BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7238_g2_i1 len=1260 path=[1242:0-1259]

Length=1260
                                                                      Score     E

ref|XP_010653102.1|  PREDICTED: uncharacterized protein LOC104879960  72.4    1e-10   
ref|XP_009797935.1|  PREDICTED: uncharacterized protein LOC104244245  69.3    1e-09   
ref|XP_009606101.1|  PREDICTED: uncharacterized protein LOC104100550  67.8    4e-09   
ref|XP_011006244.1|  PREDICTED: suppressor protein SRP40-like         64.7    4e-08   
ref|XP_002323691.2|  hypothetical protein POPTR_0016s14860g           64.3    5e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011016577.1|  PREDICTED: uncharacterized protein LOC105120091  62.8    2e-07   
ref|XP_009370926.1|  PREDICTED: uncharacterized protein LOC103960218  62.0    3e-07   
ref|XP_010327697.1|  PREDICTED: uncharacterized protein LOC101257...  59.7    1e-06   
ref|XP_004249019.2|  PREDICTED: uncharacterized protein LOC101257...  60.5    1e-06   
ref|XP_011018930.1|  PREDICTED: uncharacterized protein LOC105121822  58.9    3e-06   
ref|XP_006362330.1|  PREDICTED: putative mediator of RNA polymera...  59.3    3e-06   
ref|XP_006381276.1|  hypothetical protein POPTR_0006s11310g           58.5    4e-06   
ref|XP_008244395.1|  PREDICTED: uncharacterized protein LOC103342532  58.5    5e-06   
ref|XP_007206569.1|  hypothetical protein PRUPE_ppa020068mg           55.1    1e-05   
ref|XP_010113046.1|  hypothetical protein L484_022772                 56.2    3e-05   
ref|XP_008370302.1|  PREDICTED: uncharacterized protein LOC103433...  55.5    4e-05   
gb|KDP21829.1|  hypothetical protein JCGZ_00616                       54.7    6e-05   
ref|XP_004305065.1|  PREDICTED: uncharacterized protein LOC101292730  53.9    2e-04   



>ref|XP_010653102.1| PREDICTED: uncharacterized protein LOC104879960 [Vitis vinifera]
Length=329

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 65/234 (28%), Positives = 114/234 (49%), Gaps = 43/234 (18%)
 Frame = +3

Query  444   FLPVNHLLNT-LEGPQIDDSMGDDHFQNSAISNDGSKQLVLSMSRARSR-TAADGGGVMN  617
             F  +N +LN  +   ++  S   D         D +++L  + SR  S+ T A  G +  
Sbjct  127   FSAINRVLNAFVSSSRVPSSEETDRI-------DENRRLASAESRKASKVTTAINGSITK  179

Query  618   MMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFSRQRAKSGGGLDSNQKMSR  797
             +++KFR +   R M+ S +K R+ +   V              +  +    + S++K+ +
Sbjct  180   ILIKFRSI-KIRPMLTSFVKPRQGKGNKV--------------KSQEMSSTIWSHRKLIK  224

Query  798   RQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIVA--SDDHRGG----SRSHPKSCPG  959
                   +G   G  + + +     + I ++AIRG++   S    GG    +++  KSCPG
Sbjct  225   PLDNRTVGEGRGDCRRKKTKTSAAMDINMEAIRGVLEAISSMSIGGRSKQTKTKMKSCPG  284

Query  960   SIKSSPLHHQG----QGGGATSLSGTLVCSRDNNVQAAIAHCKKSFGRSEDFSF  1109
             SIK SP++ +G    +  G T         R+N+VQAAIAHCK+SFG++++FSF
Sbjct  285   SIKCSPINERGVADRESRGYT---------RENSVQAAIAHCKRSFGQAQEFSF  329



>ref|XP_009797935.1| PREDICTED: uncharacterized protein LOC104244245 [Nicotiana sylvestris]
Length=349

