRGYWDLVWSEA  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T +F ++  T FKV +E E QVE+SF + +  S +   +P+NIDKRF+ML  SSG
Sbjct  65    GSVGTTGTFDVIKGTKFKVRVENEEQVEISFTRKWNPSQEGKLVPLNIDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H K     +L QTR+ FKL +  F ++A+ D  Q  MP   +R  E  + L 
Sbjct  125   FYSYAIYEHLKEWPPFNLPQTRITFKLRKEKFHYMAIADNRQRYMPLPDDRSPERSQALA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+ KG+VDDKY+Y+ ++QN+ V+GW+   P +GFW IT S+EFR GGP
Sbjct  185   YPEAVLLVDPIEPEFKGEVDDKYEYSCENQNLHVHGWVCMDPPIGFWQITPSDEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTL  1284
             LKQ+LT H GP  L+MFLS HYSG+D  +KL+  E WK +FGPVFIY+NS    TD   L
Sbjct  245   LKQNLTSHVGPTCLAMFLSAHYSGEDLVLKLKPDEPWKKIFGPVFIYLNSXSDATDPSPL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AKKQM+ E + WPY FP SEDYP + QRG V GR+ I D    K   P   A+VGLA
Sbjct  305   WDDAKKQMMTEVQSWPYKFPASEDYPPSDQRGNVKGRIQILDRYVSKDXVPGBGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ D   YQFWTR D+ G + I  +R G+Y+LYAW PG +GD+++ A I+I  
Sbjct  365   PPGDVGSWQRDCKGYQFWTRADEKGYYSIQNIREGDYNLYAWCPGFIGDYRYDATISITA  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI V D+V+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW
Sbjct  425   GCDIDVDDIVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPMYINKLYVNHPDRFRQYGLW  484

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYT  1998
             +RY EL+   DL+Y++G SD  KDWFFAQV RK  + +Y+ T W + F ++  ++     
Sbjct  485   ERYQELYPDEDLIYSIGTSDYTKDWFFAQVPRKKDEYTYQGTTWQIKFQLKHFSESDTLK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LRIA+A++  A L I +N D K D   FT+ + G DN IARHGIHGLY   + +IPG+L+
Sbjct  545   LRIALATANIAELQIRIN-DSKADPPLFTTGVIGNDNTIARHGIHGLYRLYNIDIPGTLL  603

Query  2179  VKGENKLYLRQ---SKAGYPFYGIMYDYIRLEA  2268
             V+G N L+L Q   S    PF+G+MYDYIRLE 
Sbjct  604   VEGANTLFLTQPMSSSPLAPFHGLMYDYIRLEG  636



>gb|KGN56316.1| hypothetical protein Csa_3G115050 [Cucumis sativus]
Length=682

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/617 (49%), Positives = 426/617 (69%), Gaps = 7/617 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI++V LS P+G V G+ Y G+  N+LE +N+ ++RGYWD  WN P E  +T  +
Sbjct  65    VIMDNGIVQVTLSTPDGDVVGLSYNGIP-NILETNNEEQNRGYWDAVWNNPDEPIATD-R  122

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFYTYAIYDHPK  786
             +    ++VI+  E Q+E+SF KT+  G   +  P+N+DKR+V+L GSSGFY YAI++ P 
Sbjct  123   LKGESYEVIIGNEEQLEISFNKTWSIGKGNETAPVNVDKRYVLLRGSSGFYCYAIFERPI  182

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G   +++DQ R+VFKL   +F ++AV+D+ Q  MP+ ++RE GE L + EAV LT   N 
Sbjct  183   GWPQIEMDQVRIVFKLQSQMFDYMAVSDDRQRVMPTMRDRENGEPLAFPEAVLLTNPSNE  242

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
             +L+G+VDDKYQY+ + ++  V+GWIS  P +GFW+IT S+EFR+ GP+KQDLT H GP  
Sbjct  243   ELRGEVDDKYQYSTEDKDNQVHGWISSDPPVGFWMITPSDEFRVAGPVKQDLTSHAGPIT  302

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETK  1323
             LSMF+S HY+G D G++   GE WK VFGPVF+Y+NS     D  +LWE AK+Q+  E  
Sbjct  303   LSMFVSTHYAGKDIGMRFAAGEPWKKVFGPVFVYLNSVSPEEDSLSLWEDAKQQLAIEIN  362

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY+FP+SED+P +AQRG+V+G+L + D         A  A VGLA PG  GSWQ ++ 
Sbjct  363   EWPYTFPQSEDFPSSAQRGSVAGQLFVRDRYISSRLMRASNAFVGLALPGPVGSWQAETK  422

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWT+ D+ G F I+ +R G Y+LYA+VPG +GD+K++A+ITI+ G +I + ++VF P
Sbjct  423   GYQFWTQADNHGNFLINNIRVGVYNLYAFVPGFIGDYKYEANITIEFGSEINLDEMVFDP  482

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLV  1860
              + G T+WEIG PDR+AAEF++P+P P L N L ++  +KFRQYGLW+RY+ ++   DLV
Sbjct  483   PRQGPTIWEIGFPDRTAAEFYVPDPYPTLMNKLYNNHADKFRQYGLWERYAAIYPNNDLV  542

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGC-YTLRIAVASSTRATL  2037
             +TVG  D   DWF+A V R     +YEAT W + F ++ V +   YTL+IA+AS+    L
Sbjct  543   FTVGVDDYKVDWFYAHVNRNMGNQTYEATTWEIRFLLQPVNQTTNYTLQIALASAAECEL  602

Query  2038  LIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSK  2217
              + +N + + ++  F++   GKDNAIARHGIHGLY   S   PG   ++G N +YL Q++
Sbjct  603   QVRLN-NRESEQPGFSTGRIGKDNAIARHGIHGLYWLYSIPFPGDQFLQGNNSIYLTQAR  661

Query  2218  AGYPFYGIMYDYIRLEA  2268
             +  PF G+MYDYIRLEA
Sbjct  662   SESPFEGLMYDYIRLEA  678



>emb|CDX76902.1| BnaC08g34880D [Brassica napus]
Length=675

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/623 (50%), Positives = 425/623 (68%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ E V++DNGII+V  S+P+G + GI Y G+D+    L ++I DRGYWD+ W  P EKA
Sbjct  55    VSNERVVVDNGIIQVTFSSPQGLITGIKYNGIDN---VLDDEIDDRGYWDVAWYEP-EKA  110

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  T F++I + E QVE+SF +T+  S   + +P+N+DKR+++  G SG Y Y I
Sbjct  111   LEIDKLEGTKFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRYIIRTGVSGIYMYGI  170

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +   DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+  ++L Y+EAV LT
Sbjct  171   LERLEDWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRDNAKILAYREAVLLT  230

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
               +NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  231   NPKNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  290

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPV  Y+NS    D    LW+ AK+QM
Sbjct  291   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLAYLNSVSPKDSTLRLWKDAKRQM  350

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
              EE + WPY+F  SEDYP + QRG + G+  I D    + +   K A VGLA  GE GSW
Sbjct  351   AEEVRSWPYNFVNSEDYPLSHQRGTIEGQFYIKDRYVSRLNIYGKFAFVGLAPCGEAGSW  410

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG  + VG 
Sbjct  411   QTESKGYQFWTKADRKGRFIIENVRAGNYSLYAWGYGFIGDYKYEQNITITPGSQMNVGP  470

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             +V+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  471   IVYEPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  530

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYTVG SD  +DWFFA VTR     +Y++T W ++F +E V + G YTLRIA+AS
Sbjct  531   PQNDLVYTVGVSDYKRDWFFAHVTRNAGNNTYDSTTWQIIFNLENVNRVGLYTLRIALAS  590

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L + VN +PK D   FT+ L GKDNAIARHGIHGLY   S  + G L+  G+N +
Sbjct  591   AADSELQVRVN-NPKSDHI-FTTGLIGKDNAIARHGIHGLYRLYSINVAGDLLSVGDNTI  648

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL QS++  PF G+MYDYIRLE+
Sbjct  649   YLTQSRSVGPFQGVMYDYIRLES  671



>ref|XP_011016984.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105120478 
[Populus euphratica]
Length=1290

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/636 (53%), Positives = 435/636 (68%), Gaps = 16/636 (3%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             HLG    V+L V    V+MDNGI++V LSNP+G V GI Y G+D NLLE+ N+  +RGYW
Sbjct  3     HLG----VQLLVQDRHVVMDNGILQVTLSNPDGIVTGIRYSGID-NLLEVQNEESNRGYW  57

Query  562   DLDWNTPKEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVM  735
             DL WNT     +  F ++    FKVI+E E QVEVSF +T+ S  +   +P+NIDKRFVM
Sbjct  58    DLVWNT--AGTTGIFDVIKGKSFKVIVETEEQVEVSFTRTWDSSQEGKLVPLNIDKRFVM  115

Query  736   LPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--E  909
             L GSSGFY+YAIY+H K     +L +TR+ FKL +  F ++ V D  Q  MP   +R   
Sbjct  116   LRGSSGFYSYAIYEHLKEWPGFNLGETRIAFKLRKDKFHYMIVADNRQRYMPLPDDRLPP  175

Query  910   EGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNE  1089
              G+ L Y EAV+L     P  KG+VDDKYQY++++++  V+GWI   P +GFW IT S+E
Sbjct  176   RGQPLAYPEAVQLVNPVEPDFKGEVDDKYQYSIENKDNKVHGWICMDPAVGFWQITPSDE  235

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKG  1266
             FR GGP+KQ+LT H GP  L MFLS HYSG+D   K+  GEAWK VFGPVF+Y NS   G
Sbjct  236   FRSGGPVKQNLTSHVGPTTLVMFLSAHYSGEDLVPKIEAGEAWKKVFGPVFMYFNSVMDG  295

Query  1267  TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
              D  +LWE AK QML E + WPY FP SEDY K+ QRG VSGRLL+ D        PA  
Sbjct  296   DDPLSLWEDAKLQMLIEVQSWPYRFPDSEDYQKSDQRGNVSGRLLVRDRFVSDDYIPANG  355

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             A+VGLA PG+ GSWQ +   YQFW R D+ G F I+ VR G+Y+LYAWVPG +GD+++  
Sbjct  356   AYVGLALPGDVGSWQRECKDYQFWNRADEGGYFSINNVRTGDYNLYAWVPGVIGDYRYDV  415

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKF  1806
              ITI  GCDI++GDLV+ P ++G T+WEIGIPDRSA EF++P+P P   N L  +  ++F
Sbjct  416   SITITSGCDIEMGDLVYEPPRDGPTLWEIGIPDRSAEEFYVPDPNPKYINKLYVNHPDRF  475

Query  1807  RQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA  1983
             RQYGLW+RY+EL+   DLVYTVG SD  KDWF+AQVTRK    +Y+ T W + F ++ V 
Sbjct  476   RQYGLWERYAELYPDGDLVYTVGVSDYRKDWFYAQVTRKKDDNTYQRTTWQIKFNLDEVD  535

Query  1984  K-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
             + G Y LR+A+AS+T + L + +N DPK  K  F+S L GKDN+IARHGIHGLY     +
Sbjct  536   QNGIYKLRVALASATISELQVRIN-DPKA-KPLFSSGLIGKDNSIARHGIHGLYWLYGID  593

Query  2161  IPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +PG+ +V+G+N ++L Q ++  PF GIMYDYIRLE 
Sbjct  594   VPGARLVEGDNAVFLTQPRSTSPFQGIMYDYIRLEG  629


 Score =   596 bits (1536),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/630 (49%), Positives = 423/630 (67%), Gaps = 12/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L + K+ V++DNGI++V LSNP G V GI Y G++ NLLE  N   +RGYWD+ W+  
Sbjct  660   VQLHIQKDYVVLDNGILQVTLSNPGGHVTGIQYNGLE-NLLETDNGESNRGYWDVVWSGE  718

Query  583   --KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 K     ++  T+  V++E E +VE+SF + + S  +  + P+N DKR+VML GSSG
Sbjct  719   GVTRKKGDLDRLDGTNLTVVVESEEKVEISFTRMWNSSLQAKVVPLNFDKRYVMLRGSSG  778

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAIY+H +G    DL  TR+VFKL++  F ++A+ D  Q  MP  ++R  E G+ L 
Sbjct  779   FYTYAIYEHLRGWPAFDLANTRIVFKLTKQKFRYMAIADNRQRYMPLPEDRSPERGQTLA  838

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+ +G+VDDKY Y+ +S+++ V+GWIS  P +GFW IT SNEFR GGP
Sbjct  839   YPEAVLLVHPIEPEFEGEVDDKYAYSCESKDIGVHGWISADPLIGFWQITPSNEFRTGGP  898

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTL  1284
             LKQ LT H GP  L +  S HY+G D  IK+   E WK V+GPVF Y+NS   G D  +L
Sbjct  899   LKQFLTSHVGPTTLGVMHSTHYAGADITIKIGPNEPWKKVYGPVFAYVNSLSDGRDPLSL  958

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AKKQM+ E  +WPY F  SED+P + QRG+V GRLL+ +        PA+ A+VGLA
Sbjct  959   WKDAKKQMMNEVHMWPYDFIASEDFPSSKQRGSVGGRLLVLERYVSNATIPAEGAYVGLA  1018

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PGE GSWQ +S  YQFW +TD+ G F I+ +R G+Y+LYAWVPG +GD+K  + I I  
Sbjct  1019  APGEAGSWQLESKGYQFWNKTDEGGNFTINGIRPGDYNLYAWVPGFIGDYKFTSLININS  1078

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GC+I +GDLV+   +NG+T+WEIG PDRSAAEF+IP+  P   N L   + E++RQYGLW
Sbjct  1079  GCNIDIGDLVYEAPRNGSTLWEIGFPDRSAAEFYIPDANPKYINKLYL-KQERYRQYGLW  1137

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYT  1998
             +RY+EL+ T DLV+TVGKS+   DWFFAQVTRK    +YE T W + F ++ V  +  Y 
Sbjct  1138  ERYAELYPTADLVFTVGKSNHTTDWFFAQVTRKKDNTTYEGTTWQIKFLLDEVDERAAYK  1197

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+A++  A L + VN +P  +  +F++   GKDN IARHGIHGLY   + +IPG+ +
Sbjct  1198  LRLALATANVAELEVRVN-EPNAN-PQFSTGEIGKDNTIARHGIHGLYRLFNVDIPGAQL  1255

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + G N ++L Q+ +  PF G+MYDYIRLE 
Sbjct  1256  LIGNNTIFLTQTASISPFQGVMYDYIRLEG  1285



>ref|XP_009597661.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009597662.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=639

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/621 (52%), Positives = 425/621 (68%), Gaps = 10/621 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF-  606
             V+MDNGI++V LS P G V  I Y GVD NLLE+ N   +RGYWD+ W+      +T   
Sbjct  16    VVMDNGILQVTLSVPAGIVTRIKYNGVD-NLLEILNDETNRGYWDVVWSPAGTTGTTGTF  74

Query  607   -KILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDH  780
              +++ T +KVI+E + Q+E+SF + +  S     IP+NIDKRF+ML GSSGFY+YAIY+H
Sbjct  75    ERLICTTYKVILETDDQIELSFSREWDVSLQDKLIPLNIDKRFIMLKGSSGFYSYAIYEH  134

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTK  954
              +G    +LD+TR+ FKL +  F ++A+ D  Q  MP   +R  + G+ L Y EAV L  
Sbjct  135   LEGWPGFNLDETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRLPDRGQPLAYPEAVLLVN  194

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
                P+ KG+VDDKYQY+ + +++ V+GWI   P LGFWII  S+EFR GGPLKQ+LT H 
Sbjct  195   PVEPEFKGEVDDKYQYSCEDKDLKVHGWICMDPPLGFWIIIPSDEFRSGGPLKQNLTSHV  254

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYIN-SDKGTDHKTLWEGAKKQML  1311
             GP ALSMFLS HY+G+D   K   GE WK VFGPVFIY+N  ++G D   LWE AK+QML
Sbjct  255   GPTALSMFLSAHYAGEDLVAKFGEGEPWKKVFGPVFIYLNYVNEGEDPLILWEDAKEQML  314

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSFP SED+P ++QRG +SGRLL+ D         A  A+VGLA PGE GSWQ
Sbjct  315   VEVQSWPYSFPASEDFPSSSQRGNISGRLLVQDRYFKDDKISASGAYVGLAPPGEVGSWQ  374

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
              +   YQFW + D+ G + IS +RAG Y+LYA+VPG +GD+K    +TI  GC I++ DL
Sbjct  375   RECKDYQFWIKADEEGYYVISDIRAGNYNLYAFVPGFIGDYKSDITVTITSGCSIEMDDL  434

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT  1851
             VF P +NG T+WEIGIPDRSA EF+IP+P P   N L  +  +KFRQYGLW+RYS+L+  
Sbjct  435   VFEPPRNGPTLWEIGIPDRSAREFYIPDPDPKYINKLFVNHPDKFRQYGLWERYSDLYPN  494

Query  1852  -DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASST  2025
              D+V+T G+SD  KDWFFAQVTRK  + +Y  T W + F +++V  K  YTLR+A+AS+ 
Sbjct  495   GDIVFTAGESDYKKDWFFAQVTRKRDEKTYIGTTWQIKFKLDSVKQKEIYTLRVALASAA  554

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
             +A L + VN D   +   F+S + GKDNAIARHGIHGL+   +  + G+++V+GEN +YL
Sbjct  555   QAELQVRVN-DSSTNTPLFSSGVIGKDNAIARHGIHGLHWLFNVNLQGNILVEGENTIYL  613

Query  2206  RQSKAGYPFYGIMYDYIRLEA  2268
              Q+ A  PF GIMYDYIRLE 
Sbjct  614   TQANATSPFQGIMYDYIRLEG  634



>ref|XP_008440517.1| PREDICTED: rhamnogalacturonate lyase B isoform X1 [Cucumis melo]
Length=696

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/623 (50%), Positives = 419/623 (67%), Gaps = 14/623 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V++DNGI++V  S P+G+V  + Y+GVD NLLE+ N   +RGYWD+ WN P  KAS + +
Sbjct  74    VIIDNGIVRVTFSRPDGNVIALKYKGVD-NLLEIHNVHYNRGYWDVVWNRPN-KASATDR  131

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
             + AT+FKVI   + QVE+SF KT+   D + +P+NIDKR+++  G SGFY+Y I++   G
Sbjct  132   VRATNFKVITANDDQVELSFTKTWDPSDASSLPLNIDKRYIVRRGDSGFYSYGIFERLNG  191

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPK  969
                +D+DQ R+ +KL    F ++AV+D+ Q  MP+ ++R  G+ L+Y EAV LT+  +P 
Sbjct  192   WPQIDVDQIRIAYKLLGDKFHYMAVSDDRQRMMPTAEDRLAGKPLDYPEAVLLTRPADPS  251

Query  970   LKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFAL  1149
              +G+VDDKYQY+L++    V+GW S  PH+GFW+IT S+EFR  GP+KQDLT H GP  L
Sbjct  252   FQGEVDDKYQYSLENMENRVHGWESSDPHVGFWMITPSDEFRTAGPVKQDLTSHVGPITL  311

Query  1150  SMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK-TLWEGAKKQMLEETK  1323
             SMF+S HY+G D  ++ R GEAWK VFGPVF Y+NSD  GTD+  +LWE AK QM  ET 
Sbjct  312   SMFVSTHYAGKDVSMRFREGEAWKKVFGPVFTYLNSDPTGTDNPGSLWEDAKNQMTIETS  371

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY+F +S ++P + QRG++ G+LL+ D  A      A  A+VGLA PGE GSWQ +S 
Sbjct  372   RWPYNFVESREFPSSDQRGSLRGQLLVRDRYAKYPQMWADSAYVGLAAPGELGSWQRESK  431

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWTR D+ G F I  +R+G Y+LYAWVPG LGD+K+  +ITI P     +  LVF P
Sbjct  432   GYQFWTRADEHGYFSIDNIRSGTYNLYAWVPGVLGDYKYDKEITITPRSSTNLNLLVFDP  491

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-----RTEKFRQYGLWDRYSELH-  1845
              + G T+WEIGIPDR AAEF+IP P P L N   +D       + FRQYGLW+RY+EL+ 
Sbjct  492   PRQGPTLWEIGIPDRKAAEFYIPSPRPTLMNRFYNDSKIHIHDDNFRQYGLWERYAELYP  551

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASS  2022
               DLVY V   D  ++WFFA VTR    G YEAT W +VF ++   K G Y LR+A+ASS
Sbjct  552   HQDLVYNVDTDDYRRNWFFAHVTRATNSGIYEATTWQIVFRLQRPKKIGNYMLRLALASS  611

Query  2023  TRATLLIWVNGDPKKDKAKFTSKL--GGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             T A + I  N +P   +  FT+     GKDNAIARHGIHGLY   +F++P   +V+GEN 
Sbjct  612   TEAVIDIRFN-NPSTKRTHFTTGYWSSGKDNAIARHGIHGLYWLFNFKVPSQYLVEGENV  670

Query  2197  LYLRQSKAGYPFYGIMYDYIRLE  2265
             +YL Q +    F G+MYDYIR E
Sbjct  671   IYLTQRRHTGAFQGVMYDYIRFE  693



>ref|XP_009112504.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
 ref|XP_009112506.1| PREDICTED: probable rhamnogalacturonate lyase B [Brassica rapa]
Length=675

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/623 (50%), Positives = 424/623 (68%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ E V++DNGII+V  S+P+G + GI Y G+D+    L ++I DRGYWD+ W  P EKA
Sbjct  55    VSNEKVVVDNGIIQVTFSSPQGLITGIKYNGIDN---VLDDEIDDRGYWDIVWYEP-EKA  110

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  T F++I + E QVE+SF +T+  S   + +P+N+DKR+++  G SG Y Y I
Sbjct  111   LEIDKLEGTKFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRYIIRTGVSGIYMYGI  170

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+  ++L YKEAV LT
Sbjct  171   LERLEGWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRDNAKILAYKEAVLLT  230

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
               +NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  231   NPKNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  290

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPV  Y+NS    D    LW+ AK+QM
Sbjct  291   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLAYLNSVSPKDSTLRLWKDAKRQM  350

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E + WPY F  SEDYP + QRG + G+  I D    + +   K A VGLA  GE GSW
Sbjct  351   AVEVRSWPYDFVNSEDYPLSHQRGTIEGQFYIKDRYVSRLNIYGKFAFVGLAPCGEAGSW  410

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG  + VG 
Sbjct  411   QTESKGYQFWTKADRKGRFIIDNVRAGNYSLYAWGYGFIGDYKYEQNITITPGSQMNVGP  470

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             LV+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  471   LVYEPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  530

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYTVG SD  +DWFFA VTR     +Y++T W ++F +E V + G YTLRIA+AS
Sbjct  531   PQNDLVYTVGVSDYKRDWFFAHVTRNVGNNTYDSTTWQIIFNLENVNRVGLYTLRIALAS  590

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L + VN +PK D   FT+ L GKDNAIARHGIHGLY   S  + G L+  G+N +
Sbjct  591   AADSELQVRVN-NPKSDHI-FTTGLIGKDNAIARHGIHGLYRLYSINVAGDLLSVGDNTI  648

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL QS++  PF G+MYDYIRLE+
Sbjct  649   YLTQSRSVGPFQGVMYDYIRLES  671



>emb|CDX93466.1| BnaA06g05820D [Brassica napus]
Length=656

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/621 (52%), Positives = 422/621 (68%), Gaps = 12/621 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+ P   A T   
Sbjct  38    VVMDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEESNRGYWDLVWSGPG-TAGTFDV  95

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I  T F VIME E Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H K
Sbjct  96    IKGTKFDVIMETEEQIEISFTRKWDPSQEGKAVPLNIDKRFVMLRGSSGFYTYAIYEHLK  155

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
                   + +TR+ FKL +  F ++A+TD+ Q  MP   +R  + G+ L Y EAV L    
Sbjct  156   EWPAFSIAETRIAFKLRKEKFHYMAITDDRQRFMPLPDDRLPDRGQALAYPEAVLLVNPV  215

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
              P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H G
Sbjct  216   EPQFKGEVDDKYQYSCENKDIAVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHVG  275

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQML  1311
             P +L++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM 
Sbjct  276   PTSLAVFMSAHYTGEDLVPKFSAGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAKSQMN  335

Query  1312  EETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQ  1491
              E + WPYSFP S+DY KA QRG V GRLL+ D    K    A   +VGLA PG  GSWQ
Sbjct  336   VEVESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDKDFIAANRGYVGLALPGATGSWQ  395

Query  1492  NDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDL  1671
              +   YQFWTRTD+ G F I+ VR G+Y+LYAW+PG +GD+K+   ITI PGC + + DL
Sbjct  396   RECKDYQFWTRTDEEGFFYINGVRPGQYNLYAWIPGFIGDYKYDDIITITPGCYMYMEDL  455

Query  1672  VFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-K  1848
             V+ P +NG T+WEIG PDRSAAEF+ P+P P   N L  +  ++FRQYGLW+RY+EL+  
Sbjct  456   VYQPPRNGATLWEIGFPDRSAAEFYAPDPNPKYINKLYQNHPDRFRQYGLWERYAELYPD  515

Query  1849  TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASST  2025
              DLVY VG SD  KDWF+AQVTRK    +Y+ T W + F ++ + K   YTLR+A+AS+T
Sbjct  516   KDLVYVVGSSDYRKDWFYAQVTRKKDNKTYQGTTWQIKFELKNIDKDHTYTLRVAIASAT  575

Query  2026  RATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYL  2205
              A L + VN         FTS L G+DN+IARHGIHGLY   + E+ GS +V+GEN L+L
Sbjct  576   FAELQVRVND--ANASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLFL  633

Query  2206  RQSKAGYPFYGIMYDYIRLEA  2268
              Q ++  PF GIMYDYIR EA
Sbjct  634   TQPRSISPFQGIMYDYIRFEA  654



>ref|XP_010319233.1| PREDICTED: probable rhamnogalacturonate lyase B [Solanum lycopersicum]
Length=684

 Score =   628 bits (1619),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/636 (50%), Positives = 426/636 (67%), Gaps = 9/636 (1%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             L    PVKL    + VL+DNG+  +  S P+G V  I Y G+D NLLE  NK  +RGYWD
Sbjct  45    LQTYPPVKLIRLNKHVLVDNGLFSITFSVPDGMVVNIKYNGID-NLLENKNKENNRGYWD  103

Query  565   LDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPG  744
             + WN  +++     K+  T F+VI++ E+QVE+SF +T+K+ + + + +NI+KRF++L G
Sbjct  104   IVWNKAEKQGDIFDKLEGTKFEVILQDENQVELSFTRTWKTLNSSSLSMNIEKRFIILRG  163

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVL  924
             SSGFY+YAI++  +G  D+D+ Q R+ FKL+  LF+++A++DE Q  MP+ ++R  G  L
Sbjct  164   SSGFYSYAIFERLEGWPDIDVYQGRMAFKLNEKLFSYMAISDERQRIMPTAQDRAMGRQL  223

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
             +YKEAV LT      LKG+VDDKYQY++++++  V+GWISP P  GFW+IT S+EF+ GG
Sbjct  224   DYKEAVLLTGPSTSFLKGEVDDKYQYSVENKDNKVHGWISPSPKTGFWMITPSSEFQAGG  283

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKT  1281
             P+KQDLT H GP  LSMF S HY+G+  G++ R GE WK VFGPVFIY+N      D  T
Sbjct  284   PVKQDLTSHTGPITLSMFFSTHYTGEIIGLRFRNGEPWKKVFGPVFIYLNCVPNEEDILT  343

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LW  AK+QML ET+ WPY FP S+D+  A QRG V GRLL++D    KT        +GL
Sbjct  344   LWTDAKEQMLIETERWPYEFPLSQDFVGADQRGIVCGRLLVNDSYMSKTLITPNSTFIGL  403

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ ++  YQFWT+T++ G F I+ +  G YSLYAWVPG +GD+K+K  I I 
Sbjct  404   AAPGDVGSWQIENKGYQFWTQTNNEGYFFINNIIPGNYSLYAWVPGFIGDYKYKDYINIT  463

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYG  1818
             PG   ++  LV+ P +NG T+WEIGIPDR+A EFFIP P P L+N L ++   EKFRQYG
Sbjct  464   PGSRTRLQTLVYYPPRNGPTLWEIGIPDRTAEEFFIPNPQPKLQNQLCIAHYEEKFRQYG  523

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVT----RKNAKGSYEATIWTVVFPIETVA  1983
             LWDRY+E++   DL+YTVG S+   DWFFA V     + N   +Y  T W +VF ++ V 
Sbjct  524   LWDRYTEIYPNIDLIYTVGSSNYQTDWFFAHVNKYIYKDNGDKTYIPTTWQIVFDLQEVK  583

Query  1984  K-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
                 YTL++A+ASS  A L I +N    +    FT+   GKDNAIARHGIHGLY   S +
Sbjct  584   DFSNYTLQLALASSNEAELQIRINDQNPEHAPHFTTGSIGKDNAIARHGIHGLYRMYSID  643

Query  2161  IPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             IP  L+  G N ++L+QS+    + GIMYDYIRLE 
Sbjct  644   IPSDLLTIGSNTMFLKQSRGSSSWSGIMYDYIRLEG  679



>ref|XP_004161760.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
Length=626

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/621 (52%), Positives = 416/621 (67%), Gaps = 13/621 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF--K  609
             MDNGIIKVNLSNP+G V GI Y+G++ NLL L N   +RGYWD+ WN      +     +
Sbjct  1     MDNGIIKVNLSNPKGMVNGIEYEGIE-NLLSLDNDEDNRGYWDIVWNLKGSSGTKGIFDR  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTD---IPINIDKRFVMLPGSSGFYTYAIYDH  780
             + ATDFKVI+E E Q+E+SF +TY +   T    IP+NIDKRFVML  SSGFYTYAIY+H
Sbjct  60    LEATDFKVIVENEEQIELSFSRTYNNNSSTGGNLIPLNIDKRFVMLRNSSGFYTYAIYEH  119

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYKEAVKLTK  954
              K     +LD TR+ FK  +  F ++AV D+ Q  MP   +R+   G+ L Y EAV L  
Sbjct  120   LKEWPAFNLDNTRIAFKPRKDKFHYMAVADKRQRLMPLPDDRKPPRGQALAYPEAVLLVD  179

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
                P  KG+VDDKYQY  +S++  V+GWIS  P +GFW I  + EFR GGPLKQ LT H 
Sbjct  180   PIEPDFKGEVDDKYQYGCESKDSRVHGWISTDPPIGFWQIAPTEEFRSGGPLKQFLTSHV  239

Query  1135  GPFALSM-FLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQM  1308
             GP  L++ F S HY+G+D  IK    E WK V+GP+FI++NS  +G D   LW+ AK+QM
Sbjct  240   GPTTLTVSFHSTHYAGEDMVIKFGDNEPWKKVYGPIFIHLNSLPEGEDPLRLWQNAKQQM  299

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
             + E + WPYSF  SED+PK+ QRG VSG++LI +        PA  A+VGLA PGE GSW
Sbjct  300   MAEVQSWPYSFIASEDFPKSDQRGTVSGKILIRERYVSDESVPASGAYVGLALPGELGSW  359

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             QN+S  YQFWTR D  G F ++ VR+G YSLY WVP  +G++++ A I + PG DIKVG+
Sbjct  360   QNESKGYQFWTRADQNGSFSLNNVRSGNYSLYGWVPNFIGNYQYSAFIVVTPGSDIKVGE  419

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-  1845
             LVF P ++G T+WEIGIPDR+AAEF+IP+P P   N L  + +++FRQYGLW+RY+EL+ 
Sbjct  420   LVFEPPRDGPTLWEIGIPDRTAAEFYIPDPNPKYINKLYVNHSDRFRQYGLWERYAELYP  479

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASS  2022
               DLVYTVG SD  KDWFF+QVTRK     Y  T W + F +++    G Y LR+A+A++
Sbjct  480   DEDLVYTVGLSDYRKDWFFSQVTRKIGDNKYAGTTWKIKFQLDSPDTNGTYRLRLALATA  539

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLY  2202
               A L + +N D +     FT+ L GKDN +ARHGIHGLY   + +IPG  +V G N + 
Sbjct  540   HGAELQVRLN-DAQALPPLFTTGLIGKDNTVARHGIHGLYRLYTVDIPGGELVVGNNTIL  598

Query  2203  LRQSKAGYPFYGIMYDYIRLE  2265
             L Q+ +  PF GIMYDYIRLE
Sbjct  599   LTQASSNSPFVGIMYDYIRLE  619



>ref|XP_004133752.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
 ref|XP_004155216.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Cucumis 
sativus]
Length=616

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/615 (49%), Positives = 424/615 (69%), Gaps = 7/615 (1%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V LS P+G V G+ Y G+  N+LE +N+ ++RGYWD  WN P E  +T  ++ 
Sbjct  1     MDNGIVQVTLSTPDGDVVGLSYNGIP-NILETNNEEQNRGYWDAVWNNPDEPIATD-RLK  58

Query  616   ATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
                ++VI+  E Q+E+SF KT+  G   +  P+N+DKR+V+L GSSGFY YAI++ P G 
Sbjct  59    GESYEVIIGNEEQLEISFNKTWSIGKGNETAPVNVDKRYVLLRGSSGFYCYAIFERPIGW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKL  972
               +++DQ R+VFKL   +F ++AV+D+ Q  MP+ ++RE GE L + EAV LT   N +L
Sbjct  119   PQIEMDQVRIVFKLQSQMFDYMAVSDDRQRVMPTMRDRENGEPLAFPEAVLLTNPSNEEL  178

Query  973   KGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALS  1152
             +G+VDDKYQY+ + ++  V+GWIS  P +GFW+IT S+EFR+ GP+KQDLT H GP  LS
Sbjct  179   RGEVDDKYQYSTEDKDNQVHGWISSDPPVGFWMITPSDEFRVAGPVKQDLTSHAGPITLS  238

Query  1153  MFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETKLW  1329
             MF+S HY+G D G++   GE WK VFGPVF+Y+NS     D  +LWE AK+Q+  E   W
Sbjct  239   MFVSTHYAGKDIGMRFAAGEPWKKVFGPVFVYLNSVSPEEDSLSLWEDAKQQLAIEINEW  298

Query  1330  PYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSY  1509
             PY+FP+SED+P +AQRG+V+G+L + D         A  A VGLA PG  GSWQ ++  Y
Sbjct  299   PYTFPQSEDFPSSAQRGSVAGQLFVRDRYISSRLMRASNAFVGLALPGPVGSWQAETKGY  358

Query  1510  QFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLK  1689
             QFWT+ D+ G F I+ +R G Y+LYA+VPG +GD+K++A+ITI+ G +I + ++VF P +
Sbjct  359   QFWTQADNHGNFLINNIRVGVYNLYAFVPGFIGDYKYEANITIEFGSEINLDEMVFDPPR  418

Query  1690  NGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLVYT  1866
              G T+WEIG PDR+AAEF++P+P P L N L ++  +KFRQYGLW+RY+ ++   DLV+T
Sbjct  419   QGPTIWEIGFPDRTAAEFYVPDPYPTLMNKLYNNHADKFRQYGLWERYAAIYPNNDLVFT  478

Query  1867  VGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGC-YTLRIAVASSTRATLLI  2043
             VG  D   DWF+A V R     +YEAT W + F ++ V +   YTL+IA+AS+    L +
Sbjct  479   VGVDDYKVDWFYAHVNRNMGNQTYEATTWEIRFLLQPVNQTTNYTLQIALASAAECELQV  538

Query  2044  WVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSKAG  2223
              +N + + ++  F++   GKDNAIARHGIHGLY   S   PG   ++G N +YL Q+++ 
Sbjct  539   RLN-NRESEQPGFSTGRIGKDNAIARHGIHGLYWLYSIPFPGDQFLQGNNSIYLTQARSE  597

Query  2224  YPFYGIMYDYIRLEA  2268
              PF G+MYDYIRLEA
Sbjct  598   SPFEGLMYDYIRLEA  612



>ref|XP_010244707.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nelumbo 
nucifera]
Length=621

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/619 (51%), Positives = 418/619 (68%), Gaps = 11/619 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNG+++V +S P G V  I Y  +D NLLE+ N+ ++RGYWD  WN P  + ST  ++ 
Sbjct  1     MDNGLLRVTISVPGGIVTAIQYSSLD-NLLEVLNEEENRGYWDTVWNEPG-RISTMDRME  58

Query  616   ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
              T FKVIM+ E Q+E+SF +T+  S     IP+NIDKRF+ML G  G Y YAIY+H +G 
Sbjct  59    GTAFKVIMKNEKQIELSFTRTWNYSFQGNAIPLNIDKRFIMLHGIHGLYCYAIYEHLEGW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKL  972
              D ++++TR+VFKL +  F ++A++D  Q  MP  ++R +G+ L Y EAV LT   NP L
Sbjct  119   PDFNINETRIVFKLRKDKFHYMALSDTRQRMMPMPEDRAKGQPLAYPEAVLLTNPTNPDL  178

Query  973   KGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALS  1152
             KG+VDDKYQY+ + ++  V+GWIS  P +GFW+IT S EF  GGPLKQDLT H GP  L+
Sbjct  179   KGEVDDKYQYSCNVEDNKVHGWISADPPVGFWMITPSYEFVAGGPLKQDLTSHVGPITLA  238

Query  1153  MFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETKLW  1329
             MF+S HYSG+D G   R GE WK VFGPVFIY+NS   G D ++LWE AK Q   +   W
Sbjct  239   MFISAHYSGEDTGPMFRNGEPWKKVFGPVFIYLNSLSPGKDLQSLWEDAKYQASIQIASW  298

Query  1330  PYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSY  1509
             PY+FP SED+P + QRG V+GRLL+ D    + ++ A  A+VG+A PGE GSWQ +   Y
Sbjct  299   PYTFPASEDFPSSYQRGIVTGRLLVQDRYISEENSSAAFAYVGVAPPGELGSWQRECKGY  358

Query  1510  QFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLK  1689
             QFWTR    G F I  +R G+Y+LYAWVPG +GD+K+   ITI PG ++ +GDLV+ P +
Sbjct  359   QFWTRASADGSFSIRDIRVGDYNLYAWVPGFIGDYKYDFSITITPGNNVSLGDLVYKPPR  418

Query  1690  NGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEK-FRQYGLWDRYSELH-KTDLVY  1863
             +G T+WEIGIPDRSA+EF++P+P P   N L  D   + FRQYGLW+RY++ +   DL+Y
Sbjct  419   DGPTLWEIGIPDRSASEFYVPDPNPKYVNKLYVDIPMRLFRQYGLWERYADFYPHEDLIY  478

Query  1864  TVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK---GCYTLRIAVASSTRAT  2034
             TV  SD   DWFFA VTRK  K +Y+AT W ++F +E + +   G YTLR+A+AS+T + 
Sbjct  479   TVNSSDYRNDWFFAHVTRKTEKNTYQATTWQILFTLEKMNQTQNGTYTLRLAIASATESE  538

Query  2035  LLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS-LIVKGENKLYLRQ  2211
             L +  N +P  +   F++ L GKDNAIARHGIHGLY   S  +    L+  G N + L Q
Sbjct  539   LQVRFN-NPNVNPPHFSTGLIGKDNAIARHGIHGLYRLFSVAVESEWLVAGGNNTIILTQ  597

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             S+   PF GIMYDYIRLE 
Sbjct  598   SRHSTPFNGIMYDYIRLEG  616



>ref|NP_179847.1| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
 gb|AAD15570.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07329.1| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
Length=677

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/623 (50%), Positives = 420/623 (67%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V  + V++DNGI++V  SNPEG + GI Y G+D+    L +KI DRGYWD+ W  P++K 
Sbjct  57    VGHDTVVVDNGIVQVTFSNPEGLITGIKYHGIDN---VLDDKIDDRGYWDVVWYEPEKKQ  113

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
              T  K+  T F++I + E Q+E+SF +T+  S   + +P+N+DKR+++  G SG Y Y I
Sbjct  114   KTD-KLEGTKFEIITQNEEQIEISFTRTWTISRRGSLVPLNVDKRYIIRSGVSGLYMYGI  172

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +RE  + L YKEAV LT
Sbjct  173   LERLEGWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRENSKSLAYKEAVLLT  232

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
                NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  233   NPSNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  292

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPV  Y+NS    D    LW  AK+QM
Sbjct  293   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLAYLNSVSPKDSTLRLWRDAKRQM  352

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E K WPY F  SEDYP   QRG + G+ LI D    +     K A VGLA  GE GSW
Sbjct  353   AAEVKSWPYDFITSEDYPLRHQRGTLEGQFLIKDSYVSRLKIYGKFAFVGLAPIGEAGSW  412

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG ++ VG 
Sbjct  413   QTESKGYQFWTKADRRGRFIIENVRAGNYSLYAWGSGFIGDYKYEQNITITPGSEMNVGP  472

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             LV+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  473   LVYEPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  532

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYT+G SD   DWFFA V R     +Y+ T W ++F ++ V + G YTLRIA+AS
Sbjct  533   PQNDLVYTIGVSDYRSDWFFAHVARNVGNDTYQPTTWQIIFNLKNVNRIGRYTLRIALAS  592

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L I +N DPK D A FT+   GKDNAIARHGIHGLY   S ++ G+L+  G+N +
Sbjct  593   AADSELQIRIN-DPKSD-AIFTTGFIGKDNAIARHGIHGLYRLYSIDVAGNLLSVGDNTI  650

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             +L Q+++  PF GIMYDYIRLE+
Sbjct  651   FLTQTRSRTPFQGIMYDYIRLES  673



>ref|XP_010244708.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Nelumbo 
nucifera]
Length=622

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/620 (51%), Positives = 418/620 (67%), Gaps = 12/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNG+++V +S P G V  I Y  +D NLLE+ N+ ++RGYWD  WN P  + ST  ++ 
Sbjct  1     MDNGLLRVTISVPGGIVTAIQYSSLD-NLLEVLNEEENRGYWDTVWNEPG-RISTMDRME  58

Query  616   ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
              T FKVIM+ E Q+E+SF +T+  S     IP+NIDKRF+ML G  G Y YAIY+H +G 
Sbjct  59    GTAFKVIMKNEKQIELSFTRTWNYSFQGNAIPLNIDKRFIMLHGIHGLYCYAIYEHLEGW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKL  972
              D ++++TR+VFKL +  F ++A++D  Q  MP  ++R +G+ L Y EAV LT   NP L
Sbjct  119   PDFNINETRIVFKLRKDKFHYMALSDTRQRMMPMPEDRAKGQPLAYPEAVLLTNPTNPDL  178

Query  973   KGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALS  1152
             KG+VDDKYQY+ + ++  V+GWIS  P +GFW+IT S EF  GGPLKQDLT H GP  L+
Sbjct  179   KGEVDDKYQYSCNVEDNKVHGWISADPPVGFWMITPSYEFVAGGPLKQDLTSHVGPITLA  238

Query  1153  MFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETKLW  1329
             MF+S HYSG+D G   R GE WK VFGPVFIY+NS   G D ++LWE AK Q   +   W
Sbjct  239   MFISAHYSGEDTGPMFRNGEPWKKVFGPVFIYLNSLSPGKDLQSLWEDAKYQASIQIASW  298

Query  1330  PYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSY  1509
             PY+FP SED+P + QRG V+GRLL+ D    + ++ A  A+VG+A PGE GSWQ +   Y
Sbjct  299   PYTFPASEDFPSSYQRGIVTGRLLVQDRYISEENSSAAFAYVGVAPPGELGSWQRECKGY  358

Query  1510  QFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLK  1689
             QFWTR    G F I  +R G+Y+LYAWVPG +GD+K+   ITI PG ++ +GDLV+ P +
Sbjct  359   QFWTRASADGSFSIRDIRVGDYNLYAWVPGFIGDYKYDFSITITPGNNVSLGDLVYKPPR  418

Query  1690  NGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEK--FRQYGLWDRYSELH-KTDLV  1860
             +G T+WEIGIPDRSA+EF++P+P P   N L  D   +  FRQYGLW+RY++ +   DL+
Sbjct  419   DGPTLWEIGIPDRSASEFYVPDPNPKYVNKLYVDIPMRLVFRQYGLWERYADFYPHEDLI  478

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK---GCYTLRIAVASSTRA  2031
             YTV  SD   DWFFA VTRK  K +Y+AT W ++F +E + +   G YTLR+A+AS+T +
Sbjct  479   YTVNSSDYRNDWFFAHVTRKTEKNTYQATTWQILFTLEKMNQTQNGTYTLRLAIASATES  538

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS-LIVKGENKLYLR  2208
              L +  N +P  +   F++ L GKDNAIARHGIHGLY   S  +    L+  G N + L 
Sbjct  539   ELQVRFN-NPNVNPPHFSTGLIGKDNAIARHGIHGLYRLFSVAVESEWLVAGGNNTIILT  597

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             QS+   PF GIMYDYIRLE 
Sbjct  598   QSRHSTPFNGIMYDYIRLEG  617



>ref|XP_006472413.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X3 [Citrus 
sinensis]
Length=638

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/630 (50%), Positives = 417/630 (66%), Gaps = 22/630 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V++DNGI++V  S P G V GI Y  +D NLLE+ N   +RGYWDL WN P
Sbjct  6     VNLLIQDRHVVLDNGILEVTFSYPGGIVTGIRYNDID-NLLEVLNDELNRGYWDLVWNAP  64

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
                 +      I  T F VI+E E QVE+SF +T+ S  +   +P+NIDKRFVML GSSG
Sbjct  65    GSTGTRGIFDVIQGTSFNVIVENEDQVEISFTRTWDSSLEGKLVPLNIDKRFVMLRGSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTY+IY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  125   FYTYSIYEHLEEWPGFNLGETRIAFKLRKDKFHYMAIADNRQRYMPLPDDRVPPRGQPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P  KG+VDDKYQY+ D+++++V+GWI   P +GFW IT S EFR GGP
Sbjct  185   YPEAVLLVNPVEPDFKGEVDDKYQYSCDNKDINVHGWICTDPPVGFWHITPSAEFRTGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
              KQ+LT H GP  LS+F+S HYSG+D   K   GEAWK VFGPVF+Y NS   G D  +L
Sbjct  245   QKQNLTSHVGPTTLSVFVSAHYSGEDLVPKFNAGEAWKKVFGPVFVYCNSAFDGDDPLSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK QM  ET+ WPYSFP S+D+PK+ QRG VSGRLL+ D         A  A+VGLA
Sbjct  305   WDDAKMQMSVETESWPYSFPASDDFPKSDQRGNVSGRLLVQDEYISDDYISASGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT  D+ G F I+AVRAG+Y+LYAWVPG +GD+++   + I P
Sbjct  365   PPGDAGSWQRECKDYQFWTSADEDGYFSITAVRAGDYNLYAWVPGFIGDYRYDVVVNITP  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G DI +GDLV+ P +NG T+WEIGIPDRSAAEF++P+P P            KFRQYGLW
Sbjct  425   GFDIDMGDLVYEPPRNGPTLWEIGIPDRSAAEFYVPDPNP------------KFRQYGLW  472

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DLVYTVG SD  KDWFF QVTRK    +Y+ + W + F ++ V +   Y 
Sbjct  473   ERYAELYPDGDLVYTVGSSDYTKDWFFVQVTRKKDNNTYQGSTWQIKFELDDVNQSSTYK  532

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + +N DP  ++  F+S L G+DN+IARHGIHGLY   + ++PG+ +
Sbjct  533   LRVAIASANLSELQVRIN-DPSTNRPLFSSGLIGRDNSIARHGIHGLYWLFNVDVPGARL  591

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V G+N ++L Q ++  PF GIMYDYIR E 
Sbjct  592   VSGDNTIFLTQPRSTSPFQGIMYDYIRFEG  621



>ref|XP_002527352.1| lyase, putative [Ricinus communis]
 gb|EEF35024.1| lyase, putative [Ricinus communis]
Length=633

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/628 (50%), Positives = 423/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+M+NGI+++ LS PEG V GI Y G+D NLLE+ N+  +RGYWDL WN P
Sbjct  6     VRLHIQDRHVVMENGIVQITLSKPEGIVTGIRYSGID-NLLEILNRESNRGYWDLFWNPP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T+F+VI+E E Q+E+SF + + S  +   IP+NIDKRF++L GSSGFY
Sbjct  65    GGKGIFDV-ISGTNFRVIVENEEQIEISFTRMWDSSLEGKYIPLNIDKRFILLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H       +L +TR+ FKL +  F ++AV ++ Q  MP   +R  G  + L Y 
Sbjct  124   SYAIYEHLPEWPGFELGETRITFKLRKDKFQYMAVANDRQRPMPLPDDRMPGRCQTLGYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   ++P LKG+VDDKYQY+ ++++  V+GW+   P +GFW IT SNEFR GGPLK
Sbjct  184   EAVLLLNPKDPVLKGEVDDKYQYSCENKDNRVHGWMCFNPPVGFWQITPSNEFRTGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWE  1290
             Q+LT H GP  L+MF S HY+G D   +   GE WK VFGPVFIY+NS   G D + LWE
Sbjct  244   QNLTSHVGPTTLAMFHSSHYAGKDLVPRFNPGEHWKKVFGPVFIYLNSVPPGYDSRFLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP SED+ K+ QRG + GRLL+ D    +    A  A VG+A P
Sbjct  304   DAKTQMMTEVQSWPYSFPASEDFQKSEQRGNICGRLLVKDRYLNEDYIFASGASVGVAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT  D  G F I  VR G+Y+LYAWVPG +GD++ +A ITI  GC
Sbjct  364   GDVGSWQRECKDYQFWTTADGNGYFSIRNVRTGDYNLYAWVPGFIGDYRCQAVITIISGC  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             +I VGDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW R
Sbjct  424   NIDVGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPEPRHVNKLFINHPDRFRQYGLWSR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLR  2004
             Y +L+ + DLVYTVG SD +KDWFFAQV R+   G++  T W + F ++ +  +  Y LR
Sbjct  484   YVDLYPEVDLVYTVGLSDYSKDWFFAQVVRRRDDGTHVGTTWQIKFKLDKIDQRSNYKLR  543

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L + VN D K  +  FT+ L G+DN+IARHGIHGLY   +  +PG+ +V+
Sbjct  544   VALASATLAELQVRVN-DSKAVRPLFTTGLIGRDNSIARHGIHGLYWLYNVNVPGARLVE  602

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++  Q +   PF G+MYDYIRLE 
Sbjct  603   GENTIFFTQPRCTCPFQGLMYDYIRLEG  630



>ref|XP_002306520.2| hypothetical protein POPTR_0005s19450g [Populus trichocarpa]
 gb|EEE93516.2| hypothetical protein POPTR_0005s19450g [Populus trichocarpa]
Length=697

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/631 (51%), Positives = 423/631 (67%), Gaps = 11/631 (2%)
 Frame = +1

Query  397   KPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN  576
             + V+L +    V+MDNGI++V LS P G V GI Y G+D NLLE+ N+  +RGYWDL WN
Sbjct  56    QAVRLYIQDHHVVMDNGIVQVTLSKPAGIVTGIRYDGID-NLLEVLNRETNRGYWDLHWN  114

Query  577   TPKEKASTSFKILA-TDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSS  750
              P    +  F +++ T F+V++E + QVE+SF + + S  +   IP+NIDKRF++L GSS
Sbjct  115   PPG--GNGIFDVISGTSFRVVVENDEQVELSFTRMWDSSLEGKYIPLNIDKRFILLRGSS  172

Query  751   GFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVL  924
             GFY+YAIY+H +     D+ +TR+ FKL +  F ++A+ D  Q  MP   +R  G  + L
Sbjct  173   GFYSYAIYEHLQEWPGFDIGETRITFKLRKDKFQYMAIADNRQRLMPLPDDRLPGRCQAL  232

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
              Y EAV L   + P+L G+VDDKYQY+ ++++  V+GWI  KP +GFW IT S+EFR  G
Sbjct  233   AYPEAVILVNPKLPELTGEVDDKYQYSCENKDNQVHGWICFKPPVGFWQITPSDEFRTAG  292

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKT  1281
             PLKQ+LT H GP  L+MF S HY+G D  + +  GE WK VFGPVFIY+NS   G D   
Sbjct  293   PLKQNLTSHVGPTTLAMFHSSHYAGKDLVLSISPGEPWKKVFGPVFIYLNSASNGEDPLF  352

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK QM+ E + WPYSFP SED+ K+ QRG V GRLL+ D         A  A+VGL
Sbjct  353   LWEDAKMQMMAEVQSWPYSFPASEDFQKSEQRGNVCGRLLVKDRNISDDYILASGAYVGL  412

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ +   YQFWTR D+ G F I  +R G+Y+LYAWVPG LGD++  A + I 
Sbjct  413   APPGDVGSWQTECKDYQFWTRADENGYFSIKNIRTGDYNLYAWVPGFLGDYRWDAIVNII  472

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
              GCD+ +GDLV+ P ++G T+WEIGIPDRSAAEF+IP P P   N L ++  ++FRQYGL
Sbjct  473   SGCDMDMGDLVYEPPRDGPTLWEIGIPDRSAAEFYIPGPDPKFMNNLYANHPDRFRQYGL  532

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W RY++L+  TDLVYTVG SD  KDWFFAQV R+    +   T W + F ++ V +   Y
Sbjct  533   WGRYADLYPDTDLVYTVGLSDYRKDWFFAQVVRRKDDDTQVGTTWQIKFKLDKVDRNSSY  592

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+T A L + VN D K  +  FTS L G+DNAIARHGIHGLY   +  IPG+ 
Sbjct  593   KLRVAIASATLAELQVRVN-DAKAQRPLFTSGLIGRDNAIARHGIHGLYRLYNVNIPGAR  651

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+GEN ++L Q +   PF G+MYDYIRLE 
Sbjct  652   LVEGENTIFLTQPRCTSPFQGLMYDYIRLEG  682



>ref|XP_010458304.1| PREDICTED: probable rhamnogalacturonate lyase B [Camelina sativa]
Length=633

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/622 (52%), Positives = 424/622 (68%), Gaps = 14/622 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W       +  F 
Sbjct  15    VVMDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEEVNRGYWDLVWG--GSGTAGGFD  71

Query  610   IL-ATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
             ++  T+F+VIM+ E Q+E+SF + + +  +   +P+NIDKRFVML GSSGFYTYAIY+H 
Sbjct  72    VIKGTNFEVIMKNEEQIEISFTRKWDASLEGKAVPLNIDKRFVMLSGSSGFYTYAIYEHL  131

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKT  957
             K      L +TR+ FKL +  F ++AVTD+ Q  MP   +R  + G+ L Y EA+ L   
Sbjct  132   KEWPAFSLAETRIAFKLRKEKFHYMAVTDDRQRFMPLPDDRLPDRGQALAYPEAILLVNP  191

Query  958   ENPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
               P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H 
Sbjct  192   VEPQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHV  251

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQM  1308
             GP AL++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM
Sbjct  252   GPTALAVFMSAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAKSQM  311

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               ET+ WPYSFP S+DY KA QRG V GRLL+ D    K    A   +VGLA PG  GSW
Sbjct  312   NVETESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDKDFIAANRGYVGLAVPGAAGSW  371

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +   YQFWTRTD+ G F IS +R G+Y+LYAWVPG +GD+K+   ITI  GC I V D
Sbjct  372   QRECKDYQFWTRTDEEGFFYISGIRPGQYNLYAWVPGFIGDYKYDDIITITQGCYIYVED  431

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-  1845
             LV+ P +NG T+WEIG PDRSAAEF++P+P P   N L  +  ++FRQYG+W+RY+EL+ 
Sbjct  432   LVYQPPRNGETLWEIGFPDRSAAEFYVPDPNPKYINKLYQNHPDRFRQYGIWERYAELYP  491

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASS  2022
               DLVY VG SD  KDWF+AQVTRK    +Y+ T W + F ++ + +   YTLR+A+AS+
Sbjct  492   DKDLVYVVGSSDYRKDWFYAQVTRKKDNKTYQGTTWQIKFELKNIDQSHSYTLRVAIASA  551

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLY  2202
             T + L I VN         FTS L G+DN+IARHGIHGLY   + E+ GS +V+GEN L+
Sbjct  552   TFSELQIRVND--ATASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLF  609

Query  2203  LRQSKAGYPFYGIMYDYIRLEA  2268
             L Q ++  PF GIMYDYIR EA
Sbjct  610   LTQPRSTSPFQGIMYDYIRFEA  631



>gb|EYU30909.1| hypothetical protein MIMGU_mgv1a002454mg [Erythranthe guttata]
Length=672

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/634 (50%), Positives = 419/634 (66%), Gaps = 12/634 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H GA   V L      V + NGI+ V L+ P+G+V  + Y+G  DNLLE  NK  DRGYW
Sbjct  44    HAGAG--VHLLQQNHTVSLTNGIVNVLLTIPDGNVISVTYKG-GDNLLETQNKENDRGYW  100

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLP  741
             DL WN P    S   K+  T +K+I++   Q E+SF +T+  G    +P+NIDKRFVML 
Sbjct  101   DLIWNKPGAPTSMD-KLEGTSYKIIVQNNDQTEISFTRTWAVG-SARMPLNIDKRFVMLK  158

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
              S GFYTY + +  KG    D+ + R +FKL  + F ++A++D+ Q  MP   +R    G
Sbjct  159   DSPGFYTYTVLERLKGWPAFDIQEGRFLFKLQENKFHYMAMSDDRQRVMPMPVDRIPGHG  218

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFR  1095
             + L+Y EAV LT   NP+LKG+VDDKY Y+ D+++  V+GW+S    +GFW+IT SNEFR
Sbjct  219   QPLDYPEAVLLTNPTNPQLKGEVDDKYLYSCDNKDNKVHGWVSSDQGVGFWMITPSNEFR  278

Query  1096  LGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG--T  1269
              GGPLKQDLT H GP  LSMF+S HY+G+D  +K + G+ WK V GPVF+Y+NSD    T
Sbjct  279   TGGPLKQDLTSHVGPTLLSMFISTHYAGEDLALKFQTGDYWKKVLGPVFVYLNSDPSAKT  338

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             +   LW  AK++M +E   WPY+FP S D+ K+ QRGAV G+LL+HD    K   P   A
Sbjct  339   NPSVLWNDAKQRMQKEVSSWPYNFPLSVDFLKSNQRGAVKGQLLVHDWYKNKMAEPGASA  398