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 70/251 (28%), Positives = 112/251 (45%), Gaps = 44/251 (18%)
 Frame = +3

Query  423   NKRKVPLFLPVNHLLNTLEGPQIDDSMGDDHFQNSAISNDGSKQLVLSMSRARSRTAADG  602
             NK ++ LF+ +  ++N      + + +     + +   ++ +   +LS  + R+   +  
Sbjct  119   NKARLGLFVSLTRIVNAFMASSVKN-LNSLRVEKANFDHESNCTEMLSNRKDRTMVTSKP  177

Query  603   GGVMNMMVKFRYVMSFRWMVASML--KIRRqqsqavtspspsstatHFSRQRAKSGGGLD  776
              G+MN ++KF+Y  +   M+ SM+  K +R+Q                +RQ     G   
Sbjct  178   NGIMNFIIKFKY-RNIPSMLFSMVTPKAKREQMP--------------ARQPLLQRGSST  222

Query  777   SNQ-------KMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGI----VASDDHR  923
              N+       K+  R    +   +   +KS +SV  +   I L A+RG+    V +  + 
Sbjct  223   CNENPTNDTMKLKTRNHSDLNYQDLTRDKSTTSVAGI---INLKAMRGVLDSLVRTSRYY  279

Query  924   GGSR---------SHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCK  1076
               +R         S  KSCP SIKSSP+H    G         L   RDN+VQAAIAHCK
Sbjct  280   TSARTRTSFAHKNSKSKSCPNSIKSSPMHSNNNGYDDEVRRFYL---RDNSVQAAIAHCK  336

Query  1077  KSFGRSEDFSF  1109
             KSFG   DF F
Sbjct  337   KSFGAPVDFEF  347



>ref|XP_009606101.1| PREDICTED: uncharacterized protein LOC104100550 [Nicotiana tomentosiformis]
Length=370

 Score = 67.8 bits (164),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 95/333 (29%), Positives = 139/333 (42%), Gaps = 61/333 (18%)
 Frame = +3

Query  237   AYIEINL----------DHppppppKCRNENEGDDDLEFRVSFLEAALP--FIGIsspps  380
             AYIEINL          D+        R E E  + +E R+SF  A +P      S   +
Sbjct  55    AYIEINLNPLPTKTTLVDYDGESVNFHREEKEASE-VELRISF-SAGIPSTVTTCSISAA  112

Query  381   nsyysppVDWPPAPNKRKVPLFLPVNHLLNTLEGP--------QIDDSMGDDHFQNSAIS  536
              +  S         NK ++ LF+ +  ++N             +++++     F++  I 
Sbjct  113   ETSRSTTQHAQRTINKPRLGLFVSLTRIINAFVASSAKTSNLVRVEEANFGHEFEHERIH  172

Query  537   -NDGSKQLVLSMSRAR---SRTAADGGGVMNMMVKFRYVMSFRWMVASML--KIRRqqsq  698
                 SK     M R+R   +  A+   G+M+ +VKF+Y  +   M+ SML  K +R+Q  
Sbjct  173   LPSMSKADYTEMLRSRKDRTMVASKPNGIMSFIVKFKY-RNIPSMLFSMLSPKPKREQMP  231

Query  699   avtspspsstatHFSRQRAKS---GGGLDSNQKMSRRQKKAIIGTNNGPEKSRSSVLLLR  869
             A               QR  +   G   +   K+  R    +   +   +KS SSV  + 
Sbjct  232   ARQPLL----------QRGSNTCNGNPTNDTTKLKTRNHSELNYQDLTRDKSTSSVAGI-  280

Query  870   LGIKLDAIRGIVASDDHRG-------------GSRSHPKSCPGSIKSSPLHHQGQGGGAT  1010
               + L A+RG++ S    G                S  KSCP SIKSSP+H      G  
Sbjct  281   --MNLKAMRGVLDSLVRTGRYYTSARTRTSFANKHSKSKSCPSSIKSSPMHSNNISCGD-  337