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA  G PGSWQ ++  YQFWT+ D  G F I+ V  G YSL+AWVPG +GD+KH +D
Sbjct  399   YVGLAPQGGPGSWQFENKGYQFWTQADQHGNFAITNVVPGTYSLFAWVPGFVGDYKHASD  458

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             ITI PG +I+  ++VF P + G T+WEIG+PDR+AAEFFIP+P P  K Y      EKFR
Sbjct  459   ITITPGSNIQATNVVFVPPRKGATLWEIGVPDRTAAEFFIPDPNPSFKTYPYRAPVEKFR  518

Query  1810  QYGLWDRYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK  1986
             QYGLW RY ++H  TD VYTVG SD  KDWFFA V +      + AT W ++F ++++AK
Sbjct  519   QYGLWARYKDIHPVTDQVYTVGLSDYKKDWFFAHVPKNVGPRQFAATTWQIIFDLKSIAK  578

Query  1987  GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
             G YTL++A+AS+  A + + VN       A FT++L GKDNAIARHGIHGLY   S +IP
Sbjct  579   GSYTLQLALASANAAEVQVRVNN--PNSAALFTTRLIGKDNAIARHGIHGLYHLFSIDIP  636

Query  2167  GSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G+ +V G+N ++L Q+++  PF  +MYDYIRLE 
Sbjct  637   GTQLVVGKNTIFLTQARSISPFCEVMYDYIRLEG  670



>ref|XP_011011722.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Populus 
euphratica]
Length=675

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/633 (50%), Positives = 423/633 (67%), Gaps = 9/633 (1%)
 Frame = +1

Query  388   GACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             G    V+L      ++MDNG+++V LS+P G + GI Y G+  N+LE  N+  +RGYWD+
Sbjct  37    GKSLGVRLHKHHHRMVMDNGLVQVTLSSPGGDITGIQYNGIH-NVLETRNREGNRGYWDV  95

Query  568   DWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPG  744
              WN+P    +   ++  TDF VIME E QVE+SFKK++  +   +  P+N+DKR++M  G
Sbjct  96    VWNSPGNHIAYD-RLKGTDFNVIMEDEDQVELSFKKSWNFTNGNSSAPLNVDKRYIMRRG  154

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVL  924
             SSG Y YAI++  +G  D+D+DQ R+V KL    F  +A++D+ Q  MP  ++R  GE L
Sbjct  155   SSGVYLYAIFERLEGWPDMDMDQIRIVLKLQNDKFHFMAISDDRQRIMPMPRDRISGEPL  214

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
              Y EAV LT     +L G+VDDKYQY+ ++++  V+GWIS  P +GFW+IT S+EFR GG
Sbjct  215   AYPEAVLLTNPTTRQLGGEVDDKYQYSCENKDNRVHGWISENPQVGFWMITPSDEFRAGG  274

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-TDHKT  1281
             PLKQDLT H GP  L MF S HYSG D   K R G  WK V GPVF+Y+NS     D KT
Sbjct  275   PLKQDLTSHVGPTVLCMFTSTHYSGKDLNTKYRNGRPWKKVLGPVFVYLNSISSLEDPKT  334

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK QM  E   WPY+FP+SED+P + +RG VSG+LL+ D         A  A+VGL
Sbjct  335   LWEDAKDQMSIEVNSWPYNFPQSEDFPSSDRRGTVSGQLLVGDRYISDKPMWASYAYVGL  394

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG  GSWQ D+M YQFW + ++ G F I  +RAG Y+LYAWVPG +GD ++   I I+
Sbjct  395   AAPGGVGSWQRDAMGYQFWVQANEEGHFLIENIRAGHYNLYAWVPGIVGDCRYDVIIHIQ  454

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYG  1818
             PGCD+++G LV+ P +NG T+W+IGIPDR+AAEFF+P+  P L N L ++  T KFRQYG
Sbjct  455   PGCDVQLGVLVYEPPRNGPTLWQIGIPDRTAAEFFVPDTYPTLMNKLFINQSTHKFRQYG  514

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIE--TVAKG  1989
             LW+RYS+L+ K DL+YT G S+  +DWFFAQV R     +Y+AT W + F IE  T   G
Sbjct  515   LWERYSDLYPKHDLIYTTGISNYHQDWFFAQVPRNMGNHTYQATTWQIKFEIENATPRTG  574

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTL++A+AS++ + L + +N D +  +  F ++L G+DNAIARHGIHGLY   S  +P 
Sbjct  575   NYTLQVALASASASELQVRLN-DRRAKRPHFRTRLIGRDNAIARHGIHGLYWFYSINVPS  633

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              L+ +G N +YL QS++  P  GIMYDYIRLE 
Sbjct  634   RLLRQGNNTVYLTQSRSKSPVGGIMYDYIRLEG  666



>ref|XP_006364644.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=680

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/636 (50%), Positives = 426/636 (67%), Gaps = 13/636 (2%)
 Frame = +1

Query  391   ACKPVK-LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             A  PV+ L +  + V++DNGI  +  S P G V GI Y G+D NLLE  NK  +RGYWD+
Sbjct  42    AFPPVQILRLDDDYVVVDNGIFNITFSVPGGMVTGIQYNGID-NLLENGNKDDNRGYWDI  100

Query  568   DWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGS  747
              WN P EK     K+ ATDFKVIME E+QVE+SF +T+ S +   + +NIDKRF++L G 
Sbjct  101   VWNKPDEKGIFD-KLHATDFKVIMEDENQVELSFTRTWDSLNSKQLSMNIDKRFIILRGI  159

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLN  927
             SGFY Y I +  +G  D+D+ Q R+VFKL   LF ++A++DE Q  MP+  +RE G+ L+
Sbjct  160   SGFYCYGILERLEGWPDIDVYQGRIVFKLKEKLFQYMAISDERQRIMPTAHDREVGQKLD  219

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV LT   N  +KG+VDDKYQY+ ++++  V+GWISP P  GFW+IT ++EFR GGP
Sbjct  220   YSEAVLLTNPNNSFIKGEVDDKYQYSCENKDNRVHGWISPTPRTGFWMITPTDEFRTGGP  279

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK--T  1281
             +KQDLT H GP  L+MF S HY+G+  G+K R GE W+ VFGPVF+Y+NS    +    T
Sbjct  280   VKQDLTSHTGPVNLNMFFSTHYAGEVLGLKFRNGEPWRKVFGPVFVYMNSLSPNEPNTLT  339

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LW  AK+QM  ET+ WPY+FP SEDY +A QRG VSGRLL+ D    ++   A  A +GL
Sbjct  340   LWTDAKEQMFVETENWPYNFPLSEDYARADQRGIVSGRLLVRDRYVSQSLMIANSAFIGL  399

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG  GSWQ ++ +YQFWT+TD  G F I  V  G YSLYAWVPG +GD+ +   I + 
Sbjct  400   AAPGNVGSWQLENKAYQFWTQTDSEGYFLIKNVIPGNYSLYAWVPGFVGDYMYDPYIIVT  459

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYG  1818
             PG   +V  L++   +NG T+WEIGIPDR+AAEFFIP+  P L N L +    E++RQYG
Sbjct  460   PGSRKRVETLIYDAPRNGPTLWEIGIPDRTAAEFFIPDAQPKLLNQLYVVHNQERYRQYG  519

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTR----KNAKGSYEATIWTVVFPIETVA  1983
             LWDRY+E++   DLV+++G S+   DWFFA + R     +   +Y  T W V+F +E V 
Sbjct  520   LWDRYTEIYPDDDLVFSIGLSNYQTDWFFAHLNRYLYNDDGNKTYAPTTWQVLFDLEDVD  579

Query  1984  KGC-YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
             +   YTL++A+AS+  A L +  N DP+ D   +++ L GKDNAIARHGIHG+Y   +  
Sbjct  580   QSSNYTLQLALASAHEAELQVRFN-DPEIDAPHYSTGLIGKDNAIARHGIHGIYRLYTIN  638

Query  2161  IPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +PGSL+  G N +YL+QS+   PF G+MYDYIRLE 
Sbjct  639   VPGSLLGFGTNIMYLKQSRGDRPFRGLMYDYIRLEG  674



>ref|XP_009771422.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
sylvestris]
Length=682

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/632 (50%), Positives = 428/632 (68%), Gaps = 12/632 (2%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV+L    + V+++NGI  +  S P G V GI Y G++ NLLE  N+  +RGYWD+ WN 
Sbjct  49    PVQLLRLDDYVVVNNGIFNITFSIPGGMVTGIQYNGIE-NLLEDENEDDNRGYWDIVWNK  107

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             P +K     K+ ATDF VIM  E+QVE+SFK+T+ S + + + +NIDKRF+++ GSSGFY
Sbjct  108   P-DKPGIFDKLHATDFNVIMADENQVELSFKRTWDSLNNSHLSMNIDKRFIIIRGSSGFY  166

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y I +  +G  ++D+ Q R+VFKL   LF ++A++DE Q  MP+ ++RE G+ L+Y EA
Sbjct  167   SYGILERLEGWPNIDVYQGRIVFKLKEELFQYMAISDERQRIMPTAQDREMGQKLDYPEA  226

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT   N  +KG+VDDKYQY+ ++++  V+GWISP P  GFW+IT ++EFR GGPLKQD
Sbjct  227   VLLTNPTNSFIKGEVDDKYQYSCENKDNRVHGWISPNPRTGFWMITPTDEFRTGGPLKQD  286

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYIN--SDKGTDHKTLWEG  1293
             LT H GP  L+MF S HY+G+  G+K R GE WK VFGPVF Y+N  S    D  TLW  
Sbjct  287   LTSHTGPVNLNMFFSTHYAGESLGLKFRDGEPWKKVFGPVFTYLNSLSPDELDTLTLWTD  346

Query  1294  AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPG  1473
             AK+QM  ET+ WPY+FP SED+ ++ QRG V+GRLL+ D         A  A +GLA PG
Sbjct  347   AKEQMFIETENWPYNFPLSEDFVRSDQRGIVTGRLLVRDSYESDKLITANSAFIGLAAPG  406

Query  1474  EPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCD  1653
             + GSWQ ++  YQFWT+TD  G F I+ V  G YSLYAW+PG +GD+ H A I + PG  
Sbjct  407   DVGSWQMENKGYQFWTQTDTEGYFLINNVITGNYSLYAWIPGFIGDYMHDAYINVNPGSR  466

Query  1654  IKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDR  1830
              +V  LV+   +NG T+WEIGIP+R+A+EFFIP+  P L N L + +  E+FRQYGLWDR
Sbjct  467   TRVETLVYDAPRNGPTLWEIGIPERTASEFFIPDAQPRLLNQLYVVNNAERFRQYGLWDR  526

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTR----KNAKGSYEATIWTVVFPIETVAKGC-  1992
             Y+E++   DLV+TVG S+   DWFFA V R     +   +Y  T W V+F ++ + +   
Sbjct  527   YTEIYPDDDLVFTVGLSNYQTDWFFAHVNRYIYNDDGNKTYVPTTWQVLFDLDDIDQSAN  586

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTL++A+AS+  A L +  N D + D   +T+ L GKDNAIARHGIHGLY   +  +PGS
Sbjct  587   YTLQLALASANDAELQVQFN-DAEPDAPHYTTGLIGKDNAIARHGIHGLYRLYTINVPGS  645

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V G N +YL+Q+++  P+ GIMYDYIRLE 
Sbjct  646   LLVFGTNVMYLKQTRSERPWRGIMYDYIRLEG  677



>ref|XP_011003640.1| PREDICTED: rhamnogalacturonate lyase B-like [Populus euphratica]
Length=697

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/630 (50%), Positives = 419/630 (67%), Gaps = 9/630 (1%)
 Frame = +1

Query  397   KPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN  576
             + V+L +    V+MDNGI++V LS P G V GI Y G+D NLLE+ N+  +RGYWDL WN
Sbjct  56    QAVRLYIQDHHVVMDNGIVQVTLSKPAGIVTGIRYDGID-NLLEVLNRETNRGYWDLHWN  114

Query  577   TPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
              P  K      I  T F+V++E + QVE+SF + + S  +   IP+NIDKRF++L GSSG
Sbjct  115   PPGGKGIFDV-ISGTRFRVVVENDDQVELSFTRMWDSSLEGKYIPLNIDKRFILLRGSSG  173

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H +     D+ +TR+ FKL +  F ++A+ D  Q  MP   +R     + L 
Sbjct  174   FYSYAIYEHLQEWPGFDIGETRITFKLRKDKFQYMAIADNRQRLMPLPDDRLPRRCQALA  233

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L   + P+L G+VDDKYQY+ ++++  V+GWI  KP +GFW IT S+EFR  GP
Sbjct  234   YPEAVMLVNPKLPELAGEVDDKYQYSCENKDNQVHGWICFKPPVGFWQITPSDEFRTAGP  293

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTL  1284
             LKQ+LT H GP  L+MF S HY+G +  + +  GE WK VFGPVFIY+NS   G D   L
Sbjct  294   LKQNLTSHVGPTTLAMFHSSHYAGKELVLSISPGEPWKKVFGPVFIYLNSASNGEDPLFL  353

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK QM+ E + WPYSFP SED+ K+ QRG V GRLL+ D         A  A+VGLA
Sbjct  354   WEDAKVQMMAEVQSWPYSFPASEDFQKSEQRGNVCGRLLVKDRNTSDDYILANGAYVGLA  413

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWTR D+ G F I  +R G+Y+LYAWVPG LGD++  A + I  
Sbjct  414   PPGDVGSWQTECKDYQFWTRADENGYFSIKNIRTGDYNLYAWVPGFLGDYRWDAIVNIIS  473

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCD+ +GDLV+ P ++G T+WEIGIPDRSAAEF+IP P P   N L ++  ++FRQYGLW
Sbjct  474   GCDMDMGDLVYEPPRDGPTLWEIGIPDRSAAEFYIPGPDPKFMNNLYANHPDRFRQYGLW  533

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYT  1998
              RY++L+  TDLVYTVG SD  KDWFFAQV R+    ++  T W + F ++ V +   Y 
Sbjct  534   GRYTDLYPDTDLVYTVGLSDYRKDWFFAQVVRRKDNDTHVGTTWQIKFELDKVDRNSSYK  593

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T A L + VN D    +  FTS L G+DNAIARHGIHGLY   +  IPG+ +
Sbjct  594   LRVAIASATLAELQVRVN-DANAQRPLFTSGLIGRDNAIARHGIHGLYRLYNVNIPGARL  652

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+GEN ++L Q +   PF G+MYDYIRLE 
Sbjct  653   VEGENTIFLTQPRCTSPFQGLMYDYIRLEG  682



>ref|XP_008219198.1| PREDICTED: rhamnogalacturonate lyase B-like [Prunus mume]
Length=638

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/630 (52%), Positives = 422/630 (67%), Gaps = 16/630 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V GI Y G+D N+LE  NK  +RGYWDL W+ P
Sbjct  6     VRLHIQGGHVVMDNGILQVTLSNPDGIVTGIRYNGID-NVLEPLNKETNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F+VI++ E QVEVSF + +  S +   +P+NIDKRFVML  SSGFY
Sbjct  65    GSKGIFDV-IKGTSFRVIVDNEEQVEVSFTRVWDPSLEGKYVPLNIDKRFVMLRASSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H K   D ++ +TR+ FKL +  F ++AV+D  Q  MP   +R  G  + L Y 
Sbjct  124   SYAIYEHLKDWPDFEIGETRITFKLRKDKFQYMAVSDNRQRYMPLPDDRLPGRCQTLAYP  183

Query  934   EAVKLTKTENPKLK---GKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
             EAV L   ENPK+K   G+VDDKYQY+ ++++  V+GWI   P +GFW IT S+EFR GG
Sbjct  184   EAVLL---ENPKMKELAGEVDDKYQYSCENKDNKVHGWICTNPPVGFWQITPSDEFRSGG  240

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-  1281
             P KQ+LT H GP  L+MFLS HY+G D   K RGGE WK VFGPVFIY+NS    D    
Sbjct  241   PHKQNLTSHVGPTTLAMFLSGHYAGQDLVPKFRGGEPWKKVFGPVFIYLNSSAIKDDPFW  300

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D    +   PA  A+VGL
Sbjct  301   LWEDAKIQMMTEVQSWPYSFPASEDFQKSDQRGNVSGRLLVLDRYICEELIPANGAYVGL  360

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ +   YQFWTR DD G F IS +R G Y+LYAWVPG +GD+++ A I I 
Sbjct  361   APPGDVGSWQRECKDYQFWTRADDRGYFSISNIRTGTYNLYAWVPGFIGDYRYDAVINIT  420

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
              G  I+ GDLVF P ++G T+WEIGIPDRSAAEF++P+P  +  N L  +  ++FRQYGL
Sbjct  421   SGSFIESGDLVFEPPRDGPTLWEIGIPDRSAAEFYVPDPDANHINKLFVNHPDRFRQYGL  480

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W+RY+EL+   DLVY VG SD AKDWFFAQV R+   G +E T W + F +  V +   Y
Sbjct  481   WNRYAELYPHEDLVYIVGVSDYAKDWFFAQVPRQKENG-HEGTTWQIRFELRNVDRNSTY  539

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+T A L + +N DP   +  FTS L G+DN++ARHGIHG+Y   +  +PG+ 
Sbjct  540   KLRVAIASATLAELQVRIN-DPNSRRPLFTSGLIGRDNSVARHGIHGIYWLYNVNVPGAQ  598

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             +V G N  + +Q +   PF G+MYDYIR E
Sbjct  599   LVDGTNTFFFKQPRCTSPFQGLMYDYIRFE  628



>ref|XP_006346801.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Solanum 
tuberosum]
Length=656

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/637 (49%), Positives = 428/637 (67%), Gaps = 10/637 (2%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             L    PV+L    + VL+DNG+  +  S P+G V  I Y G+D NLLE  NK  +RGYWD
Sbjct  16    LQTYPPVQLLRLNKHVLVDNGVFNITFSVPDGMVINIQYNGID-NLLENKNKENNRGYWD  74

Query  565   LDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPG  744
             + WN  +++     K+  T F+VI++ E+QVE+SF + +K+ + + + +NIDKRF++  G
Sbjct  75    IVWNKAEKQGDIFDKLEGTKFEVILQDENQVELSFTRIWKTLNSSSLSMNIDKRFIIHRG  134

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVL  924
             SSGFY+YAI++  +G  D+D+ Q R+VFKL+  LF+++A++DE Q  MP+ ++RE G  L
Sbjct  135   SSGFYSYAIFERLEGWPDIDVYQGRMVFKLNEKLFSYMAISDERQRIMPTAQDREMGRQL  194

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
             +YKEAV LT      LKG+VDDKYQY++++++  V+GWISP    GFW+IT S+EF+ GG
Sbjct  195   DYKEAVLLTGPSTSFLKGEVDDKYQYSVENKDNRVHGWISPTLKTGFWMITPSSEFQTGG  254

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK--  1278
             P+KQDLT H GP  LSMF S HY+G+  G++ R GE WK VFGPVFIY+NS    D    
Sbjct  255   PVKQDLTSHTGPITLSMFFSTHYAGEIIGLRFRNGEPWKKVFGPVFIYLNSVSSDDEGIL  314

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             TLW  AK+QML ET+ WPY FP S+D+  A QRG VSGRLL++D    KT        +G
Sbjct  315   TLWTDAKEQMLIETENWPYEFPLSQDFVGADQRGIVSGRLLVNDSYMSKTLITPNSTFIG  374

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG+ GSWQ ++  YQFWT+TD+ G F I+ +  G YSLYAWVPG +GD+K+ A I I
Sbjct  375   LAAPGDVGSWQIENKGYQFWTQTDNEGYFLINNIIPGNYSLYAWVPGFIGDYKYMAYINI  434

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQY  1815
              PG   ++  LV+ P +NG T+WEIGIPDR+AAEFFIP P P L++ L ++   EKFRQY
Sbjct  435   TPGSRTRLQTLVYYPPRNGPTLWEIGIPDRTAAEFFIPNPQPKLQDQLYIAHYEEKFRQY  494

Query  1816  GLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTR----KNAKGSYEATIWTVVFPIETV  1980
             GLWDRY+E++   DLVYT+G S+   DW+FA V R     +   +Y  T W +VF ++ V
Sbjct  495   GLWDRYTEIYPNDDLVYTIGSSNYQTDWYFAHVNRYIYKDDGDKTYIPTTWQIVFDLQEV  554

Query  1981  AK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSF  2157
                  +TL++A+AS+  A L I +N    +    FT+   GKDNAIARHGIHGLY   S 
Sbjct  555   KDFSNFTLQLALASTNEAELQIRINDQNPEHAPHFTTGSIGKDNAIARHGIHGLYRMYSI  614

Query  2158  EIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             ++P  L+  G N ++L+Q++    + G+MYDYIRLE 
Sbjct  615   DVPSDLLAIGSNTMFLKQNRGSSSWSGLMYDYIRLEG  651



>ref|XP_009366368.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Pyrus 
x bretschneideri]
Length=1179

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/626 (52%), Positives = 427/626 (68%), Gaps = 9/626 (1%)
 Frame = +1

Query  412   TVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEK  591
             T+ +  V+MDNGI++V LS PEG V GI Y G+D NLLE+ N+  +RGYWDL WN+    
Sbjct  549   TLAELQVMMDNGILQVTLSKPEGIVTGIQYNGID-NLLEIRNEESNRGYWDLVWNSAATG  607

Query  592   ASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTY  765
              +  F ++  T F +IME E QVE+SF +T+  S +   +P+NIDKRF+ML GSSGFY+Y
Sbjct  608   TTGIFDVIKGTSFTIIMETEEQVELSFTRTWDPSQEGKLVPLNIDKRFIMLRGSSGFYSY  667

Query  766   AIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYKEA  939
             AIY+H K     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y EA
Sbjct  668   AIYEHLKDWPAFELGETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGQALAYAEA  727

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V L     P+LKG+VDDKYQY+ D+++  V+GWI  +P +GFW IT S EFR GGP KQ+
Sbjct  728   VLLVNPVEPELKGEVDDKYQYSCDNKDNKVHGWICTEPPVGFWQITPSTEFRSGGPFKQN  787

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGA  1296
             LT H GP  L+MFLS HY+G+D   K   GE WK VFGPVF+Y+NS   G D  +LWE A
Sbjct  788   LTSHVGPTTLAMFLSAHYAGEDLVPKFAAGEEWKKVFGPVFMYVNSSYDGNDPLSLWEDA  847

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             K QM+ E + WPYSFP SE++PK+ +RG V GRLLI D            A+VGLA PG+
Sbjct  848   KSQMMMEVQCWPYSFPASEEFPKSHERGNVRGRLLIQDRYVSNDYISVNGAYVGLAPPGD  907

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +   YQFWT TD+ G F I+ +R G+Y+L A VPG +GD+ +   +TI  GCDI
Sbjct  908   IGSWQRECKDYQFWTTTDEDGYFCINGIRTGDYNLNASVPGFIGDYHYDVVMTITSGCDI  967

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
              +GDLV+ P ++G T+WEIGIPDRSAAEF++PEP P   N L  +  ++FRQYGLW+RYS
Sbjct  968   DMGDLVYEPPRDGHTLWEIGIPDRSAAEFYVPEPNPKYINKLFVNHPDRFRQYGLWERYS  1027

Query  1837  ELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIA  2010
             EL+   DLVYTVG SD +KDWFFAQVTRK     Y+ T W + F ++ V + G Y LR+A
Sbjct  1028  ELYSDQDLVYTVGVSDYSKDWFFAQVTRKKDDNKYQGTTWQIKFNLDNVDQTGSYKLRVA  1087

Query  2011  VASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGE  2190
             +AS+T + L + VN DPK ++  FTS + G+DN+IARHGIHGLY   + ++P S +V+G+
Sbjct  1088  LASATFSELQVRVN-DPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGD  1146

Query  2191  NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             N +YL Q ++  PF GIMYDY+R E 
Sbjct  1147  NIIYLTQPRSTGPFQGIMYDYLRFEG  1172


 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/556 (53%), Positives = 380/556 (68%), Gaps = 9/556 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V GI Y G+D NLLE  NK  +RGYWDL W+ P
Sbjct  6     VQLHIQGPHVMMDNGILQVTLSNPDGIVTGIRYNGID-NLLEPLNKETNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F+VI+E E QVE+SF KT+ +S +   +P+NIDKRFVML GSSGFY
Sbjct  65    GSKGIFDV-IKGTTFEVIVENEEQVELSFSKTWDRSLEGKYVPLNIDKRFVMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H K   D D+ +TR+ FKL +  F ++ V+D  Q  MP   +R  G  + L Y 
Sbjct  124   SYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMTVSDNRQRYMPLPDDRSSGRCQALAYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   +  +L G+VDDKYQY+ D+++  V+GWI   P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLVDPKMKELAGEVDDKYQYSCDNKDNKVHGWICTNPPVGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q+LT H GP  L+MFLS HY+G D   K RGG+ WK VFGPVFIY+NS    D    LWE
Sbjct  244   QNLTSHVGPTTLAMFLSSHYAGQDLVPKFRGGKPWKKVFGPVFIYLNSSTIKDDPFWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D    +  TPA  A+VGLA P
Sbjct  304   DAKIQMMTEVQSWPYSFPASEDFQKSGQRGNVSGRLLVLDRYISEEYTPANGAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR DD G F I+ VR G Y+LYAWVPG +GD+++ A I I  G 
Sbjct  364   GDAGSWQRECKDYQFWTRADDRGYFSINNVRTGTYNLYAWVPGFIGDYRYDAVINITSGS  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I++GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  D  ++FRQYGLW+R
Sbjct  424   FIEMGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPDPKYINRLFIDHPDRFRQYGLWNR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+   DLVY VG SD AKDWFFAQV RK   G +E T W + F ++ V + G Y LR
Sbjct  484   YAELYPDEDLVYIVGVSDYAKDWFFAQVPRKTDNG-HEGTTWQIKFELKNVDRNGSYKLR  542

Query  2005  IAVASSTRATLLIWVN  2052
             +A+AS+T A L + ++
Sbjct  543   VAIASATLAELQVMMD  558



>ref|XP_009591965.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=679

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/632 (50%), Positives = 427/632 (68%), Gaps = 12/632 (2%)
 Frame = +1

Query  400   PVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNT  579
             PV+L    + V+++NG+  +  S P G V GI Y G+D NLLE  N+  +RGYWD+ WN 
Sbjct  46    PVQLLRLDDYVVVNNGLFNITFSVPGGMVTGIQYNGID-NLLEDENEDDNRGYWDIVWNK  104

Query  580   PKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFY  759
             P +K     K+ AT+F VIME E+QVE+SF +T+ S + + + +NIDKRF++L GS GFY
Sbjct  105   P-DKPGIFDKLHATEFNVIMEDENQVELSFTRTWDSLNSSHLSMNIDKRFIILRGSFGFY  163

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
             +Y I +  +G  ++D+ Q R+VFKL   LF ++A++DE Q  MP+ ++RE G++L+Y EA
Sbjct  164   SYGILERLEGWPNIDVYQGRIVFKLKEELFQYMAISDERQRIMPTAQDREMGQILDYPEA  223

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT   N  +KG+VDDKYQY+ ++++  V+GWISP P  GFW+IT ++EFR GGPLKQD
Sbjct  224   VLLTNPTNSFIKGEVDDKYQYSCENKDNRVHGWISPNPRTGFWMITPTDEFRTGGPLKQD  283

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYIN--SDKGTDHKTLWEG  1293
             LT H GP  L+MF S HY+G+  G+K R GE WK VFGPVF Y+N  S    D  TLW  
Sbjct  284   LTSHTGPVNLNMFFSTHYAGESLGLKFREGEPWKKVFGPVFTYLNSLSPDELDTLTLWTD  343

Query  1294  AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPG  1473
             AK+QM  ET+ WPY+FP SED+ +  QRG V+GRLL+ D    +    A  A +GLA PG
Sbjct  344   AKEQMFIETENWPYNFPLSEDFVRFDQRGIVTGRLLVRDSYVSEKLITANSAFIGLAAPG  403

Query  1474  EPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCD  1653
             + GSWQ ++ +YQFWT+TD  G F I  V  G YSLYAW+PG +GD+ + A I + PG  
Sbjct  404   DIGSWQMENKAYQFWTQTDTEGYFLIKNVIPGNYSLYAWIPGFIGDYMYDAYINVTPGSR  463

Query  1654  IKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDR  1830
              +V  LV+   +NG T+WEIGIP+R+A+EFFIP+  P L N L + +  E+FRQYGLWDR
Sbjct  464   TRVETLVYNAPRNGPTLWEIGIPERTASEFFIPDAQPRLLNQLYVVNNAERFRQYGLWDR  523

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTR----KNAKGSYEATIWTVVFPIETVAKGC-  1992
             Y+E++   DLV+TVG S    DWFFA V R     +   +Y  T W V+F ++ + +   
Sbjct  524   YTEIYPDDDLVFTVGLSSYQTDWFFAHVNRYIYNDDGNKTYVPTTWQVLFDLDDIDQSAN  583

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTL++A+AS+  A L +  N DP  D   +T+ L GKDNAIARHGIHGLY   +  +PGS
Sbjct  584   YTLQLALASANDAELQVQFN-DPDTDAPHYTTGLIGKDNAIARHGIHGLYRLYTINVPGS  642

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+V G N +YL+Q+++  P+ GIMYDYIRLE 
Sbjct  643   LLVFGTNVMYLKQTRSERPWRGIMYDYIRLEG  674



>ref|XP_010312681.1| PREDICTED: probable rhamnogalacturonate lyase B [Solanum lycopersicum]
Length=680

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/633 (51%), Positives = 425/633 (67%), Gaps = 13/633 (2%)
 Frame = +1

Query  400   PVK-LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN  576
             PV+ L +  + V +DNGI  +  S P G V GI Y  +D NLLE  NK  +RGYWDL WN
Sbjct  45    PVQILRLDDDYVAVDNGIFNITFSIPGGMVTGIQYNEID-NLLENGNKDDNRGYWDLVWN  103

Query  577   TPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGF  756
              P+EK     K+ AT+FKVIME E+QVE+SF +T+ S D   + +NIDKRF++L G SGF
Sbjct  104   KPEEKGIFD-KLHATNFKVIMEDENQVELSFTRTWDSLDSKQLSMNIDKRFIILRGISGF  162

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKE  936
             Y Y I +  +G  D+D+ Q R+VFKL  +LF ++A++DE Q  MP+  +RE G+ L+YKE
Sbjct  163   YCYGILERLEGWPDIDVYQGRIVFKLKETLFQYMAISDERQRIMPTAHDREVGQKLDYKE  222

Query  937   AVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQ  1116
             AV LT   N  +KG+VDDKYQY+ ++++  V+GWIS  P +GFW+IT S+EFR GGP+KQ
Sbjct  223   AVLLTNPNNSFIKGEVDDKYQYSCENKDNRVHGWISQTPRIGFWMITPSDEFRTGGPVKQ  282

Query  1117  DLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYIN--SDKGTDHKTLWE  1290
             DLT H GP  L+MF S HY+G+  G+K   GE WK VFGPVF+Y+N  S    D  TLW 
Sbjct  283   DLTSHTGPVNLNMFFSTHYAGEVLGLKFTTGEPWKKVFGPVFVYMNSLSPDEPDPLTLWT  342

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QML ET+ WPY+FP SEDY +A QRG VSGRLL+ D    ++   A  A VGLA P
Sbjct  343   DAKEQMLVETENWPYNFPLSEDYARADQRGIVSGRLLVRDRYVNESPMIANSAFVGLAAP  402

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G  GSWQ ++ +YQFWT+TD  G F I  +  G YSLYAWVPG +GD+ +   I + PG 
Sbjct  403   GNVGSWQLENKAYQFWTQTDSEGYFLIKNIIPGNYSLYAWVPGFVGDYMYDPYIIVTPGS  462

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWD  1827
               K+  L++   +NG T+WEIGIPDR+AAEFFIP+  P L N L +    E++RQYGLWD
Sbjct  463   RKKLDTLIYDAPRNGPTLWEIGIPDRTAAEFFIPDAQPKLLNQLYVVHNQERYRQYGLWD  522

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTR----KNAKGSYEATIWTVVFPIETVAKGC  1992
             RY+E++   DLV+TVG S+   DWFFA + R     +   +Y  T W V+F +E V +  
Sbjct  523   RYTEIYPDDDLVFTVGFSNYQTDWFFAHLNRYFYNDDGNKTYAPTTWQVLFDLEDVDQSS  582

Query  1993  -YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTL++A+AS+  A L +  N DP+ D   +++ L GKDNAIARHGIHG+Y   +  +PG
Sbjct  583   NYTLQLALASAHEAELQVRFN-DPEIDAPHYSTGLIGKDNAIARHGIHGIYRLYTINVPG  641

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             SL+  G N LYL QS+   PF G+MYDYIRLE 
Sbjct  642   SLLSFGTNILYLTQSRGDRPFRGLMYDYIRLEG  674



>ref|XP_002527357.1| lyase, putative [Ricinus communis]
 gb|EEF35029.1| lyase, putative [Ricinus communis]
Length=639

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/630 (50%), Positives = 428/630 (68%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V L +    V++DNGI++V LSNP G V G+ Y  VD NLLE+ +   +RGYWDL W+  
Sbjct  6     VHLHIEDHHVVLDNGILQVTLSNPGGIVTGVRYNNVD-NLLEVLDDEVNRGYWDLVWSAA  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T +F +   T F+VI+E E QVE+SF +T+  S +   + +N+DKRF+ML  SSG
Sbjct  65    GSTGTTGTFDVFEGTSFRVIVENEDQVEISFTRTWDPSLEGKLVSLNLDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YA+++H       +L QTR+VF+L +  F ++A+ D  Q  MP   +R  E G+ L+
Sbjct  125   FYSYAVFEHLGEWPPFNLPQTRIVFQLRKDKFHYMAIADNRQRFMPLPDDRLPERGQPLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             + EAV L     P+ KG+VDDKY+Y+L+++++ V+GWI   P +GFW I  S+EFR GGP
Sbjct  185   FPEAVLLVDPVEPEFKGEVDDKYEYSLENKDLKVHGWICFDPPIGFWQINPSSEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTL  1284
             LKQ+LT H GP+ L+MFLS HYSG+D  +KL  GE WK VFGPVF+Y+NS +   D  +L
Sbjct  245   LKQNLTSHVGPYTLAMFLSAHYSGEDLVLKLNPGEPWKKVFGPVFMYVNSVEDKDDALSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W  A++QML+E + WPYSFP SED+P + QRG +SG L I D        PA  A+VGLA
Sbjct  305   WNDAQEQMLKEVQSWPYSFPASEDFPHSDQRGTISGTLQIRDRYVSNECIPANGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT  D  G F IS+VR+GEY+LYAWVPG +GD+++   I I  
Sbjct  365   PPGDVGSWQTECKGYQFWTNADADGYFSISSVRSGEYNLYAWVPGFIGDYRNDCVIKITA  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI VGDL++ P ++G T+WEIGIPDR+A EF+IP+P P   N L  +  ++FRQYGLW
Sbjct  425   GCDINVGDLLYEPPRDGPTLWEIGIPDRTAGEFYIPDPNPKYINKLYINHPDRFRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY++L+   DLVYTVG SD  KDWFFAQV RK   G Y+ T W + F ++++ + G Y 
Sbjct  485   ERYADLYPNEDLVYTVGVSDYKKDWFFAQVNRKKDDGIYQGTTWQIKFELDSLDQSGTYK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+A++  A L + +N D K D  +FT+   G DN IARHGIHGLY   S ++PG+ +
Sbjct  545   LRLALATANVAELQVRIN-DGKADSPQFTTGEIGHDNTIARHGIHGLYRLYSVDVPGTQL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+GEN ++L Q+ +  P  GIMYDYIRLE 
Sbjct  604   VEGENSIFLTQTISTGPVQGIMYDYIRLEG  633



>ref|XP_006417521.1| hypothetical protein EUTSA_v10007093mg [Eutrema salsugineum]
 gb|ESQ35874.1| hypothetical protein EUTSA_v10007093mg [Eutrema salsugineum]
Length=617

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/620 (52%), Positives = 419/620 (68%), Gaps = 14/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W       + +F ++
Sbjct  1     MDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEESNRGYWDLVWG--GSGTAGAFDVI  57

Query  616   -ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
               T F+VIME + Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H K 
Sbjct  58    KGTKFEVIMENDEQIELSFTRKWDPSQEGKAVPLNIDKRFVMLRGSSGFYTYAIYEHLKE  117

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTEN  963
                  + +TR+ FKL +  F ++AVTD+ Q  MP   +R  + G+ L Y EAV L     
Sbjct  118   WPAFSIAETRIAFKLRKEKFHYMAVTDDRQRFMPLPDDRLPDRGQALAYPEAVLLVNPVE  177

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
             P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H GP
Sbjct  178   PQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHVGP  237

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQMLE  1314
              +L++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM  
Sbjct  238   TSLAVFMSAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAKTQMNV  297

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             E + WPYSFP S+DY KA QRG V GRLL+ D    K    A   +VGLA PG  GSWQ 
Sbjct  298   EVESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDKDFIAANRGYVGLAVPGAAGSWQR  357

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
             +   YQFWTRTD+ G F IS VR G+Y+LYAWVPG +GD+K+   IT+ PGC + V DLV
Sbjct  358   ECKEYQFWTRTDEEGFFYISGVRPGQYNLYAWVPGFIGDYKYDDIITVTPGCYLYVEDLV  417

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KT  1851
             + P +NG T+WEIG PDRSAAEFF+P+P P   N L  +  ++FRQYGLW+RY EL+   
Sbjct  418   YQPPRNGATLWEIGFPDRSAAEFFVPDPNPKYINKLYQNHPDRFRQYGLWERYVELYPDK  477

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTR  2028
             DLVY VG SD   DWF+AQVTRK    +Y+AT W + F ++ + K   YTLR+A+AS+T 
Sbjct  478   DLVYVVGSSDYRNDWFYAQVTRKKDSKTYQATTWQIKFELKNIEKNHTYTLRVAIASATF  537

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             A L I VN         FTS L G+DN+IARHGIHGLY   + E+ GS  V+G+N L+L 
Sbjct  538   AELQIRVND--ASASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKFVEGDNTLFLT  595

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q +   PF G+MYDYIR EA
Sbjct  596   QPRCTSPFQGMMYDYIRFEA  615



>ref|XP_009366367.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Pyrus 
x bretschneideri]
Length=1198

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/626 (52%), Positives = 427/626 (68%), Gaps = 9/626 (1%)
 Frame = +1

Query  412   TVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEK  591
             T+ +  V+MDNGI++V LS PEG V GI Y G+D NLLE+ N+  +RGYWDL WN+    
Sbjct  568   TLAELQVMMDNGILQVTLSKPEGIVTGIQYNGID-NLLEIRNEESNRGYWDLVWNSAATG  626

Query  592   ASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTY  765
              +  F ++  T F +IME E QVE+SF +T+  S +   +P+NIDKRF+ML GSSGFY+Y
Sbjct  627   TTGIFDVIKGTSFTIIMETEEQVELSFTRTWDPSQEGKLVPLNIDKRFIMLRGSSGFYSY  686

Query  766   AIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYKEA  939
             AIY+H K     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L Y EA
Sbjct  687   AIYEHLKDWPAFELGETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGQALAYAEA  746

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V L     P+LKG+VDDKYQY+ D+++  V+GWI  +P +GFW IT S EFR GGP KQ+
Sbjct  747   VLLVNPVEPELKGEVDDKYQYSCDNKDNKVHGWICTEPPVGFWQITPSTEFRSGGPFKQN  806

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGA  1296
             LT H GP  L+MFLS HY+G+D   K   GE WK VFGPVF+Y+NS   G D  +LWE A
Sbjct  807   LTSHVGPTTLAMFLSAHYAGEDLVPKFAAGEEWKKVFGPVFMYVNSSYDGNDPLSLWEDA  866

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             K QM+ E + WPYSFP SE++PK+ +RG V GRLLI D            A+VGLA PG+
Sbjct  867   KSQMMMEVQCWPYSFPASEEFPKSHERGNVRGRLLIQDRYVSNDYISVNGAYVGLAPPGD  926

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +   YQFWT TD+ G F I+ +R G+Y+L A VPG +GD+ +   +TI  GCDI
Sbjct  927   IGSWQRECKDYQFWTTTDEDGYFCINGIRTGDYNLNASVPGFIGDYHYDVVMTITSGCDI  986

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
              +GDLV+ P ++G T+WEIGIPDRSAAEF++PEP P   N L  +  ++FRQYGLW+RYS
Sbjct  987   DMGDLVYEPPRDGHTLWEIGIPDRSAAEFYVPEPNPKYINKLFVNHPDRFRQYGLWERYS  1046

Query  1837  ELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIA  2010
             EL+   DLVYTVG SD +KDWFFAQVTRK     Y+ T W + F ++ V + G Y LR+A
Sbjct  1047  ELYSDQDLVYTVGVSDYSKDWFFAQVTRKKDDNKYQGTTWQIKFNLDNVDQTGSYKLRVA  1106

Query  2011  VASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGE  2190
             +AS+T + L + VN DPK ++  FTS + G+DN+IARHGIHGLY   + ++P S +V+G+
Sbjct  1107  LASATFSELQVRVN-DPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRLVEGD  1165

Query  2191  NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             N +YL Q ++  PF GIMYDY+R E 
Sbjct  1166  NIIYLTQPRSTGPFQGIMYDYLRFEG  1191


 Score =   560 bits (1443),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 297/575 (52%), Positives = 380/575 (66%), Gaps = 28/575 (5%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V GI Y G+D NLLE  NK  +RGYWDL W+ P
Sbjct  6     VQLHIQGPHVMMDNGILQVTLSNPDGIVTGIRYNGID-NLLEPLNKETNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F+VI+E E QVE+SF KT+ +S +   +P+NIDKRFVML GSSGFY
Sbjct  65    GSKGIFDV-IKGTTFEVIVENEEQVELSFSKTWDRSLEGKYVPLNIDKRFVMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H K   D D+ +TR+ FKL +  F ++ V+D  Q  MP   +R  G  + L Y 
Sbjct  124   SYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMTVSDNRQRYMPLPDDRSSGRCQALAYP  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   +  +L G+VDDKYQY+ D+++  V+GWI   P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLVDPKMKELAGEVDDKYQYSCDNKDNKVHGWICTNPPVGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q+LT H GP  L+MFLS HY+G D   K RGG+ WK VFGPVFIY+NS    D    LWE
Sbjct  244   QNLTSHVGPTTLAMFLSSHYAGQDLVPKFRGGKPWKKVFGPVFIYLNSSTIKDDPFWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D    +  TPA  A+VGLA P
Sbjct  304   DAKIQMMTEVQSWPYSFPASEDFQKSGQRGNVSGRLLVLDRYISEEYTPANGAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR DD G F I+ VR G Y+LYAWVPG +GD+++ A I I  G 
Sbjct  364   GDAGSWQRECKDYQFWTRADDRGYFSINNVRTGTYNLYAWVPGFIGDYRYDAVINITSGS  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIP-------------------DRSAAEFFIPEPAPDLK  1773
              I++GDLV+ P ++G T+WEIGIP                   DRSAAEF++P+P P   
Sbjct  424   FIEMGDLVYEPPRDGPTLWEIGIPDRSAAAPRDGHTLWEIGIPDRSAAEFYVPDPDPKYI  483

Query  1774  NYLLSDRTEKFRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATI  1950
             N L  D  ++FRQYGLW+RY+EL+   DLVY VG SD AKDWFFAQV RK   G +E T 
Sbjct  484   NRLFIDHPDRFRQYGLWNRYAELYPDEDLVYIVGVSDYAKDWFFAQVPRKTDNG-HEGTT  542

Query  1951  WTVVFPIETVAK-GCYTLRIAVASSTRATLLIWVN  2052
             W + F ++ V + G Y LR+A+AS+T A L + ++
Sbjct  543   WQIKFELKNVDRNGSYKLRVAIASATLAELQVMMD  577



>ref|XP_008353960.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=676

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/624 (50%), Positives = 421/624 (67%), Gaps = 8/624 (1%)
 Frame = +1

Query  409   LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKE  588
             L  TK  V+MDNGI+++  S P G V GI Y+G+D NLLE+ N+  +RGYWD+ WN  KE
Sbjct  52    LIKTKNQVVMDNGIVRLTFSYPGGDVIGIKYKGID-NLLEIKNQENNRGYWDVVWNN-KE  109

Query  589   KASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTY  765
                   K+    FK+I  +  Q E+SF KTY  S     + +N+DKR++M  G +GFY Y
Sbjct  110   TGGID-KLQGRRFKIITARADQTEISFTKTYDISRGNATLSMNVDKRYIMQRGRAGFYAY  168

Query  766   AIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVK  945
             +I++ PKG   +D+DQ R+V+KL +  F  +AV+D+ Q  MP+  +R  G  L Y EAV 
Sbjct  169   SIFERPKGWPGLDIDQIRIVYKLQQDKFQFMAVSDDRQRVMPTADDRSNGIKLAYPEAVL  228

Query  946   LTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLT  1125
             LT   NP L+G+VDDKYQY+ + ++  V+GWI  KP +GFWIIT S+EFR  GP KQDLT
Sbjct  229   LTNPSNPDLRGEVDDKYQYSSEDKDNKVHGWICTKPAVGFWIITPSDEFRTAGPFKQDLT  288

Query  1126  CHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAKKQ  1305
              H GP ALSMF+S HY+G + G +   GEAWK VFGPVF+Y+NS    +   LWE AK+Q
Sbjct  289   SHVGPTALSMFVSTHYAGKEVGXRFARGEAWKKVFGPVFVYLNSVPSLNESALWENAKEQ  348

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGS  1485
             ++EE K WPYSF +SED P ++ RG+V+G+LL+ D    K+   A  A+VGLA PG+ GS
Sbjct  349   LVEEVKSWPYSFXQSEDIPSSSGRGSVAGQLLVRDRYTSKSLVWASSAYVGLAAPGKAGS  408

Query  1486  WQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVG  1665
             WQ +S  YQFWT+ ++ G F I  VR G YSLYA VPG +GD+K K++ITI+PG +I + 
Sbjct  409   WQKESKGYQFWTQANEQGHFLIKDVRPGNYSLYATVPGIIGDYKFKSNITIEPGSEINLA  468

Query  1666  DLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLL-SDRTEKFRQYGLWDRYSEL  1842
             +L + P +NG T+WEIGIPDRSAAEF++P+P P L N L  ++R  KFRQYGLW+RY++L
Sbjct  469   NLTYVPPRNGPTLWEIGIPDRSAAEFYVPDPNPTLMNKLFTTNRAHKFRQYGLWERYADL  528

Query  1843  H-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVA  2016
             +   DL+Y +G  + + +WFFA VTR     +YEAT W ++F ++ +   G YTL++A+A
Sbjct  529   YPDEDLIYNIGTDNYSDNWFFAHVTRNIGNRTYEATTWRILFELQDLTNTGNYTLQLALA  588

Query  2017  SSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             S+T A + +  N +       FT+ L GKDNAIARHGIHGLY   S  +P   + +G N 
Sbjct  589   SATNAEVQVRFN-BQSAFPPHFTTGLIGKDNAIARHGIHGLYWLFSIGVPSYRLREGNNT  647

Query  2197  LYLRQSKAGYPFYGIMYDYIRLEA  2268
             +YL QS++   F G+MYDYIRLE 
Sbjct  648   IYLTQSRSLGTFEGVMYDYIRLEG  671



>gb|EYU30915.1| hypothetical protein MIMGU_mgv1a003154mg [Erythranthe guttata]
Length=604

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/599 (52%), Positives = 413/599 (69%), Gaps = 7/599 (1%)
 Frame = +1

Query  484   VAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEV  663
             V  I Y G+D NLL+   K  +RGYWDL W+ P        K+    F+VIME E+QVE+
Sbjct  2     VTAIEYNGID-NLLQFDYKENNRGYWDLVWSKPDHPHDVFDKLDGDSFEVIMEDENQVEI  60

Query  664   SFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRS  843
             SF +T+ S + T +P+NIDKR++M+ GSSGFY+YAI++  +G  DV++ Q R+VFKL ++
Sbjct  61    SFLRTWNSSE-TGLPLNIDKRYIMVRGSSGFYSYAIFERLEGWPDVNIAQGRIVFKLQQN  119

Query  844   LFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNM  1023
             LF ++AV+D+ Q  MP+ ++R+ GE L+Y EAV LT   N  L+G+VDDKYQY+ D+++ 
Sbjct  120   LFRYMAVSDDRQRIMPTSEDRDNGEALDYPEAVLLTNPANDFLRGEVDDKYQYSSDNKDN  179

Query  1024  SVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLR  1203
              V+GWI   P  GFWIIT SNEF+  GP+KQDLT H GP +LSMF S HY+G    +K R
Sbjct  180   RVHGWICSDPPTGFWIITPSNEFKTAGPVKQDLTSHAGPISLSMFFSTHYAGQPLILKFR  239

Query  1204  GGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRG  1380
              GE WK VFGPVF+Y+NS  +G +   LW  AK+QML ET+ WPY FPKS D+P A QRG
Sbjct  240   DGEPWKKVFGPVFVYLNSVLEGEEPLALWPDAKEQMLIETESWPYDFPKSGDFPYADQRG  299

Query  1381  AVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAV  1560
              VSGRL++ D    +    A+ A++GLA PGEPGSWQ ++  YQFWT TDD G F I+ +
Sbjct  300   TVSGRLVVRDSYISERLIIARSAYIGLAPPGEPGSWQRENKGYQFWTETDDMGYFLINGI  359

Query  1561  RAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAE  1740
             R+G YSLYAW+PG +GD+K    I ++PGC I++G +++ P +NG T+WEIGIPDR+AAE
Sbjct  360   RSGNYSLYAWIPGFIGDYKCDIQIEVRPGCKIRLGYIIYDPPRNGPTLWEIGIPDRTAAE  419

Query  1741  FFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTR  1917
             FF+P+P P L N L + + +KFRQYGLWDRY++L+   DLVYT+G S    DW+FA V R
Sbjct  420   FFVPDPNPTLMNQLYNIQPDKFRQYGLWDRYTDLYPDEDLVYTIGSSVYQTDWYFAHVNR  479

Query  1918  KNAKGSYEATIWTVVFPIETVAKGC-YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKL  2094
                  +Y  T W ++F ++ V +   YTL+IA+AS+  A L + +N D   +   F + L
Sbjct  480   NIGNKTYVPTTWKILFELDDVDESANYTLQIALASANDAELQVRIN-DETTETPYFKTGL  538

Query  2095  GGKDNAIARHGIHGLYSEVSFEIPGS-LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              GKDNAIARHGIHGLY   S  IPGS L+    N + L QS+   P+ GIMYDYIRLEA
Sbjct  539   IGKDNAIARHGIHGLYWLYSVSIPGSTLVCTTTNTILLTQSRGSTPWKGIMYDYIRLEA  597



>ref|XP_006304407.1| hypothetical protein CARUB_v10010965mg [Capsella rubella]
 gb|EOA37305.1| hypothetical protein CARUB_v10010965mg [Capsella rubella]
Length=617

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/620 (52%), Positives = 421/620 (68%), Gaps = 14/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W       +  F ++
Sbjct  1     MDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEEVNRGYWDLVWG--GSGTAGGFDVI  57

Query  616   -ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
               T+F+VIM+ E Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H K 
Sbjct  58    KGTNFEVIMKNEEQIELSFTRKWDPSLEGKAVPLNIDKRFVMLRGSSGFYTYAIYEHLKE  117

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTEN  963
                  L +TR+ FKL +  F ++AVTD+ Q  MP   +R  + G+ L Y EAV L     
Sbjct  118   WPAFSLAETRIAFKLRKDKFHYMAVTDDRQRFMPLPDDRLPDRGQALAYPEAVLLVNPVE  177

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
             P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H GP
Sbjct  178   PQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHVGP  237

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQMLE  1314
              +L++F+S HYSG+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM  
Sbjct  238   TSLAVFMSAHYSGEDLVPKFTEGEAWKKVFGPVFVYLNSSTDDENDPLWLWQDAKSQMNV  297

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             ET+ WPYSFP S+DY KA QRG V GRLL+ D         A   +VGLA PG  GSWQ 
Sbjct  298   ETESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDTDFIAANRGYVGLAVPGAAGSWQR  357

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
             +   YQFWTRTD+ G F IS +R G+Y+LYAWVPG +GD+K+   ITI  GC I + DLV
Sbjct  358   ECKEYQFWTRTDEEGFFYISGIRPGQYNLYAWVPGFIGDYKYDDIITITSGCYIYMEDLV  417

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KT  1851
             + P +NG T+WEIG PDRSAAEF++P+P P   N L  +  ++FRQYGLW+RY+EL+   
Sbjct  418   YQPRRNGETLWEIGFPDRSAAEFYVPDPNPKYINNLYKNHPDRFRQYGLWERYAELYPDK  477

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTR  2028
             DLVY VG SD  KDWF+AQVTR+    +Y+ T W + F +E + K   YTLR+A+AS+T 
Sbjct  478   DLVYVVGSSDYRKDWFYAQVTRRKDSKTYQGTTWQIKFELENIDKSQSYTLRVAIASATF  537

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             + L I VN         FTS L G+DN+IARHGIHGLY   + E+ GS +V+GEN L+L 
Sbjct  538   SELQIRVND--ATASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLFLT  595

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q ++  PF GIMYDYIR EA
Sbjct  596   QPRSTSPFQGIMYDYIRFEA  615



>ref|XP_002892533.1| hypothetical protein ARALYDRAFT_334271 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68792.1| hypothetical protein ARALYDRAFT_334271 [Arabidopsis lyrata subsp. 
lyrata]
Length=633

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/622 (52%), Positives = 423/622 (68%), Gaps = 14/622 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V++DNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W       +  F 
Sbjct  15    VVLDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEEVNRGYWDLVWG--GSGTAGGFD  71

Query  610   IL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
             ++  T+F+VIM+ E Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H 
Sbjct  72    VIKGTNFEVIMKNEEQIELSFTRKWDPSQEGKAVPLNIDKRFVMLRGSSGFYTYAIYEHL  131

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKT  957
             K      L +TR+ FKL +  F ++AVTD+ Q  MP   +R  + G+ L Y EAV L   
Sbjct  132   KEWPAFSLAETRIAFKLRKEKFHYMAVTDDRQRFMPLPDDRLPDRGQALAYPEAVLLVNP  191

Query  958   ENPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
               P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H 
Sbjct  192   VEPQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHV  251

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQM  1308
             GP AL++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM
Sbjct  252   GPTALAVFVSAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAKSQM  311

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E + WPYSFP S+DY KA QRG V GRLL+ D    K    A   +VGLA PG  GSW
Sbjct  312   NVEAESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDKDFIAANRGYVGLAVPGAAGSW  371

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +   YQFWTRTD+ G F IS +R G+Y+LYAW+PG LGD+K+   ITI  GC I V D
Sbjct  372   QRECKEYQFWTRTDEEGFFYISGIRPGQYNLYAWIPGFLGDYKYDDIITITSGCYIYVED  431

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-  1845
             LV+ P +NG T+WEIG PDRSAA+F++P+P P   N L  +  ++FRQYGLW+RY+EL+ 
Sbjct  432   LVYQPPRNGATLWEIGFPDRSAADFYVPDPNPKYINKLYQNHPDRFRQYGLWERYAELYP  491

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASS  2022
               DLVY VG SD  KDWF+AQVTRK    +Y+ T W + F ++ + K   YTLR+A+AS+
Sbjct  492   DKDLVYVVGSSDYRKDWFYAQVTRKKDSKTYQGTTWQIKFELKNIDKNHSYTLRVAIASA  551

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLY  2202
             T + L I VN         FTS L G+DN+IARHGIHGLY   + E+ GS +V+GEN L+
Sbjct  552   TFSELQIRVND--ANASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLVEGENTLF  609

Query  2203  LRQSKAGYPFYGIMYDYIRLEA  2268
             L Q ++  PF GIMYDYIR EA
Sbjct  610   LTQPRSTSPFQGIMYDYIRFEA  631



>ref|XP_008368110.1| PREDICTED: uncharacterized protein LOC103431713 [Malus domestica]
Length=1262

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/630 (52%), Positives = 428/630 (68%), Gaps = 11/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V    V+MDNGI++V LS PEG V GI Y G+D NLLE+ N   +RGYWDL WN+ 
Sbjct  629   VELLVQDHHVMMDNGILQVTLSKPEGIVTGIRYNGID-NLLEIRNDESNRGYWDLVWNSA  687

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTY--KSGDKTDIPINIDKRFVMLPGSSG  753
                 +  F ++  T F +IME E QVE+SF +T+    G K  +P+NIDKRF+ML GSSG
Sbjct  688   TTGTTGIFDVIKGTSFTIIMENEEQVELSFTRTWDPSQGGKL-VPLNIDKRFIMLRGSSG  746

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLN  927
             FY+YAIY+H K     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  747   FYSYAIYEHLKDWPAFELGETRIAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGQALA  806

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+LKG+VDDKYQY+ D+++  V+GWI  +P +GFW IT S EFR GGP
Sbjct  807   YPEAVLLVNPVEPELKGEVDDKYQYSCDNKDNKVHGWICTEPPVGFWQITPSTEFRSGGP  866

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTL  1284
              KQ+LT H GP  L+MFLS HY+G+D   K   GE WK VFGPVF+Y+NS  +G D  +L
Sbjct  867   FKQNLTSHVGPTTLAMFLSAHYAGEDLVPKFAAGEEWKKVFGPVFMYVNSAYEGNDPLSL  926

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK QM  E + WPYSFP SE++PK+ QRG V GRLLI D            A+VGLA
Sbjct  927   WEDAKSQMEMEVQCWPYSFPASEEFPKSYQRGNVRGRLLIQDRYISNDYISVNGAYVGLA  986

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT TD+ G F I+ +R G+Y+L A VPG +GD+ +   +TI  
Sbjct  987   LPGDIGSWQRECKDYQFWTTTDEDGYFCINGIRTGDYNLNASVPGFIGDYHYDVVMTITS  1046

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GCDI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW
Sbjct  1047  GCDIDMGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLFVNHPDRFRQYGLW  1106

Query  1825  DRYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RYSEL+   DLVYTVG SD +KDWFFAQVTRKN    Y+ T W + F ++ + + G Y 
Sbjct  1107  ERYSELYSDQDLVYTVGVSDYSKDWFFAQVTRKNEDNKYQGTTWQIKFNLDNLDQTGSYK  1166

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+T + L + VN DPK ++  FTS + G+DN+IARHGIHGLY   + ++P S +
Sbjct  1167  LRVALASATFSELQVRVN-DPKANRPLFTSGMIGRDNSIARHGIHGLYWLYNVDVPSSRL  1225

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+G+N +YL Q ++  PF GIMYDY+R E 
Sbjct  1226  VEGDNIIYLTQPRSTGPFQGIMYDYLRFEG  1255


 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/605 (52%), Positives = 405/605 (67%), Gaps = 13/605 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V LSNP+G V GI Y G+D NLLE  NK  +RGYWDL W+ P  K      I 
Sbjct  1     MDNGILQVTLSNPDGIVTGIRYNGID-NLLEPLNKETNRGYWDLVWSAPGSKGIFDV-IK  58

Query  616   ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
              T FKVI+E E QVE+SF KT+  S +   +P+NI KRFVML GSSGFY+Y IY+H K  
Sbjct  59    GTTFKVIVESEEQVELSFSKTWDCSLEGKYVPLNIYKRFVMLRGSSGFYSYGIYEHLKDW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTENP  966
              D D+ +TR+ FKL +  F ++AV+D  Q  MP   +R  E+ + L Y EAV L   +  
Sbjct  119   PDFDIGETRITFKLRKDKFQYMAVSDNRQRYMPLPDDRLSEQCQALAYPEAVLLVDPKMK  178

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
              L G+ DDKYQY+ DSQ+  V+GWI   P +GFW IT S+EFR GGPLKQ+LT H GP  
Sbjct  179   DLAGEXDDKYQYSCDSQDNKVHGWICTNPPVGFWQITPSDEFRSGGPLKQNLTSHVGPTT  238

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWEGAKKQMLEETK  1323
             L+MFLS HY+G D   K RGGE WK VFGPVFIY+NS   TD    LWE AK QM+ E +
Sbjct  239   LAMFLSSHYAGQDLVPKFRGGEPWKKVFGPVFIYLNSSTITDDPFWLWEDAKIQMMTEVQ  298

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPYSF  SED+ K++    VSGRLL+ D    K  TPA  A+VGLA PG+ GSWQ +  
Sbjct  299   SWPYSFSASEDFQKSSN---VSGRLLVLDRYISKEYTPANGAYVGLAPPGDAGSWQRECK  355

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWTR DD G F I+ VR G Y+LYAWVPG +GD+++ A I I  G  I++GDLV+ P
Sbjct  356   DYQFWTRADDHGYFSINNVRTGTYNLYAWVPGFIGDYRYDAVINITSGSFIEMGDLVYEP  415

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLV  1860
              + G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW+ Y+EL+   DLV
Sbjct  416   PRXGQTLWEIGIPDRSAAEFYVPDPHPKYINRLFINHPDRFRQYGLWNGYAELYPDEDLV  475

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTRATL  2037
             Y VG SD AKDWFFAQV RK   G +E T W + F ++ V +  CY LR+A+AS+T A L
Sbjct  476   YIVGVSDYAKDWFFAQVPRKTDNG-HEGTTWQIKFELKNVDRNSCYNLRVAIASATLAEL  534

Query  2038  LIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSK  2217
              + +N +P   +  FTS L G++N++ARHGIHG+Y   +  +PG+ +V+G N  + RQ +
Sbjct  535   QVRIN-NPDSRRPLFTSGLIGRENSVARHGIHGIYWLYNINVPGAQLVEGNNTFFFRQPR  593

Query  2218  AGYPF  2232
                PF
Sbjct  594   CTSPF  598



>ref|XP_004152608.1| PREDICTED: rhamnogalacturonate lyase B-like [Cucumis sativus]
Length=625

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/616 (51%), Positives = 419/616 (68%), Gaps = 9/616 (1%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V LSNP+G V GI Y GVD N+LE+ N   +RGYWDL W++          I 
Sbjct  1     MDNGIVQVTLSNPDGIVTGIRYGGVD-NVLEVLNDESNRGYWDLVWSSSSSTTGLFDVIK  59

Query  616   ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
             AT F+VI+E E QVE+SF +T+  S +   +P+ IDKRF+ML GSSGFY+YAIY H +  
Sbjct  60    ATGFEVIVENEEQVELSFTRTWDLSLEGKLVPLEIDKRFIMLRGSSGFYSYAIYQHLEEW  119

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE--EGEVLNYKEAVKLTKTENP  966
                +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G  L Y EAV L     P
Sbjct  120   PGFNLGETRLAFKLRKDKFHYMAMADNRQRYMPLPDDRSPPRGRALAYPEAVLLVDPIEP  179

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
             +L+G+VDDKYQY+ D+++  V+GWIS  P +GFW+I+ SNEFR GGP+KQ+LT H GP  
Sbjct  180   ELQGEVDDKYQYSCDNKDSGVHGWISTDPAVGFWLISPSNEFRSGGPVKQNLTSHVGPTT  239

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT-DHKTLWEGAKKQMLEETK  1323
             L++F+S HY+G+D   K+  GEAWK VFGPVFIY+NS   + D   LWE AK Q + E +
Sbjct  240   LAVFISAHYAGEDLVPKIGAGEAWKKVFGPVFIYLNSTYDSFDALQLWEDAKAQAVIEVQ  299

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPYSFP S+D+P++ QR ++SG+LL+ D    +   PA  A VGLA PG+ GSWQ +S 
Sbjct  300   SWPYSFPASDDFPRSNQRSSISGKLLVKDSYVNEDLIPADGAFVGLAPPGDVGSWQRESK  359

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFW+R D++G F I  VR G+Y+LYAWVPG +GD+++ A I +  G ++ +GD+ + P
Sbjct  360   GYQFWSRADESGNFSIDGVRPGDYNLYAWVPGFIGDYRYDALINLTEGSEVDMGDITYEP  419

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLV  1860
              + G T+WEIGIPDRSAAEF++P+P P+  N L  +  +KFRQYGLW+RYSEL   +DLV
Sbjct  420   PRQGATLWEIGIPDRSAAEFYVPDPNPNYVNKLYLNHPDKFRQYGLWERYSELFPDSDLV  479

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASSTRATL  2037
             YTVG SD  KDWFFAQV RK   G+Y+ T W V F ++ V  +  Y LR+A+AS + A L
Sbjct  480   YTVGVSDYTKDWFFAQVPRKMENGTYKGTTWQVKFELDDVDNQATYKLRVALASVSLAEL  539

Query  2038  LIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSK  2217
              + VN    K KA F+S L G+DN+IARHGIHGLY   + +IPG+ +V G N ++  Q +
Sbjct  540   QVGVN--EAKAKAVFSSGLIGRDNSIARHGIHGLYWVYNIDIPGNRLVTGNNTIFFTQPR  597

Query  2218  AGYPFYGIMYDYIRLE  2265
                PF  IMYDYIRLE
Sbjct  598   CTGPFQAIMYDYIRLE  613



>ref|XP_010671338.1| PREDICTED: rhamnogalacturonate lyase B [Beta vulgaris subsp. 
vulgaris]
Length=659

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/632 (51%), Positives = 420/632 (66%), Gaps = 10/632 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
               + V+L +    V++DNGI +V +S P G V GI Y G+D NLLE  N   +RGYWDL 
Sbjct  25    TAQAVQLQILDRYVVLDNGIARVTISKPGGIVTGIAYNGID-NLLESRNVEDNRGYWDLV  83

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGS  747
             WN       T   I AT+F+VIM  + QVEVSF + +    K   +P+NIDKRF+ML GS
Sbjct  84    WND-DTTPGTFDTIKATNFQVIMSNDDQVEVSFSRQWDPSLKGKLVPLNIDKRFIMLRGS  142

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EV  921
             SGFYTYAIY+H        + +TR+ FKL++  F ++A+ D  Q  MP   +R  G  E 
Sbjct  143   SGFYTYAIYEHMNDWPSFSMGETRITFKLNKQWFHYMAIADNRQRFMPLPDDRMPGRCEK  202

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV LT    P+LKG+VDDKYQY+ D++++ V+GWIS     GFW IT S E+R G
Sbjct  203   LAYAEAVLLTNPIEPELKGEVDDKYQYSCDNKDILVHGWISTDQPTGFWQITPSYEYRSG  262

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT H GP +LS+F S HY+GD    K   GE WK VFGPVFIY NS  K  D  
Sbjct  263   GPVKQNLTSHVGPTSLSVFYSGHYAGDALVPKFGDGEPWKRVFGPVFIYCNSCPKDVDFH  322

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK Q++ +T+ WPYSFP SED+PK  QRG V G+L++ D        PA  A+VG
Sbjct  323   QLWEDAKHQLMLQTQSWPYSFPASEDFPKPNQRGKVRGKLVVRDRYVSDDHIPASGAYVG  382

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA  G PGSWQ +   YQFWT  D+ G F I+ +R G+Y+LYAWVPG +GD+++ A ITI
Sbjct  383   LAVLGPPGSWQTEIKGYQFWTTADENGCFSINGIREGDYNLYAWVPGVIGDYRYDAVITI  442

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               GCD  +GDLV+ PL++G T+WEIGIPDR+AAEFF P+P P+  N L  +   +FRQYG
Sbjct  443   TAGCDADMGDLVYEPLRDGPTLWEIGIPDRTAAEFFAPDPNPNYVNQLYVNHPNRFRQYG  502

Query  1819  LWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RY+EL+   DLVYT+G SD  KDWFFAQV RK   G +  T W V F ++ V + G 
Sbjct  503   LWERYAELYPNEDLVYTIGVSDYRKDWFFAQVPRKVENG-FVGTTWQVRFKLDKVDQNGI  561

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LR+A+AS+T A + + VN DPK ++  FT+ L G+DN+IARHGIHGLY   + +I GS
Sbjct  562   YKLRLAIASATLAEVQVRVN-DPKANRPVFTTGLMGRDNSIARHGIHGLYWLYNVDIQGS  620

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+G+N LYL Q +   PF GI+YDY+RLE 
Sbjct  621   KLVQGDNVLYLTQPRNQSPFQGILYDYLRLEG  652



>ref|XP_010544057.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Tarenaya 
hassleriana]
Length=639

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/631 (52%), Positives = 424/631 (67%), Gaps = 14/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             ++L V    V M+NGI++V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     LQLQVKDNHVTMNNGILQVTLSKPDGIVTGIQYNGLD-NLLEVRNEESNRGYWDLVWS--  62

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
                 + +F ++  T FKVI+EKE Q+E+SF +T+  S +   +P+NIDKRFVML GSSGF
Sbjct  63    GSGTTGAFDVIRGTSFKVIVEKEEQIELSFTRTWDPSQEGKAVPLNIDKRFVMLRGSSGF  122

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             YTYAIY+H +      + +TR+ FKL +  F ++A+ D  Q  MP   +R  + G+ L Y
Sbjct  123   YTYAIYEHSEQWPAFSMAETRIAFKLRKDKFHYMAIADNRQRFMPLPDDRLQDRGQALAY  182

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWIS-PKPHLGFWIITASNEFRLGGP  1107
              EAV L     P+  G+VDDKYQY+ +++++ V+GWIS  +P +GFW+IT S EFR GGP
Sbjct  183   PEAVLLVNPIEPEFTGEVDDKYQYSCENKDILVHGWISTEQPLVGFWLITPSQEFRTGGP  242

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLW  1287
              KQ+LT H GP +L++F S HYSGDD   K   GE WK VFGPVFIY+NS    D   LW
Sbjct  243   HKQNLTSHVGPTSLAVFSSAHYSGDDLVPKFGVGEQWKKVFGPVFIYLNSSTDDDDDPLW  302

Query  1288  EG--AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
                 AK Q + E + WPY FP SED+ KA QRG V GRLL+ D    +   PA   +VGL
Sbjct  303   LWDDAKSQTVAEVESWPYDFPASEDFVKADQRGNVVGRLLVRDRYLEEGLIPANRGYVGL  362

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG PGSWQ +   YQFWT +D+ G F IS +R G+Y+LYAWVPG +GDFK++  ITI 
Sbjct  363   APPGAPGSWQRECKEYQFWTTSDEEGFFYISGIRPGQYNLYAWVPGFIGDFKYEEIITIT  422

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC I V D+V+ P +NG T+WEIGIPDRSAAEF++P+P+P   N L  +  ++FRQYGL
Sbjct  423   PGCYIYVEDVVYQPPRNGPTLWEIGIPDRSAAEFYVPDPSPKYINRLYVNHPDRFRQYGL  482

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W+RYSE++   DLVYT+G SD  +DWFFAQVTRK    +Y+ T W + F +E+V K   Y
Sbjct  483   WERYSEMYPDGDLVYTIGTSDYGRDWFFAQVTRKKDNKTYQGTTWQIKFKLESVDKANSY  542

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
             TLR+A+AS+T + L I VN         FTS L GKDN+IARHGIHGLY   S E+PGS 
Sbjct  543   TLRVAIASATLSELQIRVND--ANGSPLFTSGLIGKDNSIARHGIHGLYWLFSIEVPGSK  600

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              V+G N  +  Q ++  PF GIMYDYIRLE 
Sbjct  601   FVEGVNTFFFTQPRSTSPFQGIMYDYIRLEG  631



>ref|XP_007018290.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
 gb|EOY15515.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
Length=642

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/630 (50%), Positives = 427/630 (68%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN-T  579
             V+L +    V+MDNGI++V +S+P+G V GI Y G+D N+LE+ ++  +RGYWDL W+ T
Sbjct  6     VQLLIRDHYVVMDNGILQVTISSPDGIVTGIRYNGID-NVLEVQDEEVERGYWDLVWSKT  64

Query  580   PKEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                  + +F +   T FKV++E E QVE+SF +T+  S +   +P+N+DKRF+ML  SSG
Sbjct  65    GSTGTTGTFDVFKGTSFKVVVENEDQVEISFTRTWDFSLEGNVVPLNLDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAI++H       +L Q R+VFKL +  F ++AV D  Q  MP   +R  + G+ L 
Sbjct  125   FYSYAIFEHLGEWPPFNLPQVRIVFKLRKDKFHYMAVADNRQRFMPLPDDRLPDRGQPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
               EAV L     P+ +G+VDDKYQY+ +++++ V+GWIS  P +GFW IT S+EFR GGP
Sbjct  185   TPEAVLLVNPVEPEFRGEVDDKYQYSSENKDLKVHGWISLNPPIGFWQITPSSEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH-KTL  1284
             +KQ+LT H GP+AL+MFLS HY+G+D  +KL  GE WK VFGPVF+Y+NS    D+  +L
Sbjct  245   VKQNLTSHVGPYALAMFLSAHYAGEDLVLKLNPGEPWKKVFGPVFLYLNSLWDKDNVYSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK QM  E + WPYSFP +ED+PK+ QRG   GRL + D        PA  A+VGLA
Sbjct  305   WEDAKDQMQMEVQNWPYSFPAAEDFPKSDQRGKACGRLKVQDRYVSYDCIPANGAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PGE GSWQ +   YQFWTR+D+ G F +  +RAGEY++YAWVPG +GD+K+ A I I  
Sbjct  365   PPGEVGSWQRECKGYQFWTRSDEDGNFAVENIRAGEYNIYAWVPGFIGDYKYDAVINITE  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GC   VGDL+F P ++G T+WEIGIPDRSAAEF+IP+P P   N L  +  +++RQYGLW
Sbjct  425   GCTTDVGDLIFEPPRDGPTLWEIGIPDRSAAEFYIPDPDPMYINRLYVNHPDRYRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYT  1998
             +RY++L+   DLV+TVG SD  KDWFFAQV RK   G+Y+ T W + F +  V   G Y 
Sbjct  485   ERYADLYPDGDLVFTVGDSDYEKDWFFAQVNRKKEDGTYQGTTWQIKFMLNIVDHTGTYI  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+A++  A L + +N DPK D   FT+   G DN IARHGIHGLY   + ++PG  +
Sbjct  545   LRLALATAHLAELQVRIN-DPKADPPLFTTGQIGHDNTIARHGIHGLYRLYNVDVPGVQL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+GEN ++L Q+    P  GIMYDYIRLE 
Sbjct  604   VEGENIVFLTQAINTDPLQGIMYDYIRLEC  633



>ref|XP_010104584.1| hypothetical protein L484_025563 [Morus notabilis]
 gb|EXC01185.1| hypothetical protein L484_025563 [Morus notabilis]
Length=1193

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/634 (51%), Positives = 431/634 (68%), Gaps = 12/634 (2%)
 Frame = +1

Query  397   KPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN  576
             K V+L VTK  V+MDNGI++V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+
Sbjct  555   KGVELRVTKNHVIMDNGILQVTLSKPDGIVTGIKYNGID-NLLEVLNEKDNRGYWDLVWS  613

Query  577   TPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
                   +T    +I  T FKVI+E E QVE+SF + +  S +   +P+NID RFVML  S
Sbjct  614   KTGSIGTTGVYDRIQGTKFKVIVENEEQVEISFTRNWNPSLEGQLVPLNIDIRFVMLRDS  673

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFY+YAIY+H K     +L QTR+VFKL +  F ++ V D  Q  MP   +R  + G+ 
Sbjct  674   SGFYSYAIYEHLKEWPPFNLPQTRIVFKLRKEKFQYMVVADNRQRYMPLPDDRLPDRGQE  733

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L     P  KG+VDDKY+Y+ +++++ V+GWI  +P +GFW IT SNEFR G
Sbjct  734   LAYPEAVLLVNPVEPNFKGEVDDKYEYSCENKDLKVHGWICDEPPVGFWQITPSNEFRSG  793

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDH-  1275
             GPLKQ+LT H GP  L+MFLS HY+G+D  +K++  E WK VFGPVFIY+NS   G+D  
Sbjct  794   GPLKQNLTSHVGPTTLAMFLSAHYAGEDMVLKIQPNEPWKKVFGPVFIYVNSVPDGSDQF  853

Query  1276  -KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAH  1452
                LW+ AK QML E + WPY+F  S+D+P   +RG +SGRLL+ D      D     A+
Sbjct  854   RAQLWDDAKMQMLIEVQSWPYTFLASKDFPSWDERGYLSGRLLVRDQYISNDDMCGDRAY  913

Query  1453  VGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADI  1632
             VGLA PGE GSWQ +   YQFWTR D+ G F I  +R GEY+LYAW+PG +G++K+   I
Sbjct  914   VGLAPPGEVGSWQKECKGYQFWTRADENGYFSICDIRVGEYNLYAWLPGFIGEYKNNVTI  973

Query  1633  TIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQ  1812
             +I  GCDI VGD+VF P + G T+WEIG+PDRSAAEF++P+P P   N L  +  ++FRQ
Sbjct  974   SITEGCDIDVGDVVFEPPRYGPTLWEIGVPDRSAAEFYVPDPNPKYINPLYLNHPDRFRQ  1033

Query  1813  YGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPI-ETVAK  1986
             YGLW+RY+EL+   DLVYT+G +D +KDWFFA VTR+ A G+Y++T W + FP+     +
Sbjct  1034  YGLWERYAELYPDQDLVYTIGVNDYSKDWFFAHVTRRKADGTYQSTTWQINFPLGNATTR  1093

Query  1987  GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
             G   LRIA+A++  A L + +N D K ++  FT+ + G DN IARHGIHGLY   + ++P
Sbjct  1094  GTSKLRIALATANVAELQVRIN-DAKAERPLFTTGVIGNDNTIARHGIHGLYRLFNIDVP  1152

Query  2167  GSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GS++V+G NK++L Q+    PF G+MYDYIRLE 
Sbjct  1153  GSVLVEGNNKIFLTQAMCTSPFQGVMYDYIRLEG  1186


 Score =   289 bits (739),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 149/327 (46%), Positives = 207/327 (63%), Gaps = 18/327 (6%)
 Frame = +1

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             + +M  E + WPY FP+S+D+P   +RG +SGRLL+ D    K    A  A VGLA PG+
Sbjct  237   RGEMEIEVQSWPYDFPQSKDFPSLDERGNISGRLLLLDRYVSKKKIYANGAFVGLAPPGD  296

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +S  YQFW+R D+ G F I+ +RAG+Y+LYAWVPG +GD+++   I I P    
Sbjct  297   VGSWQRESKGYQFWSRADEKGYFNINNIRAGDYNLYAWVPGFIGDYRYDDLIKITPASK-  355

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
             K  ++V             G    SAAEF++P+P P+  N L  +  +KFRQYGLW+RY+
Sbjct  356   KWANIV-------------GNWHSSAAEFYVPDPNPNYVNKLYVNHPDKFRQYGLWERYA  402

Query  1837  ELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG--CYTLRI  2007
             EL+   DL+YTVG +D +KDWFF QVTRK    +YE + W + F +     G   YTLRI
Sbjct  403   ELYPDEDLIYTVGVNDYSKDWFFVQVTRKKDNNTYEGSTWQIRFCLSNYVDGTQTYTLRI  462

Query  2008  AVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKG  2187
             A+A++  + L + +N DP+     F++ + GKDN IARHGIHGLY   + +IPG+ ++ G
Sbjct  463   ALATAHFSELQVRIN-DPEAISPLFSTGVIGKDNTIARHGIHGLYWLYNIDIPGNRLLVG  521

Query  2188  ENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              N ++L +  +  PF GIMYDYIRLEA
Sbjct  522   NNTIFLTRLNSTSPFQGIMYDYIRLEA  548


 Score =   107 bits (267),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/204 (36%), Positives = 105/204 (51%), Gaps = 47/204 (23%)
 Frame = +1

Query  403  VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDW--N  576
            ++L +  + V MDNGI+ V LS P GSV GI Y GV DNLL L++++ +RGYWDL W  N
Sbjct  84   LQLHIRDQYVEMDNGILHVTLSKPGGSVTGIRYNGV-DNLLALNSEV-NRGYWDLVWIGN  141

Query  577  TPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
              K K  +  ++  TDFKVI+E E Q+E+SF +T+  S +   +P+NIDKR         
Sbjct  142  GSKGKKGSLDRLEGTDFKVIVENEEQIEISFTRTWNFSLEGKMVPLNIDKR---------  192

Query  754  FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
                                           F ++A++D  Q  MP  ++R  E G  L 
Sbjct  193  -------------------------------FNYMAISDNRQRCMPLPEDREPERGRALA  221

Query  928  YKEAVKLTKTENPKLKGKVDDKYQ  999
            Y EAVKL     P  +G+++ + Q
Sbjct  222  YPEAVKLVNPVEPDFRGEMEIEVQ  245



>ref|XP_011098603.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=641

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/633 (49%), Positives = 430/633 (68%), Gaps = 16/633 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             + L V +  V++DNG+ ++ LSNP G + GI Y G++ NLLEL+NK  + G+WDL+W+  
Sbjct  6     MHLWVKEHQVVIDNGVFQLTLSNPGGIIRGIQYHGIE-NLLELNNKDLNGGFWDLNWS--  62

Query  583   KEKASTSFK-----ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPG  744
              E  ST  +     I  T  +VI+E E QVE+SF +T+  S      P+ ID+RFVML G
Sbjct  63    -EAGSTKTRGKFDTIEGTSLRVIVETEEQVELSFTRTWDPSVQGEQAPLTIDRRFVMLRG  121

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
             S+GFY+YAI++H +     +L+ TR+ F L +  F ++A+ D+ Q  MP   +R    G+
Sbjct  122   STGFYSYAIFEHSEDFPGFNLNTTRIAFMLRKDKFHYMAIADDRQRYMPLPDDRLPGRGQ  181

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L     P+ KG+VDDKYQY+ ++++  V+GWI   P +GFW IT SNEFR 
Sbjct  182   QLAYPEAVLLVDPVEPEFKGEVDDKYQYSCENKDNQVHGWICFDPPVGFWQITPSNEFRN  241

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDH  1275
             GGP KQDLT H  P  L++F++ HY+G+D  +K + GE WK VFGPVFIY+NS     D 
Sbjct  242   GGPFKQDLTSHVNPTTLAIFVTSHYAGEDLILKFQPGEIWKKVFGPVFIYLNSVSDANDA  301

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
              +LW  AK+QM +E + WPYSF  S+D+P + QRGAV G++L+HD C  K   PAK A+V
Sbjct  302   FSLWSDAKEQMKKEVESWPYSFVASDDFPNSNQRGAVRGKMLVHDRCISKDAIPAKAAYV  361

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+ GSWQ +S  YQFWT  D+ G F I+ +R  +Y+LYAWVPG +GD+K +  +T
Sbjct  362   GLAPPGDDGSWQRESKGYQFWTTADENGYFAINDIRTADYNLYAWVPGFIGDYKCEIVLT  421

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I PGCDI VG+L + P +NG T+WEIGIPDR+AAEF++P+P P   N L  +  ++FRQY
Sbjct  422   ITPGCDIDVGELTYEPPRNGPTLWEIGIPDRTAAEFYVPDPNPMYINKLYVNHPDRFRQY  481

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-G  1989
             GLW+RY++L+   DLVYTVG SD  KDWF+AQVTR+    SY++T W + F I TV + G
Sbjct  482   GLWERYTDLYPDKDLVYTVGVSDYRKDWFYAQVTRRIGDNSYKSTTWQIKFNIITVDEGG  541

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTLR+A+AS+  + L + VN D   D   F++ + G DNAIARHGIHG+Y   + +IP 
Sbjct  542   TYTLRLALASAHNSELQVRVN-DSDADPPLFSTGVIGADNAIARHGIHGIYWLFNVDIPA  600

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +++GEN +YL Q+K+  PF GIMYDY+RLE 
Sbjct  601   AQLMQGENTIYLTQAKSSSPFQGIMYDYLRLEG  633



>emb|CDP00942.1| unnamed protein product [Coffea canephora]
Length=681

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/635 (50%), Positives = 429/635 (68%), Gaps = 12/635 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   V+L +  +  ++DNGI+KV LSNP G + GI Y G+D N+LEL+N+  + G+WDL+
Sbjct  44    AATGVQLHIEADHAVIDNGIVKVTLSNPGGLLRGIEYGGID-NVLELNNQDLNGGFWDLN  102

Query  571   WN---TPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVML  738
             W+   +P  +      I  T  KVI++ E QVE+SF + +    K D  P++IDKRFV+L
Sbjct  103   WSEAGSPGTRGKFD-TIEGTSLKVIVQTEDQVELSFTRIWSPSVKGDQAPLSIDKRFVVL  161

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EE  912
              G SGFY+YAI++H K     +L+ TR+ F L +  F ++A+TD  Q  MP   +R    
Sbjct  162   RGFSGFYSYAIFEHLKDLPGFNLNTTRIAFMLRKDRFHYIAITDSRQRFMPLPDDRLPPR  221

Query  913   GEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
             G+ L Y EAV L     P+ KG+VDDKYQY+L++++  V+GWI   P +GFW IT SNEF
Sbjct  222   GQQLAYPEAVLLVDPIEPEFKGQVDDKYQYSLENKDNRVHGWICFDPPVGFWQITPSNEF  281

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGT  1269
             R GGP KQDLT H  P  L++F++ HY+G+D  +K   GE WK VFGPV IY+NS  KG 
Sbjct  282   RTGGPPKQDLTSHVNPTTLAIFVTSHYAGEDLIVKFEDGEVWKKVFGPVCIYLNSAPKGA  341

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             + + LW+ AK+QM +E + WPY+FP SED+PK  QRG V G LL+ D C  K   PA  A
Sbjct  342   EAQDLWDNAKEQMNKEVQSWPYTFPASEDFPKTDQRGTVRGNLLVQDRCVNKEAIPAAGA  401

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ ++  YQFWT  D +G F IS +R G+Y+LYAWVPG +GD+K+ A 
Sbjct  402   YVGLAPPGNAGSWQRENKGYQFWTTVDQSGSFAISHIRPGDYNLYAWVPGFIGDYKYDAA  461

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             I I PG DI VG+LV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +KFR
Sbjct  462   IGISPGSDIDVGELVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINPLYVNHPDKFR  521

Query  1810  QYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK  1986
             QYGLW+RY+EL+ + DLVYTV  SD  KDWFFAQV RK  +G+Y++T W + F I+ V +
Sbjct  522   QYGLWERYAELYPEKDLVYTVDVSDYKKDWFFAQVNRKVGEGTYKSTTWQIKFKIDNVDQ  581

Query  1987  G-CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
                Y LRIA+AS+  + L + VN D   +   F+S + G DNAIARHGIHGLY   + +I
Sbjct  582   TETYKLRIALASAHNSDLQVRVN-DEMANPPLFSSGVIGTDNAIARHGIHGLYWLFNIDI  640

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PGS ++ G+N ++L Q+K+  PF GIMYDYIRLE 
Sbjct  641   PGSELLGGDNTIFLTQAKSSSPFQGIMYDYIRLEG  675



>ref|XP_011098611.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=640

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/629 (49%), Positives = 429/629 (68%), Gaps = 16/629 (3%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             + ++ V++DNG+ ++ LSNP G + GI Y G++ NLLEL+NK  + G+WDL+W+   E  
Sbjct  9     ILEDSVVIDNGVFQLTLSNPGGIIRGIQYHGIE-NLLELNNKDLNGGFWDLNWS---EAG  64

Query  595   STSFK-----ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
             ST  +     I  T  +VI+E E QVE+SF +T+  S      P+ ID+RFVML GS+GF
Sbjct  65    STKTRGKFDTIEGTSLRVIVETEEQVELSFTRTWDPSVQGEQAPLTIDRRFVMLRGSTGF  124

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             Y+YAI++H +     +L+ TR+ F L +  F ++A+ D+ Q  MP   +R    G+ L Y
Sbjct  125   YSYAIFEHSEDFPGFNLNTTRIAFMLRKDKFHYMAIADDRQRYMPLPDDRLPGRGQQLAY  184

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV L     P+ KG+VDDKYQY+ ++++  V+GWI   P +GFW IT SNEFR GGP 
Sbjct  185   PEAVLLVDPVEPEFKGEVDDKYQYSCENKDNQVHGWICFDPPVGFWQITPSNEFRNGGPF  244

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLW  1287
             KQDLT H  P  L++F++ HY+G+D  +K + GE WK VFGPVFIY+NS     D  +LW
Sbjct  245   KQDLTSHVNPTTLAIFVTSHYAGEDLILKFQPGEIWKKVFGPVFIYLNSVSDANDAFSLW  304

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
               AK+QM +E + WPYSF  S+D+P + QRGAV G++L+HD C  K   PAK A+VGLA 
Sbjct  305   SDAKEQMKKEVESWPYSFVASDDFPNSNQRGAVRGKMLVHDRCISKDAIPAKAAYVGLAP  364

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG+ GSWQ +S  YQFWT  D+ G F I+ +R  +Y+LYAWVPG +GD+K +  +TI PG
Sbjct  365   PGDDGSWQRESKGYQFWTTADENGYFAINDIRTADYNLYAWVPGFIGDYKCEIVLTITPG  424

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             CDI VG+L + P +NG T+WEIGIPDR+AAEF++P+P P   N L  +  ++FRQYGLW+
Sbjct  425   CDIDVGELTYEPPRNGPTLWEIGIPDRTAAEFYVPDPNPMYINKLYVNHPDRFRQYGLWE  484

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RY++L+   DLVYTVG SD  KDWF+AQVTR+    SY++T W + F I TV + G YTL
Sbjct  485   RYTDLYPDKDLVYTVGVSDYRKDWFYAQVTRRIGDNSYKSTTWQIKFNIITVDEGGTYTL  544

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+  + L + VN D   D   F++ + G DNAIARHGIHG+Y   + +IP + ++
Sbjct  545   RLALASAHNSELQVRVN-DSDADPPLFSTGVIGADNAIARHGIHGIYWLFNVDIPAAQLM  603

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +GEN +YL Q+K+  PF GIMYDY+RLE 
Sbjct  604   QGENTIYLTQAKSSSPFQGIMYDYLRLEG  632



>ref|XP_006404724.1| hypothetical protein EUTSA_v10000697mg, partial [Eutrema salsugineum]
 gb|ESQ46177.1| hypothetical protein EUTSA_v10000697mg, partial [Eutrema salsugineum]
Length=642

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 419/623 (67%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ + V++DNGII+V  S+P+G + GI Y G+D+    L ++I DRGYWD+ W  P +K 
Sbjct  22    VSHDKVVVDNGIIQVTFSSPQGLITGIKYNGIDN---VLDDEIDDRGYWDVVWYEPGKKG  78

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFYTYAI  771
              T  K+  T F++I + E QVE+SF +T+    +  + P+N+DKR+++  G SG Y Y I
Sbjct  79    ETD-KLEGTKFEIITQNEEQVEISFTRTWTISKRGSLAPLNVDKRYIIRSGVSGIYMYGI  137

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R   + L YKEAV LT
Sbjct  138   LERLEGWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRNNAKELAYKEAVLLT  197

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
                NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  198   NPSNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  257

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPVF Y+NS    D    LW  AK+QM
Sbjct  258   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVFAYLNSVSPKDSTLRLWRDAKRQM  317

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E K WPY F KSEDYP + QRG + G+  I D    +     K A VGLA  GE GSW
Sbjct  318   AAEVKSWPYEFVKSEDYPLSHQRGTIQGQFYIKDSYVSRLRIYGKFAFVGLAPIGEAGSW  377

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG  + VG 
Sbjct  378   QTESKGYQFWTKADRKGRFIIENVRAGNYSLYAWGFGFIGDYKYEQNITITPGSKMNVGQ  437

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             +V+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  438   IVYEPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  497

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYT+G SD  +DWFFA VTR     +Y+AT W ++F ++ V +   YTLRIA+AS
Sbjct  498   PQNDLVYTIGVSDYRRDWFFAHVTRNVGNNTYQATTWQIIFNLKNVNRVRLYTLRIALAS  557

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L + +N +PK D   FT+   GKDNAIARHGIHGLY   S ++ G+L+  G+N +
Sbjct  558   AADSELQVRIN-NPKSDHI-FTTGYIGKDNAIARHGIHGLYRLYSIDVGGNLLSVGDNTI  615

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL Q+++  PF G+MYDYIRLE 
Sbjct  616   YLTQTRSLGPFQGVMYDYIRLEG  638



>ref|XP_011016987.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Populus 
euphratica]
Length=643

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/630 (50%), Positives = 426/630 (68%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +  + V+MDNGI++V LSNP G V GI Y G+D NLLE+ +   +RGYWDL W+  
Sbjct  6     VQLLIEDQHVVMDNGILQVTLSNPGGLVTGIQYNGID-NLLEVLDVETNRGYWDLVWSQA  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T +F +   T F+VI+E E QVEVSF +T+  S +   + +N+D RF+ML  SSG
Sbjct  65    GSTGTTGTFDVFEGTTFRVIVENEEQVEVSFTRTWDPSLEGKFVSLNLDNRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAI++H       +L QTR+VF+L +  F ++ V D  Q  MP   +R  E GE L+
Sbjct  125   FYSYAIFEHLADWPPFNLPQTRIVFQLRKDKFHYMVVADNRQRFMPLPDDRLPERGEPLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             + EAV L     P+ KG+VDDKYQY+ +++++ V+GWI   P  GFW IT S+EFR GGP
Sbjct  185   FPEAVLLVDPVEPEFKGEVDDKYQYSCENKDLHVHGWICFDPPTGFWQITPSSEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TL  1284
             LKQ+LT H GP+ L+MFLS HY+G+D  +KL  GE WK VFGPVF+Y+NS    D+  +L
Sbjct  245   LKQNLTSHVGPYTLAMFLSAHYAGEDLVLKLNPGEPWKKVFGPVFMYLNSVVDKDNALSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK+Q L+E   WPYSFP SED+P + QRG +SGRL + D         A  A+VGLA
Sbjct  305   WDDAKEQYLKEVHCWPYSFPASEDFPCSDQRGKISGRLQVLDRYISHECIAANDAYVGLA  364

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT+TD  G F I  +R G+Y+LYAW+PG +GD+++   IT+  
Sbjct  365   PPGDVGSWQRECKGYQFWTKTDGDGSFCIGDIRTGDYNLYAWIPGFIGDYRNDTVITVTA  424

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GC+I VGDLV+ P ++G TVWEIGIPDRSAAEF+IP+P P   N L  +  ++FRQYGLW
Sbjct  425   GCEIDVGDLVYEPPRDGPTVWEIGIPDRSAAEFYIPDPNPKYINKLFINHPDRFRQYGLW  484

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY++L+   DLVY VG SD  KDWFFAQV RK   G+ E T W + F ++ V + G + 
Sbjct  485   ERYADLYPDGDLVYRVGLSDYKKDWFFAQVNRKKDDGTLEGTTWQIKFKLDDVDQSGAFK  544

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+A++  A LL+ +N DPK D   F++   G DN IARHG+HGLY   + ++PG+ +
Sbjct  545   LRLALATANVAELLVRIN-DPKIDPPHFSTGEIGHDNTIARHGVHGLYRLYNVDVPGTTL  603

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+GEN ++L Q+    P  GIMYDYIRLE 
Sbjct  604   VEGENTVFLTQTPRTSPLQGIMYDYIRLEG  633



>emb|CBI19298.3| unnamed protein product [Vitis vinifera]
Length=656

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/641 (51%), Positives = 425/641 (66%), Gaps = 22/641 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP G V GI Y  +D NLLE+ N   +RGYWDL W+ P
Sbjct  6     VQLYIQDRHVVMDNGILQVTLSNPGGIVTGIRYSAID-NLLEVLNDETNRGYWDLVWSVP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
                A     I  T+F+VI+E E QVE+SF + +  S +   +P+NIDKRF+ML GSSGFY
Sbjct  65    G-SAGIFDVIKGTNFRVIVENEEQVEISFTRMWDPSLEGKLVPLNIDKRFIMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRS------------LFTHLAVTDEIQGEMPSYKE  903
             +YAIY+H K      L +TR+ FKL +             LF ++A+ D  Q  MP   +
Sbjct  124   SYAIYEHLKEWPAFTLAETRIAFKLRKDNTVLKGKMKKHRLFHYMAMADNRQRFMPLPDD  183

Query  904   R--EEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIIT  1077
             R    G+ L Y EAV L     P+ KG+VDDKYQY+ D+++  V+GW+  +P +GFW IT
Sbjct  184   RLPGRGQPLAYPEAVLLVNPVEPEFKGEVDDKYQYSCDNKDNRVHGWVCLEPPVGFWQIT  243

Query  1078  ASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS  1257
              S+EFR GGP+KQ+LT H GP  L+MF S HY+G+    K    E WK VFGPVFIY+NS
Sbjct  244   PSDEFRTGGPVKQNLTSHVGPTTLAMFHSAHYAGEPLVPKFGPDEPWKKVFGPVFIYVNS  303

Query  1258  DKGT-DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDT  1434
               G  D   LWE AK+QM  E + WPYSFP SED+P + QRG VSGRLL+ D        
Sbjct  304   VFGDGDPFWLWEDAKEQMTIEVQSWPYSFPASEDFPSSDQRGNVSGRLLVQDGYISDDYI  363

Query  1435  PAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDF  1614
              A CA+VGLA PG+ GSWQ +   YQFWT+ D  G F I+ +R G+Y+LYAWVPG +GD+
Sbjct  364   LASCAYVGLAPPGDVGSWQRECKDYQFWTQADLGGYFCINDIRPGDYNLYAWVPGFIGDY  423

Query  1615  KHKADITIKP-GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD  1791
             K  A ITI P GCD+ VGDL++ P ++G T+WEIGIPDRSAAEF+ P+P P   N L   
Sbjct  424   KLDAVITITPAGCDVFVGDLLYEPPRDGPTLWEIGIPDRSAAEFYSPDPNPTYVNKLFIG  483

Query  1792  RTEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFP  1968
               ++FRQYGLW+RY+EL+   DLVYT+G SD  KDWFFAQVTRK    +Y+ T W + F 
Sbjct  484   HPDRFRQYGLWERYAELYPDGDLVYTIGVSDYTKDWFFAQVTRKKDNNTYQGTTWQIKFT  543

Query  1969  IETVAK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYS  2145
             ++TV + G Y LR+A+AS+T + L + VN DPK +   FTS L G+DN IARHGIHGLY 
Sbjct  544   LDTVDQIGTYKLRVAIASATLSELQVRVN-DPKANPPHFTSGLIGRDNTIARHGIHGLYW  602

Query  2146  EVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
               S  + G+L+V+GEN ++L Q ++  PF GI+YDYIRLE 
Sbjct  603   LYSVNVLGNLLVEGENTIFLTQPRSTSPFQGILYDYIRLEG  643



>ref|XP_008384665.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=675

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/624 (50%), Positives = 420/624 (67%), Gaps = 7/624 (1%)
 Frame = +1

Query  409   LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKE  588
             LT TK  V++DNGI+++NLS P G V GI Y+G+  NLLE  N I +RGYWD+ WN    
Sbjct  51    LTKTKNQVVIDNGIVRLNLSYPGGDVIGINYKGIK-NLLETKNAIDNRGYWDVVWNRDGG  109

Query  589   KASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTY  765
             K     K+  T F+VI E+  Q+E+SF KTY  S     +P+N+DKR+++  G  GFY Y
Sbjct  110   KDVVD-KLQGTGFRVITERADQIEISFTKTYNVSLGNATLPMNVDKRYIVQRGRDGFYAY  168

Query  766   AIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVK  945
             AI++  KG    ++DQ R V+KL +  F  +A++D  +  MP+ ++R  G+ L Y EAV 
Sbjct  169   AIFERLKGWPRTNVDQIRFVYKLQQDKFPFMAISDNRKRVMPTARDRANGKPLAYPEAVL  228

Query  946   LTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLT  1125
             LTKT NP L+G+VDDKYQY+ + ++  V+GWI  +P +GFWIIT+S+EFR  GP KQDLT
Sbjct  229   LTKTSNPDLRGEVDDKYQYSTEDKDNKVHGWICNEPPVGFWIITSSDEFRTAGPFKQDLT  288

Query  1126  CHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKK  1302
              H GP  LSMF S HY G + G+  + GEAW  VFGPVF+Y+NS + +++   LWE AK+
Sbjct  289   SHAGPTVLSMFASTHYGGKEVGMTFKDGEAWXKVFGPVFVYLNSVRSSNNSLRLWENAKE  348

Query  1303  QMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPG  1482
             QMLEE K WPY+F +SED+P + +RG+V+G+LLI D    ++   A   +VGLA PG  G
Sbjct  349   QMLEEVKRWPYNFTQSEDFPSSDKRGSVAGQLLIQDQYINESLVWASSXYVGLAAPGNVG  408

Query  1483  SWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKV  1662
             SWQ +S  YQFWT+T+  G F I  VR G YSLYA VPG +GD+K++  I IKP   I +
Sbjct  409   SWQKESKGYQFWTQTNKQGYFLIKDVRPGNYSLYATVPGVVGDYKYETIIKIKPRRGINL  468

Query  1663  GDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSEL  1842
             G++ + P +NG T+WEIGIPDRSAAEF +P+P+P L+N L ++ T+KFRQYGLWDRY++L
Sbjct  469   GNITYVPPRNGPTLWEIGIPDRSAAEFNVPDPSPTLRNQLYTNHTDKFRQYGLWDRYTDL  528

Query  1843  HKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVA  2016
             +   DL+YTVG  D    WFFA VTR     +YEAT W ++F ++ +   G YTL++A+A
Sbjct  529   YPNHDLIYTVGADDYHDKWFFAHVTRNTGNNTYEATTWRILFQLKNLTTTGNYTLQLALA  588

Query  2017  SSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             S+  A + +  N    K    FT+ L GKDNAIARHGIHGLY   S  +P   + +G N 
Sbjct  589   SANNAEVQVRFNNQSAK-PPHFTTGLIGKDNAIARHGIHGLYWLFSIIVPSYRLQEGNNS  647

Query  2197  LYLRQSKAGYPFYGIMYDYIRLEA  2268
             ++L QS+    F G+MYDYIRLE 
Sbjct  648   IFLTQSRRLGSFDGVMYDYIRLEG  671



>ref|XP_009397844.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=618

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/617 (50%), Positives = 418/617 (68%), Gaps = 7/617 (1%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI+++ LS P GS+ G+ + GV  NLLE+ N+   RGYWD+ WN     +     IL
Sbjct  1     MDNGIVQLTLSKPRGSITGVKHHGVG-NLLEVKNREDGRGYWDVVWNRSDPDSGIFDIIL  59

Query  616   ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
              T+F V+ +  +QVEVSF+  +  S     +P+N+DKRFVML GSSGFYTYAIY+H +G 
Sbjct  60    GTEFDVVQQDANQVEVSFRTQWNPSHGGKLVPLNVDKRFVMLRGSSGFYTYAIYEHLQGW  119

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYKEAVKLTKTENP  966
              D +L +TRV FKL +  F ++A+ D  Q  MP  ++R+ G  + L+Y EAV+LT   N 
Sbjct  120   PDFNLAETRVAFKLRKDRFHYMAIADNRQRIMPMPEDRQPGRSQKLDYSEAVRLTNPINA  179

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
              L+G+VDDKYQY++++++  V+GWIS  P +GFW+IT S EF+ GGP+KQDLT H GP A
Sbjct  180   ALRGEVDDKYQYSIENKDSMVHGWISSDPSVGFWVITPSIEFKSGGPVKQDLTSHVGPTA  239

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETK  1323
             L+ F+S HY+GDD   ++R GE WK VFGPVFIY+NS    +D K LWE AKKQ   E  
Sbjct  240   LATFVSSHYAGDDILPRVRNGEYWKKVFGPVFIYLNSASTKSDPKLLWEDAKKQARVEEG  299

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY FP S+D+ K  QRG+VSGRL + D            A VGLA PGE GSWQ +S 
Sbjct  300   SWPYKFPASKDFQKREQRGSVSGRLFVVDEYVAFHYVNGNAAFVGLASPGEAGSWQRESK  359

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFW R D  G F I  VR G Y+LYAWVPG +GD+K   +IT+  G  I +G+L + P
Sbjct  360   GYQFWVRADAKGMFFIKNVRTGVYNLYAWVPGFIGDYKSSVNITVTSGNHINLGNLEYRP  419

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-DLV  1860
              ++G T+WEIGIPDRSAAEFF+P+P P   N L  +  ++FRQYGLW+RY++L+   DL+
Sbjct  420   PRDGPTLWEIGIPDRSAAEFFVPDPYPCYINRLYVNHPDRFRQYGLWERYTDLYPDHDLM  479

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRATL  2037
             YTVG S+  KDWF+A VTRK+ + SY+AT W + F +  V + G Y LR+A+AS+  + +
Sbjct  480   YTVGISNYKKDWFYAHVTRKHGQASYQATTWQIKFRLNNVRRSGTYKLRLALASAVFSEI  539

Query  2038  LIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSK  2217
              +  N    +  A FT++L G+DN+IARHGIHGLY   S ++  S ++KG+N ++L Q++
Sbjct  540   QVRFNNPIVQQPAHFTTELIGRDNSIARHGIHGLYWLFSIDVDSSWLLKGDNIIFLTQTR  599

Query  2218  AGYPFYGIMYDYIRLEA  2268
             +  PF G+MYDYIRLEA
Sbjct  600   SESPFQGVMYDYIRLEA  616



>ref|XP_010935407.1| PREDICTED: rhamnogalacturonate lyase B-like [Elaeis guineensis]
Length=701

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/629 (51%), Positives = 425/629 (68%), Gaps = 12/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V    V++DN I+++NLSNP G V G+ Y G+D NL++  ++    GYWD+ W   
Sbjct  74    VRLIVQDGCVIIDNNILQLNLSNPGGIVMGVRYNGID-NLMKADDEENSGGYWDIIWGG-  131

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
              E      +I  T+F +I++ E QVEVSFK+ +  S ++T +P+NIDKRFVML GSSGFY
Sbjct  132   TEVFGVFDRIKETEFTIILQSEEQVEVSFKRIWTPSHNETLVPLNIDKRFVMLRGSSGFY  191

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             TYAI +H  G  D  + + R  FKL +  F ++A++D  Q  MP   +R  E  + L Y 
Sbjct  192   TYAILEHQDGWPDFGIGEMRAAFKLRKDKFHYMAMSDTRQRIMPMPDDRMSERSQQLAYP  251

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV LT   NP+LKG+VDDKYQY+ + Q+  V+GWIS  P +GFW+IT S+EFR GGP+K
Sbjct  252   EAVLLTNPINPELKGEVDDKYQYSCEDQDNKVHGWISSDPPIGFWLITPSDEFRTGGPMK  311

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWE  1290
             QDLT H GP  L+MF+S HY G+    K R GE WK VFGPVF+Y+NS   G D KTLW+
Sbjct  312   QDLTSHVGPTTLAMFISSHYHGE--SPKFRNGEYWKKVFGPVFLYLNSASNGEDPKTLWQ  369

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM  E + WPYSFP SED+ K++QRG+VSG+LL+ D      D  A  A+VGLA P
Sbjct  370   DAKMQMQREVESWPYSFPVSEDFQKSSQRGSVSGKLLVRDRYIHGDDIYANGAYVGLALP  429

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ +S  YQFWTR D+ G F I+ VR G+Y+LYAWVPG +GD+++ A ITI  G 
Sbjct  430   GEAGSWQRESKGYQFWTRADENGSFTITNVRTGDYNLYAWVPGFIGDYRYNATITITSGN  489

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWD  1827
              I +G LV+ P ++G T+WEIGIPDRSAAEF+IPEP P   N L ++D  ++FRQYGLW+
Sbjct  490   IIDLGPLVYEPPRDGVTLWEIGIPDRSAAEFYIPEPNPKYVNRLYVNDPADRFRQYGLWE  549

Query  1828  RYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTL  2001
             RY +L+  +DLVYT+GKSD  +DWFFAQVTRK  +  Y+ T W + F +++V +   Y L
Sbjct  550   RYVDLYPYSDLVYTIGKSDYEEDWFFAQVTRKIDEKLYQPTTWQIKFHLDSVNQSKSYKL  609

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS   + L +  N + K D   FT+   G+DNAIARHGIHGLY      +    +V
Sbjct  610   RVALASVAHSKLQVRFN-NLKADPTHFTANPNGRDNAIARHGIHGLYWLYDITVSNIWLV  668

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N +++ Q  +  PF GIMYDYIR+E 
Sbjct  669   QGDNTIFITQPMSQSPFSGIMYDYIRMEG  697



>gb|AAS99719.1| At2g22620 [Arabidopsis thaliana]
 dbj|BAD43911.1| unknown protein [Arabidopsis thaliana]
Length=677

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/623 (50%), Positives = 418/623 (67%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V  + V++DNGI++V  SNPEG + GI Y G+D+    L +KI DRGYWD+ W  P++K 
Sbjct  57    VGHDTVVVDNGIVQVTFSNPEGLITGIKYHGIDN---VLDDKIDDRGYWDVVWYEPEKKQ  113

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
              T  K+  T F++I + E Q+E+SF +T+  S   + +P+N+DKR+++  G SG Y Y I
Sbjct  114   KTD-KLEGTKFEIITQNEEQIEISFTRTWTISRRGSLVPLNVDKRYIIRSGVSGLYMYGI  172

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+D  R+VFKL+   F  +A++D+ +  MPS  +RE  + L YKEAV LT
Sbjct  173   LERLEGWPDVDMDPIRIVFKLNPKKFDFMAISDDRRRSMPSMADRENSKSLAYKEAVLLT  232

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
                NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  233   NPSNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  292

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPV  Y+NS    D    LW  AK+QM
Sbjct  293   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLAYLNSVSPKDSTLRLWRDAKRQM  352

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E K WPY F  SEDYP   QRG + G+ LI D    +     K A VGLA  GE GSW
Sbjct  353   AAEVKSWPYDFITSEDYPLRHQRGTLEGQFLIKDSYVSRLKIYGKFAFVGLAPIGEAGSW  412

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG ++ VG 
Sbjct  413   QTESKGYQFWTKADRRGRFIIENVRAGNYSLYAWGSGFIGDYKYEQNITITPGSEMNVGP  472

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             LV+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  473   LVYEPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  532

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYT+G SD   DWFFA V R     +Y+ T W ++F ++ V + G YTLRIA+AS
Sbjct  533   PQNDLVYTIGVSDYRSDWFFAHVARNVGNDTYQPTTWQIIFNLKNVNRIGRYTLRIALAS  592

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L I +N DPK D A FT+   GKDNAIARHGIHGLY   S ++ G+L+  G+N +
Sbjct  593   AADSELQIRIN-DPKSD-AIFTTGFIGKDNAIARHGIHGLYRLYSIDVAGNLLSVGDNTI  650

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             +L Q+++  PF GIMY YIRLE+
Sbjct  651   FLTQTRSRTPFQGIMYGYIRLES  673



>ref|XP_010544055.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Tarenaya 
hassleriana]
Length=642

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/637 (51%), Positives = 425/637 (67%), Gaps = 23/637 (4%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             ++L V    V M+NGI++V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     LQLQVKDNHVTMNNGILQVTLSKPDGIVTGIQYNGLD-NLLEVRNEESNRGYWDLVWS--  62

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
                 + +F ++  T FKVI+EKE Q+E+SF +T+  S +   +P+NIDKRFVML GSSGF
Sbjct  63    GSGTTGAFDVIRGTSFKVIVEKEEQIELSFTRTWDPSQEGKAVPLNIDKRFVMLRGSSGF  122

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             YTYAIY+H +      + +TR+ FKL +  F ++A+ D  Q  MP   +R  + G+ L Y
Sbjct  123   YTYAIYEHSEQWPAFSMAETRIAFKLRKDKFHYMAIADNRQRFMPLPDDRLQDRGQALAY  182

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWIS-PKPHLGFWIITASNEFRLGGP  1107
              EAV L     P+  G+VDDKYQY+ +++++ V+GWIS  +P +GFW+IT S EFR GGP
Sbjct  183   PEAVLLVNPIEPEFTGEVDDKYQYSCENKDILVHGWISTEQPLVGFWLITPSQEFRTGGP  242

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLW  1287
              KQ+LT H GP +L++F S HYSGDD   K   GE WK VFGPVFIY+NS    D   LW
Sbjct  243   HKQNLTSHVGPTSLAVFSSAHYSGDDLVPKFGVGEQWKKVFGPVFIYLNSSTDDDDDPLW  302

Query  1288  EG--AKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
                 AK Q + E + WPY FP SED+ KA QRG V GRLL+ D    +   PA   +VGL
Sbjct  303   LWDDAKSQTVAEVESWPYDFPASEDFVKADQRGNVVGRLLVRDRYLEEGLIPANRGYVGL  362

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG PGSWQ +   YQFWT +D+ G F IS +R G+Y+LYAWVPG +GDFK++  ITI 
Sbjct  363   APPGAPGSWQRECKEYQFWTTSDEEGFFYISGIRPGQYNLYAWVPGFIGDFKYEEIITIT  422

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC I V D+V+ P +NG T+WEIGIPDRSAAEF++P+P+P   N L  +  ++FRQYGL
Sbjct  423   PGCYIYVEDVVYQPPRNGPTLWEIGIPDRSAAEFYVPDPSPKYINRLYVNHPDRFRQYGL  482

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W+RYSE++   DLVYT+G SD  +DWFFAQVTRK    +Y+ T W + F +E+V K   Y
Sbjct  483   WERYSEMYPDGDLVYTIGTSDYGRDWFFAQVTRKKDNKTYQGTTWQIKFKLESVDKANSY  542

Query  1996  TLRIAVASSTRATLLIWV------NGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSF  2157
             TLR+A+AS+T + L +        NG P      FTS L GKDN+IARHGIHGLY   S 
Sbjct  543   TLRVAIASATLSELQVRTIRVNDANGSP-----LFTSGLIGKDNSIARHGIHGLYWLFSI  597

Query  2158  EIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             E+PGS  V+G N  +  Q ++  PF GIMYDYIRLE 
Sbjct  598   EVPGSKFVEGVNTFFFTQPRSTSPFQGIMYDYIRLEG  634



>ref|XP_004143542.1| PREDICTED: rhamnogalacturonate lyase B-like [Cucumis sativus]
 ref|XP_004160152.1| PREDICTED: rhamnogalacturonate lyase B-like [Cucumis sativus]
 gb|KGN48684.1| hypothetical protein Csa_6G497340 [Cucumis sativus]
Length=673

 Score =   619 bits (1595),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 415/623 (67%), Gaps = 14/623 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V++DNGI++V LS P+G V  + Y G+D NLLE+ N   +RGYWD+ WN P  KAS + +
Sbjct  51    VIIDNGIVRVTLSRPDGDVIALKYNGID-NLLEIRNVQSNRGYWDVVWNRPN-KASATDR  108

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
             ++AT+FKVI     QVE+SF KT+   D + +P NIDKR+++  G SGFY+Y I++   G
Sbjct  109   VIATNFKVITSNSDQVELSFAKTWDPSDPSSLPSNIDKRYILRRGDSGFYSYGIFERLNG  168

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPK  969
                +++DQ R+ +KL    F ++A++D  Q  MP+ ++R  G+ L+Y EAV LT+  +P 
Sbjct  169   WPQIEVDQIRIAYKLLGDKFHYMAISDNRQRMMPTAEDRLTGKPLDYPEAVLLTRPRDPS  228

Query  970   LKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFAL  1149
              +G+VDDKYQY+L++    V+GW S  PH+GFW+IT S+EFR  GP+KQDLT H GP  L
Sbjct  229   FRGEVDDKYQYSLENMENKVHGWESSDPHVGFWMITPSDEFRTAGPVKQDLTSHVGPVTL  288

Query  1150  SMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK--TLWEGAKKQMLEETK  1323
             SMF+S HY+G D  ++ + GEAWK VFGPVF YINSD     K  +LW+ AK QM  ET 
Sbjct  289   SMFVSTHYAGKDVSMRFQEGEAWKKVFGPVFTYINSDPTGTGKPGSLWDDAKNQMRIETS  348

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY+F +S ++P + QRG++SG+LL+ D  A         A+VGLA PGE GSWQ +S 
Sbjct  349   KWPYNFVESTEFPSSEQRGSLSGQLLVRDGFAKYPQMWGDSAYVGLAAPGELGSWQRESK  408

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWTR DD G F I  +R+G Y+LYAWVPG LGD+K+   ITI P     +  LVF P
Sbjct  409   GYQFWTRADDHGYFSIDNIRSGTYNLYAWVPGVLGDYKYDNQITITPRSSTNLNLLVFHP  468