Query  1011  SLSGTLVCSRDNNVQAAIAHCKKSFGRSEDFSF  1109
                     SRDN+VQAAIAHCKKSFG   DF F
Sbjct  338   --EVRRFYSRDNSVQAAIAHCKKSFGAPVDFEF  368



>ref|XP_011006244.1| PREDICTED: suppressor protein SRP40-like [Populus euphratica]
Length=347

 Score = 64.7 bits (156),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/229 (30%), Positives = 100/229 (44%), Gaps = 34/229 (15%)
 Frame = +3

Query  426   KRKVPLFLPVNHLLNTLEGPQIDDSMGDDHFQNSAISNDGSKQLVL-SMSRARSRTAADG  602
             KRK   F  VN  LN L+      S  +D  +N   +N    +LV  S  +    TA + 
Sbjct  141   KRKAQ-FPKVNGFLNMLKPSLTVSSEAND--ENGGPANSSHLELVRPSTMKGSKETAMNS  197

Query  603   GGVM-NMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFS-----RQRAKSG  764
              G+M   +VKFR  +  R ++AS +K R++ +      +  +  T          R   G
Sbjct  198   SGIMMKFLVKFR-TLRIRTLLASFMKSRQEINFPREKKNIGTYHTLIKPFDNWLVRKGQG  256

Query  765   GGLDSNQKMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIV-ASDDHRGGSRSH  941
              G +SN       +  ++  N                  LDAIRG++ A     GG    
Sbjct  257   SGSNSNNPFGNGDRSRVMEKN------------------LDAIRGVLEAMSTSIGGKDRK  298

Query  942   PKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFG  1088
              KSCP S KSSP H     G ++      +C +DN++QAAIAHCK+S G
Sbjct  299   SKSCPSSTKSSPTHL----GFSSGNQNHKICGQDNSIQAAIAHCKRSLG  343



>ref|XP_002323691.2| hypothetical protein POPTR_0016s14860g [Populus trichocarpa]
 gb|EEF05452.2| hypothetical protein POPTR_0016s14860g [Populus trichocarpa]
Length=346

 Score = 64.3 bits (155),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 73/229 (32%), Positives = 103/229 (45%), Gaps = 34/229 (15%)
 Frame = +3

Query  426   KRKVPLFLPVNHLLNTLEGPQIDDSMGDDHFQNSAISNDGSKQLVL-SMSRARSRTAADG  602
             KRK   F  V+  LN L+      S   D     A SN    +LV  S  +    TA + 
Sbjct  140   KRKAQ-FPKVHGFLNMLKPSLTVSSEASDENGRPASSNH--LELVRPSTMKGSKETAMNS  196

Query  603   GGVM-NMMVKFRYVMSFRWMVASMLKIRRqqsq---avtspspsstatHFSRQRAKSGGG  770
              G+M   +VKFR  +  R ++AS +K R++ +         +  +    F +   + G G
Sbjct  197   SGIMMKFLVKFR-TLRIRTLLASFMKSRQEINFPRGKKNIGAYQTLIKPFDKWLVRKGQG  255

Query  771   LDSNQKMSRRQKKAIIGTNNGP--EKSRSSVLLLRLGIKLDAIRGIV-ASDDHRGGSRSH  941
               SN              +N P     RS V+       LDAIRG++ A     GG    
Sbjct  256   SSSN--------------SNNPFGNGDRSRVM----EKNLDAIRGVLEAMSTSVGGKDRK  297

Query  942   PKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFG  1088
              KSCP S KSSP H     G ++      +C++DN++QAAIAHCK+SFG
Sbjct  298   SKSCPSSTKSSPTHL----GFSSGDQNHKICAQDNSIQAAIAHCKRSFG  342



>ref|XP_011016577.1| PREDICTED: uncharacterized protein LOC105120091 [Populus euphratica]
Length=347

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 100/229 (44%), Gaps = 34/229 (15%)
 Frame = +3