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-----RTEKFRQYGLWDRYSELH-  1845
              + G T+WEIGIPDR AAEF+IP P P L N   +D     + + FRQYGLW+RY+EL+ 
Sbjct  469   PRQGPTLWEIGIPDRKAAEFYIPSPRPTLTNCFYNDSKLHIQDDNFRQYGLWERYAELYP  528

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASS  2022
               DLVY V   D  ++WF+A VTR    G+YEAT W +VF I+   + G Y LR+A+ASS
Sbjct  529   HGDLVYNVDTDDYHRNWFYAHVTRATGSGTYEATTWQIVFHIQRPKQIGNYMLRLALASS  588

Query  2023  TRATLLIWVNGDPKKDKAKFTSKL--GGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             T A + I  N +P   +  FT+     GKDNAIARHGIHGL+   +F++P  L+V+G+N 
Sbjct  589   TDAVIDIRFN-NPSTKQPHFTTGYWSSGKDNAIARHGIHGLHWLFNFQVPSQLLVEGQNV  647

Query  2197  LYLRQSKAGYPFYGIMYDYIRLE  2265
             +YL Q +    F G+MYDYIR E
Sbjct  648   IYLTQRRHTGEFQGVMYDYIRFE  670



>emb|CDX89492.1| BnaC04g35110D [Brassica napus]
Length=654

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/619 (49%), Positives = 421/619 (68%), Gaps = 9/619 (1%)
 Frame = +1

Query  427   MVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF  606
             +V++DNGI++V  S+P+GS+ GI Y G+D N+L+     + RGYWD+ W  P++K  T  
Sbjct  36    LVVVDNGIVQVTFSSPQGSITGIKYDGID-NVLDDEVDERRRGYWDVAWYEPEKKFKTD-  93

Query  607   KILATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
             K+  T F++I + E QVE+SF +T+    + + +P+N+DKR+++  G SG Y Y I +  
Sbjct  94    KLEGTRFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRYIIRSGVSGIYIYCIMERL  153

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTEN  963
             +G  DVD+DQ R+VFKL+ ++F  +A++D+ Q  MPS  +R     L YKEAV LT   N
Sbjct  154   EGWPDVDMDQIRIVFKLNHTIFNFMAISDDRQRSMPSMADRNHAMQLAYKEAVLLTNPRN  213

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPF  1143
             P  KG+VDDKY Y+++ ++ +V+GWIS +P +GFW+IT S+EFRLGGP+KQDLT H  P 
Sbjct  214   PMFKGEVDDKYMYSMEDKDNNVHGWISSEPPVGFWMITPSDEFRLGGPIKQDLTSHARPI  273

Query  1144  ALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEET  1320
              LSMF S HY+G +  +  R GE WK VFGPV  Y+NS         LW  AK+QM EE 
Sbjct  274   TLSMFTSTHYAGKEMRMGYRNGEPWKKVFGPVLAYLNSVSPNASTLRLWRDAKRQMAEEV  333

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDS  1500
             K WP+ F  SEDYP + QRG + G+  I D    + +   K A VGLA  GE GSWQ +S
Sbjct  334   KSWPFDFVHSEDYPLSNQRGTIQGQFYIKDSYVSRLNIYGKFAFVGLAPVGEAGSWQTES  393

Query  1501  MSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFT  1680
               YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +ITI PG ++ VG +V+ 
Sbjct  394   KGYQFWTKADRKGRFVIENVRAGNYSLYAWGIGFIGDYKYEQNITITPGTEMNVGPIVYE  453

Query  1681  PLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH-KTD  1854
             P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWD YS+L+ + D
Sbjct  454   PPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNNLYVNPLQDRFRQYGLWDCYSDLYPEND  513

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRA  2031
             LVYT+G S+  +DWFFA VTR     +Y+ T W ++F ++ + + G YTLR+A+AS+  +
Sbjct  514   LVYTIGLSNYRRDWFFAHVTRNVGNNTYQPTTWQIIFNLQNLNRVGLYTLRVALASAADS  573

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L + +N DP+ D   FT+ L GKDNAIARHGIHGLY   S ++ G+L+  G+N +YL Q
Sbjct  574   ELQVRIN-DPESDHI-FTTGLIGKDNAIARHGIHGLYRLYSIDVAGNLLGAGDNTIYLTQ  631

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             S++  PF G+MYDYIRLE+
Sbjct  632   SRSTTPFQGVMYDYIRLES  650



>ref|XP_010023418.1| PREDICTED: uncharacterized protein LOC104414097 [Eucalyptus grandis]
Length=676

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/631 (50%), Positives = 419/631 (66%), Gaps = 16/631 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V    V+ DNGI+++  SNP+G V GI + G+D NLLE  NK  DRGYWD+ WN P
Sbjct  48    VQLKVQNNQVVTDNGIVEITFSNPDGMVTGIKFNGID-NLLEARNKEADRGYWDIVWNRP  106

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSGFY  759
             +E AS   +I  T FKV+   +  VE+SF  ++ +  ++ + P+ IDKRFV+  GSSGFY
Sbjct  107   EE-ASMFTRIEGTTFKVVANTDDIVELSFVSSWSNSSESYLAPLIIDKRFVVRRGSSGFY  165

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEA  939
              YAI++HPKG  D+D+ + R+ FKL+   F ++A++DE Q  MP+ ++R  G VL+YKEA
Sbjct  166   GYAIFNHPKGWPDLDIGEARIAFKLNGQKFRYMAISDERQRVMPTDEDRASGRVLDYKEA  225

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT   N +L+G+VDDKYQY+ ++Q   V+GWIS  P +GFW+IT S+E    GP+KQD
Sbjct  226   VLLTGPSNSELEGEVDDKYQYSCENQENKVHGWISSDPPVGFWMITPSDESHTAGPVKQD  285

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGA  1296
             LT H GP  L++F S HY+G D  +  R GEAWK V+GP  +Y+NS     D   LW  A
Sbjct  286   LTSHVGPTTLNVFYSNHYAGKDVSMSFRNGEAWKKVYGPFMVYVNSVSPEEDQSKLWADA  345

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             K QML ET  WPY F  S+DYP AA RG VSG+L + D      D  A  A+VGLA PGE
Sbjct  346   KGQMLMETASWPYDFISSDDYPSAAGRGTVSGQLSVRDRYMANRDMAAGSAYVGLAAPGE  405

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ ++  YQFWTR ++ G FEI  VR G Y LYAWVPG +GD+K+  ++ +KPG +I
Sbjct  406   VGSWQTNTKGYQFWTRANENGSFEIKNVRPGIYGLYAWVPGFIGDYKYHLNVMVKPGSEI  465

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRT-EKFRQYGLWDRY  1833
             +V  LVF+P ++G T+WEIGIPDR+AAEF++P P P   N L  +   E+FRQYGLWDRY
Sbjct  466   QVDPLVFSPPRSGPTLWEIGIPDRTAAEFYVPLPNPRFMNNLFKNGIGERFRQYGLWDRY  525

Query  1834  SELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYTLRI  2007
             SEL+ K DLVYTVG  +  +DWFFA VTRK    +Y  T W + F ++ V  +G Y L++
Sbjct  526   SELYPKNDLVYTVGVDNYHRDWFFAHVTRKTGNSTYVPTTWRIDFHLQNVNFRGTYRLQM  585

Query  2008  AVASSTRATLLIWVNG---DPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             AVAS+T + + I VN     P     +F     G DNAIARHGIHGLY    F++PGS +
Sbjct  586   AVASATLSRISIGVNNLSQQPPSSTGRF-----GNDNAIARHGIHGLYWTFGFDVPGSRL  640

Query  2179  VKGENKLYLRQ-SKAGYPFYGIMYDYIRLEA  2268
              +G N +YL Q S A  PF G+MYDYIR E+
Sbjct  641   RRGTNSIYLAQSSSARTPFEGVMYDYIRFES  671



>ref|XP_010249437.1| PREDICTED: probable rhamnogalacturonate lyase B [Nelumbo nucifera]
Length=616

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/617 (50%), Positives = 419/617 (68%), Gaps = 12/617 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V LSNP G V GI Y G++ N+LE+ N+  +RGYWD+DW+ P  +    + I 
Sbjct  1     MDNGIVRVTLSNPGGVVTGINYGGIN-NILEVRNRETNRGYWDVDWDEPGGRGQ-QYVIQ  58

Query  616   ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
             AT+FKVI++ E++VEVSF + ++    +  +P+NIDKRFVML GS GFYTYAI++H  G 
Sbjct  59    ATEFKVIVQNETRVEVSFSRKWEPSSGSGLVPLNIDKRFVMLRGSHGFYTYAIFEHLNGW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTENP  966
              D DL   R VFKL    F ++A++D  Q  MPS  +R  +  E L YKEAV+LT    P
Sbjct  119   PDFDLGVARTVFKLRGDKFHYMAISDSRQRHMPSQDDRSPQRAEPLAYKEAVRLTNPGEP  178

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
             + +G+VDDKYQY+ + +++ V+GWIS +P +GFW+IT SNEFR GGPLKQ+LT H GP +
Sbjct  179   EFRGQVDDKYQYSSNREDIRVHGWISFEPPVGFWVITPSNEFRTGGPLKQELTSHVGPTS  238

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQMLEETK  1323
             L++++S HY G D     R GE WK VFGP+FIY+NS  +GT   +LWE AK QM  E +
Sbjct  239   LAVYISCHYMGTDILPMFRNGEPWKKVFGPIFIYLNSGPEGTKANSLWEDAKAQMRNEVQ  298

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPYSFP SED+PK+AQRG+V GRLL+ +    + D P   A+VGLA PGE GSWQ +  
Sbjct  299   SWPYSFPASEDFPKSAQRGSVIGRLLVREMFINREDMPGSSAYVGLALPGEAGSWQKEGK  358

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWT+ D  G F I  +RAG+Y+LYAWVPG +G++K+   I+++PG  + +G LV  P
Sbjct  359   GYQFWTKADSNGSFSIKNIRAGDYNLYAWVPGFIGEYKYPTVISVRPGGYVDLGTLVHEP  418

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLV  1860
              ++  T+WEIG+PDRSAAEFFIP+P     N L  ++ ++FRQYGLW++Y  ++   DL 
Sbjct  419   PRDAPTLWEIGVPDRSAAEFFIPDPDSRYVNPLYINQ-DRFRQYGLWEKYGLMYPDKDLA  477

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRATL  2037
             YTVG SD  KDWF+A VTR N  G+Y  T WT+ F +E V   G Y LR+A+AS+  A +
Sbjct  478   YTVGVSDYRKDWFYAHVTRNN-NGTYLPTTWTIHFRLENVVPGGIYKLRLAIASANFAEV  536

Query  2038  LIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSK  2217
              +  N      +  FT+   G+DN+IARH IHG YS  S ++  + + +G+N +YLRQ++
Sbjct  537   QVRFND--MVVRPHFTTGRIGRDNSIARHAIHGFYSFYSVDVESNWLRQGDNTIYLRQAR  594

Query  2218  AGYPFYGIMYDYIRLEA  2268
                 F G+MYDYIR E 
Sbjct  595   GSTTFQGVMYDYIRFEG  611



>ref|XP_004974168.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Setaria italica]
Length=658

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/632 (50%), Positives = 419/632 (66%), Gaps = 8/632 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   V++ V+   V + NGI ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL 
Sbjct  25    ATDGVRVKVSNRYVEIKNGIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLV  83

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P +K      I  T+F++I   E+Q EVSF + +  S +   +P+NIDKRF++L GS
Sbjct  84    WNPPGQKTGIFDVIKGTEFRIIYHDENQAEVSFTRNWDPSLEGKAVPLNIDKRFIVLRGS  143

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H +G  D  L +TRV FKL +  F ++A+ D  Q  MP   +R    G+ 
Sbjct  144   SGFYTYGIYEHKEGWPDFGLGETRVAFKLRKDKFHYMALADNRQRIMPMPDDRLPPRGQP  203

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NP L+G+VDDKYQY+ + Q  +V+GW+S  P +GFW IT S+EFR G
Sbjct  204   LAYPEAVLLVDPINPDLRGEVDDKYQYSCEDQCNNVHGWMSFDPPIGFWQITPSDEFRTG  263

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GPLKQ+LT H GP  L+MFLS HY+GDD       GE WK V GPVF+Y+NS   G+D  
Sbjct  264   GPLKQNLTSHVGPTTLAMFLSAHYAGDDLSPVFTNGEYWKKVHGPVFMYLNSSWDGSDPT  323

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E + WPYSF  SED+ K  QRG +SGRLL+ D      D  A  A+VG
Sbjct  324   MLWEDAKVQMMIEKESWPYSFALSEDFQKTEQRGCISGRLLVRDRYIDDEDLYASGAYVG  383

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW R D  G F I ++  G Y+LYAWVPG +GD++  A +TI
Sbjct  384   LALPGEVGSWQRECKGYQFWCRADVDGSFYIRSIVTGNYNLYAWVPGFIGDYRLDATLTI  443

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G DI +GDLV+ P ++G T+WEIG+PDRSAAEF++P+P P+  N L  +  ++FRQYG
Sbjct  444   ASGDDIYLGDLVYEPPRDGPTMWEIGVPDRSAAEFYVPDPNPNYINRLYINHPDRFRQYG  503

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-C  1992
             LW+RY+EL+  +DLVYT+G+SD + DWF+AQV RK    +Y+ T W + F +++V+ G  
Sbjct  504   LWERYAELYPDSDLVYTIGQSDYSTDWFYAQVNRKVDDNTYQPTTWQIKFTLDSVSPGST  563

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y  R+A+ASS RA L ++ N D  +    F + L G+DNAIARHGIHGLY   +  +  +
Sbjct  564   YKFRVALASSARAELQVFFN-DQNRGVPHFATGLIGRDNAIARHGIHGLYWLFNINVDSA  622

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+G N +YL+Q +   PF G+MYDY+RLE 
Sbjct  623   WLVQGMNTIYLKQPRNQSPFQGLMYDYLRLEG  654



>gb|AES73961.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=652

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/628 (51%), Positives = 421/628 (67%), Gaps = 9/628 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L + +  V+MDNGI++V LSNP+G V GI Y GVD NLLE+ NK  +RGYWDL W+ P
Sbjct  24    VRLHIQQNYVVMDNGIVQVTLSNPDGIVTGIRYNGVD-NLLEVLNKETNRGYWDLVWSAP  82

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T F+VI++ E QVE+SFK+T+  S +   +P+NIDKRF++L GSSGFY
Sbjct  83    GSKGIFDV-IKGTCFEVIVQNEDQVELSFKRTWDPSLEGKFVPLNIDKRFILLRGSSGFY  141

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV--LNYK  933
             +Y IY+H     D D+ +TR+ FKL +  F ++A+ D+ +  MP  ++R  G    L Y+
Sbjct  142   SYGIYEHLPRWPDFDISETRITFKLRKDKFQYMAMADDRRRIMPFPEDRLPGRCQPLAYQ  201

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   ++P+LKG+VDDKYQY+  + +  V+GWIS  P +GFW IT S+EFR GGPLK
Sbjct  202   EAVLLVNPKDPQLKGEVDDKYQYSCKNIDNRVHGWISFNPPVGFWQITPSDEFRSGGPLK  261

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWE  1290
             Q+LT H GP  L+MFLS HY+G D   K+RGGE WK VFGPV+IY+NS   G D   LWE
Sbjct  262   QNLTSHVGPTTLAMFLSGHYAGQDLVPKIRGGEPWKKVFGPVYIYLNSGPTGYDPLWLWE  321

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK +M+ E + WPY FP SED+ K  QRG VSGRLL+ D         A  A+VGLA P
Sbjct  322   DAKIKMMTEVQSWPYLFPASEDFLKPDQRGNVSGRLLVLDRYISTDLISANGAYVGLAPP  381

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWTR D  G F I+ VR G+Y+L+AWVPG +GD++    + I  G 
Sbjct  382   GDAGSWQRECKDYQFWTRADMNGFFTINNVRPGDYNLFAWVPGFIGDYRFGDFVKITSGS  441

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I++G+LV+ P ++G T+WEIGIPDRSAAEF+ P+P P   N L  +  ++FRQYGLWDR
Sbjct  442   YIELGELVYEPPRDGPTLWEIGIPDRSAAEFYAPDPNPQHINKLFINHPDRFRQYGLWDR  501

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGC-YTLR  2004
             Y+EL+   DLVYT+G SD  KDWF+AQV RK A  + E T W + F +  V +G  Y LR
Sbjct  502   YTELYPDADLVYTIGVSDYRKDWFYAQVPRKKADNTLEGTTWQIKFELSGVIQGATYKLR  561

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L I VN DP   +  FT+ L G++N+IAR GIHGLY      IP SL++ 
Sbjct  562   VAIASATLAELQIRVN-DPNARRPVFTTGLIGRENSIARLGIHGLYWLYHVNIPSSLLID  620

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G N ++  Q +   PF G MYDYIRLE 
Sbjct  621   GTNTIFFTQPRCTSPFQGFMYDYIRLEG  648



>ref|XP_006660373.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Oryza brachyantha]
Length=648

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/632 (49%), Positives = 419/632 (66%), Gaps = 8/632 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   V++ V+   V + NGI ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL 
Sbjct  15    ATTGVRVKVSDRYVEIKNGIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLV  73

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             W+   E+      I  T+F++I + E+Q EVSF +T+  S +   +P+NIDKRF++L G 
Sbjct  74    WSPLGERTGIFDVIKGTEFRIIYQDENQAEVSFVRTWDPSLEGKAVPLNIDKRFIVLRGC  133

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H +G     + +TRV FKL +  F ++A+ D+ Q  MP  ++R    G+ 
Sbjct  134   SGFYTYGIYEHQEGWPGFSMGETRVAFKLRKDKFRYMALADDRQRIMPMPEDRVPPRGQQ  193

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NP L+G+VDDKYQY+ + Q  +V+GWIS  P +GFW IT S+EFR G
Sbjct  194   LAYPEAVLLVDPINPDLRGEVDDKYQYSCEDQYNNVHGWISFNPAIGFWQITPSDEFRTG  253

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GP+KQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS   G+D  
Sbjct  254   GPVKQNLTSHVGPTMLAMFLSGHYAGDDLSPKFMNGEYWKKVHGPVFMYLNSSWDGSDPT  313

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E + WPY F  S+D+ K  QRG VSGRLL+ D      D  A  A+VG
Sbjct  314   LLWEDAKVQMMIEKESWPYCFALSDDFQKTEQRGCVSGRLLVRDRYLDDADLYATAAYVG  373

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG+ GSWQ +   YQFW R +D G F I  +  G+Y+LYAWVPG +GD+K  A ITI
Sbjct  374   LALPGDAGSWQRECKGYQFWCRAEDDGSFCIRNIVTGDYNLYAWVPGFIGDYKLDATITI  433

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G DI +GDLV+ P ++G T+WEIGIPDRSA EF++P+P P+  N L  +  ++FRQYG
Sbjct  434   SSGVDIYLGDLVYEPPRDGPTMWEIGIPDRSAFEFYVPDPNPNYINRLYINHPDRFRQYG  493

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGC  1992
             LW+RY+EL+  +DLVYT+G+SD   DWFFAQV R+  + +Y+ T W + F +++V     
Sbjct  494   LWERYAELYPDSDLVYTIGQSDYTTDWFFAQVNRRTDQNTYQPTTWQIKFNLDSVVPNST  553

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y  R+A+ASS  A L +  N DP +    FTS L G+DN IARHGIHGLY   + ++ G+
Sbjct  554   YKFRVALASSANAELQVRFN-DPDRSAPHFTSGLIGRDNGIARHGIHGLYWLFNIDVSGA  612

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+G N +YL+Q +   PF G+MYDY+R+E 
Sbjct  613   WLVQGMNTIYLKQPRNQSPFQGLMYDYLRMEG  644



>ref|XP_007208155.1| hypothetical protein PRUPE_ppa022021mg, partial [Prunus persica]
 gb|EMJ09354.1| hypothetical protein PRUPE_ppa022021mg, partial [Prunus persica]
Length=618

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/617 (50%), Positives = 418/617 (68%), Gaps = 7/617 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+++NG++++  S P G V GI Y+G+D NLL++ N+  +RGYWDL WN   EK     K
Sbjct  1     VVLNNGLVQLTFSYPGGDVIGIKYKGID-NLLDIKNQPSNRGYWDLVWNKRGEKGGVD-K  58

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             +  T FKV+     Q+E+SF KTY  S     +P+N+DKR++M  G SGFY YAI++  K
Sbjct  59    LQGTRFKVVRTTSDQIEISFTKTYSHSLGNASVPLNVDKRYIMQRGRSGFYAYAIFERLK  118

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G  +VD+DQ R+V+KL +  F ++A++D+ +  MP+  +R  G  L Y EAV LT   NP
Sbjct  119   GMPEVDMDQIRIVYKLQQDKFRYMAISDDRKRVMPTADDRANGLPLAYPEAVLLTNPSNP  178

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
               +G+VDDKYQY+ + ++  V+GWI   P +GFWIIT S+EFR  GP KQDLT H GP A
Sbjct  179   DFRGEVDDKYQYSSEDKDNKVHGWICKDPAVGFWIITPSDEFRTAGPFKQDLTSHVGPTA  238

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTD-HKTLWEGAKKQMLEETK  1323
             LSMF+S HY+G + G+  R GEAWK VFGPVFI++NS   ++ + TLWE AK+Q++EE +
Sbjct  239   LSMFVSTHYAGKEVGMTFRDGEAWKKVFGPVFIHLNSAPSSNEYLTLWENAKEQLVEEMQ  298

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY+F +S+D+  + QRG+V+G+LL+ D    K    A  A+VGLA PG  GSWQ +S 
Sbjct  299   RWPYNFTQSKDFLSSDQRGSVAGQLLVRDRYRNKRLIWASSAYVGLAAPGNAGSWQKESK  358

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWT+ +  G F I  VR G YSLYA VPG +GD+K++A+I I+PG +I + DL + P
Sbjct  359   GYQFWTQANKQGYFLIKDVRPGNYSLYATVPGFIGDYKYEANIIIQPGKEINLADLTYEP  418

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-DLV  1860
              +NG T+WEIGIPDRSAAEF +P+P+P L N L ++ T+KFRQYGLW+RYS+L+   DL+
Sbjct  419   PRNGPTLWEIGIPDRSAAEFNVPDPSPTLMNQLYTNHTDKFRQYGLWERYSDLYPNHDLI  478

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRATL  2037
             YTVG  +   DWFFA VTR     +YE T W + F +   A  G YTL++A+AS+T A +
Sbjct  479   YTVGTDNYPDDWFFAHVTRNTGNQTYEPTTWQIRFQLNKGANPGNYTLQLALASATNAEV  538

Query  2038  LIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSK  2217
              + VN D   +   FT+ L GKDNAIARHGIHGLY   S  +    + +G N +YL QS+
Sbjct  539   QVRVN-DWSANPPHFTTGLIGKDNAIARHGIHGLYWLFSVGLRNDRLQEGNNTIYLTQSR  597

Query  2218  AGYPFYGIMYDYIRLEA  2268
                 F GIMYDY+RLE 
Sbjct  598   HKTTFDGIMYDYLRLEG  614



>ref|XP_010235392.1| PREDICTED: probable rhamnogalacturonate lyase B [Brachypodium 
distachyon]
 ref|XP_010235393.1| PREDICTED: probable rhamnogalacturonate lyase B [Brachypodium 
distachyon]
Length=658

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/632 (50%), Positives = 416/632 (66%), Gaps = 8/632 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   VK+ VT   V + NGI  + LSNP+G V G+ Y GVD NL+E+ NK  +RGYWD+ 
Sbjct  25    AMDVVKVKVTDRYVEIKNGIFGLTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDVV  83

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P ++      I  T+F++I   ++Q EVSF +++  S +   +P+ IDKRF++L GS
Sbjct  84    WNPPGQRTGIFDVIKGTEFRIIYHDDNQAEVSFTRSWDPSLEGKAVPLIIDKRFIVLRGS  143

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H +G  D  L +TRV FKL +  F ++A+ D  Q  MP   +R    G+ 
Sbjct  144   SGFYTYGIYEHKEGWPDFGLGETRVAFKLRKDKFHYMAMADNRQRIMPMPDDRLPPRGQP  203

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NP+LKG+VDDKYQY+ + Q  +V+GWIS  P +GFW IT S+EFR G
Sbjct  204   LAYPEAVLLVDPINPELKGEVDDKYQYSCEDQYNNVHGWISSDPPIGFWQITPSDEFRTG  263

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GPLKQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS   G+D  
Sbjct  264   GPLKQNLTSHVGPTMLAMFLSAHYAGDDLSPKFTNGEYWKKVHGPVFLYLNSSWDGSDPS  323

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK Q + E + WPYSF  SED+ K  QRG VSGRLL+ D      D  A  A+VG
Sbjct  324   LLWEDAKVQTVIEKESWPYSFALSEDFQKTEQRGCVSGRLLVRDRYIDAEDLYATSAYVG  383

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW R D  G F I  +  G Y+LYAWVPG +GD+K  A +TI
Sbjct  384   LALPGEAGSWQRECKGYQFWCRADADGSFYIRNIVTGNYNLYAWVPGFIGDYKFSATLTI  443

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G DI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYG
Sbjct  444   SSGDDIYLGDLVYEPPRDGPTMWEIGIPDRSAAEFYVPDPNPNYVNRLFINHPDRFRQYG  503

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGC  1992
             LW+RY+EL+   DLVYT+G+SD   DWF+AQVTR+  + +Y+ T W + F ++ V     
Sbjct  504   LWERYAELYPDRDLVYTIGESDYRTDWFYAQVTRRTDENTYQPTTWQIRFDLDNVPPNST  563

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y  R+A+ASS  A L I  N D  +    F+S L G+DN IARHGIHGLY   + ++ G+
Sbjct  564   YKFRVALASSAIAELQIRFN-DQDRGAPHFSSGLIGRDNTIARHGIHGLYWLFTVDVSGA  622

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+G N +YL+Q ++  PF G+MYDY+RLE 
Sbjct  623   WLVQGMNTVYLKQPRSQSPFQGLMYDYLRLEG  654



>gb|KFK43288.1| hypothetical protein AALP_AA1G104600 [Arabis alpina]
Length=633

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/631 (50%), Positives = 426/631 (68%), Gaps = 14/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             +KL      V+MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+  
Sbjct  6     LKLQDKGNHVVMDNGIARVTLSKPDGIVTGIDYNGID-NLLEVLNEEPNRGYWDLVWS--  62

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
                 + +F ++  T+F+VIM+ E Q+E+SF + +  S +   +P+NIDKRFVML GSSGF
Sbjct  63    GSGTTGAFDVIKGTNFEVIMQNEEQIELSFTRKWDPSQEGKTVPLNIDKRFVMLRGSSGF  122

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             YTYAIY+H K      + +TR+ FKL ++ F ++A+TD+ Q  MP   +R  + G+ L Y
Sbjct  123   YTYAIYEHLKEWPAFSIAETRIAFKLRKAKFHYMAITDDRQRFMPLPDDRLPDRGQALAY  182

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGP  1107
              EAV L     P+ KG+VDDKYQY+ +++++ V+GWI + +P +GFW+IT S+E+R GGP
Sbjct  183   PEAVLLVNPIEPQFKGEVDDKYQYSCENKDIGVHGWICTEQPTVGFWLITPSHEYRTGGP  242

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKT  1281
              KQ+LT H GP +L++F+S HYSG+D   K   GEAWK VFGP+F+Y+NS  D   D   
Sbjct  243   QKQNLTSHVGPTSLAVFMSAHYSGEDLVPKFSEGEAWKKVFGPIFVYLNSSSDDDNDPLW  302

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LW+ AK QM  E + WPYSFP S+DY KA QRG V GRLL+ D    +    A   +VGL
Sbjct  303   LWKDAKSQMNVEVESWPYSFPASDDYLKAEQRGNVVGRLLVQDRYVDEDFIAANRGYVGL  362

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG  GSWQ +   YQFWTRTD+ G F IS +R G+Y+LYAW+PG +GD+K+   ITI 
Sbjct  363   ALPGAAGSWQRECKDYQFWTRTDEEGFFYISGIRPGQYNLYAWIPGFIGDYKYDDIITIT  422

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGC + V DLV+ P +NG T+WEIG PDRSA EF++P+P P   N L  +  ++FRQYGL
Sbjct  423   PGCYMYVEDLVYQPPRNGATLWEIGFPDRSAIEFYVPDPNPKYINKLYQNHPDRFRQYGL  482

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W+RY+EL+   DLVY VG SD  KDWF+AQVTRK    +Y+ T W + F ++ + K   Y
Sbjct  483   WERYAELYPDKDLVYVVGSSDYRKDWFYAQVTRKKDSKTYQPTTWQIKFELKNIDKNHTY  542

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+T A L I +N         FTS L G+DN+IARHGIHGLY   + E+ GS 
Sbjct  543   ILRVAIASATYAELQIRLND--VNASPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSK  600

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+G+N ++L Q +   PF GI+YDYIR EA
Sbjct  601   LVEGDNTMFLTQPRCTSPFQGIIYDYIRFEA  631



>ref|NP_172460.6| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
 gb|AEE28511.1| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
Length=617

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/620 (51%), Positives = 419/620 (68%), Gaps = 14/620 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W       +  F ++
Sbjct  1     MDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEEVNRGYWDLVWG--GSGTAGGFDVI  57

Query  616   -ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKG  789
               ++F+VI++ E Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H K 
Sbjct  58    KGSNFEVIVKNEEQIELSFTRKWDPSQEGKAVPLNIDKRFVMLSGSSGFYTYAIYEHLKE  117

Query  790   GVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTEN  963
                  L +TR+ FKL +  F ++AVTD+ Q  MP   +R  + G+ L Y EAV L     
Sbjct  118   WPAFSLAETRIAFKLRKEKFHYMAVTDDRQRFMPLPDDRLPDRGQALAYPEAVLLVNPLE  177

Query  964   PKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
              + KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H GP
Sbjct  178   SQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHVGP  237

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQMLE  1314
              AL++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM  
Sbjct  238   TALAVFISAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAKSQMNV  297

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             E + WPYSFP S+DY K  QRG V GRLL+ D    K    A   +VGLA PG  GSWQ 
Sbjct  298   EAESWPYSFPASDDYVKTEQRGNVVGRLLVQDRYVDKDFIAANRGYVGLAVPGAAGSWQR  357

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
             +   YQFWTRTD+ G F IS +R G+Y+LYAW+PG +GD+K+   ITI  GC I V DLV
Sbjct  358   ECKEYQFWTRTDEEGFFYISGIRPGQYNLYAWIPGFIGDYKYDDVITITSGCYIYVEDLV  417

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KT  1851
             + P +NG T+WEIG PDRSAAEF++P+P P   N L  +  ++FRQYGLW+RY+EL+   
Sbjct  418   YQPPRNGATLWEIGFPDRSAAEFYVPDPNPKYINNLYQNHPDRFRQYGLWERYAELYPDK  477

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTR  2028
             DLVY VG SD  KDWF+AQVTRK    +Y+ T W + F ++ + K   YTLR+A+AS+T 
Sbjct  478   DLVYVVGSSDYRKDWFYAQVTRKKDNKTYQGTTWQIKFELKNIDKNHSYTLRVAIASATF  537

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             + L I VN         FTS L G+DN+IARHGIHGLY   + E+ GS +++GEN L+L 
Sbjct  538   SELQIRVNN--ANASPMFTSGLIGRDNSIARHGIHGLYWLFNVEVAGSKLLEGENTLFLT  595

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q ++  PF GIMYDYIR EA
Sbjct  596   QPRSTSPFQGIMYDYIRFEA  615



>ref|XP_010429187.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Camelina 
sativa]
Length=677

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 416/623 (67%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+++ V++DNGII+V  S+P+G + GI Y G+D+    L ++I+DRGYWD+ W  P +K 
Sbjct  57    VSRDKVVIDNGIIQVTFSSPQGLITGIKYHGIDN---VLDDEIEDRGYWDVTWYEPGKKL  113

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  T F++I + E Q+E+SF +T+    + + +P+N+DKR+++  G SG Y Y I
Sbjct  114   EID-KLEGTKFEIITQNEEQIEISFTRTWTISKRGSLVPLNVDKRYIIRSGVSGIYMYGI  172

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+  + L YKEAV  T
Sbjct  173   LERLEGWPDVDMDQIRIVFKLNSKKFDFMAISDDRQRSMPSMADRDNAKQLAYKEAVLFT  232

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
                NP  KG+VDDKY Y+++ ++ +V+GWIS +P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  233   NPRNPMFKGEVDDKYMYSMEDKDNNVHGWISSEPPVGFWMITPSDEFRLGGPMKQDLTSH  292

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G D  +  R GE WK VFGPVF Y+NS    D    LW  AK+QM
Sbjct  293   AGPITLSMFTSTHYAGKDMRMDYRNGEPWKKVFGPVFAYLNSVSPKDSTLRLWRDAKRQM  352

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E K WPY F  S DYP   QRG + G+ LI D    +     + A VGLA  GE GSW
Sbjct  353   AAEVKSWPYDFVTSVDYPLRHQRGTIEGQFLIKDSYVSRLRIYGRFAFVGLAPIGEAGSW  412

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VR G YSLYAW  G +GD+K +  ITI PG  + VG 
Sbjct  413   QTESKGYQFWTKADRKGRFIIENVREGNYSLYAWGFGFIGDYKFEQSITITPGSLMNVGP  472

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             +V+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+
Sbjct  473   IVYEPPRNGPTLWEIGVPDRTAREFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLY  532

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYTVG SD  +DWFFA VTR     +Y+ T W ++F +  V + G YTLRIA+AS
Sbjct  533   PQNDLVYTVGVSDYRRDWFFAHVTRNVGNKTYQPTTWQIIFNLRNVNRVGLYTLRIALAS  592

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L I +N DPK D   FT+   GKDNAIARHGIHGLY   S ++  SL+  G+N +
Sbjct  593   AANSELQIRIN-DPKSDHI-FTTGFIGKDNAIARHGIHGLYRLYSIDVAVSLLNIGDNTI  650

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL QS++  PF GIMYDYIRLE+
Sbjct  651   YLTQSRSIGPFEGIMYDYIRLES  673



>ref|XP_006293793.1| hypothetical protein CARUB_v10022775mg [Capsella rubella]
 gb|EOA26691.1| hypothetical protein CARUB_v10022775mg [Capsella rubella]
Length=676

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/623 (49%), Positives = 419/623 (67%), Gaps = 11/623 (2%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ + V++DNGII+V  SNP+G + GI Y G+D+    L ++I+DRGYWD+ W  P +K 
Sbjct  56    VSHDKVVIDNGIIQVTFSNPQGLITGIRYHGIDN---VLDDEIEDRGYWDVTWYEPHKKL  112

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  + F++I + E QVE+SF +T+  S   + +P+N+DKR+++  G SG Y Y I
Sbjct  113   EID-KLEGSKFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRYIIRSGVSGIYMYGI  171

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLT  951
              +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+  + L YKEAV LT
Sbjct  172   LERLEGWPDVDMDQIRIVFKLNPKKFEFMALSDDRQRSMPSMADRDNAKQLGYKEAVLLT  231

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
               +NP  KG+VDDKY Y+++ ++ +V+GWIS  P +GFW+IT S+EFRLGGP+KQDLT H
Sbjct  232   NPKNPMFKGEVDDKYMYSMEDKDNNVHGWISSDPPVGFWMITPSDEFRLGGPIKQDLTSH  291

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQM  1308
              GP  LSMF S HY+G +  +  R GE WK VFGPV  Y+NS    D    LW+ AK+QM
Sbjct  292   AGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLAYLNSVSPKDSTLRLWKDAKRQM  351

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E K WPY F  SEDYP   QRG + G+ LI D    +     K A VGLA  GE GSW
Sbjct  352   AAEVKSWPYDFVTSEDYPLRHQRGTIEGQFLIKDRYVSRLRIYGKFAFVGLAPIGEAGSW  411

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +S  YQFWT+ D  G+F I  VR G YSLYAW  G +GD+K++ +ITI PG  + VG 
Sbjct  412   QTESKGYQFWTKADRKGRFIIENVREGNYSLYAWGFGFIGDYKYEQNITITPGSVMDVGP  471

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH  1845
             +V+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLW+RY++L+
Sbjct  472   IVYEPPRNGPTIWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWERYADLY  531

Query  1846  -KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
              + DLVYTVG SD  +DWFFA VTR     +Y+ T W ++F ++ V + G YTLRIA+A+
Sbjct  532   PQNDLVYTVGVSDYTRDWFFAHVTRNVGNDTYQPTTWQIIFNLKNVNQVGLYTLRIALAA  591

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + L I +N DPK D   F S   GKDNAIARHGIHGLY   S ++ G L+  G+N +
Sbjct  592   AADSELQIRIN-DPKSDHI-FMSGYIGKDNAIARHGIHGLYRLYSIDVAGGLLNIGDNTI  649

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             YL Q+++  PF GIMYDYIRLE+
Sbjct  650   YLTQTRSLTPFQGIMYDYIRLES  672



>ref|XP_007018292.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
 gb|EOY15517.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
Length=1344

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/631 (51%), Positives = 435/631 (69%), Gaps = 12/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V++DNG++++ LSNP+G V GI Y  +D NLLE+ N+  +RGYWDL W++P
Sbjct  702   VQLHIQDTHVMIDNGVLQLTLSNPDGIVTGIRYNDID-NLLEVLNEESNRGYWDLVWSSP  760

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 +      I  T FKVI+E   QVEVSF +T+ S  +  + P+NIDKRF++L G SG
Sbjct  761   GTAGTAGLFDVIKGTIFKVIVENVDQVEVSFTRTWDSSQEGKVVPLNIDKRFIVLRGCSG  820

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+  K     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L 
Sbjct  821   FYSYAIYERLKDWPGFNLAETRIAFKLRQDKFHYMAMADNRQRYMPLPDDRLPGRGQALA  880

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGG  1104
             Y EAV L      +LKG+VDDKYQY+ D+++  V+GWI +  P +GFW+IT SNEFR GG
Sbjct  881   YPEAVLLVDPVEHELKGEVDDKYQYSCDNKDSQVHGWIRTDPPAVGFWMITPSNEFRSGG  940

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYIN-SDKGTDHKT  1281
             P+KQ+LT H GP  L++FLS HYSG+D   K   GEAWK VFGPVFIY+N + +G D  +
Sbjct  941   PVKQNLTSHVGPTTLAVFLSAHYSGEDLVPKFSAGEAWKKVFGPVFIYLNCAMEGDDPLS  1000

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+QM+ E + WPY+FP SED+PK+ QRG+VSGRLL+HD      + PA  A++GL
Sbjct  1001  LWEDAKEQMITEFQSWPYTFPASEDFPKSDQRGSVSGRLLVHDRYVSDDNIPANGAYIGL  1060

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG  GSWQ +   YQFWT+TD  G F I+ +R  +Y+LYAWVPG +GD++    ITI 
Sbjct  1061  APPGTAGSWQRECKDYQFWTQTDVNGYFLINDIRTADYNLYAWVPGFIGDYRSDVAITIT  1120

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PG  I+VGDL++ P +NG T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGL
Sbjct  1121  PGSYIEVGDLIYEPPRNGPTLWEIGIPDRSAAEFYVPDPNPKYINKLYVNHPDRFRQYGL  1180

Query  1822  WDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCY  1995
             W+RY+EL+   DLVYTVG SD  KDWFFAQVTRK     Y+ T W + F ++ V +   Y
Sbjct  1181  WERYAELYPVGDLVYTVGSSDYKKDWFFAQVTRKTDNNKYQGTTWQIKFKLDNVDQSNSY  1240

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+AS+T + L I +N DPK +   F+S L G+DN+IARHGIHGLY   + +IPG L
Sbjct  1241  KLRLAIASATLSELQIRIN-DPKGNPL-FSSGLFGRDNSIARHGIHGLYWLFNVDIPGKL  1298

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+G+N ++L Q ++  PF GIMYDYIRLE 
Sbjct  1299  LVQGDNTIFLTQPRSSGPFQGIMYDYIRLEG  1329


 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/636 (50%), Positives = 424/636 (67%), Gaps = 14/636 (2%)
 Frame = +1

Query  391   ACKP-----VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRG  555
             AC P     V+L +    V+MDNGI +V LS P G V GI Y G+D NLLE+ NK  +RG
Sbjct  37    ACAPMPPQGVRLHIQDRYVVMDNGICQVTLSKPGGIVTGIRYNGID-NLLEVRNKETNRG  95

Query  556   YWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFV  732
             YWDL WN    K      I  T F+VI+E E QVE+SF + +  S +   IP+NIDKRF+
Sbjct  96    YWDLHWNEIGGKGIFDV-IQGTSFRVIVENEEQVELSFTRAWDPSLEGKYIPLNIDKRFI  154

Query  733   MLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREE  912
             ML GSSGFY+YAIY+H K     +L +TR+ FKL +  F ++A+ D  Q  MP   +R  
Sbjct  155   MLRGSSGFYSYAIYEHFKEWPGFELGETRITFKLRKEKFQYMAIADNRQRYMPFPDDRST  214

Query  913   GEV--LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASN  1086
             G    L Y EAV      + +L G+VDDKYQY+ +++++ V+GWI   P +GFW IT S+
Sbjct  215   GRCQPLAYPEAVLFVNPMDQRLTGEVDDKYQYSCENKDLRVHGWICFDPPVGFWQITPSD  274

Query  1087  EFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-K  1263
             EFR GGPLKQ+LT H GP  L+MFLS HY+G     +   GE WK VFGPVFIY+NS   
Sbjct  275   EFRSGGPLKQNLTSHVGPTTLAMFLSAHYAGKYMVPRFEAGEPWKKVFGPVFIYLNSAAH  334

Query  1264  GTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAK  1443
             G D   LWE AK +M+ E + WPYSFP SED+ K  QRG V+GRLL+ D         A 
Sbjct  335   GYDPLWLWEDAKIKMMVEVQSWPYSFPASEDFLKTEQRGNVNGRLLVQDRYISNDYLIAS  394

Query  1444  CAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHK  1623
              A++GLA  G  GSWQ +S +YQFWT+ D  G F I  +R G+Y+LYAWVPG +GD++++
Sbjct  395   GAYIGLAPRGNAGSWQMESKNYQFWTKADQNGFFSIRNIRPGDYNLYAWVPGFIGDYRNE  454

Query  1624  ADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEK  1803
               ITI  GC+I++GD+++ P ++G T+WEIGIPDRSAAEF +P+P P   N L  +  ++
Sbjct  455   VVITISSGCNIEMGDIIYEPPRDGPTLWEIGIPDRSAAEFHVPDPDPKYINRLFVNHPDR  514

Query  1804  FRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV  1980
             FRQYGLW+RY+EL+   DLVYT+G SD  KDWFFAQV RK +  SY+ T W + F ++ V
Sbjct  515   FRQYGLWERYAELYPDGDLVYTIGASDYRKDWFFAQVVRKTSDNSYQGTTWQIKFKLDNV  574

Query  1981  AK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSF  2157
              + G Y LR+A+AS+T A L + VN DP  ++  FT+ L G+DNAIARHGIHG+Y   + 
Sbjct  575   DQSGTYKLRVALASATLAELQVRVN-DPNTNRPLFTTGLIGRDNAIARHGIHGIYMLYNV  633

Query  2158  EIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             +IPG+ +VKG+N ++L+Q +   PF G MYDYIRLE
Sbjct  634   DIPGTRLVKGDNTIFLKQPRCNGPFQGFMYDYIRLE  669



>ref|XP_008378659.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=1231

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/628 (53%), Positives = 423/628 (67%), Gaps = 10/628 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +    V+MDNGI++V LSNP+G V GI Y G+D NLLE  NK  +RGYWDL W+ P
Sbjct  6     VRLHIQGPHVVMDNGILQVTLSNPDGIVTGIRYNGID-NLLEPLNKETNRGYWDLVWSAP  64

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
               K      I  T FKVI+E E QVE+SF K +  S +   +P+NIDKRFVML GSSGFY
Sbjct  65    GSKGIFDV-IKGTTFKVIVENEEQVELSFSKMWDHSLEGKYVPLNIDKRFVMLRGSSGFY  123

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H K   D D+ +TR+ FKL +  F ++AV+D  Q  MP   +R  G  + L Y+
Sbjct  124   SYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMAVSDNRQRYMPLPDDRLPGRCQTLAYQ  183

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   +   L G+VDDKYQY+ D+++  V+GWI   P +GFW IT S+EFR GGPLK
Sbjct  184   EAVLLVNPKMKDLAGEVDDKYQYSCDNKDNKVHGWICTNPPVGFWQITPSDEFRSGGPLK  243

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWE  1290
             Q+LT H GP  L+MFLS HY+G D   K RGGE WK VFGPVFIY+NS    D    LWE
Sbjct  244   QNLTSHVGPTTLAMFLSGHYAGQDLVPKFRGGEPWKKVFGPVFIYLNSSTIKDDPFWLWE  303

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E + WPYSFP SED+ K+ QRG VSGRLL+ D    +  TPA  A+VGLA P
Sbjct  304   DAKIQMMTEVQSWPYSFPASEDFQKSDQRGNVSGRLLVLDRYICEQYTPAGGAYVGLAPP  363

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ +   YQFWT  DD G F I+ VR G Y+LYAWVPG +GD+++ A I I  G 
Sbjct  364   GDVGSWQRECKDYQFWTTADDRGYFAINNVRTGNYNLYAWVPGFIGDYRYDAVIDITSGS  423

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I++GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQYGLW R
Sbjct  424   FIEMGDLVYEPPRDGPTLWEIGIPDRSAAEFYVPDPDPKYVNKLFINHPDRFRQYGLWSR  483

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLR  2004
             Y+E++   DLVYT+G SD AKDWFFAQV RK   G +E T W + F ++ V +   Y LR
Sbjct  484   YAEIYPDEDLVYTIGVSDYAKDWFFAQVPRKTDNG-HEGTTWQIKFELKNVDRNTTYKLR  542

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+AS+T A L + +N DP   +  FTS L G+DN++AR GIHG+Y   +  +PG+ +V+
Sbjct  543   VAIASATLAELQVRIN-DPNSRRPLFTSGLIGRDNSVARLGIHGIYWLYNINVPGNQLVE  601

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G N  + RQ +   PF GIMYDYIR E 
Sbjct  602   GNNTFFFRQPRCTSPFQGIMYDYIRFEG  629


 Score =   585 bits (1509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/579 (51%), Positives = 391/579 (68%), Gaps = 9/579 (2%)
 Frame = +1

Query  556   YWDLDWNTPKEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRF  729
             YWDL W++     + +F ++  T F VIM+ + QVE+SF + +  S +   +P+NIDKRF
Sbjct  647   YWDLVWSSATTGTTGTFDVIKGTSFTVIMQNDEQVELSFTRXWDPSQEGQLVPLNIDKRF  706

Query  730   VMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER-  906
             +ML G SGFY+YAIY+H K      L +TR+ FKL +  F ++A+ D  Q  MP   +R 
Sbjct  707   IMLRGCSGFYSYAIYEHLKDWPAFQLAETRIAFKLRKDNFHYMAMADNRQRYMPLPDDRL  766

Query  907   -EEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITAS  1083
                G+ L Y EAV L     P+ KG+VDDKYQY+ D+++  V+GWI  +P +GFW+IT S
Sbjct  767   PPRGQALAYPEAVLLVNPVEPEFKGEVDDKYQYSCDNKDSKVHGWICTEPXVGFWLITPS  826

Query  1084  NEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-  1260
              EFR GGP KQ+LT H GP  L++FLS HYSG+D   K   GE WK VFGPVF+Y+NS  
Sbjct  827   QEFRSGGPFKQNLTSHVGPTTLAVFLSAHYSGEDLVXKFAVGEEWKKVFGPVFMYVNSAY  886

Query  1261  KGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPA  1440
             +G D  +LWE AK QM+ E + WPYSFP SED+PK+  RG V GRLLI D          
Sbjct  887   EGNDPLSLWEDAKLQMVXEVQSWPYSFPASEDFPKSRXRGNVRGRLLIQDRYVSDDYVSI  946

Query  1441  KCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKH  1620
               A+VGLA PG+ GSWQ +   YQFWT TD+ G F I+ VR G+Y+L A VPG +GD+ +
Sbjct  947   NGAYVGLAPPGDVGSWQRECKDYQFWTTTDEDGYFCINGVRTGDYNLNASVPGFIGDYHY  1006

Query  1621  KADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTE  1800
                +TI  GCDI +GDLV+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  +
Sbjct  1007  DVVMTITSGCDIDMGDLVYKPPRDGPTLWEIGIPDRSAAEFYVPDPNPKYINKLFVNHPD  1066

Query  1801  KFRQYGLWDRYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIET  1977
             +FRQYGLW+RYSEL+   DLVYTVG SD +KDWFFAQVTRK     Y+ T W + F +E 
Sbjct  1067  RFRQYGLWERYSELYSDQDLVYTVGVSDYSKDWFFAQVTRKKDDNKYQGTTWQIKFKLEN  1126

Query  1978  VAK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVS  2154
             V K G Y LR+A+AS+  + L +WVN DPK ++  FTS + GKDN+IARHGIHGLY   +
Sbjct  1127  VDKTGSYKLRVALASANYSELQVWVN-DPKANRPLFTSGMIGKDNSIARHGIHGLYWLYN  1185

Query  2155  FEIPGSLIVKGENKLYLRQSKAGY-PFYGIMYDYIRLEA  2268
              ++P S +V+G+N +YL Q ++   PF GIMYDY+RLE 
Sbjct  1186  VDVPSSRLVEGDNIIYLTQPRSTTGPFQGIMYDYLRLEG  1224



>ref|XP_010490435.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Camelina 
sativa]
 ref|XP_010490440.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Camelina 
sativa]
Length=633

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/622 (52%), Positives = 422/622 (68%), Gaps = 14/622 (2%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W       +  F 
Sbjct  15    VVMDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEEVNRGYWDLVWG--GSGTAGGFD  71

Query  610   IL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHP  783
             ++  T+F+VIM+ E QVE+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H 
Sbjct  72    VIKGTNFEVIMKNEEQVELSFTRKWDPSLEGKAVPLNIDKRFVMLSGSSGFYTYAIYEHL  131

Query  784   KGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKT  957
             K      L +TR+ FKL +  F ++AVT++ Q  MP   +R  + G+ L Y EAV L   
Sbjct  132   KEWPAFSLAETRIAFKLRKEKFHYMAVTEDRQRFMPLPDDRLPDRGQALAYPEAVLLVNP  191

Query  958   ENPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
               P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT H 
Sbjct  192   IEPQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLTSHV  251

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQM  1308
             GP AL++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK QM
Sbjct  252   GPTALAVFMSAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWKDAKSQM  311

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               ET+ WPYSFP S+DY KA QRG V GRLL+ D    K    A   +VGLA PG  GSW
Sbjct  312   NVETESWPYSFPASDDYLKAEQRGNVVGRLLVQDRYVDKDFIAATRGYVGLAVPGAAGSW  371

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +   YQFWTRTD+ G   IS +R G+Y+LYAWVPG +GD+K+   ITI  GC I V D
Sbjct  372   QRECKDYQFWTRTDEEGFLYISGIRPGQYNLYAWVPGFIGDYKYDDIITITQGCYIYVED  431

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-  1845
             LV+ P +NG T+WEIG PDRSAAEF++P+P P   N L  +  ++FRQYGLW+RY+EL+ 
Sbjct  432   LVYQPPRNGETLWEIGFPDRSAAEFYVPDPNPKYINKLYKNHPDRFRQYGLWERYAELYP  491

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASS  2022
               DLVY VG SD  KDWF+AQVTRK    +Y+ T W + F ++ + +   YTLR+A+AS+
Sbjct  492   DKDLVYVVGSSDYRKDWFYAQVTRKKDNKTYQGTTWQIKFELKNIDQSHSYTLRVAIASA  551

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLY  2202
             T + L I VN         FTS L G+DN+IARHGIHGLY   + E+  + +V+GEN L+
Sbjct  552   TFSELQIRVND--ANTIPLFTSGLIGRDNSIARHGIHGLYWLFNVEVAVAKLVEGENTLF  609

Query  2203  LRQSKAGYPFYGIMYDYIRLEA  2268
             L Q ++  PF GIMYDYIR EA
Sbjct  610   LTQPRSTSPFQGIMYDYIRFEA  631



>ref|XP_011099951.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Sesamum 
indicum]
Length=666

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/632 (49%), Positives = 415/632 (66%), Gaps = 10/632 (2%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             L A   V L    + V+M NGI+ V L+ P G V  I Y+G  +NLL+  NK  +RGYWD
Sbjct  38    LPASSTVHLQRHNQHVVMSNGIVNVTLTAPGGLVTSITYKG-SENLLQTQNKEDNRGYWD  96

Query  565   LDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPG  744
             + W  P        K+L T +KVI       E+SF  T+  G    +P+N+DKR+VML  
Sbjct  97    VVWTKPGGHDIMD-KLLGTRYKVIRRNRDHTEISFTTTWTVG-SARVPLNVDKRYVMLRD  154

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVL  924
             S GFY+YA+ +  KG    D+ + R+VFKL  + F ++A++DE Q  MP   +R  G+VL
Sbjct  155   SPGFYSYAVLERLKGWPAFDIQEARIVFKLEENRFQYMAMSDERQRVMPMSVDRYTGQVL  214

Query  925   NYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGG  1104
             +Y EAV LT+  NP+LKG+VDDKY Y+ D++N  V+GW+S   H+GFW+IT SNEFR GG
Sbjct  215   DYPEAVLLTRPTNPELKGEVDDKYLYSCDNKNNKVHGWVS-NDHVGFWMITPSNEFRTGG  273

Query  1105  PLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG--TDHK  1278
             P KQDLT H GP  LSMF+S HY+G+D  +K +  E WK VFGPV+IY+NSD    T+  
Sbjct  274   PFKQDLTSHVGPTLLSMFISTHYAGEDLALKFQSEEYWKKVFGPVYIYLNSDASSKTNPS  333

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW  AK++M  E   WPY+FP SED+ K+ QRGA  G+LL+HD    K   P   ++VG
Sbjct  334   ILWNDAKQRMQMEEGSWPYNFPLSEDFLKSNQRGAARGQLLVHDWYKNKKALPGASSYVG  393

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG  GSWQ ++  YQFWT+TD  G F I  V  G YSL+AWVPG +GD+KH++DITI
Sbjct  394   LAPPGAVGSWQLENRGYQFWTQTDQEGNFLIKNVIPGTYSLFAWVPGTIGDYKHRSDITI  453

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              PG  +++ ++VF   + G T+WEIG+PDR+AAEFFIP P P  K +      E+FRQYG
Sbjct  454   SPGSIVELRNVVFEAPRKGATLWEIGVPDRTAAEFFIPNPDPKFKIHQYERPIERFRQYG  513

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGC-  1992
             LW  Y++ +  TDLVYTVG+SD  KDWFFA VTR      ++AT W ++F +  V KG  
Sbjct  514   LWTGYTDHYPHTDLVYTVGQSDYEKDWFFAHVTRNLGDRQFQATTWQILFNLTKVTKGAN  573

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTL+IA+AS+ +A L + VN   +K    FT++L G+DNA+ARHGIHGLY   S +I GS
Sbjct  574   YTLQIALASANQAELQVRVND--QKSLPHFTTRLIGRDNALARHGIHGLYHLYSIDITGS  631

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              ++ G N ++L Q+++  PF  +MYDYIRLE 
Sbjct  632   RLINGTNTIFLTQARSQGPFREVMYDYIRLEG  663



>ref|XP_003519207.1| PREDICTED: rhamnogalacturonate lyase B-like [Glycine max]
Length=651

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/642 (50%), Positives = 428/642 (67%), Gaps = 18/642 (3%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A + V+L V    V+MDNGI++V LSNP G V GI Y G+D NLLE  N+  +RGYWD+ 
Sbjct  2     ASQAVQLRVEDSQVVMDNGILQVYLSNPGGFVTGIQYNGID-NLLETLNEKDNRGYWDVV  60

Query  571   WNTPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPINIDKRFVMLP  741
             W+      +T    +I+ T F VIME E QVE+SF + +    K    P+NIDKR+VML 
Sbjct  61    WSEAGSTGTTGTFERIVGTSFNVIMENEEQVEISFTRKWDPSLKGKRAPLNIDKRYVMLR  120

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
              S+GFY+YAI++H +     ++ Q R+V+KL +  F ++AV+D+ Q  MP   +R    G
Sbjct  121   NSAGFYSYAIFEHLQEWPAFNIPQIRIVYKLRKDKFHYMAVSDDRQRFMPLPDDRLPGRG  180

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPK----PHLGFWIITAS  1083
             + L   EAV L     P  KG+VDDKYQY+ +++++ V+GWIS +    P +G W+I  S
Sbjct  181   KELVPPEAVLLVNPVEPDFKGEVDDKYQYSSENKDLMVHGWISSQSEDDPAMGLWVILPS  240

Query  1084  NEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-  1260
             NEFR GG LKQ+LT H GP +L+MFLS HY+G+D  +KL+  E WK VFGP F+Y+NS  
Sbjct  241   NEFRSGGLLKQNLTSHVGPISLAMFLSAHYAGEDIVLKLQPNEPWKKVFGPTFVYLNSLL  300

Query  1261  KGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPA  1440
              G D   LWE AK QM EE + WPY FP SED+ K++QRG++ G LL+ D C    +  A
Sbjct  301   NGDDPLELWEDAKNQMKEEVQSWPYDFPASEDFQKSSQRGSLCGTLLVRDRCVSDENIIA  360

Query  1441  KCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKH  1620
             + A+VGLA PGE GSWQ +   YQFWTR ++ G F I  +R+G+Y+LYAWVPG +G++ +
Sbjct  361   EGAYVGLATPGEAGSWQRECKGYQFWTRANEEGYFSIDNIRSGDYNLYAWVPGFIGEYWN  420

Query  1621  KADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTE  1800
                +TI PGC+I +GD++F P ++G T+WEIGIPDRSAA F++P+P P   N L  +  +
Sbjct  421   NVVLTITPGCEINLGDIIFEPPRDGPTLWEIGIPDRSAAGFYVPDPNPKYINKLFVNHPD  480

Query  1801  -KFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIE  1974
              KFRQYGLW+RY+EL+   DL+YTVG SD  KDWFFA V RK   GSY+ T W + F ++
Sbjct  481   NKFRQYGLWERYAELYPNEDLIYTVGVSDYTKDWFFAHVPRKQEDGSYQGTTWQIKFNLD  540

Query  1975  TV-AKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEV  2151
              V A   Y LR+A+AS+  + L + VN DPK+D   FT+ + GKDNAIARHGIHGLY   
Sbjct  541   DVEASNIYRLRLALASANISELQVRVN-DPKQDPPLFTTGVIGKDNAIARHGIHGLYWLF  599

Query  2152  SFEIPGSLIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
             S ++PG L+ K  N ++L Q+ A  P   F GIMYDYIRLE 
Sbjct  600   SIDVPGLLLEKSVNIIFLTQTMASGPLALFQGIMYDYIRLEG  641



>ref|XP_002880453.1| hypothetical protein ARALYDRAFT_481121 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56712.1| hypothetical protein ARALYDRAFT_481121 [Arabidopsis lyrata subsp. 
lyrata]
Length=681

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/620 (49%), Positives = 419/620 (68%), Gaps = 11/620 (2%)
 Frame = +1

Query  424   EMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTS  603
             + V++DNGI++V  S+P+G + GI Y G+D+    L ++I+DRGYWD+ W  P +K+ T 
Sbjct  64    DTVVIDNGIVQVTFSSPQGLITGIKYHGIDN---VLDDEIEDRGYWDVVWYEPGKKSETD  120

Query  604   FKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYDH  780
              K+  T F++I + E Q+E+SF +T+    +   +P+N+DKR+++  G SG Y Y I + 
Sbjct  121   -KLEGTKFEIITQNEEQIEISFTRTWTISKRGSLVPLNVDKRYIIRSGVSGIYMYGILER  179

Query  781   PKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTE  960
               G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+  + L YKEAV LT   
Sbjct  180   LGGWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRDNSKTLAYKEAVLLTNPS  239

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
             NP LKG+VDDKY Y+++ ++ +V+GWI+  P +GFW+IT S+EFRLGGP+KQDLT H GP
Sbjct  240   NPMLKGEVDDKYMYSMEDKDNNVHGWITSDPPVGFWMITPSDEFRLGGPIKQDLTSHAGP  299

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAKKQMLEE  1317
               LSMF S HY+G +  +  R GE WK VFGPV +Y+NS    +    LW  AK+QM  E
Sbjct  300   ITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVLVYLNSVSPKESTLRLWRDAKRQMAAE  359

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
              K WPY F  SEDYP   QRG + G+ LI D    +     K A VGLA  GE GSWQ +
Sbjct  360   VKSWPYDFVTSEDYPLRHQRGTIEGQFLIKDSYVSRLKIYGKFAFVGLAPIGEAGSWQTE  419

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
             S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K++ +I I PG ++ VG +V+
Sbjct  420   SKGYQFWTKADRKGRFIIENVRAGNYSLYAWGIGFIGDYKYEQNIIITPGSEMNVGPIVY  479

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH-KT  1851
              P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++FRQYGLWDRY++L+ + 
Sbjct  480   EPPRNGPTLWEIGVPDRTAGEFYIPDPYPTLMNKLYVNPLQDRFRQYGLWDRYADLYPQN  539

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTR  2028
             DLVYT+G SD  +DWFFA VTR     +Y+ T W ++F ++ V + G YTLR+A+AS+  
Sbjct  540   DLVYTIGVSDYRRDWFFAHVTRNFGNDTYQPTTWQIIFNLKNVNRIGLYTLRLALASAAS  599

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             + L I +N DPK     FT+ L GKDNAIARHGIHGLY   S +I G+L+  G+N +YL 
Sbjct  600   SELQIRIN-DPKSGHI-FTTGLIGKDNAIARHGIHGLYRLYSIDIAGNLLSVGDNTIYLT  657

Query  2209  QSKAGYPFYGIMYDYIRLEA  2268
             Q+++   F G+MYDYIRLE+
Sbjct  658   QTRSIGMFQGVMYDYIRLES  677



>ref|XP_010472252.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Camelina 
sativa]
 ref|XP_010472253.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Camelina 
sativa]
Length=677

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/637 (49%), Positives = 420/637 (66%), Gaps = 16/637 (3%)
 Frame = +1

Query  388   GACKPVKLTV-----TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDR  552
             G   P  LTV     + + V++DNGII+V  S+P+G + GI Y G+D+    L ++I+DR
Sbjct  43    GQNIPAALTVQLRRVSHDKVVIDNGIIQVTFSSPQGLITGIKYHGIDN---VLDDEIEDR  99

Query  553   GYWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRF  729
             GYWD+ W  P++K     K+  T F++I + E QVE+SF +T+    +   +P+N+DKR+
Sbjct  100   GYWDVTWYEPRKKLEID-KLEGTKFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRY  158

Query  730   VMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE  909
             ++  G SG Y Y I +  +G  DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+
Sbjct  159   IIRSGVSGIYMYGILERLEGWPDVDMDQIRIVFKLNSKKFDFMAISDDRQRSMPSMADRD  218

Query  910   EGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNE  1089
               + L YKEAV  T   NP  KG+VDDKY Y+++ ++ +V GWIS +P +GFW+IT S+E
Sbjct  219   NAKQLAYKEAVLFTNPRNPMFKGEVDDKYMYSMEDKDNNVNGWISSEPPVGFWMITPSDE  278

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT  1269
             FRLGGP+KQDLT H GP  LSMF S HY+G +  +  R GE WK VFGPVF Y+NS    
Sbjct  279   FRLGGPMKQDLTSHVGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVFAYLNSVSPK  338

Query  1270  DHK-TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
             D    LW  AK+QM  E K WPY F  S DYP   QRG + G+ LI D    +     + 
Sbjct  339   DSTLRLWRDAKRQMAAEVKSWPYDFVTSVDYPLRHQRGTIEGQFLIKDSYVSRLRIYGRF  398

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             A VGLA  GE GSWQ +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K + 
Sbjct  399   AFVGLAPIGEAGSWQTESKGYQFWTKADRKGRFIIENVRAGNYSLYAWGFGFIGDYKFEQ  458

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEK  1803
             +ITI  G ++ VG +V+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++
Sbjct  459   NITITAGSEMNVGPIVYEPPRNGPTLWEIGVPDRTAREFYIPDPYPTLMNKLYVNPLQDR  518

Query  1804  FRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV  1980
             FRQYGLWDRY++L+ + DLVYTVG SD  +DWFFA VTR     +Y+ T W ++F +  V
Sbjct  519   FRQYGLWDRYADLYPQNDLVYTVGVSDYRRDWFFAHVTRNVGNKTYQPTTWQIIFNLRNV  578

Query  1981  AK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSF  2157
              + G YTLRIA+AS+  + L I +N DPK D   FT+   GKDNAIARHGIHGLY   S 
Sbjct  579   NRVGLYTLRIALASAANSELQIRIN-DPKSDHI-FTTGYIGKDNAIARHGIHGLYRLYSI  636

Query  2158  EIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             ++ GSL+  G+N +YL QS++   F GIMYDYIRLE+
Sbjct  637   DVAGSLLNVGDNTIYLTQSRSLGLFDGIMYDYIRLES  673



>ref|XP_007225686.1| hypothetical protein PRUPE_ppa002905mg [Prunus persica]
 gb|EMJ26885.1| hypothetical protein PRUPE_ppa002905mg [Prunus persica]
Length=622

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/619 (52%), Positives = 415/619 (67%), Gaps = 16/619 (3%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V LSNP+G V GI Y G+D N+LE  NK  +RGYWDL W+ P  K      I 
Sbjct  1     MDNGILQVTLSNPDGIVTGIRYNGID-NVLEPLNKETNRGYWDLVWSAPGSKGIFDV-IK  58

Query  616   ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
              T F+VI++   QVEVSF + +  S +   +P+NIDKRFVML  SSGFY+YAIY+H K  
Sbjct  59    GTSFRVIVDNGEQVEVSFTRMWDPSLEGKYVPLNIDKRFVMLRASSGFYSYAIYEHLKDW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYKEAVKLTKTENP  966
              D ++ +TR+ FKL +  F ++AV+D  Q  MP   +R  G  + L Y EAV L   ENP
Sbjct  119   PDFEIGETRITFKLRKDKFQYMAVSDNRQRYMPLPDDRLPGRCQTLAYPEAVLL---ENP  175

Query  967   KLK---GKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCG  1137
             K+K   G+VDDKYQY+ ++++  V+GWI   P +GFW IT S+EFR GGP KQ+LT H G
Sbjct  176   KMKELAGEVDDKYQYSCENKDNKVHGWICTNPPVGFWQITPSDEFRSGGPHKQNLTSHVG  235

Query  1138  PFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LWEGAKKQMLE  1314
             P  L+MFLS HY+G D   K RGGE WK VFGPVFIY+NS    D    LWE AK QM+ 
Sbjct  236   PTTLAMFLSGHYAGQDLVPKFRGGEPWKKVFGPVFIYLNSSAIKDDPFWLWEDAKIQMMT  295

Query  1315  ETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQN  1494
             E + WPYSFP SED+ K+ QRG VSGRLL+ D    +   PA  A+VGLA PG+ GSWQ 
Sbjct  296   EVQSWPYSFPASEDFQKSDQRGNVSGRLLVLDRYICEELIPANGAYVGLAPPGDVGSWQR  355

Query  1495  DSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLV  1674
             +   YQFW R DD G F IS +R G Y+L+AWVPG +GD+++ A I I  G  I++GDLV
Sbjct  356   ECKDYQFWMRADDRGYFSISNIRTGTYNLFAWVPGFIGDYRYDAVINITSGSFIEMGDLV  415

Query  1675  FTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KT  1851
             F P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +  ++FRQYGLW+RY+E +   
Sbjct  416   FEPPRDGPTLWEIGIPDRSAAEFYVPDPDPNHINRLFVNHPDRFRQYGLWNRYAESYPHE  475

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTR  2028
             DLVY VG SD AKDWFFAQV R+   G +E T W + F +  V +   Y LR+A+AS+T 
Sbjct  476   DLVYIVGVSDYAKDWFFAQVPRQKENG-HEGTTWQIRFELRNVDRNSTYKLRVAIASATL  534

Query  2029  ATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLR  2208
             A L + +N DP   +  FTS L G+DN++ARHGIHG+Y   +  +PG+ +V G N  + +
Sbjct  535   AELQVRIN-DPNSRRPLFTSGLIGRDNSVARHGIHGIYWLYNVNVPGAQLVDGTNTFFFK  593

Query  2209  QSKAGYPFYGIMYDYIRLE  2265
             Q +   PF G+MYDYIR E
Sbjct  594   QPRCTSPFQGLMYDYIRFE  612



>ref|XP_010458307.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Camelina 
sativa]
Length=669

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/635 (50%), Positives = 423/635 (67%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H+   + VKL +    V+MDNGI++V LSNP G + GI Y G+D N+LE+ NK  +RGYW
Sbjct  37    HMMPSQGVKLHIHDRYVVMDNGILQVTLSNPGGIITGIKYNGLD-NVLEVRNKETNRGYW  95

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  96    DLHWNEPGGKGIFDV-ISGVSFRVIVETEEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  154

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+YAIY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  155   RGSSGVYSYAIYEHLKDWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  214

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEF
Sbjct  215   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPVGFWQITPSNEF  274

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  275   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEHGEPWKKVYGPVFIYLNSTASGD  334

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D  +LW+ AK +M+ E + WPYSF  SEDYPK+ +RG   GRLLI D         A  A
Sbjct  335   DPLSLWDDAKIKMMAEVESWPYSFVASEDYPKSEERGTARGRLLIRDRFISNDMISAAGA  394

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   
Sbjct  395   YVGLAPPGGSGSWQIECKGYQFWAVGDEAGYFSIENVRPGEYNLYAWVPGFIGDYYNGTI  454

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             +++  GC I++GD+V+ P ++G T+W+IGIPDR A+EFFIP+P P L N  L    ++FR
Sbjct  455   VSVTSGCKIEMGDIVYEPPRDGPTLWDIGIPDRKASEFFIPDPDPTLVNRALVHHQDRFR  514

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW RY++L+   DLVYTVG SD  +DWFFAQV RK     +EAT W + F +E +  
Sbjct  515   QYGLWKRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGD-MHEATTWQIRFKLENIDQ  573

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      I
Sbjct  574   KANYKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNI  632

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  633   PGNRLVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  667



>ref|XP_002445711.1| hypothetical protein SORBIDRAFT_07g024560 [Sorghum bicolor]
 gb|EES15206.1| hypothetical protein SORBIDRAFT_07g024560 [Sorghum bicolor]
Length=663

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/633 (50%), Positives = 421/633 (67%), Gaps = 9/633 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   V + VT   V + NGI ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL 
Sbjct  29    ATAGVTVKVTDRYVEIKNGIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLV  87

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P +K      I  T+F++I + E+Q EVSF + +  S +   +P+NIDKRF++L GS
Sbjct  88    WNPPGQKTGIFDVIKGTEFRIIYQDENQAEVSFTRNWDPSLEGKAVPLNIDKRFIVLRGS  147

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H +G  D  L +TRV FKL +  F ++A+ D+ Q  MP   +R    G+ 
Sbjct  148   SGFYTYGIYEHKEGWPDFGLGETRVAFKLRKDKFHYMALADDRQRIMPMPDDRLPPRGQP  207

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NP L+G+VDDKYQY+ + Q  +V+GW+S  P +GFW IT S+EFR G
Sbjct  208   LAYPEAVLLVDPINPDLRGEVDDKYQYSCEDQYNNVHGWMSFDPPIGFWQITPSDEFRTG  267

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GPLKQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS   G+D  
Sbjct  268   GPLKQNLTSHVGPTMLAMFLSAHYAGDDLSPKFTNGEYWKKVHGPVFMYLNSSWDGSDPT  327

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E + WPY F  SED+ K  QRG VSGRLL+ D      D  A  A+VG
Sbjct  328   MLWEDAKVQMMIEKENWPYCFALSEDFQKTEQRGCVSGRLLVRDRYIDDQDLYASGAYVG  387

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW R D  G F I  +  G+Y+LYAWVPG +GD++  A +TI
Sbjct  388   LALPGEAGSWQRECKGYQFWCRADVDGSFYIRNIVTGKYNLYAWVPGFIGDYRLDATLTI  447

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQY  1815
               G DI +GDLV+ P ++G T+WEIG+PDRSAAEF++P+P P+  N L ++   ++FRQY
Sbjct  448   SSGDDIYLGDLVYEPPRDGPTMWEIGVPDRSAAEFYVPDPNPNYVNRLYINHPADRFRQY  507

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KG  1989
             GLW+RY+EL+  +DLVYTVG+SD   DWF+AQV RK    +Y+ T W + F +++V+   
Sbjct  508   GLWERYAELYPNSDLVYTVGQSDYTTDWFYAQVNRKLDDNTYQPTTWQIKFNLDSVSPSS  567

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y  R+A+ASS  A L ++ N D  K +  F + L G++NAIARHGIHGLY   + ++  
Sbjct  568   TYKFRVALASSALAELQVFFN-DQDKARPHFATGLIGRENAIARHGIHGLYWLFNIDVAS  626

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +V+G N +YL+Q ++  PF G+MYDY+RLE 
Sbjct  627   AWLVQGVNTIYLKQPRSQSPFQGLMYDYLRLEG  659



>gb|AES98299.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=644

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/643 (49%), Positives = 430/643 (67%), Gaps = 19/643 (3%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + V+L +    V+MDNGI++V LSNP G V  I Y G+D NLLE  N+  +RGYWD+ 
Sbjct  2     SSQAVQLRIKSNHVVMDNGIVQVYLSNPGGFVTRIQYNGID-NLLEALNEKNNRGYWDVV  60

Query  571   WNTPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLP  741
             W+      +T    +I+ T F VIME E QVE+SFK+T+    K  + P+NIDKR+VML 
Sbjct  61    WSEYGSTGTTGTFERIVGTSFNVIMETEEQVEISFKRTWNPSLKGKLSPLNIDKRYVMLR  120

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
              SSGFY+YAI++H K     ++ Q R+V+KL +  F ++A+ D  Q  MP   +R    G
Sbjct  121   NSSGFYSYAIFEHLKEWPAFNIPQIRIVYKLRKDKFHYMAMADNRQRLMPLPDDRLPGRG  180

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPK----PHLGFWIITAS  1083
             + L   EAV L     P+  G+VDDKYQY+ ++ N+ V+GWIS +    P  GFW+I  S
Sbjct  181   KELIPPEAVLLVNPIEPEFLGEVDDKYQYSSENINLKVHGWISAESETIPATGFWVIIPS  240

Query  1084  NEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK  1263
             NEFR GG +KQ+LT H GP +L+MFLS HY+G+D  +KL+  E WK VFGP F+Y+N+  
Sbjct  241   NEFRSGGLVKQNLTSHVGPISLAMFLSAHYAGEDIVLKLQPNEPWKKVFGPTFVYLNNLL  300

Query  1264  GTDH---KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDT  1434
               D      LWE AK QM +E + WPY FP S+D+ KA+QRG+V G LL+ D C    D 
Sbjct  301   DHDEDPLAQLWEDAKFQMNKEVQSWPYDFPASDDFQKASQRGSVCGTLLVRDRCVSDKDI  360

Query  1435  PAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDF  1614
              AK A+VGLA PG+ GSWQ +   YQFW+++++ G F I+ +R+G+Y+LYAWVPG +G++
Sbjct  361   IAKGAYVGLAPPGDAGSWQRECKGYQFWSKSNEEGYFSINNIRSGDYNLYAWVPGFIGEY  420

Query  1615  KHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR  1794
              +   + I PGC+I V D+VF P ++G T+WEIGIPDRSAAEF++P+P P   N L  D 
Sbjct  421   WNNVVLKITPGCEINVDDIVFEPPRDGPTLWEIGIPDRSAAEFYVPDPNPKFINKLFKDH  480

Query  1795  TEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPI  1971
              +KFRQYGLW+RY+EL+   DL+Y VG SD  KDWF+AQVTRK   GSY+ T W + F +
Sbjct  481   PDKFRQYGLWERYAELYPNEDLIYNVGVSDYTKDWFYAQVTRKKNDGSYQGTTWQIKFNM  540

Query  1972  ETVAK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSE  2148
             + V + G Y LR+A+AS+  + L + VN D K+D   FT+ + GKDNAIARHGIHGLY  
Sbjct  541   DDVQENGLYKLRLALASANVSELQVRVN-DEKQDPPLFTTGVIGKDNAIARHGIHGLYWL  599

Query  2149  VSFEIPGSLIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
              +  +P  L++KG+N ++L Q+ A  P   F GIMYDYIRLE+
Sbjct  600   FNIGVPSILLIKGDNTIFLTQTMATGPLPLFQGIMYDYIRLES  642



>ref|XP_010458305.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Camelina 
sativa]
 ref|XP_010458306.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Camelina 
sativa]
 ref|XP_010458308.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X4 [Camelina 
sativa]
Length=671

 Score =   614 bits (1583),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/635 (50%), Positives = 423/635 (67%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H+   + VKL +    V+MDNGI++V LSNP G + GI Y G+D N+LE+ NK  +RGYW
Sbjct  39    HMMPSQGVKLHIHDRYVVMDNGILQVTLSNPGGIITGIKYNGLD-NVLEVRNKETNRGYW  97

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  98    DLHWNEPGGKGIFDV-ISGVSFRVIVETEEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  156

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+YAIY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  157   RGSSGVYSYAIYEHLKDWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  216

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEF
Sbjct  217   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPVGFWQITPSNEF  276

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  277   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEHGEPWKKVYGPVFIYLNSTASGD  336

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D  +LW+ AK +M+ E + WPYSF  SEDYPK+ +RG   GRLLI D         A  A
Sbjct  337   DPLSLWDDAKIKMMAEVESWPYSFVASEDYPKSEERGTARGRLLIRDRFISNDMISAAGA  396

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   
Sbjct  397   YVGLAPPGGSGSWQIECKGYQFWAVGDEAGYFSIENVRPGEYNLYAWVPGFIGDYYNGTI  456

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             +++  GC I++GD+V+ P ++G T+W+IGIPDR A+EFFIP+P P L N  L    ++FR
Sbjct  457   VSVTSGCKIEMGDIVYEPPRDGPTLWDIGIPDRKASEFFIPDPDPTLVNRALVHHQDRFR  516

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW RY++L+   DLVYTVG SD  +DWFFAQV RK     +EAT W + F +E +  
Sbjct  517   QYGLWKRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGD-MHEATTWQIRFKLENIDQ  575

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      I
Sbjct  576   KANYKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNI  634

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  635   PGNRLVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  669



>emb|CDP01612.1| unnamed protein product [Coffea canephora]
Length=673

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/632 (49%), Positives = 418/632 (66%), Gaps = 8/632 (1%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             L    PV+L   K+ V++DNG++KV +S P G+V GI Y G+  NLLE  NK  +RGYWD
Sbjct  41    LKKFPPVQLHRQKDHVVVDNGLVKVTVSVPGGTVTGIEYNGIP-NLLETRNKETNRGYWD  99

Query  565   LDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLP  741
             + W  P   A    K+  T F VI E++S VE+SF  TY  S +   +P+NIDKRF++L 
Sbjct  100   VVWKFPHHSAFVE-KLEGTSFDVITEEDSGVELSFTITYDNSINSPQLPLNIDKRFILLR  158

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEV  921
             G +GFYTYAI++  +G   +D+ QTR VFKL   LF ++A++D+ Q  MP+ ++RE G+ 
Sbjct  159   GHNGFYTYAIFERLEGWPALDVSQTRAVFKLEEKLFQYMAISDKRQRIMPTLEDRERGKT  218

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV LT   N  LK +VDDKYQY+ D ++  V+GWI   P  GFW+I  SNEFR+G
Sbjct  219   LAYPEAVLLTNPANHSLKVEVDDKYQYSSDVKDTRVHGWICTNPPTGFWMIIPSNEFRIG  278

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHK  1278
             GP+KQ+LT   G   +S F + HY+G+D   + R GE WK V+GPVF+Y+NS  +  D  
Sbjct  279   GPMKQELTSQAGATTISSFHTNHYAGEDMRQQFRDGEPWKKVYGPVFVYLNSVPESGDPD  338

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             +LWE AK+QML+ET+ WPY FP+SEDY  A QRG+VSGRL++ D    +       A+VG
Sbjct  339   SLWEDAKQQMLQETENWPYDFPRSEDYLSADQRGSVSGRLIVRDTGKNQDLKNGSLAYVG  398

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG  GSWQ ++  YQFWT+ D+ G F I  V  G YSLYAWVPG +GD+K+ + I I
Sbjct  399   LALPGNAGSWQMENKGYQFWTQADNNGNFSIENVLPGNYSLYAWVPGCIGDYKYDSYIII  458

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
              P   I + ++++ P +NG T+WEIGIPDR+A EFF+P+P+P   N L     EKFRQYG
Sbjct  459   SPRTRITLDNVIYEPPRNGPTLWEIGIPDRTAIEFFVPDPSPRFTNPLYL-AYEKFRQYG  517

Query  1819  LWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LWDRYSE++   DLV+TVG S+   DWF+AQV R     +Y  T W + F ++ + +   
Sbjct  518   LWDRYSEIYPDHDLVFTVGDSNYETDWFYAQVNRNIGNHTYIPTTWQIAFDLQNIDESAT  577

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             YTL++A+ASST A L + +N DP      F   L GKDNAIARHGIHGLY   S  + GS
Sbjct  578   YTLQLALASSTGAVLQVRIN-DPNARNPIFNKGLIGKDNAIARHGIHGLYRLYSIGVSGS  636

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+G N ++L QS+  +P+ GIMYDYIRLE 
Sbjct  637   QLVQGRNSIFLTQSRNSFPWEGIMYDYIRLEG  668



>ref|XP_004974169.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X2 [Setaria italica]
Length=642

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/619 (50%), Positives = 413/619 (67%), Gaps = 8/619 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V + NGI ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL WN P +K      
Sbjct  22    VEIKNGIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLVWNPPGQKTGIFDV  80

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I  T+F++I   E+Q EVSF + +  S +   +P+NIDKRF++L GSSGFYTY IY+H +
Sbjct  81    IKGTEFRIIYHDENQAEVSFTRNWDPSLEGKAVPLNIDKRFIVLRGSSGFYTYGIYEHKE  140

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
             G  D  L +TRV FKL +  F ++A+ D  Q  MP   +R    G+ L Y EAV L    
Sbjct  141   GWPDFGLGETRVAFKLRKDKFHYMALADNRQRIMPMPDDRLPPRGQPLAYPEAVLLVDPI  200

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
             NP L+G+VDDKYQY+ + Q  +V+GW+S  P +GFW IT S+EFR GGPLKQ+LT H GP
Sbjct  201   NPDLRGEVDDKYQYSCEDQCNNVHGWMSFDPPIGFWQITPSDEFRTGGPLKQNLTSHVGP  260

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQMLEE  1317
               L+MFLS HY+GDD       GE WK V GPVF+Y+NS   G+D   LWE AK QM+ E
Sbjct  261   TTLAMFLSAHYAGDDLSPVFTNGEYWKKVHGPVFMYLNSSWDGSDPTMLWEDAKVQMMIE  320

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
              + WPYSF  SED+ K  QRG +SGRLL+ D      D  A  A+VGLA PGE GSWQ +
Sbjct  321   KESWPYSFALSEDFQKTEQRGCISGRLLVRDRYIDDEDLYASGAYVGLALPGEVGSWQRE  380

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
                YQFW R D  G F I ++  G Y+LYAWVPG +GD++  A +TI  G DI +GDLV+
Sbjct  381   CKGYQFWCRADVDGSFYIRSIVTGNYNLYAWVPGFIGDYRLDATLTIASGDDIYLGDLVY  440

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTD  1854
              P ++G T+WEIG+PDRSAAEF++P+P P+  N L  +  ++FRQYGLW+RY+EL+  +D
Sbjct  441   EPPRDGPTMWEIGVPDRSAAEFYVPDPNPNYINRLYINHPDRFRQYGLWERYAELYPDSD  500

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAVASSTRA  2031
             LVYT+G+SD + DWF+AQV RK    +Y+ T W + F +++V+ G  Y  R+A+ASS RA
Sbjct  501   LVYTIGQSDYSTDWFYAQVNRKVDDNTYQPTTWQIKFTLDSVSPGSTYKFRVALASSARA  560

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L ++ N D  +    F + L G+DNAIARHGIHGLY   +  +  + +V+G N +YL+Q
Sbjct  561   ELQVFFN-DQNRGVPHFATGLIGRDNAIARHGIHGLYWLFNINVDSAWLVQGMNTIYLKQ  619

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
              +   PF G+MYDY+RLE 
Sbjct  620   PRNQSPFQGLMYDYLRLEG  638



>ref|XP_007018291.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
 gb|EOY15516.1| Rhamnogalacturonate lyase family protein [Theobroma cacao]
Length=645

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/636 (50%), Positives = 426/636 (67%), Gaps = 12/636 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + V+L V  + V+MDN I++V +SNP G V G+ Y G+D NLL + N   DRGYWDL 
Sbjct  2     SSRGVQLDVQDKYVVMDNDILQVTISNPGGIVTGLQYNGID-NLLAVENDETDRGYWDLV  60

Query  571   WNTPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLP  741
             WN    K +     +I AT F VI+E E QVE+SF + + S  +   +P+NIDKRFVML 
Sbjct  61    WNLAGRKGTKGKFDRIEATSFNVIVENEEQVELSFTRMWDSSLEGRVVPLNIDKRFVMLR  120

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
              SSGFYTYAIY+H +      LD+ RV FKL +  F ++A+ D  Q  MP   +R     
Sbjct  121   NSSGFYTYAIYEHLEEWPAFILDRFRVAFKLRKDKFHYMAMADNRQRCMPLPDDRLPYRS  180

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHL--GFWIITASNE  1089
             + L Y EAV L     P+ +G+VDDKYQY+ ++++  V+GWI   P +  GFW IT S+E
Sbjct  181   QTLAYPEAVLLVDPLEPEFRGEVDDKYQYSCENKDNRVHGWICTDPPVPVGFWQITPSDE  240

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKG  1266
             FR  GPLKQ+LT H GP  L++  S+HYSG+D  +K    E WK VFGP+FIY+NS   G
Sbjct  241   FRSAGPLKQNLTSHVGPTTLAVMHSVHYSGEDLLLKFGTNEPWKKVFGPIFIYLNSLSNG  300

Query  1267  TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
              D  +LWE AK+QM  E + WPY+FP SED+P++ QRG VSGRLL+ D      + PA  
Sbjct  301   GDPLSLWEDAKEQMTIEVQGWPYTFPVSEDFPQSDQRGNVSGRLLVKDRYVHDDNIPANG  360

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             A+VGLA PG+ GSWQ +   YQFWT+TD+ G F I+ +R G+Y+LYAWVPG +GD+++  
Sbjct  361   AYVGLAPPGDVGSWQREVKGYQFWTKTDEDGYFCINNIRTGDYNLYAWVPGFIGDYRYNV  420

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKF  1806
              IT   G DI +GDLV+ P ++G T+WEIGIPDR+AAEF++P+P+P   N L  +  ++F
Sbjct  421   IITPTAGYDIYMGDLVYEPPRDGPTLWEIGIPDRTAAEFYVPDPSPVYINKLYVNHQDRF  480

Query  1807  RQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA  1983
             RQYGLW+RY+EL+   DLVYTVG SD  KDWFFAQVTRK    +Y+ T W + F ++ V 
Sbjct  481   RQYGLWERYAELYPDGDLVYTVGVSDYTKDWFFAQVTRKKDDNTYQGTTWQIKFKLDCVD  540

Query  1984  K-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFE  2160
             + G Y LR+A+AS+  + L + VN DP      F+S   GKDN IARHGIHGLY   + +
Sbjct  541   ESGTYKLRLALASAHASELQVRVN-DPDAISPLFSSGQIGKDNTIARHGIHGLYWLYNVD  599

Query  2161  IPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             IPG+L+ +G+N ++L QSK+  PF GIMYDYIRLE 
Sbjct  600   IPGNLLHEGDNTIFLTQSKSTSPFQGIMYDYIRLEG  635



>ref|XP_006586511.1| PREDICTED: rhamnogalacturonate lyase B-like [Glycine max]
Length=618

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/618 (49%), Positives = 417/618 (67%), Gaps = 12/618 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             M+NGII+V+LS PEG+V GI Y G+D N+LE  NK  +RGY+D+ WN P    S  + I 
Sbjct  1     MENGIIRVSLSKPEGTVLGISYNGID-NVLERRNKFNNRGYFDIVWNAPG-STSKLWGIQ  58

Query  616   ATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGGV  795
              + F VI   E+QVEVSF +T+   D + +P+NIDKR+++  GSSG Y YAI++HPK   
Sbjct  59    GSKFSVIEASENQVEVSFTRTWDM-DSSSLPLNIDKRYILRRGSSGLYIYAIFEHPKDFP  117

Query  796   DVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKLK  975
              +++D  R+VFKL R  F ++A+ D+ Q  MP+ ++R +G  L++ EAV +T   NP+L+
Sbjct  118   ALEIDHIRIVFKLQRDRFHYMAIADDRQRVMPTAEDRSKGRRLDFDEAVLITNPSNPELQ  177

Query  976   GKVDDKYQYALDSQNMSVYGWIS----PKPHLGFWIITASNEFRLGGPLKQDLTCHCGPF  1143
             G+VDDKYQY+ ++++  V+GWI+        +GFW+IT SNEFR GGP+KQ LT H GP 
Sbjct  178   GEVDDKYQYSCENKDNKVHGWINLDSNSNESVGFWMITPSNEFRSGGPIKQGLTSHVGPT  237

Query  1144  ALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEET  1320
              L++  + HYSG +  + L+ GE +K V+GPVF Y+NS   G D + LW  A +Q+ EE 
Sbjct  238   TLNILHTTHYSGKEVTMALKEGEPFKKVYGPVFAYLNSVSSGHDSQALWSDAVQQLSEEI  297

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDP-CAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
             K WPY FP SE++  A +RG V GRLL+ D    G        A+VGLA PG+ GSWQ  
Sbjct  298   KSWPYDFPNSEEFFPANKRGRVEGRLLVQDRHIQGGNFVYGDNAYVGLALPGDVGSWQRQ  357

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
             S  YQFWT  D  G+F I  +  G+Y LYAWVPG  GD+KH   ITI PGC I++G L++
Sbjct  358   SKGYQFWTEADKVGQFTIENILPGDYDLYAWVPGIFGDYKHNTTITITPGCVIQLGSLIY  417

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELHKT-  1851
              P +NG T+WEIGIPDRSAAEF++P+P P+L N L +     KFRQYGLW RY+EL+ + 
Sbjct  418   HPPRNGPTIWEIGIPDRSAAEFYVPDPYPNLINRLYIGKPAHKFRQYGLWQRYTELYPSQ  477

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGCYTLRIAVASSTRA  2031
             DLVY V  S+ +KDWF+AQ+ R     ++  T W + F +  V +G YTL++A+AS+TR+
Sbjct  478   DLVYNVDVSNYSKDWFYAQIPRNIGNNTFSPTTWEIKFHLPFVIRGTYTLQLALASATRS  537

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L++ +N +P      F++ L G+DN++ARHGIHGL+   S E+P  L+V+G N +YLRQ
Sbjct  538   NLVVRLN-NPVARPPHFSTGLIGRDNSVARHGIHGLHRPYSIEVPSYLLVEGTNTIYLRQ  596

Query  2212  SKAGYPFYGIMYDYIRLE  2265
             SK   PF G+MYDYIRLE
Sbjct  597   SKGLSPFLGVMYDYIRLE  614



>ref|XP_009397836.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score =   611 bits (1576),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/623 (50%), Positives = 418/623 (67%), Gaps = 13/623 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY------WDLDWNTPKEKAS  597
             MDNGI+++ LS P GS+ G+ + GV  NLLE+ N+   RGY      WD+ WN     + 
Sbjct  1     MDNGIVQLTLSKPRGSITGVKHHGVG-NLLEVKNREDGRGYANIYLYWDVVWNRSDPDSG  59

Query  598   TSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIY  774
                 IL T+F V+ +  +QVEVSF+  +  S     +P+N+DKRFVML GSSGFYTYAIY
Sbjct  60    IFDIILGTEFDVVQQDANQVEVSFRTQWNPSHGGKLVPLNVDKRFVMLRGSSGFYTYAIY  119

Query  775   DHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYKEAVKL  948
             +H +G  D +L +TRV FKL +  F ++A+ D  Q  MP  ++R+ G  + L+Y EAV+L
Sbjct  120   EHLQGWPDFNLAETRVAFKLRKDRFHYMAIADNRQRIMPMPEDRQPGRSQKLDYSEAVRL  179

Query  949   TKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTC  1128
             T   N  L+G+VDDKYQY++++++  V+GWIS  P +GFW+IT S EF+ GGP+KQDLT 
Sbjct  180   TNPINAALRGEVDDKYQYSIENKDSMVHGWISSDPSVGFWVITPSIEFKSGGPVKQDLTS  239

Query  1129  HCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQ  1305
             H GP AL+ F+S HY+GDD   ++R GE WK VFGPVFIY+NS    +D K LWE AKKQ
Sbjct  240   HVGPTALATFVSSHYAGDDILPRVRNGEYWKKVFGPVFIYLNSASTKSDPKLLWEDAKKQ  299

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGS  1485
                E   WPY FP S+D+ K  QRG+VSGRL + D            A VGLA PGE GS
Sbjct  300   ARVEEGSWPYKFPASKDFQKREQRGSVSGRLFVVDEYVAFHYVNGNAAFVGLASPGEAGS  359

Query  1486  WQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVG  1665
             WQ +S  YQFW R D  G F I  VR G Y+LYAWVPG +GD+K   +IT+  G  I +G
Sbjct  360   WQRESKGYQFWVRADAKGMFFIKNVRTGVYNLYAWVPGFIGDYKSSVNITVTSGNHINLG  419

Query  1666  DLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH  1845
             +L + P ++G T+WEIGIPDRSAAEFF+P+P P   N L  +  ++FRQYGLW+RY++L+
Sbjct  420   NLEYRPPRDGPTLWEIGIPDRSAAEFFVPDPYPCYINRLYVNHPDRFRQYGLWERYTDLY  479

Query  1846  KT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVAS  2019
                DL+YTVG S+  KDWF+A VTRK+ + SY+AT W + F +  V + G Y LR+A+AS
Sbjct  480   PDHDLMYTVGISNYKKDWFYAHVTRKHGQASYQATTWQIKFRLNNVRRSGTYKLRLALAS  539

Query  2020  STRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKL  2199
             +  + + +  N    +  A FT++L G+DN+IARHGIHGLY   S ++  S ++KG+N +
Sbjct  540   AVFSEIQVRFNNPIVQQPAHFTTELIGRDNSIARHGIHGLYWLFSIDVDSSWLLKGDNII  599

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             +L Q+++  PF G+MYDYIRLEA
Sbjct  600   FLTQTRSESPFQGVMYDYIRLEA  622



>ref|XP_002301114.1| hypothetical protein POPTR_0002s11090g [Populus trichocarpa]
 gb|EEE80387.1| hypothetical protein POPTR_0002s11090g [Populus trichocarpa]
Length=640

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/630 (49%), Positives = 423/630 (67%), Gaps = 13/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L +  + V+MDNGI++V LSNP G V GI Y G+D NLLE  +   +RGYWDL W+  
Sbjct  6     VQLLIEDQHVVMDNGILQVTLSNPGGIVTGIQYNGID-NLLEALDLETNRGYWDLVWSQA  64

Query  583   KEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
                 +T +F +   T F+VI+E E QVE+SF +T+  S +   + +N+DKRF+ML  SSG
Sbjct  65    GSTGTTGTFDVFEGTTFRVIVENEEQVEISFTRTWDPSLEGKFVSLNLDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAI++H       +L QTR+VF+L +  F ++ V D  Q  MP   +R  E GE L+
Sbjct  125   FYSYAIFEHLADWPPFNLPQTRIVFQLRKDKFHYMVVADNRQRFMPLPDDRQPERGEPLD  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             + EAV L     P+ KG+VDDKYQY+ +++++ V+GW+   P  GFW IT S+EFR GGP
Sbjct  185   FPEAVLLVDPVEPEFKGEVDDKYQYSCENKDLHVHGWMCFDPPTGFWQITPSSEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TL  1284
             LKQ+LT H GP+ L+MFLS HY+G+D  +KL  GE WK VFGPVF+Y+NS    D+  +L
Sbjct  245   LKQNLTSHVGPYTLAMFLSAHYAGEDLVLKLNPGEPWKKVFGPVFMYLNSVMDKDNALSL  304

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             W+ AK+Q   E   WPYSFP SED+P + QRG +SGRL + D         A  A+VGLA
Sbjct  305   WDDAKEQ---EVHCWPYSFPASEDFPCSDQRGKISGRLQVLDRYISHECIAANDAYVGLA  361

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +   YQFWT+TD  G F I  +R G+Y+LYAW+PG +GD+++   IT+  
Sbjct  362   PPGDVGSWQRECKGYQFWTKTDGDGSFCIGDIRTGDYNLYAWIPGFIGDYRNDTVITVTA  421

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             GC+I VGDLV+ P ++G TVWEIGIPDRSAAEF+IP+P P   N L  +  ++FRQYGLW
Sbjct  422   GCEIDVGDLVYEPPRDGPTVWEIGIPDRSAAEFYIPDPNPKYINKLFINHPDRFRQYGLW  481

Query  1825  DRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY++L+   DLVY VG SD  KDWFFAQV RK   G+ E T W + F ++ V + G + 
Sbjct  482   ERYADLYPDGDLVYKVGHSDYKKDWFFAQVNRKKDDGTLEGTTWQIRFKLDNVDQSGAFK  541

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+A++  A L + +N DPK D   F++   G DN IARHG+HGLY   + ++PG+ +
Sbjct  542   LRLALATANVAELQVRIN-DPKIDPPHFSTGEIGHDNTIARHGVHGLYRLYNVDVPGTTL  600

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             V+GEN ++L Q+    P  GIMYDYIRLE 
Sbjct  601   VEGENTVFLTQTPRTSPLQGIMYDYIRLEG  630



>tpg|DAA48720.1| TPA: hypothetical protein ZEAMMB73_778200 [Zea mays]
Length=646

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/633 (50%), Positives = 418/633 (66%), Gaps = 9/633 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   V + V+   V + NGI  + LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL 
Sbjct  12    ATAGVTVKVSDRYVEIKNGIFDLTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLV  70

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P +K      I  T+F+++ + E+Q EVSF + +  S +   +P+NIDKRF++L GS
Sbjct  71    WNPPGQKTGIFDVIKGTEFRIVYQDENQAEVSFTRNWDPSLEGKAVPLNIDKRFIVLRGS  130

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H +G  D  L +TRV FKL + +F ++A+ D+ Q  MP   +R    G+ 
Sbjct  131   SGFYTYGIYEHKEGWPDFGLGETRVAFKLRKDMFHYMALADDRQRIMPMPDDRLPPRGQP  190

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NP+L+G+VDDKYQY+ + Q  +V+GW+S  P +GFW IT S+EFR G
Sbjct  191   LAYPEAVLLVDPINPELRGEVDDKYQYSCEDQYNNVHGWMSFDPPIGFWQITPSDEFRTG  250

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GPLKQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS    +D  
Sbjct  251   GPLKQNLTSHVGPTMLAMFLSAHYAGDDLSPKFTNGEYWKKVHGPVFMYLNSSWDASDPT  310

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E   WPY F  SED+ K  QRG VSGRLL+ D      D  A  A+VG
Sbjct  311   MLWEDAKVQMMIEKGNWPYCFALSEDFQKTEQRGCVSGRLLVRDRYIDDQDLYASGAYVG  370

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW R D  G F I  +  G Y+LYAWVPG LGD+K  A +TI
Sbjct  371   LALPGEAGSWQRECKGYQFWCRADVDGSFYIRNIVTGNYNLYAWVPGFLGDYKLDATVTI  430

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQY  1815
               G DI +GDLV+ P ++G T+WEIG+PDRSAAEF++P+P P+  N L ++   ++FRQY
Sbjct  431   ASGDDIYLGDLVYEPPRDGPTMWEIGVPDRSAAEFYVPDPNPNYVNRLYVNHPADRFRQY  490

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KG  1989
             GLW+RY+EL+  +DLVYTVG+SD + DWF+AQV RK    +Y+ T W + F +++V+   
Sbjct  491   GLWERYAELYPDSDLVYTVGQSDYSTDWFYAQVNRKIDDNTYQPTTWQIKFDLDSVSPSS  550

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y  R+A+ASS  A L I  N D  +    F + L G+DNAIARHGIHGLY   + ++  
Sbjct  551   TYKFRVALASSALAELQISFN-DQDRAVPHFATGLIGRDNAIARHGIHGLYWLFNIDVAS  609

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +V+G N +YL+Q ++  PF G+MYDY+RLE 
Sbjct  610   AWLVQGVNTIYLKQPRSQSPFQGLMYDYLRLEG  642



>dbj|BAK04420.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/635 (50%), Positives = 420/635 (66%), Gaps = 11/635 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   VKL VT   V++ N I ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWD+ 
Sbjct  25    AMDGVKLKVTSRYVIIKNDIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDIV  83

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P ++      I  T+F++I   E+Q EVSF +++  S +   +P+ IDKRF++L GS
Sbjct  84    WNPPGQRTGIFDVIKGTEFRIIHHDENQAEVSFTRSWDPSQEGKAVPLIIDKRFIVLRGS  143

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H  G  D  + +TRV FKL +  F ++A+ D  Q  MP   +R    G+ 
Sbjct  144   SGFYTYGIYEHKAGWPDFGIGETRVAFKLRKDKFHYMAMADNRQRIMPMPDDRLPPRGQQ  203

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NPKL+G+VDDKYQY+ + +  SV+GW+S  P +GFW IT S+EFR G
Sbjct  204   LAYPEAVLLVDPINPKLRGEVDDKYQYSCEDRYNSVHGWVSSDPPIGFWQITPSDEFRTG  263

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK-GTDHK  1278
             GPLKQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS + G+D  
Sbjct  264   GPLKQNLTSHVGPTMLAMFLSAHYAGDDLSPKFTNGEYWKKVHGPVFMYLNSSQDGSDPS  323

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDP-CAGKTDTPAKCAHV  1455
              LWE AK QM+ E + WPY F  SED+ K  QRG +SGRLL+ D       D  A  A+V
Sbjct  324   LLWEDAKVQMMMEKQSWPYDFALSEDFQKTEQRGCISGRLLVRDRYIIEDEDLYAASAYV  383

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PGE GSWQ +   YQFW + D  G F I  +  G Y+LYAWVPG +GD++  A +T
Sbjct  384   GLALPGEAGSWQRECKGYQFWCQADTDGSFYIKNIVTGNYNLYAWVPGFIGDYRFDAILT  443

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR-TEKFRQ  1812
             I  G DI +GDLVF P ++G T+WEIGIPDRSAAEF++P+P P+  N L  +   ++FRQ
Sbjct  444   ISSGDDIYLGDLVFEPPRDGPTMWEIGIPDRSAAEFYVPDPNPNYVNRLFINHPADRFRQ  503

Query  1813  YGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNA-KGSYEATIWTVVFPIETV-A  1983
             YGLW+RY+EL+   DLVYT+G+S+ + DWF+AQVTR+   + +Y+AT W + F ++ V  
Sbjct  504   YGLWERYAELYPDRDLVYTIGESNYSTDWFYAQVTRRRGDEETYQATTWQIRFSLDAVPP  563

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
                Y LR+A+ASS  A L +  N D  +    FT+ L G+DNAIARHGIHGLY   S ++
Sbjct  564   NSTYKLRVALASSANAELQVRFN-DEARAAPHFTTGLIGRDNAIARHGIHGLYWLFSMDV  622

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              G+ +V+G N +YL+Q +   PF G+MYDY+RLE 
Sbjct  623   SGAWLVRGMNIVYLKQPRNQSPFQGVMYDYLRLEG  657



>dbj|BAD10227.1| putative MYST1 [Oryza sativa Japonica Group]
 dbj|BAD33010.1| putative MYST1 [Oryza sativa Japonica Group]
Length=645

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/633 (49%), Positives = 419/633 (66%), Gaps = 8/633 (1%)
 Frame = +1

Query  388   GACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             GA   V + V+   V + NGI ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL
Sbjct  11    GATAGVSVKVSDRYVEIKNGIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDL  69

Query  568   DWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPG  744
              W+   E+      I  T+F++I + E+  EVSF +T+  S +   +P+NIDKRF++L G
Sbjct  70    VWSKLGERTGIFDVIKGTEFRIIYQDENHAEVSFVRTWDPSLEGKAVPLNIDKRFIVLRG  129

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
              SGFYTY IY+H +G     L +TRV FKL +  F ++A+ D+ Q  MP  ++R    G+
Sbjct  130   CSGFYTYGIYEHQEGWPGFSLGETRVAFKLRKDKFHYMALADDRQRIMPMPEDRVPPRGQ  189

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L    NP L+G+VDDKYQY+ + Q  +V+GWIS  P +GFW IT S+EFR 
Sbjct  190   QLAYPEAVLLVDPINPDLRGEVDDKYQYSCEDQYNNVHGWISFDPPIGFWQITPSDEFRT  249

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDH  1275
             GGP+KQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS   G+D 
Sbjct  250   GGPVKQNLTSHVGPTMLAMFLSGHYAGDDLTPKFLTGEYWKKVHGPVFMYLNSSWDGSDP  309

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
               LWE AK QM+ E + WPY F  S+D+ K  QRG +SGRLL+ D      D  A  A+V
Sbjct  310   TLLWEDAKVQMMIEKESWPYCFALSDDFQKTEQRGCISGRLLVRDRYLDDADLYATSAYV  369

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+ GSWQ +   YQFW R +D G F I  + AG+Y+LYAWVPG +GD+K  A +T
Sbjct  370   GLALPGDVGSWQRECKGYQFWCRAEDDGSFCIRNIVAGDYNLYAWVPGFIGDYKLDAKLT  429

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  G DI +GDLV+ P ++G T+WEIGIPDRSA+EFF+P+P P+  N L  +  ++FRQY
Sbjct  430   ISSGDDIYLGDLVYEPPRDGPTMWEIGIPDRSASEFFVPDPNPNYVNRLYINHPDRFRQY  489

Query  1816  GLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KG  1989
             GLW+RY+EL+   DLVYT+G+SD   DWFFAQV R+  + +Y+ T W + F +++V+   
Sbjct  490   GLWERYAELYPDGDLVYTIGQSDYTTDWFFAQVNRRTDQSTYQPTTWQIKFNLDSVSPNS  549

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y  R+A+ASS  A L +  N D  +    FT+ L GKDN IARHGIHGLY   + ++ G
Sbjct  550   TYKFRVALASSANAELQVRFN-DQDRTAPHFTTGLIGKDNTIARHGIHGLYWLFNIDVSG  608

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +V+G N +YL+Q +   PF G+MYDY+R+E 
Sbjct  609   AWLVQGMNTIYLKQPRNQSPFQGLMYDYLRMEG  641



>ref|XP_008664579.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Zea 
mays]
Length=657

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/633 (50%), Positives = 418/633 (66%), Gaps = 9/633 (1%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             A   V + V+   V + NGI  + LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL 
Sbjct  23    ATAGVTVKVSDRYVEIKNGIFDLTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLV  81

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P +K      I  T+F+++ + E+Q EVSF + +  S +   +P+NIDKRF++L GS
Sbjct  82    WNPPGQKTGIFDVIKGTEFRIVYQDENQAEVSFTRNWDPSLEGKAVPLNIDKRFIVLRGS  141

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEV  921
             SGFYTY IY+H +G  D  L +TRV FKL + +F ++A+ D+ Q  MP   +R    G+ 
Sbjct  142   SGFYTYGIYEHKEGWPDFGLGETRVAFKLRKDMFHYMALADDRQRIMPMPDDRLPPRGQP  201

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L Y EAV L    NP+L+G+VDDKYQY+ + Q  +V+GW+S  P +GFW IT S+EFR G
Sbjct  202   LAYPEAVLLVDPINPELRGEVDDKYQYSCEDQYNNVHGWMSFDPPIGFWQITPSDEFRTG  261

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GPLKQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS    +D  
Sbjct  262   GPLKQNLTSHVGPTMLAMFLSAHYAGDDLSPKFTNGEYWKKVHGPVFMYLNSSWDASDPT  321

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LWE AK QM+ E   WPY F  SED+ K  QRG VSGRLL+ D      D  A  A+VG
Sbjct  322   MLWEDAKVQMMIEKGNWPYCFALSEDFQKTEQRGCVSGRLLVRDRYIDDQDLYASGAYVG  381

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PGE GSWQ +   YQFW R D  G F I  +  G Y+LYAWVPG LGD+K  A +TI
Sbjct  382   LALPGEAGSWQRECKGYQFWCRADVDGSFYIRNIVTGNYNLYAWVPGFLGDYKLDATVTI  441

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQY  1815
               G DI +GDLV+ P ++G T+WEIG+PDRSAAEF++P+P P+  N L ++   ++FRQY
Sbjct  442   ASGDDIYLGDLVYEPPRDGPTMWEIGVPDRSAAEFYVPDPNPNYVNRLYVNHPADRFRQY  501

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KG  1989
             GLW+RY+EL+  +DLVYTVG+SD + DWF+AQV RK    +Y+ T W + F +++V+   
Sbjct  502   GLWERYAELYPDSDLVYTVGQSDYSTDWFYAQVNRKIDDNTYQPTTWQIKFDLDSVSPSS  561

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y  R+A+ASS  A L I  N D  +    F + L G+DNAIARHGIHGLY   + ++  
Sbjct  562   TYKFRVALASSALAELQISFN-DQDRAVPHFATGLIGRDNAIARHGIHGLYWLFNIDVAS  620

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +V+G N +YL+Q ++  PF G+MYDY+RLE 
Sbjct  621   AWLVQGVNTIYLKQPRSQSPFQGLMYDYLRLEG  653



>ref|XP_008781369.1| PREDICTED: probable rhamnogalacturonate lyase B [Phoenix dactylifera]
Length=646

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/634 (50%), Positives = 423/634 (67%), Gaps = 29/634 (5%)
 Frame = +1

Query  388   GACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             G+   V+L V  + V++DNGI+++ LSNP G V GI Y GVD NLLE+ N   +RG    
Sbjct  31    GSPTDVRLAVQDQYVIIDNGILQLTLSNPGGIVTGIRYNGVD-NLLEVGNVEDNRG----  85

Query  568   DWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPG  744
                           I  T+F+ I + E QVEVSF +T+  S + T IP+N+DKRFV+L G
Sbjct  86    --------------IKGTNFRTIFQSEEQVEVSFTRTWTPSLNGTLIPLNLDKRFVVLRG  131

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--E  918
             SSGFYTYAI++H +G  + D+   RV FKL +  F ++A++D  Q  MP   +R  G  +
Sbjct  132   SSGFYTYAIFEHLEGWPEFDIGVLRVAFKLRKDKFHYMAISDNRQRIMPMPDDRMPGRCQ  191

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV LT   NP LKG+VDDKYQY+++ Q+  V+GWIS  P +GFW IT S+E R 
Sbjct  192   QLAYPEAVLLTNPINPDLKGEVDDKYQYSIEDQDNKVHGWISFDPPIGFWQITPSDEART  251

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDH  1275
             GGP+KQDLT H GP  L++F+S HYSG     K   GE WK VFGPVF+Y+NS   G D 
Sbjct  252   GGPVKQDLTSHVGPTTLAIFVSSHYSGQ--SPKFSYGEYWKKVFGPVFVYLNSASDGKDP  309

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
             K LW+ AKKQM  E + WPYSFP S+D+ K++QRG+VSG+LL+ D      D  A  ++V
Sbjct  310   KILWQDAKKQMQREVESWPYSFPVSKDFEKSSQRGSVSGKLLVRDRYIHGEDIYANGSYV  369

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PGE GSWQ +   YQFWTR D  G F I  VR G+Y+LYAWVPG +GD+K+ A IT
Sbjct  370   GLALPGEAGSWQRECKGYQFWTRADANGGFSIRNVRTGQYNLYAWVPGFIGDYKYSATIT  429

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQ  1812
             I  G ++ +GDL++ P ++  T WEIGIPDRSAAEF+IP+P P   N L ++D   ++RQ
Sbjct  430   ITSGNNVDLGDLIYEPPRDNVTFWEIGIPDRSAAEFYIPDPNPKYVNRLYINDPANRYRQ  489

Query  1813  YGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AK  1986
             YGLW+RY++L+   DLVYT+GKSD   DWFFAQVTRK  + SY+ T W + F +++V   
Sbjct  490   YGLWERYADLYPDRDLVYTIGKSDYKNDWFFAQVTRKTDQNSYKPTTWQIKFHLDSVNPS  549

Query  1987  GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
             G Y LR+A+AS+T + L +  + + K +   FT++L GKDNAIARHGIHGLY   +  I 
Sbjct  550   GSYNLRVALASATHSKLQVHFS-NLKANPPHFTAELNGKDNAIARHGIHGLYWLYNINIQ  608

Query  2167  GSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              + +V+G+N ++L Q  +  PF GIMYDYIR+E 
Sbjct  609   NNWLVQGDNTIFLTQPNSQSPFQGIMYDYIRMEG  642



>ref|XP_010417021.1| PREDICTED: probable rhamnogalacturonate lyase B [Camelina sativa]
 ref|XP_010417022.1| PREDICTED: probable rhamnogalacturonate lyase B [Camelina sativa]
Length=679

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/637 (49%), Positives = 419/637 (66%), Gaps = 16/637 (3%)
 Frame = +1

Query  388   GACKPVKLTV-----TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDR  552
             G   P  LTV     + + V++DNGII+V  S+P+G + GI Y G+D+    L ++I+DR
Sbjct  45    GKNIPAALTVQLRRVSHDKVVIDNGIIQVTFSSPQGLITGIKYHGIDN---VLDDEIEDR  101

Query  553   GYWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRF  729
             GYWD+ W  P +K     K+  T F++I + E QVE+SF +T+  S   + +P+N+DKR+
Sbjct  102   GYWDVTWYEPGKKLEID-KLEGTKFEIITQNEEQVEISFTRTWTISKRGSLVPLNVDKRY  160

Query  730   VMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE  909
             ++  G SG Y Y I +  +   DVD+DQ R+VFKL+   F  +A++D+ Q  MPS  +R+
Sbjct  161   IIRSGVSGIYMYGILERLEDWPDVDMDQIRIVFKLNPKKFDFMAISDDRQRSMPSMADRD  220

Query  910   EGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNE  1089
               + L YKEAV  T   NP  KG+VDDKY Y+++ ++ +V+GWIS +P +GFW+IT ++E
Sbjct  221   NAKQLAYKEAVLFTNPRNPMFKGEVDDKYMYSMEDKDNNVHGWISSEPPVGFWMITPNDE  280

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGT  1269
             FRLGGP+KQDLT H GP  LSMF S HY+G +  +  R GE WK VFGPVF Y+NS    
Sbjct  281   FRLGGPMKQDLTSHAGPITLSMFTSTHYAGKEMRMDYRNGEPWKKVFGPVFAYLNSVSPK  340

Query  1270  DHK-TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKC  1446
             D    LW  AK+QM  E K WPY F  S DYP   QRG + G+ LI D    +     + 
Sbjct  341   DSTLRLWRDAKRQMAAEVKSWPYDFVTSVDYPLRHQRGTIEGQFLIKDSYVSRLRIYGRY  400

Query  1447  AHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKA  1626
             + VGLA  GE GSWQ +S  YQFWT+ D  G+F I  VRAG YSLYAW  G +GD+K + 
Sbjct  401   SFVGLAPIGEAGSWQTESKGYQFWTKADRKGRFIIENVRAGNYSLYAWGFGFIGDYKFEQ  460

Query  1627  DITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEK  1803
             +ITI PG  + VG +V+ P +NG T+WEIG+PDR+A EF+IP+P P L N L ++   ++
Sbjct  461   NITITPGSVMNVGPIVYEPPRNGPTLWEIGVPDRTAREFYIPDPYPTLMNKLYVNPLQDR  520

Query  1804  FRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV  1980
             FRQYGLWDRY++L+ + DLVYTVG SD  +DWFFA VTR     +Y  T W ++F +  V
Sbjct  521   FRQYGLWDRYADLYPQNDLVYTVGVSDYRRDWFFAHVTRNVGNNTYNPTTWQIIFNLRNV  580