Query  426   KRKVPLFLPVNHLLNTLEGPQIDDSMGDDHFQNSAISNDGSKQLVL-SMSRARSRTAADG  602
             KRK   F  VN  LN L+      S  ++  +N   +N    +LV  S  +    TA + 
Sbjct  141   KRKAQ-FPKVNGFLNMLKPSLTVSSEANN--ENGRPANSNHLELVRPSTMKGSKETAMNS  197

Query  603   GGVM-NMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFS-----RQRAKSG  764
              G+M   +VKFR  +  R ++AS +K R++ +      +  +  T          R   G
Sbjct  198   SGIMMKFLVKFR-TLRIRTLLASFMKSRQEINFPREKKNIGTYQTLIKPFDNWLVRKGQG  256

Query  765   GGLDSNQKMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIV-ASDDHRGGSRSH  941
              G +SN       +  ++  N                  LDAIRG++ A     GG    
Sbjct  257   SGSNSNNPFGNGDRSRVMEKN------------------LDAIRGVLEAMSTSIGGKDRK  298

Query  942   PKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFG  1088
              KSCP S KSSP H     G ++      +C +DN++QAAIAHCK+S G
Sbjct  299   SKSCPSSTKSSPTHL----GFSSGNQNHKICGQDNSIQAAIAHCKRSLG  343



>ref|XP_009370926.1| PREDICTED: uncharacterized protein LOC103960218 [Pyrus x bretschneideri]
Length=365

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 81/174 (47%), Gaps = 23/174 (13%)
 Frame = +3

Query  603   GGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFSRQRAKSGGGLDSN  782
             GG+M ++ KFR  M+   +VAS  K R+            +         +K  G     
Sbjct  196   GGIMKLLFKFR-AMNLGALVASFAKPRQAACDDDDPHQSQNINCRRKNNNSKESGSNALP  254

Query  783   QKMSRRQKKAIIGTNN-----GPEKSRSSVLLLRLGIKLDAIRGIVA------SDDHRGG  929
               + ++Q K+    N+     G EKSR     + L I L A+RGI+       S    G 
Sbjct  255   WSVQKKQGKSSRTKNSSEAVGGGEKSR-----VLLEINLSAVRGILEAIGNSMSTGGTGR  309

Query  930   SRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVC--SRDNNVQAAIAHCKKSF  1085
              +   +SCP SIKSSP+H QG  G   S     VC  +R+ ++QAAIAHCK SF
Sbjct  310   KQRRTRSCPSSIKSSPIH-QGFTGDDHS---NKVCFHTRETSIQAAIAHCKTSF  359



>ref|XP_010327697.1| PREDICTED: uncharacterized protein LOC101257120 isoform X2 [Solanum 
lycopersicum]
Length=284

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +3

Query  924   GGSRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFGRSEDF  1103
             G  ++  KSCP SIKSSPLH                 SRDN+VQAAIAHCKKSFG   +F
Sbjct  226   GNKQNSSKSCPSSIKSSPLHSNVCDDDVKKFY-----SRDNSVQAAIAHCKKSFGTQAEF  280

Query  1104  SF  1109
              F
Sbjct  281   DF  282



>ref|XP_004249019.2| PREDICTED: uncharacterized protein LOC101257120 isoform X1 [Solanum 
lycopersicum]
Length=363

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 36/62 (58%), Gaps = 5/62 (8%)
 Frame = +3

Query  924   GGSRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFGRSEDF  1103
             G  ++  KSCP SIKSSPLH                 SRDN+VQAAIAHCKKSFG   +F
Sbjct  305   GNKQNSSKSCPSSIKSSPLHSNVCDDDVKKFY-----SRDNSVQAAIAHCKKSFGTQAEF  359

Query  1104  SF  1109
              F
Sbjct  360   DF  361



>ref|XP_011018930.1| PREDICTED: uncharacterized protein LOC105121822 [Populus euphratica]
Length=345