Query  1981  AK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSF  2157
              + G YTLRIA+AS+  + L I +N DPK D   FT+   GKDNAIARHGIHGLY   S 
Sbjct  581   NRVGLYTLRIALASAANSELQIRIN-DPKSDHI-FTTGYIGKDNAIARHGIHGLYRLYSI  638

Query  2158  EIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             ++ GSL+  G+N +YL QS++   F GIMYDYIRLE+
Sbjct  639   DVAGSLLNVGDNTIYLTQSRSLGLFDGIMYDYIRLES  675



>ref|NP_001062464.1| Os08g0554100 [Oryza sativa Japonica Group]
 dbj|BAF24378.1| Os08g0554100 [Oryza sativa Japonica Group]
Length=658

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/633 (49%), Positives = 419/633 (66%), Gaps = 8/633 (1%)
 Frame = +1

Query  388   GACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             GA   V + V+   V + NGI ++ LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL
Sbjct  24    GATAGVSVKVSDRYVEIKNGIFELTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDL  82

Query  568   DWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPG  744
              W+   E+      I  T+F++I + E+  EVSF +T+  S +   +P+NIDKRF++L G
Sbjct  83    VWSKLGERTGIFDVIKGTEFRIIYQDENHAEVSFVRTWDPSLEGKAVPLNIDKRFIVLRG  142

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
              SGFYTY IY+H +G     L +TRV FKL +  F ++A+ D+ Q  MP  ++R    G+
Sbjct  143   CSGFYTYGIYEHQEGWPGFSLGETRVAFKLRKDKFHYMALADDRQRIMPMPEDRVPPRGQ  202

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L    NP L+G+VDDKYQY+ + Q  +V+GWIS  P +GFW IT S+EFR 
Sbjct  203   QLAYPEAVLLVDPINPDLRGEVDDKYQYSCEDQYNNVHGWISFDPPIGFWQITPSDEFRT  262

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDH  1275
             GGP+KQ+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS   G+D 
Sbjct  263   GGPVKQNLTSHVGPTMLAMFLSGHYAGDDLTPKFLTGEYWKKVHGPVFMYLNSSWDGSDP  322

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
               LWE AK QM+ E + WPY F  S+D+ K  QRG +SGRLL+ D      D  A  A+V
Sbjct  323   TLLWEDAKVQMMIEKESWPYCFALSDDFQKTEQRGCISGRLLVRDRYLDDADLYATSAYV  382

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+ GSWQ +   YQFW R +D G F I  + AG+Y+LYAWVPG +GD+K  A +T
Sbjct  383   GLALPGDVGSWQRECKGYQFWCRAEDDGSFCIRNIVAGDYNLYAWVPGFIGDYKLDAKLT  442

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  G DI +GDLV+ P ++G T+WEIGIPDRSA+EFF+P+P P+  N L  +  ++FRQY
Sbjct  443   ISSGDDIYLGDLVYEPPRDGPTMWEIGIPDRSASEFFVPDPNPNYVNRLYINHPDRFRQY  502

Query  1816  GLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KG  1989
             GLW+RY+EL+   DLVYT+G+SD   DWFFAQV R+  + +Y+ T W + F +++V+   
Sbjct  503   GLWERYAELYPDGDLVYTIGQSDYTTDWFFAQVNRRTDQSTYQPTTWQIKFNLDSVSPNS  562

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y  R+A+ASS  A L +  N D  +    FT+ L GKDN IARHGIHGLY   + ++ G
Sbjct  563   TYKFRVALASSANAELQVRFN-DQDRTAPHFTTGLIGKDNTIARHGIHGLYWLFNIDVSG  621

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +V+G N +YL+Q +   PF G+MYDY+R+E 
Sbjct  622   AWLVQGMNTIYLKQPRNQSPFQGLMYDYLRMEG  654



>ref|XP_009626140.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Nicotiana 
tomentosiformis]
Length=635

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/633 (49%), Positives = 426/633 (67%), Gaps = 17/633 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             ++L    + V+++NG++++  +NP G + GI Y+G+D NLLEL+NK  + G+WDL+W+  
Sbjct  6     LRLNAQNDYVVINNGVVEITWTNPGGIIRGIKYKGID-NLLELNNKDLNGGFWDLNWS--  62

Query  583   KEKASTSFK-----ILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPG  744
              E  ST  +     I  TD +VI+E E Q+E+SF + +    + +  P+ ID+RFV+   
Sbjct  63    -EAGSTKTRGKFDTIEGTDLQVIVENEKQIELSFTRMWNPAVQGEQAPLYIDRRFVVFRD  121

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
               GFY+YAI++H K     +L+ TR+ F L++  F ++A+TD+ Q  MPS ++R  E G+
Sbjct  122   VPGFYSYAIFEHTKDMPSFNLNTTRIAFMLNKEKFHYMAITDDRQRFMPSAEDRLAERGQ  181

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L     P+ KG+VDDKYQY+L++++  V+GWI   P +GFW IT SNEFR 
Sbjct  182   ALAYPEAVLLVDPIEPEFKGEVDDKYQYSLENKDNQVHGWICFDPPVGFWQITPSNEFRT  241

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK  1278
             GGP KQDLT H  P  L++FL+ HY+G D  +K   GE WK V GPVF Y NS    +  
Sbjct  242   GGPFKQDLTSHVNPTTLAIFLTSHYAGPDLLVKFEPGEEWKKVLGPVFTYFNSVSDKEMA  301

Query  1279  -TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
              TLW+ AK+QM +E + WPYSFP SE++PK  QRG V GRLL+ D    K + P K A+V
Sbjct  302   LTLWDDAKRQMNKEVQSWPYSFPASEEFPKCGQRGIVKGRLLVQDRYLSKGNLPGKDAYV  361

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA PG+ GSWQ ++  YQFWT TD+ G F I  +RAG YSLYA VPG +GD+K++  IT
Sbjct  362   GLAAPGDAGSWQRENKGYQFWTTTDEDGYFVIENIRAGSYSLYALVPGFIGDYKYEVVIT  421

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  GC+I++G+LV+ P ++G T+WEIGIPDRSAAEF+IP+P P   N L  ++ +KFRQY
Sbjct  422   ITEGCNIELGELVYEPPRDGPTLWEIGIPDRSAAEFYIPDPNPKYVNKLYINQ-DKFRQY  480

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKG  1989
             GLW+RY+EL+   DLVYTVG ++  KDWFFAQV RK  + +Y++T W + F I+ V   G
Sbjct  481   GLWERYAELYPDNDLVYTVGVNEYQKDWFFAQVNRKIGENAYQSTTWKIKFKIDNVNLVG  540

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              YTLR+A+A++  A L + +N DP  D   F+S   G DNAIARH IHG+Y   +  IPG
Sbjct  541   AYTLRLALAAANHAELQVRIN-DPTADPPLFSSGEIGGDNAIARHAIHGIYWLFNVTIPG  599

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             SL++ GEN + L Q+K    F GIMYDYIRLE 
Sbjct  600   SLLLGGENIILLTQTKTANAFQGIMYDYIRLEG  632



>gb|KHN08932.1| Rhamnogalacturonate lyase [Glycine soja]
Length=618

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/618 (49%), Positives = 416/618 (67%), Gaps = 12/618 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             M+NGII+V+LS PEG+V GI Y G+D N+LE  NK  +RGY+D+ WN P    S  + + 
Sbjct  1     MENGIIRVSLSKPEGTVLGISYNGID-NVLERRNKFNNRGYFDIVWNAPG-STSKLWGMQ  58

Query  616   ATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGGV  795
              + F VI   E+QVEVSF +T+   D + +P+NIDKR+++  GSSG Y YAI++HPK   
Sbjct  59    GSKFSVIEASENQVEVSFTRTWDM-DSSSLPLNIDKRYILRRGSSGLYIYAIFEHPKDFP  117

Query  796   DVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKLK  975
              +++D  R+VFKL R  F ++A+ D+ Q  MP+ ++R +G  L++ EAV +T   NP+L+
Sbjct  118   ALEIDHIRIVFKLQRDRFHYMAIADDRQRVMPTAEDRSKGRRLDFDEAVLITNPSNPELQ  177

Query  976   GKVDDKYQYALDSQNMSVYGWIS----PKPHLGFWIITASNEFRLGGPLKQDLTCHCGPF  1143
             G+VDDKYQY+ ++++  V+GWI+        +GFW+IT SNEFR GGP+KQ LT H GP 
Sbjct  178   GEVDDKYQYSCENKDNKVHGWINLDSNSNESVGFWMITPSNEFRSGGPIKQGLTSHVGPT  237

Query  1144  ALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEET  1320
              L++  + HYSG +  + L+ GE +K V+GPVF Y+NS   G D + LW  A +Q+ EE 
Sbjct  238   TLNILHTTHYSGKEVTMALKEGEPFKKVYGPVFAYLNSVSSGHDSQALWSDAVQQLSEEI  297

Query  1321  KLWPYSFPKSEDYPKAAQRGAVSGRLLIHDP-CAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
             K WPY FP SE++  A +RG V GRLL+ D    G +      A+VGLA PG+ GSWQ  
Sbjct  298   KSWPYDFPNSEEFFPANKRGRVEGRLLVQDRHIQGGSFVYGDNAYVGLALPGDVGSWQRQ  357

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
             S  YQFWT  D  G+F I  +  G+Y LY WVPG  GD+KH   ITI PGC I++G L++
Sbjct  358   SKGYQFWTEADKVGQFTIENILPGDYDLYGWVPGIFGDYKHNTTITITPGCVIQLGSLIY  417

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELHKT-  1851
              P +NG T+WEIGIPDRSAAEF++P+P P+L N L +     KFRQYGLW RY+EL+ + 
Sbjct  418   NPPRNGPTIWEIGIPDRSAAEFYVPDPYPNLINRLYIGKPAHKFRQYGLWQRYTELYPSQ  477

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGCYTLRIAVASSTRA  2031
             DLVY V  S+ +KDWF+AQ+ R     ++  T W + F +  V +G YTL++A+AS+TR+
Sbjct  478   DLVYNVDVSNYSKDWFYAQIPRNIGNHTFSPTTWEIKFHLPFVIRGTYTLQLALASATRS  537

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              L + +N +P      F++ L G+DN++ARHGIHGL+   S E+P  L+V+G N +YLRQ
Sbjct  538   NLAVRLN-NPVARPPHFSTGLIGRDNSVARHGIHGLHRPYSIEVPSYLLVEGTNTIYLRQ  596

Query  2212  SKAGYPFYGIMYDYIRLE  2265
             SK   PF G+MYDYIRLE
Sbjct  597   SKGLSPFLGVMYDYIRLE  614



>ref|XP_008664578.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Zea 
mays]
Length=703

 Score =   610 bits (1574),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/629 (50%), Positives = 417/629 (66%), Gaps = 9/629 (1%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V + V+   V + NGI  + LSNP+G V G+ Y GVD NL+E+ NK  +RGYWDL WN P
Sbjct  73    VTVKVSDRYVEIKNGIFDLTLSNPDGIVTGVRYNGVD-NLMEILNKEDNRGYWDLVWNPP  131

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFY  759
              +K      I  T+F+++ + E+Q EVSF + +  S +   +P+NIDKRF++L GSSGFY
Sbjct  132   GQKTGIFDVIKGTEFRIVYQDENQAEVSFTRNWDPSLEGKAVPLNIDKRFIVLRGSSGFY  191

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             TY IY+H +G  D  L +TRV FKL + +F ++A+ D+ Q  MP   +R    G+ L Y 
Sbjct  192   TYGIYEHKEGWPDFGLGETRVAFKLRKDMFHYMALADDRQRIMPMPDDRLPPRGQPLAYP  251

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L    NP+L+G+VDDKYQY+ + Q  +V+GW+S  P +GFW IT S+EFR GGPLK
Sbjct  252   EAVLLVDPINPELRGEVDDKYQYSCEDQYNNVHGWMSFDPPIGFWQITPSDEFRTGGPLK  311

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWE  1290
             Q+LT H GP  L+MFLS HY+GDD   K   GE WK V GPVF+Y+NS    +D   LWE
Sbjct  312   QNLTSHVGPTMLAMFLSAHYAGDDLSPKFTNGEYWKKVHGPVFMYLNSSWDASDPTMLWE  371

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK QM+ E   WPY F  SED+ K  QRG VSGRLL+ D      D  A  A+VGLA P
Sbjct  372   DAKVQMMIEKGNWPYCFALSEDFQKTEQRGCVSGRLLVRDRYIDDQDLYASGAYVGLALP  431

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ +   YQFW R D  G F I  +  G Y+LYAWVPG LGD+K  A +TI  G 
Sbjct  432   GEAGSWQRECKGYQFWCRADVDGSFYIRNIVTGNYNLYAWVPGFLGDYKLDATVTIASGD  491

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSDRTEKFRQYGLWD  1827
             DI +GDLV+ P ++G T+WEIG+PDRSAAEF++P+P P+  N L ++   ++FRQYGLW+
Sbjct  492   DIYLGDLVYEPPRDGPTMWEIGVPDRSAAEFYVPDPNPNYVNRLYVNHPADRFRQYGLWE  551

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYTL  2001
             RY+EL+  +DLVYTVG+SD + DWF+AQV RK    +Y+ T W + F +++V+    Y  
Sbjct  552   RYAELYPDSDLVYTVGQSDYSTDWFYAQVNRKIDDNTYQPTTWQIKFDLDSVSPSSTYKF  611

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+ASS  A L I  N D  +    F + L G+DNAIARHGIHGLY   + ++  + +V
Sbjct  612   RVALASSALAELQISFN-DQDRAVPHFATGLIGRDNAIARHGIHGLYWLFNIDVASAWLV  670

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G N +YL+Q ++  PF G+MYDY+RLE 
Sbjct  671   QGVNTIYLKQPRSQSPFQGLMYDYLRLEG  699



>gb|EYU30914.1| hypothetical protein MIMGU_mgv1a002612mg [Erythranthe guttata]
Length=654

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/626 (50%), Positives = 415/626 (66%), Gaps = 10/626 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L    + V+M NGI+ + L+ P G+V  I Y G  DNLL   +K  DRG+W++ WN  
Sbjct  21    VELLRDDQHVVMSNGIVSIRLTVPGGAVTNITYNG-SDNLLLPEDKEADRGHWNIVWNM-  78

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYT  762
              E+      +  T +KVI++ E+Q E+SF +T+  G  T+ P+N+DKRFVML  S GFY+
Sbjct  79    TERGKIIDNLEGTSYKVIVQNENQTEISFTRTWTVG-STNAPLNVDKRFVMLRDSPGFYS  137

Query  763   YAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAV  942
             Y + +  KG    DL+  R+VFKL  ++F ++A++D  Q  MP+ ++RE GE L YKEAV
Sbjct  138   YTVLERLKGWPVFDLENGRMVFKLDGNMFDYMAMSDVRQRYMPTSEDRENGEKLEYKEAV  197

Query  943   KLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDL  1122
              LT   NP  KG+VDDKY Y+ D+++  V+GW+S     GFW+IT SNEFR GGPLKQDL
Sbjct  198   LLTNPSNPDFKGEVDDKYLYSCDNKDNKVHGWVSSNLSSGFWMITPSNEFRSGGPLKQDL  257

Query  1123  TCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG--TDHKTLWEGA  1296
             T H GP  LS+F+S HY+G D  +K    E WK V GPVFIY+NSD    T+   LW  A
Sbjct  258   TSHVGPTVLSVFISTHYAGVDLALKFESQEYWKKVLGPVFIYLNSDASAKTNPSVLWSDA  317

Query  1297  KKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGE  1476
             KK+MLEE   WPYSFP S+++ K+ QRGA+SG+LL+ D    K   PA  ++VGLA  G+
Sbjct  318   KKRMLEEVASWPYSFPNSKEFVKSEQRGALSGQLLVQDRFVHKKAAPASSSYVGLAPLGK  377

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +S  YQFWT+TD+ G F I  V  G YSL+AWVPG +GD+KH +DITI PG +I
Sbjct  378   AGSWQFESKGYQFWTQTDEDGSFSIKNVIPGNYSLFAWVPGFVGDYKHASDITITPGSNI  437

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
             +  ++VF   +NG T+WE+GIPDRSAAEFFIP+P    K +      EKFRQYGLW RY 
Sbjct  438   QATNVVFDAPRNGPTLWELGIPDRSAAEFFIPDPDSRFKIHQYKQPVEKFRQYGLWARYG  497

Query  1837  ELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIA  2010
             EL+ + DLV+TVG S+ ++DWFF+QVTR N  G Y  T W ++F ++ V K G YTL++A
Sbjct  498   ELYPQKDLVFTVGSSNYSQDWFFSQVTR-NVGGQYVGTTWQILFDLKDVDKTGNYTLQLA  556

Query  2011  VASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGE  2190
             +AS   A L +  N    K    FT+ + GKDNAIARHGI GLY   +  +PGS ++ G 
Sbjct  557   LASIHYAELQVRFNN--PKSAPHFTTGVIGKDNAIARHGIRGLYRFYTIPVPGSSLLVGT  614

Query  2191  NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             N ++L Q++   PF  IMYDYIRLE 
Sbjct  615   NTIFLTQTQIQSPFVEIMYDYIRLEG  640



>ref|XP_010490461.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Camelina 
sativa]
Length=670

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/635 (50%), Positives = 420/635 (66%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H    + VKL +    V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYW
Sbjct  38    HRMPSQGVKLHIHDRYVVMDNGILQVTLSNPGGIITGIKYNGVD-NVLEVRNKETNRGYW  96

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  97    DLHWNEPGGKGIFDV-ISGVSFRVIVETEEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  155

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+YAIY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  156   RGSSGVYSYAIYEHLKDWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  215

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEF
Sbjct  216   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPVGFWQITPSNEF  275

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  276   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEYGEPWKKVYGPVFIYLNSTANGD  335

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D   LW+ AK +M+ E + WPYSF  SE+YPK+ +RG   GRLLI D         A  A
Sbjct  336   DPLCLWDDAKIKMMAEVESWPYSFVASEEYPKSEERGTALGRLLIRDRFISNDLISAAGA  395

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   
Sbjct  396   YVGLAPPGGSGSWQIECKGYQFWAVGDEAGYFSIGNVRPGEYNLYAWVPGFIGDYHNGTI  455

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             +++  GC I++GD+V+ P ++G T+W+IGIPDR A+EFFIP+P P L N  L    ++FR
Sbjct  456   VSVTSGCKIEMGDIVYEPPRDGPTLWDIGIPDRKASEFFIPDPDPTLVNRALVHHQDRFR  515

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW RY++L+   DLVYTVG SD  +DWFFAQV RK     +E T W + F +E +  
Sbjct  516   QYGLWKRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGD-VHEGTTWQIRFKLENIDQ  574

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      I
Sbjct  575   KANYKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNI  633

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  634   PGNRLVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  668



>ref|XP_010530581.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X10 [Tarenaya 
hassleriana]
Length=644

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/633 (49%), Positives = 423/633 (67%), Gaps = 13/633 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L + ++ V+MDNGI++V +S P+G + GI Y G+  NLLE  N+   RGYWDL W+  
Sbjct  7     VELRIQEKHVVMDNGILQVTISKPDGMITGICYNGIK-NLLETHNEESHRGYWDLVWSEE  65

Query  583   KEKASTSFK--ILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 +T     I  T F+V+ E E QVE+SF + + +  +  I PINIDKR++ML  SSG
Sbjct  66    GSGGTTGTDEVISGTSFEVVAENEEQVEISFSRKWDTSLQGKIVPINIDKRYIMLRDSSG  125

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H       +L QTR+VF+L +  F ++AV D  Q +MP  ++R    G  L 
Sbjct  126   FYSYAIYEHLAEWPAFNLPQTRIVFRLRKDKFRYMAVADNRQRKMPLPEDRLPRRGRALA  185

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L      + KG+VDDKYQY+ +++++ V+GWIS  P LG W I  SNEFR GG 
Sbjct  186   YPEAVLLVHPVEEEFKGEVDDKYQYSCENKDLRVHGWISQNPPLGCWQIIPSNEFRSGGL  245

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDH-K  1278
              KQ+LT H GP +LSMFLS HY+G+D  +K++ GEAWK VFGPVF Y+N   D  TD   
Sbjct  246   SKQNLTSHVGPISLSMFLSAHYAGEDMVMKIKAGEAWKKVFGPVFTYLNCLPDGVTDSIS  305

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
             +LW  AK QML E + WPY FP SED+P + QRG++SGR+L+ D      + PA  A +G
Sbjct  306   SLWRDAKNQMLIEVESWPYDFPASEDFPASDQRGSISGRILVCDKFVNDGNLPANGAFIG  365

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             L  PGEPGSWQ +S  YQFWT  D+ G F I+ +R GEY+L A+VPG +GDF+++ +I+I
Sbjct  366   LTPPGEPGSWQLESKGYQFWTEADEDGYFMINNIREGEYNLNAYVPGFIGDFQYEQEISI  425

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               GCDI VG++V  P ++G T+WEIG+PDRSAAEF++P+P P+  N L  D  ++FRQYG
Sbjct  426   TAGCDIDVGNIVHRPPRDGPTLWEIGVPDRSAAEFYVPDPNPNYINKLYIDHPDEFRQYG  485

Query  1819  LWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GC  1992
             LW+RY E + + DLVYTVG SD  KDWFFA VTRK  + +YE T W + F +++V K   
Sbjct  486   LWERYEETYPQEDLVYTVGLSDYKKDWFFAHVTRKRGEDAYERTTWKIKFVMDSVDKNNS  545

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+A++  A L + +N D  +D   +T+ + G DNAIARHGIHG+Y   S ++P  
Sbjct  546   YKLRIALATANVAELQVRLN-DMNQDPPMYTTGVIGHDNAIARHGIHGIYRLYSVDVPSD  604

Query  2173  LIVKGE-NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             L+++G+ N L+L Q     PF G+MYDY+R E 
Sbjct  605   LLIEGDTNTLFLTQPINIGPFNGLMYDYLRFEG  637



>emb|CDX94932.1| BnaC05g07390D [Brassica napus]
Length=674

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/629 (49%), Positives = 423/629 (67%), Gaps = 12/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L ++   V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYWDL WN P
Sbjct  49    VRLYISDRYVVMDNGILQVTLSNPGGIITGIKYNGVD-NVLEIRNKETNRGYWDLHWNEP  107

Query  583   KEKASTSFKILATD-FKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
               K    F +++ + F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML GSSG 
Sbjct  108   GGKGI--FDVISGESFRVIVETEEQVEISFLRTWNPSLEGKYIPLNIDKRFIMLRGSSGV  165

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNY  930
             YTY IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G  + L+Y
Sbjct  166   YTYGIYEHLKEWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGRCQTLDY  225

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
             +EA  LT   +P L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT SNEFR GGPL
Sbjct  226   QEASLLTAPCDPHLQGEVDDKYQYSCENKDLRVHGWISFDPPVGFWQITPSNEFRSGGPL  285

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LW  1287
             KQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS    D    LW
Sbjct  286   KQNLTSHVGPTTLAVFHSTHYAGKTMMPRFECGEPWKKVYGPVFIYLNSTAARDDSLFLW  345

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             + AK +M+ E + WPYSF  SEDYPK+ +RG   GRLL+ D         A+ A+VGLA 
Sbjct  346   DDAKIKMMAEVESWPYSFVASEDYPKSEERGTARGRLLVCDRFVSNDLISAQGAYVGLAP  405

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG+ GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   +++  G
Sbjct  406   PGDAGSWQIECKGYQFWAIADEAGYFSIDNVRPGEYNLYAWVPGFIGDYHNNIVVSVTSG  465

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C I++GD+V+ P ++G T+WEIGIPDR A+EFFIP+P P L N +L    ++FRQYGLW 
Sbjct  466   CKIEMGDIVYEPPRDGPTLWEIGIPDRKASEFFIPDPDPTLVNRVLVQPQDRFRQYGLWK  525

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+   DLVYT+G SD  +DWFFA V RK   G +E T W + F +E +  K  Y L
Sbjct  526   RYTDLYPNNDLVYTIGVSDYRRDWFFAHVPRKKGDG-HEGTTWQIRFKLENIDQKANYKL  584

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T A L + +N D +  +  FT+ L G+DN+IARHGIHG+Y   +  IPG+  V
Sbjct  585   RVAIASATLAELQVRLN-DAEATRPLFTTGLIGRDNSIARHGIHGVYMLYTVNIPGNRFV  643

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L+Q +   PF GIMYDYIRLE 
Sbjct  644   QGDNTIFLKQPRCNGPFQGIMYDYIRLEG  672



>ref|XP_009364825.1| PREDICTED: probable rhamnogalacturonate lyase B [Pyrus x bretschneideri]
Length=660

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/624 (47%), Positives = 422/624 (68%), Gaps = 8/624 (1%)
 Frame = +1

Query  409   LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKE  588
             LT T  +V+++NGI+++  S+P G V GI Y+G+D NLLE+ N   +RGYWD+ WN  + 
Sbjct  36    LTKTNNLVVLNNGIVRLTFSHPGGDVIGIQYKGID-NLLEIKNHENNRGYWDVVWNNRET  94

Query  589   KASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTY  765
             +     K+  T FKVI  +  Q+E+SF KTY  S     + +N+DKR++M  G +GFY Y
Sbjct  95    EGVD--KLQGTKFKVITARADQIEISFTKTYDVSFGNATLSMNVDKRYIMQRGRAGFYAY  152

Query  766   AIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVK  945
             +I++ P+G  ++D+ Q R+V+KL +  F  + V+D+ Q  MP+ ++RE G  L Y EAV 
Sbjct  153   SIFERPEGWPEMDIYQIRIVYKLQQDKFQFMVVSDDRQRIMPTAEDRENGIKLAYPEAVL  212

Query  946   LTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLT  1125
             LT   NP L+G+VDDKYQY+ ++++  V+GWI   P +GFWII  ++EFR  GP KQ+LT
Sbjct  213   LTNPSNPDLRGEVDDKYQYSSENKDNKVHGWICTNPAVGFWIIIPNDEFRTAGPFKQELT  272

Query  1126  CHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLWEGAKKQ  1305
              H GP ALSMF+S HY+G + G++   GEAWK VFGPVF+Y+NS    +   LWE AK+Q
Sbjct  273   SHVGPTALSMFVSTHYAGKEVGMRFTEGEAWKKVFGPVFVYLNSVPTLNETILWENAKEQ  332

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGS  1485
             + EE   WPY+F +SE++P ++ RG+V+G+LL+ D    K+   A  A+VGLA PG  GS
Sbjct  333   LAEEVNSWPYNFTQSENFPSSSGRGSVAGQLLVQDWYISKSRVWANSAYVGLAPPGNAGS  392

Query  1486  WQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVG  1665
             WQ +S  YQFWT+ ++ G F I  VR G Y+LYA VPG +GD+K++A+ITI+PG +I + 
Sbjct  393   WQKESKGYQFWTQANEQGYFLIRDVRPGNYNLYATVPGIIGDYKYEANITIEPGSEINLA  452

Query  1666  DLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLL-SDRTEKFRQYGLWDRYSEL  1842
             +L + P +NG T+WEIGIPDRSAAEF +P+P P L N L  ++R  KFRQYGLW+RY++L
Sbjct  453   NLTYVPPRNGPTLWEIGIPDRSAAEFNVPDPNPTLMNKLFTTNRANKFRQYGLWERYADL  512

Query  1843  H-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVA  2016
             +   DL+YTVG  + + +WFFA VTR     +YE T W ++F ++ +   G YTL++A+A
Sbjct  513   YPDEDLIYTVGTDNYSDNWFFAHVTRNIGNHTYEPTTWKILFELQNLTNPGNYTLQLALA  572

Query  2017  SSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             S+T A + +  N +       FT+ L G+DNAIARHGIHGLY      +P   + +G N 
Sbjct  573   SATNAEVQVRFN-NQSAFPPHFTTGLIGRDNAIARHGIHGLYWLFGIIVPSYQLREGNNT  631

Query  2197  LYLRQSKAGYPFYGIMYDYIRLEA  2268
             +YL QS++   F G+MYDYIRLE 
Sbjct  632   IYLTQSRSLGTFEGVMYDYIRLEG  655



>gb|KHN24870.1| Rhamnogalacturonate lyase [Glycine soja]
Length=659

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/627 (49%), Positives = 422/627 (67%), Gaps = 15/627 (2%)
 Frame = +1

Query  418   TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKAS  597
              +E +++DNGI+ V  S PEG + GI Y G+D N+LE  N+ +DRGY D+ WNTP  K S
Sbjct  30    NREQLVVDNGIVAVTFSRPEGYILGISYNGID-NILEEENEDQDRGYLDVVWNTPG-KPS  87

Query  598   TSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIY  774
                +I  T F VI   E+ VE+SF K++ S  + + +P+NID R+++  G SGFY+YAI+
Sbjct  88    NFQRIHGTIFSVIAADENMVELSFSKSWTSSLNGSSVPMNIDIRYILRSGDSGFYSYAIF  147

Query  775   DHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTK  954
             D P+G   V++DQ R+VFKL++  F ++A++DE Q  MP+ ++RE G++L Y EAV LT+
Sbjct  148   DRPEGLPAVEIDQIRIVFKLNKDRFNYMAISDERQRSMPTMRDRETGQILAYPEAVLLTR  207

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWIS----PKPHLGFWIITASNEFRLGGPLKQDL  1122
               NP+ +G+VDDKYQY+ +++  +V+GWIS      P +GFW+IT S+EFR  GP+KQDL
Sbjct  208   PINPEFRGEVDDKYQYSCENKVNTVHGWISVDAADAPPVGFWMITPSSEFRNAGPIKQDL  267

Query  1123  TCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAK  1299
             T H GP  LSMF+S HY+G +  +  + GE +K VFGPVF Y+N+    D   +LW  A 
Sbjct  268   TSHVGPITLSMFVSTHYAGKEVTMAFQEGEIYKKVFGPVFAYVNNASNEDDTLSLWSDAV  327

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDP-CAGKTDTPAKCAHVGLAKPGE  1476
             +Q  +E + WPY FPKS D+    QRG V GRLL+ D    G     A  ++VGLA PG+
Sbjct  328   QQQSKEVRSWPYDFPKSVDFIPPNQRGIVLGRLLVQDRYFRGGRLLYANNSYVGLALPGD  387

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +S  YQFWT+ D  G F I+ V  G+Y+LYAWVPG +GD+++ A ITI PG  I
Sbjct  388   EGSWQIESKGYQFWTQADTKGFFLINNVVPGDYNLYAWVPGFIGDYRYNATITITPGGVI  447

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-RTEKFRQYGLWDRY  1833
             ++  LV+ P +NG T+WEIG PDR AAEF++PEP P L N L ++ R +KFRQYGLW+RY
Sbjct  448   RLDSLVYVPPRNGPTIWEIGFPDRKAAEFYVPEPYPTLMNKLYNEQRRDKFRQYGLWERY  507

Query  1834  SELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFP-IETVAKGCYTLRI  2007
             ++L+   DLVYTVG S   KDWFFA VTR     +Y+ T W ++F     + +G YTL++
Sbjct  508   TDLYPNDDLVYTVGISKYRKDWFFAHVTRSTGNKTYQPTTWQIIFEHPNQIIRGNYTLQL  567

Query  2008  AVASSTRATLLIWVNGDPKKDKAKF-TSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             A+A +  A L + VN DP  +   F T K+GG D+AIARHG+HGLY   S  +P    VK
Sbjct  568   ALACTADADLQVRVN-DPSANPPDFATGKIGG-DSAIARHGVHGLYRLFSINVPSDRFVK  625

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G N +YLRQS+A  PF G+MYDYIRLE
Sbjct  626   GTNTIYLRQSRAMNPFQGVMYDYIRLE  652



>ref|XP_010490456.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Camelina 
sativa]
Length=673

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/635 (50%), Positives = 420/635 (66%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H    + VKL +    V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYW
Sbjct  41    HRMPSQGVKLHIHDRYVVMDNGILQVTLSNPGGIITGIKYNGVD-NVLEVRNKETNRGYW  99

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  100   DLHWNEPGGKGIFDV-ISGVSFRVIVETEEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  158

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+YAIY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  159   RGSSGVYSYAIYEHLKDWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  218

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEF
Sbjct  219   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPVGFWQITPSNEF  278

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  279   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEYGEPWKKVYGPVFIYLNSTANGD  338

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D   LW+ AK +M+ E + WPYSF  SE+YPK+ +RG   GRLLI D         A  A
Sbjct  339   DPLCLWDDAKIKMMAEVESWPYSFVASEEYPKSEERGTALGRLLIRDRFISNDLISAAGA  398

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   
Sbjct  399   YVGLAPPGGSGSWQIECKGYQFWAVGDEAGYFSIGNVRPGEYNLYAWVPGFIGDYHNGTI  458

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             +++  GC I++GD+V+ P ++G T+W+IGIPDR A+EFFIP+P P L N  L    ++FR
Sbjct  459   VSVTSGCKIEMGDIVYEPPRDGPTLWDIGIPDRKASEFFIPDPDPTLVNRALVHHQDRFR  518

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW RY++L+   DLVYTVG SD  +DWFFAQV RK     +E T W + F +E +  
Sbjct  519   QYGLWKRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGD-VHEGTTWQIRFKLENIDQ  577

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      I
Sbjct  578   KANYKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNI  636

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  637   PGNRLVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  671



>ref|XP_011099950.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Sesamum 
indicum]
Length=672

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/638 (49%), Positives = 415/638 (65%), Gaps = 16/638 (3%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY--  558
             L A   V L    + V+M NGI+ V L+ P G V  I Y+G  +NLL+  NK  +RGY  
Sbjct  38    LPASSTVHLQRHNQHVVMSNGIVNVTLTAPGGLVTSITYKG-SENLLQTQNKEDNRGYAS  96

Query  559   ----WDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIPINIDKR  726
                 WD+ W  P        K+L T +KVI       E+SF  T+  G    +P+N+DKR
Sbjct  97    KFMYWDVVWTKPGGHDIMD-KLLGTRYKVIRRNRDHTEISFTTTWTVG-SARVPLNVDKR  154

Query  727   FVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER  906
             +VML  S GFY+YA+ +  KG    D+ + R+VFKL  + F ++A++DE Q  MP   +R
Sbjct  155   YVMLRDSPGFYSYAVLERLKGWPAFDIQEARIVFKLEENRFQYMAMSDERQRVMPMSVDR  214

Query  907   EEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASN  1086
               G+VL+Y EAV LT+  NP+LKG+VDDKY Y+ D++N  V+GW+S   H+GFW+IT SN
Sbjct  215   YTGQVLDYPEAVLLTRPTNPELKGEVDDKYLYSCDNKNNKVHGWVS-NDHVGFWMITPSN  273

Query  1087  EFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG  1266
             EFR GGP KQDLT H GP  LSMF+S HY+G+D  +K +  E WK VFGPV+IY+NSD  
Sbjct  274   EFRTGGPFKQDLTSHVGPTLLSMFISTHYAGEDLALKFQSEEYWKKVFGPVYIYLNSDAS  333

Query  1267  --TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPA  1440
               T+   LW  AK++M  E   WPY+FP SED+ K+ QRGA  G+LL+HD    K   P 
Sbjct  334   SKTNPSILWNDAKQRMQMEEGSWPYNFPLSEDFLKSNQRGAARGQLLVHDWYKNKKALPG  393

Query  1441  KCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKH  1620
               ++VGLA PG  GSWQ ++  YQFWT+TD  G F I  V  G YSL+AWVPG +GD+KH
Sbjct  394   ASSYVGLAPPGAVGSWQLENRGYQFWTQTDQEGNFLIKNVIPGTYSLFAWVPGTIGDYKH  453

Query  1621  KADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTE  1800
             ++DITI PG  +++ ++VF   + G T+WEIG+PDR+AAEFFIP P P  K +      E
Sbjct  454   RSDITISPGSIVELRNVVFEAPRKGATLWEIGVPDRTAAEFFIPNPDPKFKIHQYERPIE  513

Query  1801  KFRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIET  1977
             +FRQYGLW  Y++ +  TDLVYTVG+SD  KDWFFA VTR      ++AT W ++F +  
Sbjct  514   RFRQYGLWTGYTDHYPHTDLVYTVGQSDYEKDWFFAHVTRNLGDRQFQATTWQILFNLTK  573

Query  1978  VAKGC-YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVS  2154
             V KG  YTL+IA+AS+ +A L + VN   +K    FT++L G+DNA+ARHGIHGLY   S
Sbjct  574   VTKGANYTLQIALASANQAELQVRVND--QKSLPHFTTRLIGRDNALARHGIHGLYHLYS  631

Query  2155  FEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +I GS ++ G N ++L Q+++  PF  +MYDYIRLE 
Sbjct  632   IDITGSRLINGTNTIFLTQARSQGPFREVMYDYIRLEG  669



>ref|XP_010475848.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Camelina 
sativa]
Length=669

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/635 (50%), Positives = 419/635 (66%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H    + VKL +    V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYW
Sbjct  37    HRMPSQGVKLHIHDRYVVMDNGILQVTLSNPGGIITGIKYNGVD-NVLEVRNKETNRGYW  95

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E + QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  96    DLHWNEPGGKGIFDV-ISGVSFRVIVETDEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  154

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+Y IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  155   RGSSGVYSYGIYEHLKNWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  214

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEF
Sbjct  215   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPVGFWQITPSNEF  274

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  275   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEHGEPWKKVYGPVFIYLNSTANGD  334

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D   LW+ AK +M+ E + WPYSF  SE+YPK+ +RG   GRLLI D         A  A
Sbjct  335   DPLCLWDDAKIKMMAEVESWPYSFVASEEYPKSEERGMARGRLLIRDRFISNDLISAAGA  394

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   
Sbjct  395   YVGLAPPGGSGSWQIECKGYQFWAVGDEAGYFSIENVRPGEYNLYAWVPGFIGDYHNGTI  454

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             +++  GC I++GD+V+ P ++G T+W+IGIPDR A+EFFIP+P P L N  L    ++FR
Sbjct  455   VSVTSGCKIEMGDIVYEPPRDGPTLWDIGIPDRKASEFFIPDPDPTLVNRALVHHQDRFR  514

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW RY++L+   DLVYTVG SD  +DWFFAQV RK     +E T W + F +E +  
Sbjct  515   QYGLWKRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGD-VHEGTTWQIRFKLENIDQ  573

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      I
Sbjct  574   KANYKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNI  632

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  633   PGNRLVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  667



>ref|XP_006472995.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Citrus 
sinensis]
Length=623

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/619 (49%), Positives = 415/619 (67%), Gaps = 10/619 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDW--NTPKEKASTSFK  609
             MDNGI++V LSNP+G V GI Y G++ NLLE++N+  +RGYWDL W  +  K K     +
Sbjct  1     MDNGILQVTLSNPQGHVTGIQYNGIE-NLLEVNNRESNRGYWDLVWGGDGIKRKKGLLDR  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I AT+F VI E E QVE+SF +T+ S  +   +P+ IDKRFVM  G SGFYTYAI++H +
Sbjct  60    IEATNFAVIEEHEEQVELSFTRTWDSSLEGKVVPLKIDKRFVMRSGPSGFYTYAIFEHLQ  119

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
             G   + +   R+ FKL++  F ++A+ D  +  MP   +R     +VL + EAV L    
Sbjct  120   GWPAIGIGNIRMAFKLNKDKFHYMAIADNRKRFMPLPDDRLSNRSQVLAFPEAVLLVNPI  179

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGP  1140
              P+ +G+VDDKYQY+ +S+++ V+GWI   P  G W IT SNEFR  GP+KQ +T H GP
Sbjct  180   EPQFRGEVDDKYQYSSESKDIRVHGWICRNPAAGLWQITPSNEFRSAGPVKQYITSHVGP  239

Query  1141  FALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEE  1317
              +L++  S HY+G D  + +  GE WK VFGP+F+Y+NS   G D + LWE A KQM+ E
Sbjct  240   TSLNVLHSTHYAGADLILNIEDGEPWKKVFGPIFVYLNSLSHGGDFQKLWEDANKQMMTE  299

Query  1318  TKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQND  1497
              + WP +F  S+D+PK+ QRG VSGR+++HD        PAK A+VGLA PG+ GSWQ +
Sbjct  300   VQGWPPNFLASKDFPKSDQRGNVSGRIVVHDRYVNDKSIPAKGAYVGLAPPGDVGSWQRE  359

Query  1498  SMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVF  1677
               SYQFWT  ++ G F  + VR G Y+LYA+VPG +GD+K+   I I PG    + DLV+
Sbjct  360   CKSYQFWTSANEDGYFSFNNVRPGNYNLYAFVPGFIGDYKYDNVIAISPGSQANLDDLVY  419

Query  1678  TPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTD  1854
              P ++G T+WEIGIPDRSAAEFF+P+P P   N L  +  ++FRQYGLW+RY+EL+   D
Sbjct  420   EPPRDGPTIWEIGIPDRSAAEFFVPDPNPKYINKLYVNHPDRFRQYGLWERYAELYPDED  479

Query  1855  LVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVASSTRA  2031
             LVY+VG SD  KDWFFAQVTRK    +Y  T W + F I+ +   G Y LR+A+A++  A
Sbjct  480   LVYSVGVSDYRKDWFFAQVTRKKDNSTYRGTTWQIKFKIDNLDENGTYKLRLALATANVA  539

Query  2032  TLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              LL+ VN DP K+   F++ + GKDN IARHGIHGLY   +  +PGSL++KG N ++L Q
Sbjct  540   QLLVGVN-DPSKNPPLFSTGVIGKDNTIARHGIHGLYYLYNVSVPGSLLLKGNNTIFLTQ  598

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             +++  PF GIMYDYIRLE 
Sbjct  599   TESISPFQGIMYDYIRLEG  617



>ref|XP_010027974.1| PREDICTED: rhamnogalacturonate lyase B [Eucalyptus grandis]
 gb|KCW54628.1| hypothetical protein EUGRSUZ_I00574 [Eucalyptus grandis]
Length=697

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/618 (49%), Positives = 423/618 (68%), Gaps = 8/618 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             VL+DNG+++V LS P+G V GI Y G+D NLLE  N+  +RGYWD+ WN P E      +
Sbjct  79    VLIDNGLVQVTLSIPDGDVIGIRYNGID-NLLEGLNEENNRGYWDVVWNWPGEPIKYD-R  136

Query  610   ILATDFKVIMEKESQVEVSF-KKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I  T ++V+ + E Q+E+SF +K   S + T +P++IDKR+++  G+SGFY Y I++ P+
Sbjct  137   IQGTIYRVVTQNEDQIEMSFVRKWSPSANHTVVPLHIDKRYIVRRGTSGFYAYGIFERPE  196

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G  D+++DQ R+V++L    F  +A++D+ Q  MP  ++R  G+ L Y EAV LT   NP
Sbjct  197   GLPDIEMDQVRIVYRLQNKKFHFMALSDDRQRVMPMPEDRITGQPLAYPEAVLLTDPINP  256

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
             +L+G+VDDKYQY+ ++Q  +V+GWI   P +GFW+IT SNEFR  GP+KQDLT H GP  
Sbjct  257   ELRGEVDDKYQYSCENQYNNVHGWICGDPPVGFWLITPSNEFRTAGPVKQDLTSHVGPIT  316

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETK  1323
             LSMF+S HY+G + G+K +GG  WK VFGPV IY+NS     D  TLW+ AK++M  E+K
Sbjct  317   LSMFVSTHYAGKEVGMKFQGGRPWKKVFGPVLIYLNSVPPEEDTSTLWQNAKEKMYMESK  376

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY F +SED+P + +RG V G+LL+ D    K     + A+VGLA PG+ GSWQ ++ 
Sbjct  377   TWPYGFAESEDFPSSKERGMVVGQLLVRDRYVSKRYLWGEFAYVGLASPGQAGSWQRENK  436

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFW R D  G F I+ +RAGEY+LY WVPG +GD+K+K  +TI PG  I +G L++ P
Sbjct  437   GYQFWHRADRKGNFIINNIRAGEYNLYGWVPGTIGDYKYKGIVTITPGSVINLGMLIYEP  496

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLS-DRTEKFRQYGLWDRYSELH-KTDL  1857
              ++G T+WEIG+PDR+A+EF++P+P P L N L + +R  +FRQYGLW+RY++L+ ++DL
Sbjct  497   PRHGPTLWEIGVPDRTASEFYVPQPYPTLMNNLYANNRQYRFRQYGLWERYADLYPRSDL  556

Query  1858  VYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKGC-YTLRIAVASSTRAT  2034
             V+ VG  D  KDWFFAQVTR     ++ AT W +VF +ETV K   Y L++A+AS T + 
Sbjct  557   VFHVGVDDYRKDWFFAQVTRNLYNYTFAATTWQIVFELETVKKTAGYVLQLALASVTESD  616

Query  2035  LLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQS  2214
             L +  N DP  +   F +   G+DNAIARHGIHGLY   S  +P S + +G N ++L Q+
Sbjct  617   LQVRFN-DPTMEPPLFATGRIGQDNAIARHGIHGLYWLYSIPVPSSQLRRGSNTIFLTQA  675

Query  2215  KAGYPFYGIMYDYIRLEA  2268
              A  P+ G+MYDYIRLE 
Sbjct  676   WAINPYQGVMYDYIRLEG  693



>ref|XP_009771424.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X3 [Nicotiana 
sylvestris]
Length=607

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/604 (50%), Positives = 412/604 (68%), Gaps = 12/604 (2%)
 Frame = +1

Query  484   VAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEV  663
             V GI Y G++ NLLE  N+  +RGYWD+ WN P +K     K+ ATDF VIM  E+QVE+
Sbjct  2     VTGIQYNGIE-NLLEDENEDDNRGYWDIVWNKP-DKPGIFDKLHATDFNVIMADENQVEL  59

Query  664   SFKKTYKSGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRS  843
             SFK+T+ S + + + +NIDKRF+++ GSSGFY+Y I +  +G  ++D+ Q R+VFKL   
Sbjct  60    SFKRTWDSLNNSHLSMNIDKRFIIIRGSSGFYSYGILERLEGWPNIDVYQGRIVFKLKEE  119

Query  844   LFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNM  1023
             LF ++A++DE Q  MP+ ++RE G+ L+Y EAV LT   N  +KG+VDDKYQY+ ++++ 
Sbjct  120   LFQYMAISDERQRIMPTAQDREMGQKLDYPEAVLLTNPTNSFIKGEVDDKYQYSCENKDN  179

Query  1024  SVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLR  1203
              V+GWISP P  GFW+IT ++EFR GGPLKQDLT H GP  L+MF S HY+G+  G+K R
Sbjct  180   RVHGWISPNPRTGFWMITPTDEFRTGGPLKQDLTSHTGPVNLNMFFSTHYAGESLGLKFR  239

Query  1204  GGEAWKMVFGPVFIYIN--SDKGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQR  1377
              GE WK VFGPVF Y+N  S    D  TLW  AK+QM  ET+ WPY+FP SED+ ++ QR
Sbjct  240   DGEPWKKVFGPVFTYLNSLSPDELDTLTLWTDAKEQMFIETENWPYNFPLSEDFVRSDQR  299

Query  1378  GAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISA  1557
             G V+GRLL+ D         A  A +GLA PG+ GSWQ ++  YQFWT+TD  G F I+ 
Sbjct  300   GIVTGRLLVRDSYESDKLITANSAFIGLAAPGDVGSWQMENKGYQFWTQTDTEGYFLINN  359

Query  1558  VRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAA  1737
             V  G YSLYAW+PG +GD+ H A I + PG   +V  LV+   +NG T+WEIGIP+R+A+
Sbjct  360   VITGNYSLYAWIPGFIGDYMHDAYINVNPGSRTRVETLVYDAPRNGPTLWEIGIPERTAS  419

Query  1738  EFFIPEPAPDLKNYL-LSDRTEKFRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQV  1911
             EFFIP+  P L N L + +  E+FRQYGLWDRY+E++   DLV+TVG S+   DWFFA V
Sbjct  420   EFFIPDAQPRLLNQLYVVNNAERFRQYGLWDRYTEIYPDDDLVFTVGLSNYQTDWFFAHV  479

Query  1912  TR----KNAKGSYEATIWTVVFPIETVAKGC-YTLRIAVASSTRATLLIWVNGDPKKDKA  2076
              R     +   +Y  T W V+F ++ + +   YTL++A+AS+  A L +  N D + D  
Sbjct  480   NRYIYNDDGNKTYVPTTWQVLFDLDDIDQSANYTLQLALASANDAELQVQFN-DAEPDAP  538

Query  2077  KFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYI  2256
              +T+ L GKDNAIARHGIHGLY   +  +PGSL+V G N +YL+Q+++  P+ GIMYDYI
Sbjct  539   HYTTGLIGKDNAIARHGIHGLYRLYTINVPGSLLVFGTNVMYLKQTRSERPWRGIMYDYI  598

Query  2257  RLEA  2268
             RLE 
Sbjct  599   RLEG  602



>ref|XP_006495333.1| PREDICTED: probable rhamnogalacturonate lyase B-like [Citrus 
sinensis]
Length=695

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/630 (47%), Positives = 428/630 (68%), Gaps = 9/630 (1%)
 Frame = +1

Query  403   VKLTVTKEM--VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN  576
             VKL + ++   V+M NG+++V +S P G V GI Y+G+D NLL+  NK++ RGYWD+ WN
Sbjct  59    VKLYMNRDRPEVVMSNGLVQVTVSRPGGGVTGIKYKGID-NLLDYKNKVERRGYWDVIWN  117

Query  577   TPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSG  753
              P++   +   + AT F+V+   E QVE+SF + +  S   + +P+N+D R++M  G SG
Sbjct  118   EPRDPTGSYDVLKATKFRVVKLDEDQVELSFTRKWNFSHRGSLVPLNVDMRYIMRRGVSG  177

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYK  933
             FY YAI +  +G  DV +DQ R VFKL    F ++A++D  Q  M   ++R  G+ L+Y+
Sbjct  178   FYFYAIMEREEGWPDVYMDQIRAVFKLREDKFRYMALSDHKQKLMALNEDRVRGQTLDYR  237

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV LT   + +LKG+VDDKYQY+ ++++  V+GWIS  P +GFW+IT S+EFR  GP+K
Sbjct  238   EAVLLTNPTDQRLKGEVDDKYQYSSENKDNRVHGWISHNPRVGFWMITPSDEFRTCGPIK  297

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH-KTLWE  1290
             Q+LT H GP  LSMF S HY+G +       G+ WK V GP F+Y+NS    ++ + LWE
Sbjct  298   QELTSHAGPTVLSMFSSTHYAGREIDTYYAKGQPWKKVLGPAFVYLNSVSSHENPRALWE  357

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QML E + WPY FP+S+D+PK+ QRG VSG+L +HD    +    AK A+VGLA P
Sbjct  358   DAKQQMLREVESWPYDFPRSKDFPKSHQRGRVSGQLQVHDRYVNEKPMSAKSAYVGLAAP  417

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ ++  YQFWT+TD+ G F I  VR G+Y+LYAWVPG +GD+K+  +IT++ G 
Sbjct  418   GDAGSWQAETRGYQFWTKTDEEGHFAIENVREGDYNLYAWVPGFVGDYKYGFNITVRAGS  477

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
              I +G +VF P +NG T+WEIG+PDRSAAEFF+P+P    KN + +  ++KFRQYGLW+R
Sbjct  478   KINLGTVVFEPPRNGPTLWEIGVPDRSAAEFFVPDPYTKYKNPVFTGPSDKFRQYGLWER  537

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYTLR  2004
             Y++ + K DL+YT+G S+  +DWFFA V RK    +++ T   ++F +E V+ KG YTL+
Sbjct  538   YADFYPKDDLLYTIGVSNYTRDWFFAHVNRKVGNNTFQPTTRQIIFQLEDVSNKGNYTLQ  597

Query  2005  IAVASSTRATLLIWVNGDPKKDKAK--FTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             +A++++T + L + +N + ++   +  F++   G+DNAIARHGIHGLY   S  +P  L+
Sbjct  598   LALSAATFSNLRVRLNFNSRQRNMRPLFSTGTIGRDNAIARHGIHGLYRFYSINVPSYLL  657

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +G N +YL QS+   PF G+MYDYIR E 
Sbjct  658   NRGNNTIYLTQSRNNGPFQGVMYDYIRFEG  687



>ref|XP_010475847.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Camelina 
sativa]
Length=672

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/635 (50%), Positives = 419/635 (66%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H    + VKL +    V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYW
Sbjct  40    HRMPSQGVKLHIHDRYVVMDNGILQVTLSNPGGIITGIKYNGVD-NVLEVRNKETNRGYW  98

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E + QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  99    DLHWNEPGGKGIFDV-ISGVSFRVIVETDEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  157

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+Y IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  158   RGSSGVYSYGIYEHLKNWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  217

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEF
Sbjct  218   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPVGFWQITPSNEF  277

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  278   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEHGEPWKKVYGPVFIYLNSTANGD  337

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D   LW+ AK +M+ E + WPYSF  SE+YPK+ +RG   GRLLI D         A  A
Sbjct  338   DPLCLWDDAKIKMMAEVESWPYSFVASEEYPKSEERGMARGRLLIRDRFISNDLISAAGA  397

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+ +   
Sbjct  398   YVGLAPPGGSGSWQIECKGYQFWAVGDEAGYFSIENVRPGEYNLYAWVPGFIGDYHNGTI  457

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             +++  GC I++GD+V+ P ++G T+W+IGIPDR A+EFFIP+P P L N  L    ++FR
Sbjct  458   VSVTSGCKIEMGDIVYEPPRDGPTLWDIGIPDRKASEFFIPDPDPTLVNRALVHHQDRFR  517

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW RY++L+   DLVYTVG SD  +DWFFAQV RK     +E T W + F +E +  
Sbjct  518   QYGLWKRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGD-VHEGTTWQIRFKLENIDQ  576

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      I
Sbjct  577   KANYKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNI  635

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  636   PGNRLVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  670



>ref|XP_011016990.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Populus 
euphratica]
Length=640

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/631 (50%), Positives = 425/631 (67%), Gaps = 13/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L + +  V+MDNGI++V LS PEG V GI Y G+  NLLE+ N   +RGYWDL W+  
Sbjct  6     VQLHIQERHVVMDNGILQVTLSKPEGIVTGIQYNGIS-NLLEVLNDESNRGYWDLVWSKE  64

Query  583   KEKAST--SFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 +T  S  I    F+V++E E QVE+SF + +    +  + P+NIDKRF+ML  SSG
Sbjct  65    GSTGTTGTSDAIKGESFRVVVENEEQVEISFTRMWDPSLEGKLAPLNIDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H K     +L QTR+VFKL +  F  +AV D  Q  MP  ++R  + GE L 
Sbjct  125   FYSYAIYEHFKEWPAFNLPQTRIVFKLRKDKFHCMAVADNRQRRMPLPEDRLPKRGEPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L      + KG+VDDKYQY+ +++++ V+GWI   P +GFW IT SNEFR GGP
Sbjct  185   YPEAVLLVNPVEAEFKGEVDDKYQYSCENKDLQVHGWICLNPPVGFWQITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKT  1281
             +KQ+L+ H GP +L+MFLS HYSG+D  +KL+ GE WK VFGPVFIY+N+  D   +   
Sbjct  245   VKQNLSSHVGPISLAMFLSAHYSGEDTVLKLKPGEPWKKVFGPVFIYLNTLLDDENEPHW  304

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+QML E + WPYSFP SED+P + QRG V+GRL + D        P   A+VGL
Sbjct  305   LWEDAKEQMLIEVQSWPYSFPASEDFPSSEQRGCVNGRLQVQDRFISDYCIPGNGAYVGL  364

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ +   YQFWT+ D  G F I+ +R G+Y+LYAW+PG +GD+++   ITI 
Sbjct  365   APPGDIGSWQRECKGYQFWTKADPEGYFSINDIRTGDYNLYAWIPGFIGDYRNDEVITIT  424

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGCD+  GD+++ P ++G T+WEIGIP+RSAAEF+IP+P P   N L  +  ++FRQYGL
Sbjct  425   PGCDLDFGDVIYKPPRDGPTLWEIGIPNRSAAEFYIPDPDPKYINKLYVNHPDRFRQYGL  484

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W+RY++L+   DLVYT+G SD AKDWFFAQVTRK    SY+ T W + F +++V     Y
Sbjct  485   WERYADLYPDEDLVYTIGTSDYAKDWFFAQVTRKKDDNSYQGTTWQIKFKLDSVQNSRSY  544

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+A++  A L + +N     +   +++ + G DN IARHGIHGLY   + E+PGS 
Sbjct  545   KLRLALATANVAELQVRIN---SLETNPWSTGVIGHDNTIARHGIHGLYWLYNIEVPGSE  601

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+ +N ++L Q+ A  PF GIMYDYIRLE 
Sbjct  602   LVEEDNTIFLTQTMATSPFQGIMYDYIRLEG  632



>ref|XP_010555417.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010555418.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X1 [Tarenaya 
hassleriana]
Length=687

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/629 (49%), Positives = 416/629 (66%), Gaps = 17/629 (3%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ + V++DNGI++V  S+P+G + GI Y GV  N+L++ N   DRGYWD+ W  P+++ 
Sbjct  63    VSSDQVIVDNGIVQVTFSSPQGLITGIKYNGVY-NVLDVEND--DRGYWDVAWYEPEKEL  119

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  T+F +I + E QVE+SF + +  S   + +P+N+DKR+++  G SG Y Y +
Sbjct  120   KID-KLEGTEFNIITQDEEQVEISFTRRWNVSYRGSLVPLNVDKRYIIRSGVSGVYMYGV  178

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE----EGEVLNYKEA  939
              +  +G  DVD+DQ R+VFKL+   F  +A++D  Q  MPSY +R+      + L +KEA
Sbjct  179   LERLEGWPDVDMDQIRIVFKLNPKKFKFMAISDTRQRSMPSYADRDIDSGRAKPLAFKEA  238

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT    P  KG+VDDKY Y+ + ++  V+GWIS  P +GFW+IT S+EFR GGP+KQD
Sbjct  239   VLLTNPRQPIFKGEVDDKYMYSTEDRDNKVHGWISWDPPMGFWMITPSDEFRCGGPIKQD  298

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT---LWE  1290
             LT H GP  LSMF+S HY+G +   + R GE WK VFGPVF Y+NS    D      LW 
Sbjct  299   LTSHVGPITLSMFISTHYAGKEMDTEYRNGEPWKKVFGPVFAYLNSVSPKDTNASLHLWR  358

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QML E + WPYSF  S+DYP + QRG+V G L + D    +  T  + A VGLA  
Sbjct  359   DAKRQMLVEVQSWPYSFVNSQDYPLSHQRGSVRGHLFVKDSYVSRRSTYGQFAFVGLAPC  418

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ ++  YQFWT+ D  G+F I  VR G YSL+AWVPG +GD+K++ D+TI PG 
Sbjct  419   GEAGSWQTETKGYQFWTQADRRGRFMIENVREGNYSLFAWVPGFIGDYKYQYDVTITPGQ  478

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTE-KFRQYGLWD  1827
             ++ +  LV+ P +NG T+WEIG+PDR+A EFFIP+P P L N L  D  + KFRQYGLWD
Sbjct  479   EVNLRALVYEPPRNGPTLWEIGVPDRTAGEFFIPDPYPTLMNKLYVDMVQDKFRQYGLWD  538

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RY++L+ + DLVYT+G SD  KDWFFA VTR     +Y+AT W +VF + TV + G YTL
Sbjct  539   RYADLYPRDDLVYTIGASDYRKDWFFAHVTRNVGNNTYQATTWKIVFELGTVNQAGNYTL  598

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
              IA+AS+  + L + VN      +  FT+   GKDNAIARHGIHGLY   S EI GS++ 
Sbjct  599   WIALASAMDSELQVRVN--EANSEPVFTTGFTGKDNAIARHGIHGLYKLYSVEISGSILR  656

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              GEN +YL QS++   F G+MYDYIRLE 
Sbjct  657   DGENTIYLTQSRSRSMFQGVMYDYIRLEG  685



>ref|XP_010671318.1| PREDICTED: probable rhamnogalacturonate lyase B [Beta vulgaris 
subsp. vulgaris]
Length=641

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/636 (50%), Positives = 431/636 (68%), Gaps = 13/636 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + V+LTV    V++DNGI+++ +SNP+G +  I Y  +  NLLE +N+  +RGYWDL+
Sbjct  2     SLQAVQLTVHDHYVVLDNGILEITISNPDGIITKIKYNSLA-NLLEETNEEDNRGYWDLN  60

Query  571   WNTPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLP  741
             W+      +T +  +I  T F+V++E E  VE+SF +T+ S  K   +P+NIDKRF+ML 
Sbjct  61    WSDVGSTGTTGYYDRIKGTKFEVVVEDEEMVELSFTRTWNSSSKDKLVPLNIDKRFIMLQ  120

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
             GSSGFY+YAIY+  K     +L QTR VFKL++  F ++AV D  Q +MP   +R  E  
Sbjct  121   GSSGFYSYAIYEKLKEWPGFNLPQTRAVFKLNKKWFQYMAVADNRQRKMPLPDDRLPERC  180

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFR  1095
             +VL+Y EAV LT     + KG+VDDKYQY+ + +++ V+GWI   P  GFW IT S+EFR
Sbjct  181   QVLDYPEAVLLTNPIEQEFKGEVDDKYQYSCEDKDLKVHGWICTDPPTGFWQITPSDEFR  240

Query  1096  LGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTD  1272
              GGP KQ+LT H GP  L+MF+S HY+G+D   K   GEAWK VFGPVF Y N   K  D
Sbjct  241   TGGPFKQNLTSHVGPINLAMFMSAHYAGEDMVAKFAQGEAWKRVFGPVFTYFNCVPKELD  300

Query  1273  HKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAH  1452
              + LWE AK Q+L ET+ WPYSFP SED+P + QRG ++GRLL+HD        PA  A+
Sbjct  301   CQCLWEDAKDQVLVETENWPYSFPASEDFPTSDQRGNLTGRLLVHDRYTCDDSMPADGAY  360

Query  1453  VGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADI  1632
             +GLA P E  SWQ +   YQFWT TD+ G F I+ +RAG+Y+LYAWVPG +GD+     I
Sbjct  361   IGLASPNETNSWQLEGKGYQFWTTTDEDGYFFINDIRAGDYNLYAWVPGFIGDYVCDNHI  420

Query  1633  TIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQ  1812
             +I  G +I +G+LV+ P  +G T+WEIG+PDR+A EF++P+P P   N L  +  ++FRQ
Sbjct  421   SINSGDEIDMGELVYEPPSDGPTLWEIGVPDRTAREFYVPDPNPKYVNKLYLNHPDRFRQ  480

Query  1813  YGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-  1986
             YGLW+RY+EL+   DLVYT+G+S+  KDWFFAQVTRK    +Y+ T W + F +E V + 
Sbjct  481   YGLWERYAELYPNEDLVYTIGESNYQKDWFFAQVTRKKGN-TYQGTTWQIKFKLEDVNQN  539

Query  1987  GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
             G Y LRIA+A++  A L + VN D K +  +FT+ L GKDNAIARHGIHGLY   + +I 
Sbjct  540   GVYKLRIALATANLAELQVRVN-DAKANPPEFTTGLIGKDNAIARHGIHGLYRLFTADIH  598

Query  2167  GSLIVKGE--NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             G+ +V+G+  N +YL Q+K G PF GIMYDYIRLE 
Sbjct  599   GTKLVQGDKYNTIYLTQAKGGTPFVGIMYDYIRLEG  634



>ref|XP_010255178.1| PREDICTED: probable rhamnogalacturonate lyase B [Nelumbo nucifera]
Length=627

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/623 (50%), Positives = 417/623 (67%), Gaps = 18/623 (3%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFKIL  615
             MDNGI++V LS P G V+GI Y+G+D NLLE+ N+ ++RGYWD  WN P        ++ 
Sbjct  1     MDNGILQVTLSVPGGIVSGIRYKGLD-NLLEILNEEENRGYWDTVWNEPGRDIIFD-RME  58

Query  616   ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
              + FKVIM    Q+E+SF + +    K   IP+NID RF+ML  S GFY Y IY+H +G 
Sbjct  59    GSAFKVIMNNTKQIELSFTRAWNYSLKGRVIPLNIDTRFIMLHDSPGFYCYGIYEHLQGW  118

Query  793   VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENPKL  972
              D ++++TR+ FKL +  F ++A++D  Q  MP  ++R+ G+ L Y EAV LT   NP L
Sbjct  119   PDFNINETRMGFKLRQDKFHYMAISDWRQRIMPMPEDRKTGQPLAYPEAVLLTHPINPNL  178

Query  973   KGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFALS  1152
             KG+VDDKYQY+++ ++  V+GWIS  P +GFW+IT SNEF  GGPLKQDLT H GP  LS
Sbjct  179   KGEVDDKYQYSVEVKDNQVHGWISADPTIGFWMITPSNEFLTGGPLKQDLTSHVGPTTLS  238

Query  1153  MFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTLWEGAKKQMLEETKLW  1329
             MF+S HYSG++ G   R GE WK VFGPVFIY+NS   G D  TLW  AKKQ   +   W
Sbjct  239   MFISAHYSGENIGPMFRNGEPWKKVFGPVFIYLNSLPLGEDLHTLWRDAKKQASIQIASW  298

Query  1330  PYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSY  1509
             PYSFP S+++P   QRG +SGRLL+ D     +   A+ A+VGLA PG+ GSWQ +   Y
Sbjct  299   PYSFPASKNFPSLDQRGRISGRLLVEDRYIQFS---ARFAYVGLAPPGDVGSWQTECKGY  355

Query  1510  QFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLK  1689
             QFWT++D  G F I  +R G Y+LYAWVPG +GD+K++A ITI PGC+  +G+LV+   +
Sbjct  356   QFWTKSDANGYFTIDHIRTGVYNLYAWVPGFIGDYKYEAIITITPGCNTSLGNLVYKAPR  415

Query  1690  NGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLL-----SDRTEKFRQYGLWDRYSELH-KT  1851
              G T+WEIGIPDRSA+EF++P+P P   N L      S   +KFRQYGLW+RY++ +   
Sbjct  416   AGPTLWEIGIPDRSASEFYVPDPNPKYINKLYTVHNKSTPVDKFRQYGLWERYADCYPHE  475

Query  1852  DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK---GCYTLRIAVASS  2022
             DLVYTVG SD   DWFFA V+RK    +Y+ T W + F +E + +   G YTLR+A+AS+
Sbjct  476   DLVYTVGSSDYRNDWFFAHVSRKTGNKTYQPTTWRITFKLEAMNQPQNGNYTLRLALASA  535

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS-LIVKGENKL  2199
             T+A + +  N  P   +  FT+KL G+DNAIARHGIHGLY   +  +    L++ G N +
Sbjct  536   TQAEVQVRFN-KPNLRRPHFTTKLIGRDNAIARHGIHGLYRLFNITVRSEWLVIGGNNTI  594

Query  2200  YLRQSKAGYPFYGIMYDYIRLEA  2268
             +L QS+   PF+G+MYDYIRLE 
Sbjct  595   FLTQSRHLSPFFGVMYDYIRLEG  617



>ref|XP_009148304.1| PREDICTED: rhamnogalacturonate lyase B [Brassica rapa]
Length=671

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/629 (50%), Positives = 422/629 (67%), Gaps = 12/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L ++   V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYWDL WN P
Sbjct  46    VRLHISDRYVVMDNGILQVTLSNPGGIITGINYNGVD-NVLEVRNKETNRGYWDLHWNEP  104

Query  583   KEKASTSFKILATD-FKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
               K    F +++ + F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML GSSG 
Sbjct  105   GGKGI--FDVISGESFRVIVETEEQVEISFLRTWNPSLEGKYIPLNIDKRFIMLRGSSGV  162

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNY  930
             Y+Y IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G  + L+Y
Sbjct  163   YSYGIYEHLKEWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGRCQTLDY  222

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
             +EA  LT   +P L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT SNEFR GGPL
Sbjct  223   QEASLLTAPCDPHLQGEVDDKYQYSCENKDLRVHGWISFDPPVGFWQITPSNEFRSGGPL  282

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LW  1287
             KQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS    D    LW
Sbjct  283   KQNLTSHVGPTTLAVFHSTHYAGKTMMPRFECGEPWKKVYGPVFIYLNSTANRDDSLFLW  342

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             + AK +M+ E + WPYSF  SEDYPK+ +RG   GRLL+ D         AK A+VGLA 
Sbjct  343   DDAKIKMMAEVESWPYSFVASEDYPKSEERGMARGRLLVCDRFVSNDLISAKGAYVGLAP  402

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG+ GSWQ +   YQFW  TD+ G F I  VR GEY+LYAWVPG +GD+ +   +++  G
Sbjct  403   PGDAGSWQIECKGYQFWAITDEAGYFSIDNVRPGEYNLYAWVPGFIGDYHNNIVVSVTSG  462

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C I++GD+V+ P ++G T+WEIGIPDR A+EFFIP+P P L N +L    ++FRQYGLW 
Sbjct  463   CKIELGDIVYEPPRDGPTLWEIGIPDRKASEFFIPDPDPTLVNRVLVHPQDRFRQYGLWK  522

Query  1828  RYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+   DLVYT+G SD  +DWFFA V RK     YE T W + F +E V  K  Y L
Sbjct  523   RYTDLYPNDDLVYTIGVSDYRRDWFFAHVPRKKGD-VYEGTTWQIRFKLENVDQKANYKL  581

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T A L + VN D    +  FT+ L G+DN+IARHG+HG+Y   +  IPG+  V
Sbjct  582   RVAIASATLAELQVRVN-DADATRPLFTTGLIGRDNSIARHGVHGVYMLYTVNIPGNRFV  640

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L+Q +   PF GIMYDYIRLE 
Sbjct  641   QGDNTIFLKQPRCNGPFQGIMYDYIRLEG  669



>ref|XP_008219212.1| PREDICTED: probable rhamnogalacturonate lyase B [Prunus mume]
Length=624

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/629 (50%), Positives = 415/629 (66%), Gaps = 27/629 (4%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL +    V+MDNGI++V LSNP+G V GI + G+D NLLE+ N+  +RGYWDL W++ 
Sbjct  6     VKLLIQDRHVMMDNGIVQVTLSNPDGIVTGIRFNGID-NLLEIRNEEINRGYWDLVWSSA  64

Query  583   KEKASTSFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGF  756
                 +  F ++  T F+VIME E QVE+SF + +    +   +P+NIDKRF+ML GSSGF
Sbjct  65    TTGTTGIFDVIKGTSFRVIMESEEQVELSFTRAWDPSQQGKLVPLNIDKRFIMLRGSSGF  124

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNY  930
             Y+YAIY+H +     +L +TR+ FKL +  F ++A+ D  Q  MP   +R    G+ L +
Sbjct  125   YSYAIYEHLREWPGFELGETRIAFKLRKDKFHYMAMADNRQRNMPLPDDRLPSRGQALAF  184

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
              EAV L     P+ KG+VDDKYQY+ D+++  V+GWI  +P +GFW IT SNEFR GGP 
Sbjct  185   PEAVLLVNPVEPEFKGEVDDKYQYSCDNKDNKVHGWICTEPPVGFWQITPSNEFRSGGPF  244

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP  L+MFLS HYSG+D   K   GE WK VFGPVF+Y NS  +G D  +LW
Sbjct  245   KQNLTSHVGPTTLAMFLSAHYSGEDLVPKFAAGEQWKKVFGPVFMYANSAYEGDDPLSLW  304

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             E AK QM+ E + WPYSFP SED+PK+ QRG+VSGRLLI D         A+ A+VGLA 
Sbjct  305   EDAKSQMMMEVQCWPYSFPASEDFPKSHQRGSVSGRLLIRDRYISDDYISAQGAYVGLAP  364

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
              G+ GSWQ +  +YQFWT  D+ G F I  +  G+Y+L A VPG +GD+++   +TI  G
Sbjct  365   QGDVGSWQRECKNYQFWTTADENGYFLIDGICTGDYNLNATVPGFIGDYQYDVVLTITSG  424

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C++++GDL                  RSAAEF++P+P P   N L  D  ++FRQYGLW+
Sbjct  425   CEVEMGDL------------------RSAAEFYVPDPNPKYINKLFVDHPDRFRQYGLWE  466

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RYSEL+   DLVYTVG SD +KDWFFAQV RK     Y+ T W + F ++TV + G Y L
Sbjct  467   RYSELYPDKDLVYTVGVSDYSKDWFFAQVNRKKDDNKYQGTTWQIKFNLDTVDQSGPYKL  526

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L + VN DPK     F+S L GKDN+IARHGIHGLY   + +IP S I+
Sbjct  527   RLAIASATLSELQVRVN-DPKAYHPLFSSGLIGKDNSIARHGIHGLYWLFNVDIPSSRII  585

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N +YL Q ++  PF GIMYDYIRLE 
Sbjct  586   EGDNIIYLTQPRSTSPFQGIMYDYIRLEG  614



>emb|CDX93464.1| BnaA06g05840D [Brassica napus]
Length=671

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/629 (50%), Positives = 422/629 (67%), Gaps = 12/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L ++   V+MDNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYWDL WN P
Sbjct  46    VRLHISDRYVVMDNGILQVTLSNPGGIITGIKYNGVD-NVLEVRNKETNRGYWDLHWNEP  104

Query  583   KEKASTSFKILATD-FKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGF  756
               K    F +++ + F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML GSSG 
Sbjct  105   GGKGI--FDVISGESFRVIVETEEQVEISFLRTWNPSLEGKYIPLNIDKRFIMLRGSSGV  162

Query  757   YTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNY  930
             YTY IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G  + L+Y
Sbjct  163   YTYGIYEHLKEWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGRCQTLDY  222

Query  931   KEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPL  1110
             +EA  LT   +P L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT SNEFR GGPL
Sbjct  223   QEASLLTAPCDPHLQGEVDDKYQYSCENKDLRVHGWISFDPPVGFWQITPSNEFRSGGPL  282

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT-LW  1287
             KQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS    D    LW
Sbjct  283   KQNLTSHVGPTTLAVFHSTHYAGKTMMPRFECGEPWKKVYGPVFIYLNSTAVRDDSLFLW  342

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             + AK +M+ E + WPYSF  SEDYPK+ +RG   GRLL+ D         A+ A+VGLA 
Sbjct  343   DDAKIKMMAEVESWPYSFVASEDYPKSEERGTARGRLLVCDRFVSNDLISAQGAYVGLAP  402

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG+ GSWQ +   YQFW  TD+ G F I  VR GEY+LYAWVPG +GD+ +   +++  G
Sbjct  403   PGDAGSWQIECKGYQFWAITDEAGYFSIDNVRPGEYNLYAWVPGFIGDYHNNIVVSVTSG  462

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C I++GD+V+ P ++G T+WEIGIPDR A+EFFIP+P P L N +L    ++FRQYGLW 
Sbjct  463   CKIELGDIVYEPPRDGPTLWEIGIPDRKASEFFIPDPDPTLVNRVLVHPQDRFRQYGLWK  522

Query  1828  RYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTL  2001
             RY++L+   DLVYT+G SD  +DWFFA V RK     YE T W + F +E V  K  Y L
Sbjct  523   RYTDLYPNDDLVYTIGVSDYRRDWFFAHVPRKKGD-VYEGTTWQIRFKLENVDQKANYKL  581

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T A L + VN D    +  FT+ L G+DN+IARHG+HG+Y   +  IPG+  V
Sbjct  582   RVAIASATLAELQVRVN-DADATRPLFTTGLIGRDNSIARHGVHGVYMLYTVNIPGNRFV  640

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +G+N ++L+Q +   PF GIMYDYIRLE 
Sbjct  641   QGDNTIFLKQPRCNGPFQGIMYDYIRLEG  669



>ref|XP_006602438.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Glycine max]
Length=685

 Score =   607 bits (1564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/627 (49%), Positives = 422/627 (67%), Gaps = 15/627 (2%)
 Frame = +1

Query  418   TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKAS  597
              +E +++DNGI+ V  S PEG + GI Y G+D N+LE  N+ +DRGY D+ WNTP  K S
Sbjct  56    NREQLVVDNGIVAVTFSRPEGYILGISYNGID-NILEEENEDQDRGYLDVVWNTPG-KPS  113

Query  598   TSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIY  774
                +I  T F VI   E+ VE+SF K++ S  + + +P+NID R+++  G SGFY+YAI+
Sbjct  114   NFQRIHGTIFSVIAADENMVELSFSKSWTSSLNGSSVPMNIDIRYILRSGDSGFYSYAIF  173

Query  775   DHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTK  954
             D P+G   V++DQ R+VFKL++  F ++A++DE Q  MP+ ++RE G++L Y EAV LT+
Sbjct  174   DRPEGLPAVEIDQIRIVFKLNKDRFNYMAISDERQRSMPTMRDRETGQILAYPEAVLLTR  233

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWIS----PKPHLGFWIITASNEFRLGGPLKQDL  1122
               NP+ +G+VDDKYQY+ +++  +V+GWIS      P +GFW+IT S+EFR  GP+KQDL
Sbjct  234   PINPEFRGEVDDKYQYSCENKVNTVHGWISVDAADAPPVGFWMITPSSEFRNAGPIKQDL  293

Query  1123  TCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAK  1299
             T H GP  LSMF+S HY+G +  +  + GE +K VFGPVF Y+N+    D   +LW  A 
Sbjct  294   TSHVGPITLSMFVSTHYAGKEVTMAFQEGEIYKKVFGPVFAYVNNASNEDDTLSLWSDAV  353

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDP-CAGKTDTPAKCAHVGLAKPGE  1476
             +Q  +E + WPY FPKS D+    QRG V GRLL+ D    G     A  ++VGLA PG+
Sbjct  354   QQQSKEVRSWPYDFPKSVDFIPPNQRGIVLGRLLVQDRYFRGGRLLYANNSYVGLALPGD  413

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +S  YQFWT+ D  G F I+ V  G+Y+LYAWVPG +GD+++ A ITI PG  I
Sbjct  414   EGSWQIESKGYQFWTQADTKGFFLINNVVPGDYNLYAWVPGFIGDYRYNATITITPGGVI  473

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-RTEKFRQYGLWDRY  1833
             ++  LV+ P +NG T+WEIG PDR AAEF++PEP P L N L ++ R +KFRQYGLW+RY
Sbjct  474   RLDSLVYVPPRNGPTIWEIGFPDRKAAEFYVPEPYPTLMNKLYNEQRRDKFRQYGLWERY  533

Query  1834  SELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFP-IETVAKGCYTLRI  2007
             ++L+   DLVYTVG S   KDWFFA VTR     +Y+ T W ++F     + +G YTL++
Sbjct  534   TDLYPNDDLVYTVGISKYRKDWFFAHVTRSTGNKTYQPTTWQIIFEHPNQIIRGNYTLQL  593

Query  2008  AVASSTRATLLIWVNGDPKKDKAKF-TSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             A+A +  A L + VN DP  +   F T K+GG D+AIARHG+HGLY   S  +P    VK
Sbjct  594   ALACTADADLQVRVN-DPSANPPDFATGKIGG-DSAIARHGVHGLYRLFSINVPSDRFVK  651

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G N +YLRQS+A  PF G+MYDYIRLE
Sbjct  652   GTNTIYLRQSRAMNPFQGVMYDYIRLE  678



>ref|XP_006602439.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X2 [Glycine max]
Length=684

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/627 (49%), Positives = 422/627 (67%), Gaps = 15/627 (2%)
 Frame = +1

Query  418   TKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKAS  597
              +E +++DNGI+ V  S PEG + GI Y G+D N+LE  N+ +DRGY D+ WNTP  K S
Sbjct  55    NREQLVVDNGIVAVTFSRPEGYILGISYNGID-NILEEENEDQDRGYLDVVWNTPG-KPS  112

Query  598   TSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFYTYAIY  774
                +I  T F VI   E+ VE+SF K++ S  + + +P+NID R+++  G SGFY+YAI+
Sbjct  113   NFQRIHGTIFSVIAADENMVELSFSKSWTSSLNGSSVPMNIDIRYILRSGDSGFYSYAIF  172

Query  775   DHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTK  954
             D P+G   V++DQ R+VFKL++  F ++A++DE Q  MP+ ++RE G++L Y EAV LT+
Sbjct  173   DRPEGLPAVEIDQIRIVFKLNKDRFNYMAISDERQRSMPTMRDRETGQILAYPEAVLLTR  232

Query  955   TENPKLKGKVDDKYQYALDSQNMSVYGWIS----PKPHLGFWIITASNEFRLGGPLKQDL  1122
               NP+ +G+VDDKYQY+ +++  +V+GWIS      P +GFW+IT S+EFR  GP+KQDL
Sbjct  233   PINPEFRGEVDDKYQYSCENKVNTVHGWISVDAADAPPVGFWMITPSSEFRNAGPIKQDL  292

Query  1123  TCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWEGAK  1299
             T H GP  LSMF+S HY+G +  +  + GE +K VFGPVF Y+N+    D   +LW  A 
Sbjct  293   TSHVGPITLSMFVSTHYAGKEVTMAFQEGEIYKKVFGPVFAYVNNASNEDDTLSLWSDAV  352

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDP-CAGKTDTPAKCAHVGLAKPGE  1476
             +Q  +E + WPY FPKS D+    QRG V GRLL+ D    G     A  ++VGLA PG+
Sbjct  353   QQQSKEVRSWPYDFPKSVDFIPPNQRGIVLGRLLVQDRYFRGGRLLYANNSYVGLALPGD  412

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +S  YQFWT+ D  G F I+ V  G+Y+LYAWVPG +GD+++ A ITI PG  I
Sbjct  413   EGSWQIESKGYQFWTQADTKGFFLINNVVPGDYNLYAWVPGFIGDYRYNATITITPGGVI  472

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSD-RTEKFRQYGLWDRY  1833
             ++  LV+ P +NG T+WEIG PDR AAEF++PEP P L N L ++ R +KFRQYGLW+RY
Sbjct  473   RLDSLVYVPPRNGPTIWEIGFPDRKAAEFYVPEPYPTLMNKLYNEQRRDKFRQYGLWERY  532

Query  1834  SELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFP-IETVAKGCYTLRI  2007
             ++L+   DLVYTVG S   KDWFFA VTR     +Y+ T W ++F     + +G YTL++
Sbjct  533   TDLYPNDDLVYTVGISKYRKDWFFAHVTRSTGNKTYQPTTWQIIFEHPNQIIRGNYTLQL  592

Query  2008  AVASSTRATLLIWVNGDPKKDKAKF-TSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             A+A +  A L + VN DP  +   F T K+GG D+AIARHG+HGLY   S  +P    VK
Sbjct  593   ALACTADADLQVRVN-DPSANPPDFATGKIGG-DSAIARHGVHGLYRLFSINVPSDRFVK  650

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             G N +YLRQS+A  PF G+MYDYIRLE
Sbjct  651   GTNTIYLRQSRAMNPFQGVMYDYIRLE  677



>ref|XP_002527356.1| lyase, putative [Ricinus communis]
 gb|EEF35028.1| lyase, putative [Ricinus communis]
Length=755

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/633 (49%), Positives = 420/633 (66%), Gaps = 12/633 (2%)
 Frame = +1

Query  394   CKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDW  573
               P+K  +  E+VL DNG +++ +S PEG V G+ Y G+  NLLE+ N   DRGYWDL W
Sbjct  117   VNPIKSELKGEVVL-DNGFLQITISVPEGLVTGVQYNGMA-NLLEVLNHETDRGYWDLVW  174

Query  574   NTPK--EKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPG  744
             +  +   K     ++  T+F V+++ E Q+EVSF + + S  K   +P+NIDKRFVML G
Sbjct  175   SDEETIRKKGNFDRMEGTNFTVVVQNEEQIEVSFSRHWDSSLKGKLVPMNIDKRFVMLRG  234

Query  745   SSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGE  918
             SSGFYTYAIY+H K     DLD TR+ FKL +  F ++A+ D  +  MP   +R  + G 
Sbjct  235   SSGFYTYAIYEHLKEWPAFDLDNTRIAFKLRKDKFNYMAIADNRRRYMPLPDDRLKDRGL  294

Query  919   VLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRL  1098
              L Y EAV L     P+ KG+VDDKY+Y+ +++   V+GWIS    +GFW+IT S EF+ 
Sbjct  295   PLAYPEAVLLVNPIEPEFKGEVDDKYEYSCENRESGVHGWISTGSAVGFWLITPSAEFKS  354

Query  1099  GGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDH  1275
             GGPLKQ LT H GP  LS+F S HY+G D  I     E WK V+GPVF+Y+NS     D 
Sbjct  355   GGPLKQFLTSHVGPTILSVFHSTHYAGADMIINFGPNEPWKKVYGPVFVYLNSLSTEGDP  414

Query  1276  KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHV  1455
              +LWE AKKQM++E + WPY FP SED+P + QRG V G+LL+ D C    + PA  A+V
Sbjct  415   LSLWEDAKKQMMKEVESWPYDFPASEDFPPSDQRGNVCGKLLVMDRCVSDENIPADGAYV  474

Query  1456  GLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADIT  1635
             GLA  G+ GSWQ +S  YQFWT  D+ G F IS VR G+Y++YAWVPG +GD+K+   I 
Sbjct  475   GLAPVGDVGSWQIESKGYQFWTEADEDGSFTISNVRPGDYNIYAWVPGFIGDYKNDTVIN  534

Query  1636  IKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQY  1815
             I  G  I VGDLV+ P +NG+T+WEIGIPDRSAAEF++P+P P+  N L  + T++FRQY
Sbjct  535   ISNGSSIAVGDLVYEPPRNGSTLWEIGIPDRSAAEFYVPDPNPNYVNMLYLNHTDRFRQY  594

Query  1816  GLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-G  1989
             GLW+RYSEL+   DLV+T+G SD +KDWFFAQVT  ++  +Y+ T W + F +E V +  
Sbjct  595   GLWERYSELYPDEDLVFTIGTSDYSKDWFFAQVT-SSSNNTYQGTTWQIQFELEEVDQSA  653

Query  1990  CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPG  2169
              Y LR+A+A++  A L + VN D   D + F++   GKDN IARHGIHGLY   + ++PG
Sbjct  654   TYKLRLALATANVAELQVRVN-DRNADSSLFSTGKFGKDNTIARHGIHGLYRLFNVDVPG  712

Query  2170  SLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             + +++G N ++L Q+    PF GIMYDYIRLE 
Sbjct  713   TQLLEGNNTIFLTQANHVSPFQGIMYDYIRLEG  745


 Score = 99.4 bits (246),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 77/126 (61%), Gaps = 3/126 (2%)
 Frame = +1

Query  616  ATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYDHPKGG  792
             T   V +E + Q+EVS  +T+KS  K   +P+NI KRFVML GS+GFYTYAIY+H K  
Sbjct  3    GTKVTVAVENDEQIEVSLSRTWKSSLKGKLVPMNIGKRFVMLRGSTGFYTYAIYEHLKEW  62

Query  793  VDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTENP  966
               DLD TR+ FKL +  F ++A+ D  +  MP   +R  + G+ L Y EAV L      
Sbjct  63   PAFDLDNTRIAFKLRKDKFDYMAIADNRRRYMPLPDDRLKDRGKPLAYPEAVLLVNPIKS  122

Query  967  KLKGKV  984
            +LKG+V
Sbjct  123  ELKGEV  128



>ref|XP_006421506.1| hypothetical protein CICLE_v10006424mg [Citrus clementina]
 gb|ESR34746.1| hypothetical protein CICLE_v10006424mg [Citrus clementina]
Length=695

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/619 (47%), Positives = 421/619 (68%), Gaps = 7/619 (1%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+M NG+++V +S P G V GI Y+G+D NLL+  NK + RGYWD+ WN P++   +   
Sbjct  70    VVMSNGLVQVTVSRPGGGVTGIKYKGID-NLLDYKNKEERRGYWDVIWNEPRDPTGSYDV  128

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             + AT F+V+   E QVE+SF + +  S   + +P+N+D R++M  G SGFY YAI +  +
Sbjct  129   LKATKFRVVKLDEDQVELSFTRKWNFSHRGSLVPLNVDMRYIMRRGVSGFYFYAIMEREE  188

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEGEVLNYKEAVKLTKTENP  966
             G  DV +DQ R VFKL    F ++A++D  Q  M   ++R  G+ L+Y+EAV LT   + 
Sbjct  189   GWPDVYMDQIRAVFKLREDKFRYMALSDHKQKLMALNEDRVRGQTLDYREAVLLTNPTDQ  248

Query  967   KLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCHCGPFA  1146
             +LKG+VDDKYQY+ ++++  V+GWIS  P +GFW+IT S+EFR  GP+KQ+LT H GP  
Sbjct  249   RLKGEVDDKYQYSSENKDNRVHGWISHNPRVGFWMITPSDEFRTCGPIKQELTSHAGPTV  308

Query  1147  LSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH-KTLWEGAKKQMLEETK  1323
             LSMF S HY+G +       G+ WK V GP F+Y+NS    ++ + LWE AK+QML E +
Sbjct  309   LSMFSSTHYAGREIDTFYAKGQPWKKVLGPAFVYLNSVSSRENPRALWEDAKQQMLREVQ  368

Query  1324  LWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSM  1503
              WPY FP+S+D+PK+ QRG VSG+L +HD    +    AK A+VGLA PG+ GSWQ ++ 
Sbjct  369   SWPYDFPRSKDFPKSYQRGRVSGQLQVHDRYVNEKPMSAKSAYVGLAAPGDAGSWQAETR  428

Query  1504  SYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTP  1683
              YQFWT+TD+ G F I  VR G+Y+LYAWVPG +GD+K+  +IT++ G  I +G +VF P
Sbjct  429   GYQFWTKTDEEGHFTIENVREGDYNLYAWVPGFVGDYKYGFNITVRAGSKINLGTVVFEP  488

Query  1684  LKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-KTDLV  1860
              +NG T+WEIG+PDRSAAEFF+P+P    KN + +  ++KFRQYGLW+RY++ + K DL+
Sbjct  489   PRNGPTLWEIGVPDRSAAEFFVPDPYTKYKNPVFTGPSDKFRQYGLWERYADFYPKDDLL  548

Query  1861  YTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVA-KGCYTLRIAVASSTRATL  2037
             YT+G S+  +DWFFA V RK    +++ T   ++F +E V+ KG YTL++A++++T + L
Sbjct  549   YTIGVSNYTRDWFFAHVNRKVGNNTFQPTTRQIIFQLEDVSNKGNYTLQLALSAATFSNL  608

Query  2038  LIWVNGDPKKDKAK--FTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQ  2211
              + +N + ++   +  F++   G+DNAIARHGIHGLY   S  +P  L+ +G N +YL Q
Sbjct  609   RVRLNFNSRRRNMRPLFSTGTIGRDNAIARHGIHGLYRFYSINVPRYLLNRGNNTIYLTQ  668

Query  2212  SKAGYPFYGIMYDYIRLEA  2268
             S+   PF G+MYDYIR E 
Sbjct  669   SRNNGPFQGVMYDYIRFEG  687



>gb|KHN26157.1| Rhamnogalacturonate lyase [Glycine soja]
Length=635

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/627 (50%), Positives = 419/627 (67%), Gaps = 18/627 (3%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSF--K  609
             MDNGI++V LSNP G V GI Y G+D NLLE  N+  +RGYWD+ W+      +T    +
Sbjct  1     MDNGILQVYLSNPGGFVTGIQYNGID-NLLETLNEKDNRGYWDVVWSEAGSTGTTGTFER  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I+ T F VIME E QVE+SF + +    K    P+NIDKR+VML  S+GFY+YAI++H +
Sbjct  60    IVGTSFNVIMENEEQVEISFTRKWDPSLKGKRAPLNIDKRYVMLRNSAGFYSYAIFEHLQ  119

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
                  ++ Q R+V+KL +  F ++AV+D+ Q  MP   +R    G+ L   EAV L    
Sbjct  120   EWPAFNIPQIRIVYKLRKDKFHYMAVSDDRQRFMPLPDDRLPGRGKELVPPEAVLLVNPV  179

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISPK----PHLGFWIITASNEFRLGGPLKQDLTC  1128
              P  KG+VDDKYQY+ +++++ V+GWIS +    P +G W+I  SNEFR GG LKQ+LT 
Sbjct  180   EPDFKGEVDDKYQYSSENKDLMVHGWISSQSEDDPAMGLWVILPSNEFRSGGLLKQNLTS  239

Query  1129  HCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLWEGAKKQ  1305
             H GP +L+MFLS HY+G+D  +KL+  E WK VFGP F+Y+NS   G D   LWE AK Q
Sbjct  240   HVGPISLAMFLSAHYAGEDIVLKLQPNEPWKKVFGPTFVYLNSLLNGDDPLELWEDAKNQ  299

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGS  1485
             M EE + WPY FP SED+ K++QRG++ G LL+ D C    +  A+ A+VGLA PGE GS
Sbjct  300   MKEEVQSWPYDFPASEDFQKSSQRGSLCGTLLVRDRCVSDENIIAEGAYVGLATPGEAGS  359

Query  1486  WQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVG  1665
             WQ +   YQFWTR ++ G F I  +R+G+Y+LYAWVPG +G++ +   +TI PGC+I +G
Sbjct  360   WQRECKGYQFWTRANEEGYFSIDNIRSGDYNLYAWVPGFIGEYWNNVVLTITPGCEINLG  419

Query  1666  DLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTE-KFRQYGLWDRYSEL  1842
             D++F P ++G T+WEIGIPDRSAA F++P+P P   N L  +  + KFRQYGLW+RY+EL
Sbjct  420   DIIFEPPRDGPTLWEIGIPDRSAAGFYVPDPNPKYINKLFVNHPDNKFRQYGLWERYAEL  479

Query  1843  HKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYTLRIAVA  2016
             +   DL+YTVG SD  KDWFFA V RK   GSY+ T W + F ++ V     Y LR+A+A
Sbjct  480   YPNEDLIYTVGVSDYTKDWFFAHVPRKQEDGSYQGTTWQIKFNLDDVETSNIYRLRLALA  539

Query  2017  SSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENK  2196
             S+  + L + VN DPK+D   FT+ + GKDNAIARHGIHGLY   S ++PG L+ K  N 
Sbjct  540   SANISELQVRVN-DPKQDPPLFTTGVIGKDNAIARHGIHGLYWLFSIDVPGLLLEKSVNI  598

Query  2197  LYLRQSKAGYP---FYGIMYDYIRLEA  2268
             ++L Q+ A  P   F GIMYDYIRLE 
Sbjct  599   IFLTQTMASGPLALFQGIMYDYIRLEG  625



>ref|XP_007141289.1| hypothetical protein PHAVU_008G183500g [Phaseolus vulgaris]
 gb|ESW13283.1| hypothetical protein PHAVU_008G183500g [Phaseolus vulgaris]
Length=647

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/643 (49%), Positives = 429/643 (67%), Gaps = 17/643 (3%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             + +   VKL +  + V+MDNGI++V LSNP G V  I Y G+D NLLE  NK  DRGYWD
Sbjct  1     MASPAAVKLYMEDDQVVMDNGIVQVYLSNPGGFVTRIQYNGID-NLLETRNKSGDRGYWD  59

Query  565   LDWNTPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVM  735
             + W+      +T    +I+   F+VIME E +VE+SF   ++ S +    P+NIDKR+VM
Sbjct  60    VVWSVAGSTGTTGTFQRIVGESFRVIMENEEEVEISFTSKWEPSLEGERAPLNIDKRYVM  119

Query  736   LPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--E  909
             L  SSGFY+Y I++H +     ++ Q R V+KLS+  F ++  +D  Q  MP   +R   
Sbjct  120   LCNSSGFYSYTIFEHLQEWPAFNIPQIRTVYKLSKDKFHYMVASDNRQRFMPLPDDRLPG  179

Query  910   EGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPK----PHLGFWIIT  1077
              GEVL   EAV L     P+ KG+VDDKYQY+ ++++++V+GWIS +    P +GFW+I 
Sbjct  180   RGEVLVPPEAVLLVNPLEPEFKGEVDDKYQYSSENKDLNVHGWISSESQTDPFIGFWVII  239

Query  1078  ASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS  1257
              SNEFR GGPLKQ+LT H GP +L+MFLS HY+G+D  +KL+  E WK VFGP F+Y+N+
Sbjct  240   PSNEFRSGGPLKQNLTSHVGPISLAMFLSAHYAGEDIVLKLQPNEPWKKVFGPTFVYLNT  299

Query  1258  D-KGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDT  1434
               +G D   LWE AK +   E + WPY FP SED+ K++QRG+V G LL+ D        
Sbjct  300   LLEGDDPLLLWEDAKYKTNAEVQSWPYDFPASEDFQKSSQRGSVCGTLLVKDRFLSDEKI  359

Query  1435  PAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDF  1614
              A+ A++GLA PGE GSWQ +   YQFW++ ++ G F I+ VR+G+Y+LYAWVPG +GD+
Sbjct  360   IAEGAYIGLAPPGETGSWQRECKGYQFWSKANEKGYFSINNVRSGDYNLYAWVPGFIGDY  419

Query  1615  KHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR  1794
                  +TI PGC I+VG++++   ++G T+WEIGIPDRSAAEF++P+P P+  N L    
Sbjct  420   WSNVLLTITPGCKIEVGEVIYEAPRDGPTLWEIGIPDRSAAEFYVPDPNPNYINKLFLHH  479

Query  1795  TEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPI  1971
              +K+RQYGLW+RY+EL+ T DL+YTVG SD  KDWFFAQVTRK   GSY+ T W + F +
Sbjct  480   LDKYRQYGLWERYAELYPTQDLIYTVGVSDYTKDWFFAQVTRKKEDGSYQGTTWQIKFNL  539

Query  1972  -ETVAKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSE  2148
              +T A   Y LR+A+AS+  + L + VN DPK+D    T+ + GKD AIARHGIHGLY  
Sbjct  540   DDTEASKIYKLRLALASANVSELQVRVN-DPKQDPPLLTTGVFGKDFAIARHGIHGLYWL  598

Query  2149  VSFEIPGSLIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
              + ++PG L+ KG N ++L Q+ A  P   F GIMYDYIRLE 
Sbjct  599   FNIDVPGFLLEKGVNTVFLTQTVATGPLATFQGIMYDYIRLEG  641



>ref|XP_006433776.1| hypothetical protein CICLE_v10003807mg [Citrus clementina]
 gb|ESR47016.1| hypothetical protein CICLE_v10003807mg [Citrus clementina]
Length=650

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/630 (48%), Positives = 419/630 (67%), Gaps = 10/630 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L    + V+MDNGI++V LSNP+G V GI Y G++ NLLE++N+  +RGYWDL W+  
Sbjct  20    VQLINQDKHVVMDNGILQVTLSNPQGHVTGIQYNGIE-NLLEVNNRESNRGYWDLVWSGD  78

Query  583   --KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
               K K     +I AT+F VI + E QVE+SF +T+ S  +   +P+ IDKRFVM  G SG
Sbjct  79    GIKRKKGLLDRIEATNFTVIEQNEEQVELSFTRTWDSSLEGKVVPLKIDKRFVMRSGPSG  138

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAI++H +G   + +   R+ FKL++    ++A+ D  +  MP   +R     +VL 
Sbjct  139   FYTYAIFEHLQGWPAISIGNIRMAFKLNKDKLHYMAIADNRKRFMPLPDDRLSNRSQVLA  198

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             + EAV L     P+ +G+VDDKYQY+ +S+++ V+GWI   P  G W IT SNEFR  GP
Sbjct  199   FPEAVLLVNPIEPQFRGEVDDKYQYSSESKDIRVHGWICRNPATGLWQITPSNEFRSAGP  258

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-DKGTDHKTL  1284
             +KQ +T H GP +L++  S HY+G D  + +  GE WK VFGP+F+Y+NS   G D + L
Sbjct  259   VKQYITSHVGPTSLNVLHSTHYAGADLILNIEDGEPWKKVFGPIFVYLNSLSHGGDFQKL  318

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE A KQM+ E + WP +F  S+D+PK+ QRG VSGR+++HD        PAK A+VGLA
Sbjct  319   WEDANKQMMTEVQGWPPNFLASKDFPKSDQRGNVSGRIVVHDRYVNDKSIPAKGAYVGLA  378

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG+ GSWQ +  SYQFWT  ++ G F  + +R G Y+LYA+VPG +GD+K+   I I P
Sbjct  379   PPGDVGSWQIECKSYQFWTSANEDGYFSFNNIRPGNYNLYAFVPGFIGDYKYDNVIAISP  438

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G    + DLV+ P ++G T+WEIGIPDRSAAEFF+P+P P   N L  +  ++FRQYGLW
Sbjct  439   GSQANLDDLVYEPPRDGPTIWEIGIPDRSAAEFFVPDPNPKYINKLYVNHPDRFRQYGLW  498

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGCYT  1998
             +RY+EL+   DLVY+VG SD  KDWFFAQVTRK    +Y  T W + F I+ +   G Y 
Sbjct  499   ERYAELYPDEDLVYSVGVSDYRKDWFFAQVTRKKDNNTYRGTTWQIKFKIDNLDENGTYK  558

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+A++  A L + VN +P K+   F++ + GKDN IARHGIHGLY   +  +PGSL+
Sbjct  559   LRLALATANVAQLRVGVN-EPSKNPPLFSTGIIGKDNTIARHGIHGLYYLYNVSVPGSLL  617

Query  2179  VKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +KG N ++L Q+++  PF GIMYDYIRLE 
Sbjct  618   LKGNNTIFLTQTESISPFQGIMYDYIRLEG  647



>ref|XP_003615341.1| LG27/30-like gene [Medicago truncatula]
Length=661

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/660 (48%), Positives = 430/660 (65%), Gaps = 36/660 (5%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY----  558
             + + V+L +    V+MDNGI++V LSNP G V  I Y G+D NLLE  N+  +RGY    
Sbjct  2     SSQAVQLRIKSNHVVMDNGIVQVYLSNPGGFVTRIQYNGID-NLLEALNEKNNRGYITTN  60

Query  559   -------------WDLDWNTPKEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGD  693
                          WD+ W+      +T    +I+ T F VIME E QVE+SFK+T+    
Sbjct  61    KLRLISLFPLIMYWDVVWSEYGSTGTTGTFERIVGTSFNVIMETEEQVEISFKRTWNPSL  120

Query  694   KTDI-PINIDKRFVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTD  870
             K  + P+NIDKR+VML  SSGFY+YAI++H K     ++ Q R+V+KL +  F ++A+ D
Sbjct  121   KGKLSPLNIDKRYVMLRNSSGFYSYAIFEHLKEWPAFNIPQIRIVYKLRKDKFHYMAMAD  180

Query  871   EIQGEMPSYKER--EEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWIS  1044
               Q  MP   +R    G+ L   EAV L     P+  G+VDDKYQY+ ++ N+ V+GWIS
Sbjct  181   NRQRLMPLPDDRLPGRGKELIPPEAVLLVNPIEPEFLGEVDDKYQYSSENINLKVHGWIS  240

Query  1045  PK----PHLGFWIITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGE  1212
              +    P  GFW+I  SNEFR GG +KQ+LT H GP +L+MFLS HY+G+D  +KL+  E
Sbjct  241   AESETIPATGFWVIIPSNEFRSGGLVKQNLTSHVGPISLAMFLSAHYAGEDIVLKLQPNE  300

Query  1213  AWKMVFGPVFIYINSDKGTDH---KTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGA  1383
              WK VFGP F+Y+N+    D      LWE AK QM +E + WPY FP S+D+ KA+QRG+
Sbjct  301   PWKKVFGPTFVYLNNLLDHDEDPLAQLWEDAKFQMNKEVQSWPYDFPASDDFQKASQRGS  360

Query  1384  VSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVR  1563
             V G LL+ D C    D  AK A+VGLA PG+ GSWQ +   YQFW+++++ G F I+ +R
Sbjct  361   VCGTLLVRDRCVSDKDIIAKGAYVGLAPPGDAGSWQRECKGYQFWSKSNEEGYFSINNIR  420

Query  1564  AGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEF  1743
             +G+Y+LYAWVPG +G++ +   + I PGC+I V D+VF P ++G T+WEIGIPDRSAAEF
Sbjct  421   SGDYNLYAWVPGFIGEYWNNVVLKITPGCEINVDDIVFEPPRDGPTLWEIGIPDRSAAEF  480

Query  1744  FIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRK  1920
             ++P+P P   N L  D  +KFRQYGLW+RY+EL+   DL+Y VG SD  KDWF+AQVTRK
Sbjct  481   YVPDPNPKFINKLFKDHPDKFRQYGLWERYAELYPNEDLIYNVGVSDYTKDWFYAQVTRK  540

Query  1921  NAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLG  2097
                GSY+ T W + F ++ V + G Y LR+A+AS+  + L + VN D K+D   FT+ + 
Sbjct  541   KNDGSYQGTTWQIKFNMDDVQENGLYKLRLALASANVSELQVRVN-DEKQDPPLFTTGVI  599

Query  2098  GKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLYLRQSKAGYP---FYGIMYDYIRLEA  2268
             GKDNAIARHGIHGLY   +  +P  L++KG+N ++L Q+ A  P   F GIMYDYIRLE+
Sbjct  600   GKDNAIARHGIHGLYWLFNIGVPSILLIKGDNTIFLTQTMATGPLPLFQGIMYDYIRLES  659



>gb|AET03356.2| rhamnogalacturonate lyase B-like protein [Medicago truncatula]
Length=685

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/637 (49%), Positives = 424/637 (67%), Gaps = 13/637 (2%)
 Frame = +1

Query  382   HLGACKPVKL-TVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY  558
             +LG+   VKL T  K+ +++DNGI+ V LS PEG + GI Y G+D N+LE   K   RGY
Sbjct  48    NLGSTVVVKLNTENKQQLVVDNGIVSVTLSKPEGYLIGISYNGID-NILESEYKEHARGY  106

Query  559   WDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVM  735
             +D+ WN   +      +I  T F VI+  E+ VEVSF +++ S     D+PINID R++ 
Sbjct  107   FDVVWNELGKHGKVQ-RIHGTKFSVIVANENMVEVSFLRSWTSSMTGIDVPINIDIRYIF  165

Query  736   LPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG  915
               G SGFY+YAI+D  +G   V +DQ R VF+L++  F ++A++D  Q  MP+ ++ + G
Sbjct  166   RRGDSGFYSYAIFDRHEGMPAVKVDQIRFVFRLNKDRFNYMALSDTRQRRMPTMRDVKTG  225

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWIS--PKPHLGFWIITASNE  1089
             +VL Y EAV LTK  NP+  G+VDDKYQY+ ++ N +V+GWIS    P +GFW+IT SNE
Sbjct  226   QVLAYPEAVLLTKPHNPQFTGEVDDKYQYSCENINNTVHGWISLDSDPTVGFWMITPSNE  285

Query  1090  FRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-  1266
             FR GGP+KQDLT H GP  LSMF+S HY+G D  ++   GE +K VFGP+F+Y+N+    
Sbjct  286   FRNGGPIKQDLTSHAGPITLSMFVSPHYAGKDVTMEFEEGETYKKVFGPIFVYLNTASSE  345

Query  1267  TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHD-PCAGKTDTPAK  1443
              D+ TLW  A +Q  +E + WPY FP+S+DY    QRGAV GRLL+ D    G       
Sbjct  346   NDNATLWSDAVQQFSKEVQSWPYDFPQSKDYFPPNQRGAVFGRLLVQDWYFKGGRFQYTN  405

Query  1444  CAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHK  1623
              A+VGLA PG+ GSWQ +S  YQFWTR +  G F+I+    G+Y+LYAWVPG +GD+K+ 
Sbjct  406   NAYVGLALPGDAGSWQTESKGYQFWTRANAKGYFKITNAVPGDYNLYAWVPGFIGDYKYN  465

Query  1624  ADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR-TE  1800
             A ITI PG  IK+  LV+ P +NG T+WEIGIPDR A+EF IP+P P L N L + + ++
Sbjct  466   ATITITPGGVIKLNSLVYNPPRNGPTIWEIGIPDRLASEFHIPDPYPTLMNKLYTKKHSD  525

Query  1801  KFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIET  1977
             KFRQYGLW RYS+++   DLVYTVG ++  +DWFFA VTR     +YE T W ++F  + 
Sbjct  526   KFRQYGLWKRYSDIYPNDDLVYTVGVNN-YRDWFFAHVTRSTGNKTYEPTTWQIIFEHKN  584

Query  1978  -VAKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVS  2154
              +  G YTL++A+AS+  + L +  N D  KD   F +   G+DNAIARHGIHGLY   S
Sbjct  585   DIISGNYTLQLALASAADSNLQVRFN-DRSKDPPHFATGRIGRDNAIARHGIHGLYRLFS  643

Query  2155  FEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
               +  +L+VKG+N +YLRQSKA  PF G+MYDYIRLE
Sbjct  644   INVSSNLLVKGKNIIYLRQSKADTPFQGVMYDYIRLE  680



>ref|XP_010060112.1| PREDICTED: probable rhamnogalacturonate lyase B [Eucalyptus grandis]
 gb|KCW66660.1| hypothetical protein EUGRSUZ_F00438 [Eucalyptus grandis]
Length=685

 Score =   603 bits (1555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/629 (49%), Positives = 411/629 (65%), Gaps = 10/629 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V  + V++DNG+++V ++ PEG V GI Y G+  NLLE+ N+  DRGYWDL W+  
Sbjct  32    VQLNVQDKQVVIDNGMVQVTIAKPEGFVTGIKYNGIG-NLLEVLNEEWDRGYWDLVWSEA  90

Query  583   KEKASTSF--KILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSG  753
                 +T    ++ AT F VI+E E QVE+SF + + S      +P+NIDKRFVML   SG
Sbjct  91    GSAGTTGTDDRMNATKFNVIVENEEQVEISFTRMWDSSMAGQMVPLNIDKRFVMLRNCSG  150

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+Y IY+H       +L QTR+VFKL +  F ++AV D  +  MP   +R    G+ L 
Sbjct  151   FYSYGIYEHSGDWPAFNLPQTRIVFKLRKDKFNYMAVGDNRRRHMPLPDDRSPRRGQPLA  210

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
               EAV L     P+ KG+VDDKYQY+ +++++ V+GWI   P +GFW IT SNEFR GG 
Sbjct  211   TPEAVLLVDPVEPEFKGEVDDKYQYSCENKDLQVHGWICFDPPVGFWQITPSNEFRSGGL  270

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTLW  1287
             LKQ+LT H GP  L+MFLS HY GDD  +KL  GE WK +FGPVF Y+N       K LW
Sbjct  271   LKQNLTSHVGPITLAMFLSAHYGGDDLVLKLAPGEPWKKIFGPVFFYLNCTSENPLK-LW  329

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             + AK+QML E + WPY+FP S +Y    QRG V+GRL+I D     T  PA  A+VGLA 
Sbjct  330   DDAKEQMLSEVQGWPYAFPASAEYQILDQRGYVNGRLMIRDKYISDTLIPAAGAYVGLAP  389

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PGE GSWQ +   YQFWT+ D  G F I+ VR G+Y++YAWVP ++GD+++   ITI  G
Sbjct  390   PGEIGSWQTEVKGYQFWTKADSDGYFSINNVRTGDYNIYAWVPCYVGDYRNDEVITITLG  449

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             C + VGDLVF P +NG T+WEIG+PDRSAAEF++P+P P   N L  +  +KFRQYGLW+
Sbjct  450   CQVDVGDLVFEPPRNGPTLWEIGVPDRSAAEFYVPDPNPKYINRLYLNHPDKFRQYGLWE  509

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTL  2001
             RY+EL+  +DL+YTVG SD  KDWFFAQV RK    +Y+ T W + F ++       Y L
Sbjct  510   RYTELYPDSDLIYTVGASDYTKDWFFAQVPRKIDDSTYKGTTWQIKFKLDDARPSETYKL  569

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+A++  A L + VN  P+ +   F+S + G DN IARHGIHGLY     ++PG+ +V
Sbjct  570   RLALATANVAQLEVRVNS-PQANPPLFSSGVIGHDNTIARHGIHGLYRSYVVDVPGAQLV  628

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              G+N ++L Q+ +  P  G+MYDYIR E 
Sbjct  629   VGDNTVFLSQTMSTSPLQGVMYDYIRFEG  657



>ref|XP_010555419.1| PREDICTED: rhamnogalacturonate lyase B-like isoform X2 [Tarenaya 
hassleriana]
Length=683

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/629 (49%), Positives = 416/629 (66%), Gaps = 21/629 (3%)
 Frame = +1

Query  415   VTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKA  594
             V+ + V++DNGI++V  S+P+G + GI Y GV  N+L++ N   DRGYWD+ W  P+++ 
Sbjct  63    VSSDQVIVDNGIVQVTFSSPQGLITGIKYNGVY-NVLDVEND--DRGYWDVAWYEPEKEL  119

Query  595   STSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAI  771
                 K+  T+F +I + E QVE+SF + +  S   + +P+N+DKR+++  G SG Y Y +
Sbjct  120   KID-KLEGTEFNIITQDEEQVEISFTRRWNVSYRGSLVPLNVDKRYIIRSGVSGVYMYGV  178

Query  772   YDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKERE----EGEVLNYKEA  939
              +  +G  DVD+DQ R+VFKL+   F  +A++D  Q  MPSY +R+      + L +KEA
Sbjct  179   LERLEGWPDVDMDQIRIVFKLNPKKFKFMAISDTRQRSMPSYADRDIDSGRAKPLAFKEA  238

Query  940   VKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQD  1119
             V LT    P  KG+VDDKY Y+ + ++  V+GWIS  P +GFW+IT S+EFR GGP+KQD
Sbjct  239   VLLTNPRQPIFKGEVDDKYMYSTEDRDNKVHGWISWDPPMGFWMITPSDEFRCGGPIKQD  298

Query  1120  LTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKT---LWE  1290
             LT H GP  LSMF+S HY+G +   + R GE WK VFGPVF Y+NS    D      LW 
Sbjct  299   LTSHVGPITLSMFISTHYAGKEMDTEYRNGEPWKKVFGPVFAYLNSVSPKDTNASLHLWR  358

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QML E + WPYSF  S+DYP + QRG+V G L + D    +  T  + A VGLA  
Sbjct  359   DAKRQMLVEVQSWPYSFVNSQDYPLSHQRGSVRGHLFVKD----RRSTYGQFAFVGLAPC  414

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             GE GSWQ ++  YQFWT+ D  G+F I  VR G YSL+AWVPG +GD+K++ D+TI PG 
Sbjct  415   GEAGSWQTETKGYQFWTQADRRGRFMIENVREGNYSLFAWVPGFIGDYKYQYDVTITPGQ  474

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTE-KFRQYGLWD  1827
             ++ +  LV+ P +NG T+WEIG+PDR+A EFFIP+P P L N L  D  + KFRQYGLWD
Sbjct  475   EVNLRALVYEPPRNGPTLWEIGVPDRTAGEFFIPDPYPTLMNKLYVDMVQDKFRQYGLWD  534

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RY++L+ + DLVYT+G SD  KDWFFA VTR     +Y+AT W +VF + TV + G YTL
Sbjct  535   RYADLYPRDDLVYTIGASDYRKDWFFAHVTRNVGNNTYQATTWKIVFELGTVNQAGNYTL  594

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
              IA+AS+  + L + VN      +  FT+   GKDNAIARHGIHGLY   S EI GS++ 
Sbjct  595   WIALASAMDSELQVRVN--EANSEPVFTTGFTGKDNAIARHGIHGLYKLYSVEISGSILR  652

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              GEN +YL QS++   F G+MYDYIRLE 
Sbjct  653   DGENTIYLTQSRSRSMFQGVMYDYIRLEG  681



>ref|XP_007137654.1| hypothetical protein PHAVU_009G144700g [Phaseolus vulgaris]
 gb|ESW09648.1| hypothetical protein PHAVU_009G144700g [Phaseolus vulgaris]
Length=664

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/645 (49%), Positives = 420/645 (65%), Gaps = 20/645 (3%)
 Frame = +1

Query  385   LGA-CKP-VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGY  558
             LGA  KP V+L +  + V+MDNGI++VNLSNP G V GI Y G+D NLLE+ N+  DRGY
Sbjct  19    LGADTKPGVRLDIQDKHVIMDNGIVQVNLSNPGGIVTGIQYNGID-NLLEVLNEEYDRGY  77

Query  559   WDLDWNTPKEKAS--------TSFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDIP-I  711
             WD+ W+   E  +        T  ++ AT+  VI+E E QVE+SF +T+       +P +
Sbjct  78    WDIVWDQGGENRTKKGAKGKGTFDRMEATNLTVIVENEEQVELSFTRTWNVSFVGKLPPL  137