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 68/229 (30%), Positives = 102/229 (45%), Gaps = 32/229 (14%)
 Frame = +3

Query  426   KRKVPLFLPVNHLLNTLEGPQIDDSMGDDHFQNSAISNDGSKQLVLSMSRARSRTAA--D  599
             KRKV  F  VN +LN L+      S   D   N   +N+   +LV S +   S+TAA   
Sbjct  137   KRKVQ-FPKVNSVLNMLKPSLTVSSEAGDG--NGHPANNNHLELVSSSTMKGSKTAAMSS  193

Query  600   GGGVMNMMVKFRYVMSFRWMVASMLK---IRRqqsqavtspspsstatHFSRQRAKSGGG  770
              G VM  ++KFR  +  R ++AS +K   +     +   + +       F +  A+    
Sbjct  194   NGIVMKFLIKFRN-LKIRTLLASFMKSCQVINSPQEPRNTGTHQKLMNPFDKWFAQ----  248

Query  771   LDSNQKMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIV---ASDDHRGGSRSH  941
                    S      + G     E  RS VL      K+D +RG+V   +S    G     
Sbjct  249   ---GSSSSNVYSNNLFG-----EGERSGVL----ETKMDTVRGVVETMSSSSSVGREDRK  296

Query  942   PKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFG  1088
              +SCP   KSSP+H +     ++      +C +DN++QAAIAHCK+S G
Sbjct  297   FRSCPSPAKSSPVHQEL----SSDDQNHKICPKDNSIQAAIAHCKRSLG  341



>ref|XP_006362330.1| PREDICTED: putative mediator of RNA polymerase II transcription 
subunit 26-like [Solanum tuberosum]
Length=378

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 5/62 (8%)
 Frame = +3

Query  924   GGSRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFGRSEDF  1103
             G   +  KSCP SIKSSP+H                 SRDN+VQAAIAHCKKSFG   +F
Sbjct  320   GNKHNSSKSCPSSIKSSPMHSNVSEEDVRKFY-----SRDNSVQAAIAHCKKSFGTQAEF  374

Query  1104  SF  1109
              F
Sbjct  375   DF  376



>ref|XP_006381276.1| hypothetical protein POPTR_0006s11310g [Populus trichocarpa]
 gb|ERP59073.1| hypothetical protein POPTR_0006s11310g [Populus trichocarpa]
Length=345

 Score = 58.5 bits (140),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 68/235 (29%), Positives = 108/235 (46%), Gaps = 44/235 (19%)
 Frame = +3

Query  426   KRKVPLFLPVNHLLNTLEGPQIDDSMGDDHFQNSAISNDGSKQLVLS--MSRARSRTAAD  599
             K+KV  F  VN  LN L+      S  DD   N   +N+   +LV S  M  +++   + 
Sbjct  137   KKKVQ-FPKVNSFLNMLKPSLTVSSEADDG--NGRPANNNHLELVSSSTMKGSKATAMSS  193

Query  600   GGGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFSRQRAKSGGGLDS  779
              G VM  ++KFR  +  R ++AS +K  +  +               S Q  ++ G   +
Sbjct  194   NGIVMKFLIKFR-TLKIRTLLASFMKSCQVIN---------------SPQEPRNTG---T  234

Query  780   NQK-MSRRQKKAIIGTNNGP--------EKSRSSVLLLRLGIKLDAIRGIV---ASDDHR  923
             +QK M+   K    G+++          +  RS VL +    K+D +R +V   +S    
Sbjct  235   HQKLMNPFDKWFAPGSSSSNVYSNNLFGDGERSGVLEM----KMDTVRAVVETMSSSSSI  290

Query  924   GGSRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSFG  1088
             G      +SCP   KSSP+H +             +C++DN++QAAIAHCK+SFG
Sbjct  291   GREDRKFRSCPSPTKSSPVHQELSSDD----QNHKICAKDNSIQAAIAHCKRSFG  341



>ref|XP_008244395.1| PREDICTED: uncharacterized protein LOC103342532 [Prunus mume]
Length=357

 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 56/180 (31%), Positives = 88/180 (49%), Gaps = 26/180 (14%)
 Frame = +3

Query  576   ARSRTAAD-----GGGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHF  740
             ARSR A +      GG+M ++ KFR  M+   +VAS++K R+       S   + +    
Sbjct  187   ARSRKATNMRSSINGGIMKLLFKFR-AMNLGALVASIVKPRQVACDPGRSKKKTKSKKSV  245

Query  741   SRQRAKSGGGLDSNQKMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIVASDDH  920
              +   K    L  N++  R+  +   G     E+  S VL + LG    A+RG++ +  +
Sbjct  246   LKPLDK---WLAQNKQGKRKDSEEGEG-----EEKHSRVLEINLG----AVRGVLEAIGN  293

Query  921   R-----GGSRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSF  1085
                   G      +SCP SIKSSP+H   +G  +   +   V +R+ ++QAAIAHCK SF
Sbjct  294   SMSTGIGRKDRRTRSCPSSIKSSPIH---KGFASDERNKVYVYTRETSIQAAIAHCKTSF  350



>ref|XP_007206569.1| hypothetical protein PRUPE_ppa020068mg, partial [Prunus persica]
 gb|EMJ07768.1| hypothetical protein PRUPE_ppa020068mg, partial [Prunus persica]
Length=167

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 51/166 (31%), Positives = 80/166 (48%), Gaps = 21/166 (13%)
 Frame = +3

Query  603   GGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFSRQRAKSGGGLDSN  782
             GG+M ++ KFR  M+   +VAS++K R+       S   + +     +        LD  
Sbjct  11    GGIMKLLFKFR-AMNLGALVASIVKPRQVACDPGRSKKKTKSKKSVLKP-------LDKW  62

Query  783   QKMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIVASDDHR-----GGSRSHPK  947
                 ++ K+       G EK  S VL + LG    A+RG++ +  +      G      +
Sbjct  63    LAQKKQGKRKDSEEGEGEEKY-SRVLEINLG----AVRGVLEAIGNSMSTGIGRKDRRTR  117

Query  948   SCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKKSF  1085
             SCP SIKSSP+H   +G  +   +   V +R+ ++QAAIAHCK SF
Sbjct  118   SCPSSIKSSPIH---KGFASDERNKVYVYARETSIQAAIAHCKTSF  160



>ref|XP_010113046.1| hypothetical protein L484_022772 [Morus notabilis]
 gb|EXC35217.1| hypothetical protein L484_022772 [Morus notabilis]
Length=413

 Score = 56.2 bits (134),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 47/83 (57%), Gaps = 7/83 (8%)
 Frame = +3

Query  867   RLGIKLDAIRGIVASDDHRGGSRSHPK--SCPGSIKSSPLHHQGQGGGATSLSGTLVCSR  1040
             R+ + L  +RG++ + +     RS  K  SCP SIK SP+H QG  G          C  
Sbjct  336   RVDVNLGEVRGVLEAVNMTRSGRSKRKTSSCPSSIKCSPIH-QGFAGDHIGQ----FCGG  390

Query  1041  DNNVQAAIAHCKKSFGRSEDFSF  1109
             ++++QAAIAHCK S G+S DF F
Sbjct  391   ESSIQAAIAHCKSSLGQSSDFRF  413



>ref|XP_008370302.1| PREDICTED: uncharacterized protein LOC103433789 isoform X1 [Malus 
domestica]
Length=358

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/183 (30%), Positives = 81/183 (44%), Gaps = 21/183 (11%)
 Frame = +3

Query  573   RARSRTAADGGGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFSRQR  752
             +A ++  +  GG+M ++ KFR  M+   +VAS  K R             +        +
Sbjct  179   KASNKRTSRKGGIMKLLFKFR-AMNLGALVASFAKPRLAACDDDDPHQSQNINRRRKNNK  237