Query  712   NIDKRFVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMP  891
             NIDKRF+ML GSSGFYTYAIY+H K     DLD TR+ FK  +  F +++V D  Q  MP
Sbjct  138   NIDKRFIMLRGSSGFYTYAIYEHLKEWPAFDLDNTRIAFKPRKEKFHYMSVADNRQRFMP  197

Query  892   SYKER--EEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKP--HL  1059
                +R    G+VL Y EAV+L     P+ KG+VDDKY+Y+ +S+   V+GW+S  P    
Sbjct  198   LPDDRIPPRGQVLAYPEAVRLVDPVEPEFKGEVDDKYEYSCESRYNQVHGWMSIDPLNST  257

Query  1060  GFWIITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPV  1239
             GFW+IT S EFR  GPLKQ LT H GP  LS+F S HYSG D  ++    E WK V+GP+
Sbjct  258   GFWLITPSYEFRSAGPLKQYLTSHVGPTTLSVFHSTHYSGTDLIMQFGPNEPWKKVYGPI  317

Query  1240  FIYINS-DKGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPC  1416
             FIY+NS   G     LWE AK+QM+ E + WPY+FP S+D+  + +RG V GRLL+ D  
Sbjct  318   FIYLNSLSNGVSPIKLWEDAKQQMVSEVESWPYTFPASKDFLSSEERGKVQGRLLVRDRI  377

Query  1417  AGKTDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVP  1596
                   P   A+VGLA  G+ GSWQ +   YQFWT TDD G F I  VR G+Y+LY+WV 
Sbjct  378   VSDAFIPVSGAYVGLAAIGDVGSWQRECKGYQFWTITDDKGYFSIINVRPGDYNLYSWVT  437

Query  1597  GHLGDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKN  1776
             G++GD+K    I +  GC+I V +LV+ P ++G T+WEIGIPDRSAAEF++P+P P   N
Sbjct  438   GYIGDYKFDKIINVTSGCEINVSELVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPMYIN  497

Query  1777  YLLSDRTEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIW  1953
              L  + T++FRQYGLW+RY++L+   DLVYTVG SD  KDWFFAQV R+   G+Y+ T W
Sbjct  498   KLYVNHTDRFRQYGLWERYADLYPNKDLVYTVGVSDYKKDWFFAQVNRRKDNGTYQGTTW  557

Query  1954  TVVFPIETV-AKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGI  2130
              + F ++ V   G YTLR+A+AS   A L I +N   + D A F+S + GK+N IARHGI
Sbjct  558   QINFNLDRVNTNGSYTLRVALASVHGAELQIRIN-KLEADPALFSSGVIGKENTIARHGI  616

Query  2131  HGLYSEVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             HG Y   S ++ G+L+V+G N ++L Q     PF GIMYDYIRLE
Sbjct  617   HGFYWLFSIDVDGTLLVQGNNTIFLTQPMNTSPFIGIMYDYIRLE  661



>ref|XP_006472414.1| PREDICTED: uncharacterized protein LOC102607519 isoform X1 [Citrus 
sinensis]
 ref|XP_006472415.1| PREDICTED: uncharacterized protein LOC102607519 isoform X2 [Citrus 
sinensis]
Length=664

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/631 (49%), Positives = 417/631 (66%), Gaps = 11/631 (2%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L V  + V+MDNGI++V LSNPEG V GI +QG+D NLLE+ N   DRGYWDL W+ P
Sbjct  24    VQLQVQDKHVVMDNGILQVTLSNPEGIVTGIQFQGID-NLLEVRNAEYDRGYWDLVWSKP  82

Query  583   KEKAS--TSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSG  753
              +K +  T  +I AT+F VI+E E QVEVSF + + S  +   +P+NIDKRF+ML GSSG
Sbjct  83    GKKGTKGTLDRIEATNFTVIVENEEQVEVSFTRLWNSSLEGQVVPLNIDKRFIMLHGSSG  142

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FYTYAI++H       ++D  R+ FKL++  F  +++ D  Q  +P   +R    G+VL 
Sbjct  143   FYTYAIFEHLGEWPAFNIDNIRMAFKLNKDKFHFMSIADNRQRLVPLPDDRLPGRGQVLA  202

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L     P+ KG+VDDKY Y+  SQ++ V+GWI   P +GFW IT S E R  GP
Sbjct  203   YPEAVLLVNPVEPEFKGEVDDKYLYSCKSQDIRVHGWICADPPVGFWQITPSIESRSAGP  262

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHKTL-  1284
             LKQ L  H GP +L++F S+HYSG D  ++    E WK VFGP+FIY+NS    D   L 
Sbjct  263   LKQYLASHVGPTSLALFHSVHYSGADLILRFGHSEPWKKVFGPIFIYLNSLSNEDDPLLL  322

Query  1285  WEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLA  1464
             WE AK+QM+ E + WPY FP S+D+P++ QRG + GRLL+ D         A  A+VGLA
Sbjct  323   WEDAKQQMIFEVQSWPYDFPASKDFPQSDQRGTLHGRLLVEDRYINMDYIAANGAYVGLA  382

Query  1465  KPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKP  1644
              PG  GSWQ +   YQFW R +  G F I  +R G YSLYA+VPG +GD+K+  +ITI  
Sbjct  383   PPGNAGSWQRECKGYQFWARANADGYFYIDHIRTGNYSLYAFVPGFIGDYKYDFNITIIE  442

Query  1645  GCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLW  1824
             G  I +GDLV+ P +NG T+WEIGIPDR AAEF++P+P P   N L  + T+++RQYGLW
Sbjct  443   GSYIDIGDLVYKPPRNGPTLWEIGIPDRYAAEFYVPDPDPKYINKLYVNHTDRYRQYGLW  502

Query  1825  DRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYT  1998
             +RY+EL+   DL+Y V +SD  KDWFFAQVTRK    +YE T W + F ++ V +   Y 
Sbjct  503   ERYAELYPDEDLIYIVNQSDYRKDWFFAQVTRKKDNQTYEGTTWQIKFELDNVNESAVYK  562

Query  1999  LRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLI  2178
             LR+A+AS+  + L + +N DP  +   F++   GK+N IARHGI+GLY   + ++PG+L 
Sbjct  563   LRLALASAHVSVLQVRIN-DPSTEPPLFSTGQIGKENTIARHGIYGLYWLFNVDVPGALF  621

Query  2179  VKGENK-LYLRQSKAGYPFYGIMYDYIRLEA  2268
             VKG N  +YL Q+ +G PF G+MYDYIRLE 
Sbjct  622   VKGNNNTIYLTQALSGSPFRGVMYDYIRLEG  652



>gb|KHN38895.1| Rhamnogalacturonate lyase [Glycine soja]
Length=667

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/644 (48%), Positives = 423/644 (66%), Gaps = 22/644 (3%)
 Frame = +1

Query  385   LGAC--------KPVKL-TVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSN  537
             LGAC         PVKL T     V++DNGII +NLSNPEG + GI Y G+  N+LE  N
Sbjct  24    LGACYRSVSTSPPPVKLNTENPHQVVIDNGIISLNLSNPEGDIIGI-YNGIK-NVLEAKN  81

Query  538   KIKDRGYWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSGDK-TDIPIN  714
             K  DRGY D+ WN P +      +I  TDF VI   E+ VE+SF +T+ +  K + +P+N
Sbjct  82    KEDDRGYLDVVWNEPGKHGMFQ-RIRGTDFSVIAANENIVEISFLRTWTASMKGSSVPMN  140

Query  715   IDKRFVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPS  894
             IDKR+++  G  GFY+YAI++ P G   V++DQ R+VFKL  + F ++A++D  Q  MPS
Sbjct  141   IDKRYILRRGDYGFYSYAIFNRPSGLPAVEIDQIRIVFKLDETRFHYMAISDTRQRNMPS  200

Query  895   YKEREEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPK--PHLGFW  1068
              ++R  G+ L Y EAV LT +   + KG+VDDKYQY+ ++++ +V+GWI+      +GFW
Sbjct  201   VRDRASGQPLAYPEAVLLTNSSEQQFKGEVDDKYQYSSENKDNTVHGWITQDGLAPVGFW  260

Query  1069  IITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIY  1248
             +IT SNEFR  GP KQDLT H GP  LSMF+S HY+G +  +    GE +K VFGPVF+Y
Sbjct  261   LITPSNEFRHAGPFKQDLTSHVGPTTLSMFVSTHYAGKEVTMAFGEGETYKKVFGPVFVY  320

Query  1249  INS-DKGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGK  1425
             +NS    +  ++LW  A +Q+  E + WPY F  S+D+    QRG V+GRLL+ D   GK
Sbjct  321   LNSVPNKSQFRSLWSDAVEQLSNEVRRWPYDFVGSKDFLPPNQRGTVTGRLLVQD--GGK  378

Query  1426  TDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHL  1605
              D PA  A+VGLA PG+ GSWQ +S  YQFW + D  G F I  +  G+Y+LYAWVPG +
Sbjct  379   RDQPANNAYVGLALPGDTGSWQKESKGYQFWIQADKAGHFLIKNIVPGDYNLYAWVPGFI  438

Query  1606  GDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLL  1785
             GD+++K  ITI+ G +I +  LV+ P +NG T+WEIGIPDRSAAEF++P+P P L N L 
Sbjct  439   GDYRYKTKITIERGGNINLNSLVYNPPRNGPTLWEIGIPDRSAAEFYMPDPNPKLVNRLF  498

Query  1786  -SDRTEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTV  1959
              +D+ +KFRQYGLW+RY+EL+   DLVYTVG SD   DWF+AQVTR   + SY  T W +
Sbjct  499   QNDKQDKFRQYGLWERYTELYPNHDLVYTVGVSDYHNDWFYAQVTRSTPEKSYMPTTWQI  558

Query  1960  VFPIET-VAKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHG  2136
              F ++  +  G YT ++A+AS+T A L +  N D       F++ L G DNAIARHGIHG
Sbjct  559   QFQLKNIIMPGNYTFQVALASTTNARLEVRFN-DLNAKLPHFSTGLKGDDNAIARHGIHG  617

Query  2137  LYSEVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             LY   +  +  + +V G+N +YL QSK   PF G+MYDY+RLE+
Sbjct  618   LYRLHTIAVGSNHLVNGKNTIYLTQSKGISPFMGVMYDYVRLES  661



>ref|XP_003522745.2| PREDICTED: rhamnogalacturonate lyase B-like [Glycine max]
Length=705

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/642 (50%), Positives = 417/642 (65%), Gaps = 19/642 (3%)
 Frame = +1

Query  391   ACKP-VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDL  567
             A KP V+L +  + V+MDNGI++VNLSNPEG V GI Y G+D NLLE+ N   +RGYWD+
Sbjct  63    ATKPGVRLDIQDKHVIMDNGIVQVNLSNPEGIVTGIQYNGID-NLLEVLNDESNRGYWDI  121

Query  568   DWNTPKEKASTSF--------KILATDFKVIMEKESQVEVSFKKTYKSGDKTDIP-INID  720
              W+   +K +           ++ AT+F VI+E E QVE+SF +T+    +  +P +NID
Sbjct  122   VWDEGGKKRTKKGAKGKGRFDRMEATNFTVIVESEEQVELSFSRTWNDSLEGKLPPLNID  181

Query  721   KRFVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYK  900
             KRF+ML GSSGFYTYAIY+H K     DLD TR+ FK  +  F ++ V D  Q  MP   
Sbjct  182   KRFIMLSGSSGFYTYAIYEHLKEWPAFDLDNTRIAFKPRKDKFHYMVVADNRQRFMPLPD  241

Query  901   ERE--EGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKP--HLGFW  1068
             +R    G+VL Y EAV+L     P+ KG+VDDKYQYA +S+   V+GWI   P    GFW
Sbjct  242   DRSPPRGQVLAYPEAVRLVDPLEPEFKGEVDDKYQYACESRYNRVHGWICIDPVNSTGFW  301

Query  1069  IITASNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIY  1248
             +IT S EFR  GPLKQ LT H GP  LS+F S HYSG D  ++    E WK V+GP+FIY
Sbjct  302   LITPSYEFRSAGPLKQYLTSHVGPTTLSVFHSTHYSGADLIMQFGPNEPWKKVYGPIFIY  361

Query  1249  INS-DKGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGK  1425
             +NS   G     LWE AK+QM+ E + WPY+FP SED+  + QRG V GRLL+ D     
Sbjct  362   LNSLSNGFSPIGLWEDAKQQMVNEVESWPYTFPASEDFLSSDQRGKVEGRLLVRDRYISD  421

Query  1426  TDTPAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHL  1605
                P   A+VGLA  GE GSWQ +   YQFWT TDD G F I  +R G Y+LY+WV G +
Sbjct  422   AFIPVSGAYVGLAAIGEVGSWQRECKGYQFWTITDDKGYFSIINIRPGGYNLYSWVNGFI  481

Query  1606  GDFKHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLL  1785
             GD++  + I +  GC+  VG+LV+   ++G T+WEIGIPDRSAAEF++P+P P   N L 
Sbjct  482   GDYQFDSVIYVTSGCETNVGELVYEAPRDGPTLWEIGIPDRSAAEFYVPDPNPMCINRLY  541

Query  1786  SDRTEKFRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVV  1962
              +  ++FRQYGLW+RY+EL+   DLVYTVG SD  KDWFFAQV RK   G+Y  T W + 
Sbjct  542   VNHPDRFRQYGLWERYAELYPNEDLVYTVGISDYRKDWFFAQVNRKKDNGTYIGTTWQIN  601

Query  1963  FPIETV-AKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGL  2139
             F +++V   G YTL++A+AS   A L I +N + + +   F+S + GK+N IARHGIHGL
Sbjct  602   FKLDSVNTNGTYTLQVALASVHSAELEIRIN-NLEANPPLFSSGVIGKENTIARHGIHGL  660

Query  2140  YSEVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
             Y   S  I G+L+V+G N ++L Q++   PF GIMYDYIRLE
Sbjct  661   YWLFSIHIQGTLLVQGNNTIFLTQTRDTSPFIGIMYDYIRLE  702



>gb|KDP41510.1| hypothetical protein JCGZ_15917 [Jatropha curcas]
Length=694

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/626 (49%), Positives = 419/626 (67%), Gaps = 15/626 (2%)
 Frame = +1

Query  427   MVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWN--TPKEKAST  600
              V++DNG ++V +S PEG + GI Y G++ NLLE+ N+  DRGYWDL W+  +   K   
Sbjct  64    QVVLDNGFVQVTISLPEGFITGIQYNGIN-NLLEVLNEESDRGYWDLVWSDESTTRKKGN  122

Query  601   SFKILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFYTYAIYD  777
               ++  T+FK++++ E Q+E+SF +T+ S      +P+NIDKR+V+L GSSGFYTYAIY+
Sbjct  123   FDRMEGTNFKIVVQNEDQIELSFTRTWNSSLHGKLVPLNIDKRYVILGGSSGFYTYAIYE  182

Query  778   HPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLT  951
             H +     +LD TR+ FK  +  F ++AV D  Q  MPS  +R    G+ L Y EAV L 
Sbjct  183   HSEEWPAFNLDNTRIAFKPRKDKFNYMAVADNRQRYMPSPDDRLVGRGQALAYPEAVMLV  242

Query  952   KTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLKQDLTCH  1131
                 P+ KG+VDDKY+Y+ +S +  V+GWIS    +GFW+IT S EFR GGP KQ LT H
Sbjct  243   NPIEPEFKGEVDDKYEYSCESLDNGVHGWISTDSTVGFWLITPSIEFRSGGPRKQFLTSH  302

Query  1132  CGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAKKQ  1305
              GP  LS+F S HY+G +  I  R  E WK V+GPVF+Y+N+  DK  +  +LWE AKKQ
Sbjct  303   VGPTTLSVFHSTHYAGAEMIISFRPNEPWKKVYGPVFVYLNAVPDK-NNSLSLWEDAKKQ  361

Query  1306  MLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPC---AGKTDTPAKCAHVGLAKPGE  1476
             M+ E + WPY FP SED+P + QRG +SGRLL+ D         + PA  A+VGLA PG+
Sbjct  362   MINEVQRWPYDFPHSEDFPSSDQRGNISGRLLVLDRQYRDVRDENIPANEAYVGLAPPGD  421

Query  1477  PGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDI  1656
              GSWQ +S  YQFW++TD  G+F I+ +R G+Y++YAWVPG++GD+K+   I I PG +I
Sbjct  422   IGSWQIESKGYQFWSKTDKDGQFTINNIRTGDYNIYAWVPGYIGDYKYDPVIKISPGSNI  481

Query  1657  KVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYS  1836
              VGDL++ P ++G T+WEIGIPDRSA EF+IP+P P   N L  + ++++RQYGLW+RY+
Sbjct  482   CVGDLIYEPPRHGCTLWEIGIPDRSAVEFYIPDPDPKYVNKLYLNHSDRYRQYGLWERYT  541

Query  1837  ELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIA  2010
             EL+   DLV+TVG S+ +KDWFFAQVTRK    +YE T W + F  E V + G Y LR+A
Sbjct  542   ELYPDGDLVFTVGTSNYSKDWFFAQVTRKKENNTYEGTTWQIKFKQEAVDRSGIYKLRLA  601

Query  2011  VASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGE  2190
             +A++  A L + +N D       F++   GKDN IARHGIHGLY   + ++PG+ +V+G 
Sbjct  602   LATANNANLQVRIN-DVNASSPLFSTGRIGKDNTIARHGIHGLYRLFNVDVPGAHLVEGI  660

Query  2191  NKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             N ++L Q+    PF GIMYDYIR E 
Sbjct  661   NTIFLTQTADQSPFQGIMYDYIRFEG  686



>ref|XP_008365246.1| PREDICTED: probable rhamnogalacturonate lyase B [Malus domestica]
Length=650

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/637 (48%), Positives = 416/637 (65%), Gaps = 20/637 (3%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + V+L +    V+MDNGI++V LS P+G V  I Y G+D NLLE+ ++  +RGYWDL 
Sbjct  2     SSQSVRLIIQDRYVVMDNGILQVTLSKPDGIVTKIQYNGID-NLLEVLDEEVNRGYWDLV  60

Query  571   WNTPKEKAST-SFKIL-ATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLP  741
             W+      +T +F ++  T FKV +E E QVE+SF + +    K  + P+NIDKRF+ML 
Sbjct  61    WSEAGSVGTTGTFDVIKGTKFKVRVENEEQVEISFTRKWNPSQKGXVVPLNIDKRFIMLR  120

Query  742   GSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEG  915
              SSGFY+YAIY+H K     +L QTR+VFKL +  F ++A+ D  Q  MP   +R  E  
Sbjct  121   NSSGFYSYAIYEHLKEWPPFNLPQTRIVFKLRKEKFHYMAIADNRQRYMPLPDDRSSERS  180

Query  916   EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFR  1095
             + L Y EAV L     P+ KG+VDDKY+Y+ ++QN+ V+GW+   P +GFW IT S+EFR
Sbjct  181   QALAYPEAVLLVDPIEPEFKGEVDDKYEYSCENQNLHVHGWVCMDPPVGFWQITPSDEFR  240

Query  1096  LGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKG-TD  1272
              GGPLKQ+LT H GP+ L+MFLS HYSG+D  +KL+  E WK VFGP FIY+NS    TD
Sbjct  241   SGGPLKQNLTSHVGPYCLAMFLSAHYSGEDLVLKLKPDEPWKKVFGPXFIYLNSASDVTD  300

Query  1273  HKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAH  1452
                LW+ AKKQM+ E + WPY FP S+DYP   QRG V GR+ I D    K   P   A+
Sbjct  301   PSPLWDDAKKQMMTEVESWPYKFPASKDYPPPDQRGNVKGRIQILDRYVSKDRIPGNGAY  360

Query  1453  VGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADI  1632
             VGLA PG+ GSWQ D   YQFWTR D+ G + I  +R G+Y+LYAW PG +GD+++ A  
Sbjct  361   VGLAPPGDAGSWQRDCKGYQFWTRADEKGYYSIZNIREGDYNLYAWCPGFIGDYRYDATX  420

Query  1633  TIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQ  1812
             +I  GCDI V D+V+ P ++G T+WEIGIPDRSAAEF++P+P P   N L  +  ++FRQ
Sbjct  421   SITAGCDIDVDDIVYEPPRDGPTLWEIGIPDRSAAEFYVPDPNPMYINKLYVNHPDRFRQ  480

Query  1813  YGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG  1989
             YGLW+RY EL+   DL+Y++G SD  KDW       K    +Y+ T W + F ++  ++ 
Sbjct  481   YGLWERYQELYPDEDLIYSIGTSDYTKDW-------KKDXXTYQGTTWQIKFQLKHFSES  533

Query  1990  -CYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIP  2166
                 LRIA+A++  A L I +N D K D   FT+ + G DN IARHGIHGLY   + +IP
Sbjct  534   XTLKLRIALATANIAELQIRIN-DSKADPPLFTTGVIGXDNXIARHGIHGLYXLYNIBIP  592

Query  2167  GSLIVKGENKLYLRQSKAGY---PFYGIMYDYIRLEA  2268
             G+L+V+G N L+L Q  +     PF+G+MYDYIRLE 
Sbjct  593   GTLLVEGANTLFLTQXMSXXPLAPFHGLMYDYIRLEG  629



>ref|XP_006306941.1| hypothetical protein CARUB_v10008508mg [Capsella rubella]
 gb|EOA39839.1| hypothetical protein CARUB_v10008508mg [Capsella rubella]
Length=671

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/632 (50%), Positives = 417/632 (66%), Gaps = 10/632 (2%)
 Frame = +1

Query  391   ACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLD  570
             + + VKL +    V++DNGI++V LSNP G + GI Y GVD N+LE+ NK  +RGYWDL 
Sbjct  42    SSQGVKLHIHDRYVVLDNGILQVTLSNPGGIITGIKYNGVD-NVLEVRNKETNRGYWDLH  100

Query  571   WNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGS  747
             WN P  K      I    F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML GS
Sbjct  101   WNEPGGKGIFDV-ISGVSFRVIVETEEQVEISFVRTWDPSLEGKYIPLNIDKRFIMLRGS  159

Query  748   SGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EV  921
             SG Y+Y IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G  + 
Sbjct  160   SGVYSYGIYEHLKDWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGRCQT  219

Query  922   LNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLG  1101
             L+Y+EA  LT   +P+L+G+VDDKYQY+ ++Q++ V+GWIS  P +GFW IT SNEFR G
Sbjct  220   LDYQEASLLTTPCDPRLQGEVDDKYQYSCENQDLRVHGWISFDPPIGFWQITPSNEFRSG  279

Query  1102  GPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHK  1278
             GPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G D  
Sbjct  280   GPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEQGEPWKKVYGPVFIYLNSTPHGDDPL  339

Query  1279  TLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVG  1458
              LW+ AK +M+ E + WPYSF  SE+YPK+ +RG   GRLLI D         A  A+VG
Sbjct  340   CLWDDAKIKMMAEVESWPYSFVASEEYPKSDERGTARGRLLIRDRFISNDLISAGGAYVG  399

Query  1459  LAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITI  1638
             LA PG  GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVPG +GD+     +++
Sbjct  400   LAPPGGSGSWQIECKGYQFWAVGDEAGYFSIGNVRPGEYNLYAWVPGFIGDYHDGKIVSV  459

Query  1639  KPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYG  1818
               G  I++GD+++ P ++G T+W+IGIPDR A+EFFIP+P P L N       ++FRQYG
Sbjct  460   TSGGKIELGDIIYEPPRDGPTLWDIGIPDRKASEFFIPDPDPALVNRAFVHHQDRFRQYG  519

Query  1819  LWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-AKGC  1992
             LW+RY++L+   DLVYTVG SD  +DWFFAQV RK   G  E T W + F +E +  K  
Sbjct  520   LWNRYTDLYPNDDLVYTVGVSDYRRDWFFAQVPRKKGDGQ-EGTTWQISFKLENIDQKAN  578

Query  1993  YTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGS  2172
             Y LRIA+AS+T A L I VN D +  +  FT+ L G+DN+IARHGIHG+Y      IPG+
Sbjct  579   YKLRIAIASATLAELQIRVN-DAEAVRPLFTTGLIGRDNSIARHGIHGVYMLYEVNIPGN  637

Query  2173  LIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              +V+G+N ++LRQ +   PF GIMYDYIRLE 
Sbjct  638   RVVQGDNTIFLRQPRCNGPFQGIMYDYIRLEG  669



>ref|XP_008219218.1| PREDICTED: rhamnogalacturonate lyase B-like [Prunus mume]
Length=634

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/622 (50%), Positives = 414/622 (67%), Gaps = 13/622 (2%)
 Frame = +1

Query  436   MDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP--KEKASTSFK  609
             MDNGI++V LS P G + GI Y GVD NLLE+ N+  +RGYWDL W+ P  K K     +
Sbjct  1     MDNGILQVTLSKPAGMITGIQYNGVD-NLLEILNEDSNRGYWDLVWDAPEIKRKKGEFDR  59

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             +  T+F VI+E E+Q+E+SF + +  S +   +P+NIDKRFVML  SSGFYTY IY+H K
Sbjct  60    METTNFTVIVETENQIELSFTRMWDPSLEGKFVPLNIDKRFVMLRNSSGFYTYGIYEHLK  119

Query  787   GGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKLTKTE  960
                  +L  TRVVFKL +  F ++A++D  Q  MP   +R  E G+ L Y EAV L    
Sbjct  120   DWPAFNLTNTRVVFKLRKDKFHYMAMSDNRQRYMPLPDDRTAERGQPLAYPEAVLLVNPV  179

Query  961   NPKLKGKVDDKYQYALDSQNMSVYGWISP--KPHLGFWIITASNEFRLGGPLKQDLTCHC  1134
              P+ KG+VDDKYQY+++++N  V+GWIS    P +GFW IT S EF+ GGPLKQ LT H 
Sbjct  180   EPEFKGEVDDKYQYSIENKNNRVHGWISTVTDPPMGFWQITPSEEFKSGGPLKQCLTSHV  239

Query  1135  GPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDH--KTLWEGAKKQM  1308
             GP  L++F S HYSG D  ++    E WK VFGPVFI++NS    D   K LWE AK+QM
Sbjct  240   GPITLAIFHSTHYSGADLILQFGPNEPWKKVFGPVFIHLNSLVNGDDPLKRLWEDAKQQM  299

Query  1309  LEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEPGSW  1488
               E + WPY FP S+D+    QRG+VSGRLL+HD      D P     VGLA PG  GSW
Sbjct  300   EVEVQSWPYDFPASKDFLPLDQRGSVSGRLLVHDRYISDEDLPGNGTLVGLAAPGNVGSW  359

Query  1489  QNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIKVGD  1668
             Q +   YQFWT+ D+ G F I+ +R G Y+L+A+VPG +GD+++ A++TI PGCD  VG 
Sbjct  360   QFECKGYQFWTKADEKGCFSITGIRPGTYNLFAYVPGLIGDYRYDAEVTISPGCDKDVGT  419

Query  1669  LVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSELH-  1845
             LV+ P ++G T+WEIGIPDR+AAEFF+P+P P   N L  + T++FRQYGLW+RY++L+ 
Sbjct  420   LVYEPPRSGPTLWEIGIPDRTAAEFFVPDPNPKYINKLYLNHTDRFRQYGLWERYADLYP  479

Query  1846  KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLRIAVASS  2022
               D+VYTVG SD  KD+FFAQVTRK    +Y+ + W + F ++ V K   Y LRIA+A++
Sbjct  480   HNDMVYTVGVSDYRKDFFFAQVTRKTDNNTYQGSTWQIKFKLDIVDKNNTYKLRIALATA  539

Query  2023  TRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGENKLY  2202
               + L + +N D +     F++ L G DN IARHGIHGLY   + ++PG  +V+G N ++
Sbjct  540   HVSDLQVRIN-DLRPSNPHFSTGLIGNDNTIARHGIHGLYRLYNVDVPGVQLVEGNNTIF  598

Query  2203  LRQSKAGYPFYGIMYDYIRLEA  2268
             L ++ +  PF GIMYDYIRLE 
Sbjct  599   LTRTWSTSPFQGIMYDYIRLEG  620



>ref|XP_010104583.1| hypothetical protein L484_025562 [Morus notabilis]
 gb|EXC01184.1| hypothetical protein L484_025562 [Morus notabilis]
Length=1156

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/629 (51%), Positives = 418/629 (66%), Gaps = 27/629 (4%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             VKL V  + V+MDNGI++V LSNP+G V GI + G+D NLLE+ N   +RG         
Sbjct  541   VKLHVQDQHVVMDNGIVQVTLSNPDGIVTGIRFNGID-NLLEVLNDESNRG---------  590

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKRFVMLPGSSGFY  759
                      I  T FKVI+E E QVE+SF +T+ S  +   +P+NIDKRF+ML GSSGFY
Sbjct  591   ---------IKGTTFKVIVESEEQVEISFTRTWDSSMEGKLVPLNIDKRFIMLRGSSGFY  641

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             +YAIY+H       +L +TR+ FKL +  F ++AV D  Q  MP   +R    G+ L Y 
Sbjct  642   SYAIYEHLTEWPAFNLGETRIAFKLRKDKFHYMAVADNRQRNMPLPDDRLPPRGQALAYP  701

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHL-GFWIITASNEFRLGGPL  1110
             EAV L     P+LKG+VDDKYQY+ +++++ V+GWIS  P+L GFW+IT S+EFR GGP 
Sbjct  702   EAVLLVNPVEPELKGEVDDKYQYSCENKDIKVHGWISMDPNLVGFWMITPSHEFRSGGPH  761

Query  1111  KQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGTDHKTLW  1287
             KQ+LT H GP ALS+FLS HYSG+D   K   GE WK VFGPVFIY+NS    +D   LW
Sbjct  762   KQNLTSHVGPTALSVFLSAHYSGEDLVPKFGDGEPWKKVFGPVFIYLNSLFDESDPLELW  821

Query  1288  EGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAK  1467
             E AK QM  E + WPYSFP +ED+ K+ QRG +SGRLL+ D         A  A VGLA 
Sbjct  822   EDAKTQMNIEEQSWPYSFPATEDFQKSEQRGNLSGRLLVKDRYISDDYISANGAFVGLAP  881

Query  1468  PGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPG  1647
             PG+ GSWQ +   YQFW+R D+ G F I+ +R G Y+LYAWVP  +GD+++   I I  G
Sbjct  882   PGDVGSWQRECKDYQFWSRADENGYFSINDIRTGSYNLYAWVPSFIGDYRYDVVIAITSG  941

Query  1648  CDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWD  1827
             CDI  GDLV+ P ++G T+WEIGIPDRSAAEF+ P+P P+  N L  D  +KFRQYGLW+
Sbjct  942   CDIDTGDLVYEPPRSGPTLWEIGIPDRSAAEFYAPDPNPNYVNKLYVDHPDKFRQYGLWE  1001

Query  1828  RYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTL  2001
             RY+EL+   DLVYT+G SD +KDWFFAQVTRK    +Y+ T W + F +  V +   Y L
Sbjct  1002  RYAELYPDKDLVYTIGSSDYSKDWFFAQVTRKKDNNTYQGTTWQIQFKLNKVDESSTYKL  1061

Query  2002  RIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIV  2181
             R+A+AS+T + L + VN DPK +   FTS L G+DN+IARHGIHGLY   +  I G+ +V
Sbjct  1062  RLALASATFSELQVRVN-DPKANPPLFTSGLIGRDNSIARHGIHGLYRLYNVNIKGTRLV  1120

Query  2182  KGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              G+N ++L Q ++  PF GIMYDYIRLE 
Sbjct  1121  GGDNTIFLTQPRSSSPFQGIMYDYIRLEG  1149


 Score =   265 bits (676),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 146/312 (47%), Positives = 197/312 (63%), Gaps = 23/312 (7%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L    + V++DNG++++ LS P+G V  I Y GVD NLLE+ NK  +RG         
Sbjct  60    VRLHFHDQNVVVDNGLLQLTLSVPDGIVTSIRYHGVD-NLLEVLNKESNRG---------  109

Query  583   KEKASTSFKILATDFKVIMEKESQVEVSFKKTY-KSGDKTDIPINIDKRFVMLPGSSGFY  759
                      I  TDF+VI+  E QVE+SF + +  S +   +P+NIDKRF++L GSSGFY
Sbjct  110   ---------IKGTDFRVILHTEEQVELSFTRMWDHSLEGKFVPLNIDKRFIVLRGSSGFY  160

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG--EVLNYK  933
             +YAIY+H K   D D+ +TR+ FKL +  F ++AV D  Q  MP   +R  G  + L Y 
Sbjct  161   SYAIYEHLKDWPDFDIGETRITFKLRKDKFQYMAVADNRQRYMPLPDDRLSGRCQTLAYP  220

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L   + P+ +G+VDDKYQY+ ++++  V+GWI   P +GFW IT S+EFR GGP K
Sbjct  221   EAVLLGNPKIPEHQGEVDDKYQYSCENKDNRVHGWICTNPPIGFWQITPSDEFRSGGPHK  280

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDK-GTDHKTLWE  1290
             Q+LT H GP  L+MFLS HY+G D   K R GE WK VFGPVFIY+NS   G D  +LWE
Sbjct  281   QNLTSHVGPTTLAMFLSAHYAGQDLVPKFREGEPWKKVFGPVFIYLNSAPIGDDPFSLWE  340

Query  1291  GAKKQMLEETKL  1326
              AK Q + + K+
Sbjct  341   DAKIQTVYQQKM  352


 Score =   155 bits (391),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 103/150 (69%), Gaps = 3/150 (2%)
 Frame = +1

Query  1801  KFRQYGLWDRYSELHK-TDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIET  1977
             +FRQYGLW RY+EL+   DLVYTVG SD ++DWFFAQV +K    S+E T W + F +  
Sbjct  371   RFRQYGLWSRYTELYPYEDLVYTVGVSDYSRDWFFAQVPKKKDDNSHEGTTWQIRFKLNN  430

Query  1978  VAK-GCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVS  2154
             V + G Y LR+A+AS+T A L + VN DPK  +  FT+ L G+DN++ARHGIHGLY   S
Sbjct  431   VDRNGTYKLRVAIASATLAELQVRVN-DPKTRRPLFTTGLIGRDNSVARHGIHGLYWLHS  489

Query  2155  FEIPGSLIVKGENKLYLRQSKAGYPFYGIM  2244
               IPG  +V+G+N L+L Q +   PF GIM
Sbjct  490   INIPGDKLVEGDNTLFLTQPRCTSPFQGIM  519



>ref|XP_011098629.1| PREDICTED: probable rhamnogalacturonate lyase B [Sesamum indicum]
Length=655

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/640 (48%), Positives = 431/640 (67%), Gaps = 17/640 (3%)
 Frame = +1

Query  385   LGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWD  564
             + A   VKL V  E V++DNG++++ L+NP G + GI Y G+D NLLEL+N   + G+WD
Sbjct  8     MAASVAVKLVVEDEQVVLDNGLLQLTLTNPGGLIVGICYNGLD-NLLELNNPELNGGFWD  66

Query  565   LDWNTPKEKASTSFK-----ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKR  726
             L+W+   E  ST  +     I  ++F+VI+E E Q+EVSFK+ ++ S      P++IDKR
Sbjct  67    LNWS---EAGSTGTRGKFDTIEGSEFQVIVENEEQIEVSFKRRWEPSMQGQHSPLSIDKR  123

Query  727   FVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGE--MPSYK  900
             F+ML GSSGFY+Y IY H +     +L++TR+ F L +  F ++A+T++ Q    +P  +
Sbjct  124   FIMLRGSSGFYSYGIYQHEEDMPAFNLNETRIAFMLRKQKFKYMAITNDRQRRVALPEDR  183

Query  901   EREEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITA  1080
             E   G+ L Y EAV L     P+ KG+VDDKYQY+ ++++  V+G+I  +P +GFW IT 
Sbjct  184   EPPRGKELAYPEAVLLVDPVEPEFKGEVDDKYQYSCENKDNKVHGFICFEPPVGFWQITP  243

Query  1081  SNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS-  1257
             SNEFR GGP KQDLT H  P  L+MF+S HY G+D  +K   GE WK VFGPVFIY+NS 
Sbjct  244   SNEFRTGGPFKQDLTSHVNPTTLAMFVSTHYGGEDLVMKFGEGEKWKKVFGPVFIYLNSC  303

Query  1258  -DKGTDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDT  1434
              +   D  +LW  AK+QM +E   WPYSFP SED+P A +RG+++GRLL  D    + + 
Sbjct  304   TEDKNDTVSLWYDAKEQMEKEVGEWPYSFPASEDFPHADERGSINGRLLAQDWYISEGNI  363

Query  1435  PAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDF  1614
              AK A+VGLA PG+ GS+Q +   YQFWT  D+ G F I+ +R G Y++YAW+PG +GDF
Sbjct  364   AAKGAYVGLAPPGKDGSFQVEGKGYQFWTNADEEGFFCITNIRPGAYNIYAWIPGFIGDF  423

Query  1615  KHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYL-LSD  1791
             +   DI I  G  I VG LV+ P +NG T+WEIGIPDRSAAEFF+P+P P   N L ++ 
Sbjct  424   RCDKDIVIAAGSKIDVGVLVYVPPRNGPTLWEIGIPDRSAAEFFVPDPNPMYINKLYINL  483

Query  1792  RTEKFRQYGLWDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFP  1968
               ++FRQYGLW+RY++L+   DLVYTVG SD  KDWF+AQVTRK  + +Y+ T W + F 
Sbjct  484   PKDRFRQYGLWERYADLYPDEDLVYTVGISDYQKDWFYAQVTRKIGENAYKGTTWQIKFN  543

Query  1969  IETVAKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSE  2148
             ++ V +G +TLRIA+AS+T + L + +N + + +  +F+S L G DN IARHG+HGLY  
Sbjct  544   VDRVGEGNHTLRIALASATFSILEVRINRE-EANPPEFSSGLIGSDNTIARHGVHGLYWL  602

Query  2149  VSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
              + EI  + +V+GEN +YL Q+++    +GIMYDYIRLE 
Sbjct  603   FNLEISSAQLVQGENTIYLTQARSASAVHGIMYDYIRLEG  642



>ref|XP_006366427.1| PREDICTED: probable rhamnogalacturonate lyase B-like isoform 
X1 [Solanum tuberosum]
Length=640

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/628 (49%), Positives = 416/628 (66%), Gaps = 11/628 (2%)
 Frame = +1

Query  409   LTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKE  588
             L    + V+++NG++++  +NP G + GI Y+G+D NLLE  NK  + G+WDL+W+ P  
Sbjct  8     LNAQNDYVVINNGVVEITWTNPGGIIKGIKYKGID-NLLEQKNKDLNGGFWDLNWSEPSS  66

Query  589   -KASTSFK-ILATDFKVIMEKESQVEVSFKKTYKSGDKTD-IPINIDKRFVMLPGSSGFY  759
              K    F  I  TD +VI+E E Q+E+SF + +    + +  P+ ID+RFV+     GFY
Sbjct  67    TKTRGKFDTIQGTDLQVIVENEEQIELSFTRMWSPEVQGEQAPLYIDRRFVVFRDVPGFY  126

Query  760   TYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYK  933
             +YAI++H K      L+ TR+ F L++  F ++ +TD+ Q  MPS ++R    GE L Y 
Sbjct  127   SYAIFEHTKDMPAFHLNTTRIAFMLNKEKFHYMVITDDRQRFMPSAEDRLPGRGEPLAYP  186

Query  934   EAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGPLK  1113
             EAV L     P+ KG+VDDKYQY+L++++  V+GWIS  P +GFW IT SNEFR GGP K
Sbjct  187   EAVLLVDPIEPEFKGEVDDKYQYSLENKDNQVHGWISFDPPVGFWQITPSNEFRTGGPFK  246

Query  1114  QDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSDKGTDHK-TLWE  1290
             QDLT H  P  L++FL+ HY+G +  +K   GE WK V GPVF Y NS    D   +LW+
Sbjct  247   QDLTSHVNPTTLAIFLTSHYAGTELLVKFETGEEWKKVLGPVFTYFNSISDKDMALSLWD  306

Query  1291  GAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKP  1470
              AK+QM EE + WPYSFP SE++P   QRG V GRLL+ D    K + P K A VGLA P
Sbjct  307   DAKRQMNEEVQSWPYSFPTSEEFPNCDQRGVVRGRLLVQDRYLSKENLPGKAASVGLAAP  366

Query  1471  GEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGC  1650
             G+ GSWQ ++  YQFWT TD+ G F I  +RAG Y+LY  VPG +GD+K++  IT+  GC
Sbjct  367   GDAGSWQRENKGYQFWTMTDEDGCFVIKNIRAGSYNLYGVVPGFIGDYKYEVVITLTEGC  426

Query  1651  DIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDR  1830
             DI +G++V+ P ++G T+WEIGIPDRSAAEF+IP+P P   N L  ++ +KFRQYGLW+R
Sbjct  427   DIGLGEIVYEPPRDGPTLWEIGIPDRSAAEFYIPDPNPKYVNKLYLNQ-DKFRQYGLWER  485

Query  1831  YSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAK-GCYTLR  2004
             Y+EL+ + DLVYTVG SD  KDWFFAQV R+    +Y++T W + F I+ V + G YTLR
Sbjct  486   YAELYPENDLVYTVGVSDYQKDWFFAQVNREIGDKAYQSTTWQIKFKIDNVDQGGSYTLR  545

Query  2005  IAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVK  2184
             +A+A+S  A L + +N DP  D    ++   G DNAIARH IHG+Y   +  IPGSL++ 
Sbjct  546   VALAASNHAELQVRIN-DPTADPPLLSTGEIGGDNAIARHAIHGIYWLFTVTIPGSLLLG  604

Query  2185  GENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             GEN ++L Q+K    F GIMYDYIRLE 
Sbjct  605   GENTIFLTQAKTANAFQGIMYDYIRLEG  632



>ref|NP_172462.2| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
 gb|AEE28513.1| rhamnogalacturonate lyase-like protein [Arabidopsis thaliana]
Length=675

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/635 (49%), Positives = 419/635 (66%), Gaps = 10/635 (2%)
 Frame = +1

Query  382   HLGACKPVKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYW  561
             H  +   V L V    V+MDNGI++V LS P G + GI Y G+D N+LE+ NK  +RGYW
Sbjct  42    HRMSSHGVHLHVHDRYVVMDNGILQVTLSKPGGIITGIEYNGID-NVLEVRNKETNRGYW  100

Query  562   DLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVML  738
             DL WN P  K      I    F+VI+E E QVE+SF +T+  S +   IP+NIDKRF+ML
Sbjct  101   DLHWNEPGGKGIFDV-ISGVTFRVIVETEEQVEISFLRTWDPSLEGKYIPLNIDKRFIML  159

Query  739   PGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKEREEG-  915
              GSSG Y+Y IY+H K     +L +TR+ FKL +  F ++AV D+ +  MP   +  +G 
Sbjct  160   RGSSGVYSYGIYEHLKDWPGFELGETRIAFKLRKDKFHYMAVADDRKRIMPFPDDLCKGR  219

Query  916   -EVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEF  1092
              + L+Y+EA  LT   +P+L+G+VDDKYQY+ +++++ V+GWIS  P +GFW IT SNEF
Sbjct  220   CQTLDYQEASLLTAPCDPRLQGEVDDKYQYSCENKDLRVHGWISFDPPVGFWQITPSNEF  279

Query  1093  RLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD-KGT  1269
             R GGPLKQ+LT H GP  L++F S HY+G     +   GE WK V+GPVFIY+NS   G 
Sbjct  280   RSGGPLKQNLTSHVGPTTLAVFHSTHYAGKTMMPRFEHGEPWKKVYGPVFIYLNSTANGD  339

Query  1270  DHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCA  1449
             D   LW+ AK +M+ E + WPYSF  S+DYPK+ +RG   GRLLI D         A+ A
Sbjct  340   DPLCLWDDAKIKMMAEVERWPYSFVASDDYPKSEERGTARGRLLIRDRFINNDLISARGA  399

Query  1450  HVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKAD  1629
             +VGLA PG+ GSWQ +   YQFW   D+ G F I  VR GEY+LYAWVP  +GD+ +   
Sbjct  400   YVGLAPPGDSGSWQIECKGYQFWAIADEAGYFSIGNVRPGEYNLYAWVPSFIGDYHNGTI  459

Query  1630  ITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFR  1809
             + +  GC I++GD+V+ P ++G T+WEIGIPDR A+EFFIP+P P L N +L    ++FR
Sbjct  460   VRVTSGCMIEMGDIVYEPPRDGPTLWEIGIPDRKASEFFIPDPDPTLVNRVLVHHQDRFR  519

Query  1810  QYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETV-A  1983
             QYGLW +Y++++   DLVYTVG SD  +DWFFA V RK     +E T W ++F +E +  
Sbjct  520   QYGLWKKYTDMYPNDDLVYTVGVSDYRRDWFFAHVPRKKGD-VHEGTTWQIIFNLENIDQ  578

Query  1984  KGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEI  2163
             K  Y LR+A+AS+T A L I +N D +  +  FT+ L G+DN+IARHGIHG+Y   +  I
Sbjct  579   KANYKLRVAIASATLAELQIRIN-DAEAIRPLFTTGLIGRDNSIARHGIHGVYMLYAVNI  637

Query  2164  PGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             PG+ +V+G+N ++L+Q +   PF GIMYDYIRLE 
Sbjct  638   PGNRLVQGDNTIFLKQPRCNGPFQGIMYDYIRLEG  672



>emb|CDX94934.1| BnaC05g07370D [Brassica napus]
Length=661

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/625 (51%), Positives = 423/625 (68%), Gaps = 16/625 (3%)
 Frame = +1

Query  430   VLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTPKEKASTSFK  609
             V+MDNGI +V LS P+G V GI Y G+D NLLE+ N+  +RGYWDL W+ P   A T   
Sbjct  39    VVMDNGIARVTLSKPDGIVTGIEYNGID-NLLEVLNEESNRGYWDLVWSGPG-TAGTFDV  96

Query  610   ILATDFKVIMEKESQVEVSFKKTYK-SGDKTDIPINIDKRFVMLPGSSGFYTYAIYDHPK  786
             I  T F+VI+E E Q+E+SF + +  S +   +P+NIDKRFVML GSSGFYTYAIY+H K
Sbjct  97    IKGTKFEVIIENEEQIEISFTRKWDPSQEGKAVPLNIDKRFVMLRGSSGFYTYAIYEHLK  156

Query  787   GGVDVDLDQTRVVFKL----SRSLFTHLAVTDEIQGEMPSYKER--EEGEVLNYKEAVKL  948
                   + +TR+ FKL     +  F ++A+TD+ Q  MP   +R  + G+ L Y EAV L
Sbjct  157   EWPAFSIAETRIAFKLRKENGKCRFHYMAITDDRQRFMPLPDDRLPDRGQALAYPEAVLL  216

Query  949   TKTENPKLKGKVDDKYQYALDSQNMSVYGWI-SPKPHLGFWIITASNEFRLGGPLKQDLT  1125
                  P+ KG+VDDKYQY+ ++++++V+GWI + +P +GFW+IT S+E+R GGP KQ+LT
Sbjct  217   VNPVEPQFKGEVDDKYQYSCENKDITVHGWICTEQPSVGFWLITPSHEYRTGGPQKQNLT  276

Query  1126  CHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKTLWEGAK  1299
              H GP AL++F+S HY+G+D   K   GEAWK VFGPVF+Y+NS  D   D   LW+ AK
Sbjct  277   SHVGPTALAVFMSAHYTGEDLVPKFSEGEAWKKVFGPVFVYLNSSTDDDNDPLWLWQDAK  336

Query  1300  KQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGLAKPGEP  1479
              QM  E + WPYSFP S+DY KA QRG V GRLL+ D    +    A   +VGLA PG  
Sbjct  337   SQMNVEVESWPYSFPASDDYVKAEQRGNVVGRLLVQDRYVDRDFIAANRGYVGLALPGAA  396

Query  1480  GSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIKPGCDIK  1659
             GSWQ +   YQFWTRTD+ G F I+ VR G+Y+LYAW+PG +GD+K+   ITI PGC + 
Sbjct  397   GSWQRECKDYQFWTRTDEEGFFYINGVRPGQYNLYAWIPGFIGDYKYDDIITITPGCYMY  456

Query  1660  VGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGLWDRYSE  1839
             + DLV+ P +NG T+WEIG PDRSAAEF+ P+P P   N L  +  ++FRQYGLW+RY+E
Sbjct  457   MEDLVYQPPRNGATLWEIGFPDRSAAEFYAPDPNPKYINKLYQNHPDRFRQYGLWERYAE  516

Query  1840  LH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CYTLRIAV  2013
             L+   DLVY VG SD +KDWF+AQVTRK    +Y+ T W + F ++ + K   YTLR A+
Sbjct  517   LYPDKDLVYVVGSSDYSKDWFYAQVTRKKDSKTYQGTTWQIKFELKDIDKDHTYTLRAAI  576

Query  2014  ASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSLIVKGEN  2193
             AS+T A L + VN         FTS L G+DN+IARHGIHGLY   + ++ GS +V+GEN
Sbjct  577   ASATFAELQVRVND--ATASPLFTSGLIGRDNSIARHGIHGLYWLFNVDVAGSKLVEGEN  634

Query  2194  KLYLRQSKAGYPFYGIMYDYIRLEA  2268
              L+L Q ++  PF GIMYDYIR EA
Sbjct  635   TLFLTQPRSVSPFQGIMYDYIRFEA  659



>ref|XP_011016991.1| PREDICTED: probable rhamnogalacturonate lyase B isoform X2 [Populus 
euphratica]
Length=637

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/631 (49%), Positives = 424/631 (67%), Gaps = 16/631 (3%)
 Frame = +1

Query  403   VKLTVTKEMVLMDNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKDRGYWDLDWNTP  582
             V+L + +  V+MDNGI++V LS PEG V GI Y G+  NLLE+ N   +RGYWDL W+  
Sbjct  6     VQLHIQERHVVMDNGILQVTLSKPEGIVTGIQYNGIS-NLLEVLNDESNRGYWDLVWSKE  64

Query  583   KEKAST--SFKILATDFKVIMEKESQVEVSFKKTYKSGDKTDI-PINIDKRFVMLPGSSG  753
                 +T  S  I    F+V++E E QVE+SF + +    +  + P+NIDKRF+ML  SSG
Sbjct  65    GSTGTTGTSDAIKGESFRVVVENEEQVEISFTRMWDPSLEGKLAPLNIDKRFIMLRNSSG  124

Query  754   FYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER--EEGEVLN  927
             FY+YAIY+H K     +L QTR+VFKL +  F  +AV D  Q  MP  ++R  + GE L 
Sbjct  125   FYSYAIYEHFKEWPAFNLPQTRIVFKLRKDKFHCMAVADNRQRRMPLPEDRLPKRGEPLA  184

Query  928   YKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWISPKPHLGFWIITASNEFRLGGP  1107
             Y EAV L      + KG+VDDKYQY+ +++++ V+GWI   P +GFW IT SNEFR GGP
Sbjct  185   YPEAVLLVNPVEAEFKGEVDDKYQYSCENKDLQVHGWICLNPPVGFWQITPSNEFRSGGP  244

Query  1108  LKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINS--DKGTDHKT  1281
             +KQ+L+ H GP +L+MFLS HYSG+D  +KL+ GE WK VFGPVFIY+N+  D   +   
Sbjct  245   VKQNLSSHVGPISLAMFLSAHYSGEDTVLKLKPGEPWKKVFGPVFIYLNTLLDDENEPHW  304

Query  1282  LWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHDPCAGKTDTPAKCAHVGL  1461
             LWE AK+QML E + WPYSFP SED+P + QRG V+GRL + D        P   A+VGL
Sbjct  305   LWEDAKEQMLIEVQSWPYSFPASEDFPSSEQRGCVNGRLQVQDRFISDYCIPGNGAYVGL  364

Query  1462  AKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDFKHKADITIK  1641
             A PG+ GSWQ +    +FWT+ D  G F I+ +R G+Y+LYAW+PG +GD+++   ITI 
Sbjct  365   APPGDIGSWQREC---KFWTKADPEGYFSINDIRTGDYNLYAWIPGFIGDYRNDEVITIT  421

Query  1642  PGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDRTEKFRQYGL  1821
             PGCD+  GD+++ P ++G T+WEIGIP+RSAAEF+IP+P P   N L  +  ++FRQYGL
Sbjct  422   PGCDLDFGDVIYKPPRDGPTLWEIGIPNRSAAEFYIPDPDPKYINKLYVNHPDRFRQYGL  481

Query  1822  WDRYSELH-KTDLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFPIETVAKG-CY  1995
             W+RY++L+   DLVYT+G SD AKDWFFAQVTRK    SY+ T W + F +++V     Y
Sbjct  482   WERYADLYPDEDLVYTIGTSDYAKDWFFAQVTRKKDDNSYQGTTWQIKFKLDSVQNSRSY  541

Query  1996  TLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYSEVSFEIPGSL  2175
              LR+A+A++  A L + +N     +   +++ + G DN IARHGIHGLY   + E+PGS 
Sbjct  542   KLRLALATANVAELQVRIN---SLETNPWSTGVIGHDNTIARHGIHGLYWLYNIEVPGSE  598

Query  2176  IVKGENKLYLRQSKAGYPFYGIMYDYIRLEA  2268
             +V+ +N ++L Q+ A  PF GIMYDYIRLE 
Sbjct  599   LVEEDNTIFLTQTMATSPFQGIMYDYIRLEG  629



>ref|XP_003628880.1| Rhamnogalacturonate lyase [Medicago truncatula]
Length=688

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/640 (49%), Positives = 424/640 (66%), Gaps = 16/640 (3%)
 Frame = +1

Query  382   HLGACKPVKL-TVTKEMVLM---DNGIIKVNLSNPEGSVAGILYQGVDDNLLELSNKIKD  549
             +LG+   VKL T  K+ V++   DNGI+ V LS PEG + GI Y G+D N+LE   K   
Sbjct  48    NLGSTVVVKLNTENKQQVILLVVDNGIVSVTLSKPEGYLIGISYNGID-NILESEYKEHA  106

Query  550   RGYWDLDWNTPKEKASTSFKILATDFKVIMEKESQVEVSFKKTYKSG-DKTDIPINIDKR  726
             RGY+D+ WN   +      +I  T F VI+  E+ VEVSF +++ S     D+PINID R
Sbjct  107   RGYFDVVWNELGKHGKVQ-RIHGTKFSVIVANENMVEVSFLRSWTSSMTGIDVPINIDIR  165

Query  727   FVMLPGSSGFYTYAIYDHPKGGVDVDLDQTRVVFKLSRSLFTHLAVTDEIQGEMPSYKER  906
             ++   G SGFY+YAI+D  +G   V +DQ R VF+L++  F ++A++D  Q  MP+ ++ 
Sbjct  166   YIFRRGDSGFYSYAIFDRHEGMPAVKVDQIRFVFRLNKDRFNYMALSDTRQRRMPTMRDV  225

Query  907   EEGEVLNYKEAVKLTKTENPKLKGKVDDKYQYALDSQNMSVYGWIS--PKPHLGFWIITA  1080
             + G+VL Y EAV LTK  NP+  G+VDDKYQY+ ++ N +V+GWIS    P +GFW+IT 
Sbjct  226   KTGQVLAYPEAVLLTKPHNPQFTGEVDDKYQYSCENINNTVHGWISLDSDPTVGFWMITP  285

Query  1081  SNEFRLGGPLKQDLTCHCGPFALSMFLSLHYSGDDWGIKLRGGEAWKMVFGPVFIYINSD  1260
             SNEFR GGP+KQDLT H GP  LSMF+S HY+G D  ++   GE +K VFGP+F+Y+N+ 
Sbjct  286   SNEFRNGGPIKQDLTSHAGPITLSMFVSPHYAGKDVTMEFEEGETYKKVFGPIFVYLNTA  345

Query  1261  KG-TDHKTLWEGAKKQMLEETKLWPYSFPKSEDYPKAAQRGAVSGRLLIHD-PCAGKTDT  1434
                 D+ TLW  A +Q  +E + WPY FP+S+DY    QRGAV GRLL+ D    G    
Sbjct  346   SSENDNATLWSDAVQQFSKEVQSWPYDFPQSKDYFPPNQRGAVFGRLLVQDWYFKGGRFQ  405

Query  1435  PAKCAHVGLAKPGEPGSWQNDSMSYQFWTRTDDTGKFEISAVRAGEYSLYAWVPGHLGDF  1614
                 A+VGLA PG+ GSWQ +S  YQFWTR +  G F+I+    G+Y+LYAWVPG +GD+
Sbjct  406   YTNNAYVGLALPGDAGSWQTESKGYQFWTRANAKGYFKITNAVPGDYNLYAWVPGFIGDY  465

Query  1615  KHKADITIKPGCDIKVGDLVFTPLKNGTTVWEIGIPDRSAAEFFIPEPAPDLKNYLLSDR  1794
             K+ A ITI PG  IK+  LV+ P +NG T+WEIGIPDR A+EF IP+P P L N L + +
Sbjct  466   KYNATITITPGGVIKLNSLVYNPPRNGPTIWEIGIPDRLASEFHIPDPYPTLMNKLYTKK  525

Query  1795  -TEKFRQYGLWDRYSELHKT-DLVYTVGKSDPAKDWFFAQVTRKNAKGSYEATIWTVVFP  1968
              ++KFRQYGLW RYS+++   DLVYTVG ++  +DWFFA VTR     +YE T W ++F 
Sbjct  526   HSDKFRQYGLWKRYSDIYPNDDLVYTVGVNN-YRDWFFAHVTRSTGNKTYEPTTWQIIFE  584

Query  1969  IET-VAKGCYTLRIAVASSTRATLLIWVNGDPKKDKAKFTSKLGGKDNAIARHGIHGLYS  2145
              +  +  G YTL++A+AS+  + L +  N D  KD   F +   G+DNAIARHGIHGLY 
Sbjct  585   HKNDIISGNYTLQLALASAADSNLQVRFN-DRSKDPPHFATGRIGRDNAIARHGIHGLYR  643

Query  2146  EVSFEIPGSLIVKGENKLYLRQSKAGYPFYGIMYDYIRLE  2265
               S  +  +L+VKG+N +YLRQSKA  PF G+MYDYIRLE
Sbjct  644   LFSINVSSNLLVKGKNIIYLRQSKADTPFQGVMYDYIRLE  683



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 7549777629984