Query  753   AKSGGGLDSNQKMSRRQKKAIIGTNN-----GPEKSRSSVLLLRLGIKLDAIRGIVA---  908
             +K  G       + ++Q K+    N+     G +KSR     + L I L A+RG +    
Sbjct  238   SKESGSSTLPWSVQKKQGKSSRTKNSSEAVGGGDKSR-----VLLEINLSAVRGFLEAIG  292

Query  909   ---SDDHRGGSRSHPKSCPGSIKSSPLHHQGQGGGATSLSGTLVC-SRDNNVQAAIAHCK  1076
                S    G      +SCP SIKSSP H   QG      S  +   +R+ ++QAAIAHCK
Sbjct  293   NSMSTGGTGRKERRTRSCPSSIKSSPXH---QGFTIDDHSNKVYFHTRETSIQAAIAHCK  349

Query  1077  KSF  1085
              SF
Sbjct  350   TSF  352



>gb|KDP21829.1| hypothetical protein JCGZ_00616 [Jatropha curcas]
Length=331

 Score = 54.7 bits (130),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 74/175 (42%), Gaps = 35/175 (20%)
 Frame = +3

Query  582   SRTAADGGGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFSRQRAKS  761
             + T      VM   +KFR  +  + ++AS L      SQ        +  T+ +R   KS
Sbjct  183   TTTKTSNSFVMKFFIKFR-TLKLKTLLASFL----TASQDKGKLCEENFLTYNTRTLTKS  237

Query  762   GGGLDSNQKMSRRQKKAIIGTNNGPEKSRSSVLLLRLGIKLDAIRGIVASDDHRGGS---  932
                  S + + +  KK+ +                 L +  DAIRG++        S   
Sbjct  238   SEKESSTENIKQGDKKSKL-----------------LELNFDAIRGVLLEAMSITTSLGR  280

Query  933   --RSHPKSCPGSIKSSPLHHQGQGGGATSLSGTL-VCSRDNNVQAAIAHCKKSFG  1088
               R   KSCP S KSSP+H        T L     V + DN+VQAAIAHCK+SFG
Sbjct  281   RDRRSTKSCPVSSKSSPIHQ-------TFLHDNFKVSTADNSVQAAIAHCKRSFG  328



>ref|XP_004305065.1| PREDICTED: uncharacterized protein LOC101292730 [Fragaria vesca 
subsp. vesca]
Length=390

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 87/182 (48%), Gaps = 39/182 (21%)
 Frame = +3

Query  603   GGVMNMMVKFRYVMSFRWMVASMLKIRRqqsqavtspspsstatHFS-----RQRAKSGG  767
             GG+M ++ KFR  M+   +VAS +K R+                HFS     ++++K+  
Sbjct  226   GGIMKLIFKFR-AMNLGTLVASFVKPRKVVCPPDQEYC------HFSYGVRKKKKSKAQS  278

Query  768   GLDSNQKMSR-------RQKKAIIGTNN----GPEKSRSSVLLLRLGIKLDAIRGI---V  905
              L   + + +       ++K+  + T+     G EKSR       L   L+A RG+   +
Sbjct  279   TLQHQKPLDKFFVQKEQQKKQVKMDTSREVGGGGEKSRV------LEKNLNAFRGVLEAI  332

Query  906   ASDDHRGGSRSH--PKSCPGSIKSSPLHHQGQGGGATSLSGTLVCSRDNNVQAAIAHCKK  1079
              S    G +R     +SCP SIKSSP+H +  GG  +      + +R+ ++QAAIAHCK 
Sbjct  333   GSSMSTGVNRKERRTRSCPSSIKSSPIHKEFAGGDQSK-----IFARETSIQAAIAHCKF  387

Query  1080  SF  1085
             S 
Sbjct  388   SL  389



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3276981741080