BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c722_g1_i1 len=3463 path=[3479:0-514 40:515-3462]

Length=3463
                                                                      Score     E

ref|XP_006343914.1|  PREDICTED: fidgetin-like protein 1-like           1266   0.0      
ref|XP_004245559.1|  PREDICTED: nuclear valosin-containing protei...   1262   0.0      
ref|XP_009598009.1|  PREDICTED: probable spastin homolog Bm1_53365     1209   0.0      
ref|XP_011073426.1|  PREDICTED: nuclear valosin-containing protei...   1209   0.0      
emb|CDP12095.1|  unnamed protein product                               1207   0.0      
ref|XP_010053194.1|  PREDICTED: uncharacterized protein LOC104441703   1203   0.0      
gb|KCW77459.1|  hypothetical protein EUGRSUZ_D01797                    1201   0.0      
ref|XP_010251598.1|  PREDICTED: uncharacterized protein LOC104593...   1200   0.0      
ref|XP_008239008.1|  PREDICTED: LOW QUALITY PROTEIN: peroxisomal ...   1190   0.0      
ref|XP_004298846.1|  PREDICTED: uncharacterized protein LOC101296861   1190   0.0      
ref|XP_007210368.1|  hypothetical protein PRUPE_ppa001321mg            1188   0.0      
ref|XP_006439446.1|  hypothetical protein CICLE_v10018858mg            1184   0.0      
ref|XP_011026962.1|  PREDICTED: cell division control protein 48 ...   1183   0.0      
ref|XP_002298002.2|  hypothetical protein POPTR_0001s10050g            1182   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007040379.1|  P-loop containing nucleoside triphosphate hy...   1179   0.0      
ref|XP_006476477.1|  PREDICTED: nuclear valosin-containing protei...   1179   0.0      
emb|CBI34411.3|  unnamed protein product                               1175   0.0      
ref|XP_007038876.1|  P-loop containing nucleoside triphosphate hy...   1174   0.0      
ref|XP_010261418.1|  PREDICTED: uncharacterized protein LOC104600...   1172   0.0      
ref|XP_002513623.1|  ATP binding protein, putative                     1169   0.0      Ricinus communis
ref|XP_010658526.1|  PREDICTED: calmodulin-interacting protein 11...   1169   0.0      
ref|XP_010261423.1|  PREDICTED: uncharacterized protein LOC104600...   1165   0.0      
ref|XP_009334490.1|  PREDICTED: uncharacterized protein LOC103927306   1158   0.0      
ref|XP_002509882.1|  ATP binding protein, putative                     1157   0.0      Ricinus communis
ref|XP_008377677.1|  PREDICTED: uncharacterized protein LOC103440725   1156   0.0      
gb|EYU40052.1|  hypothetical protein MIMGU_mgv1a025345mg               1156   0.0      
ref|XP_002886363.1|  AAA-type ATPase family protein                    1153   0.0      
gb|KHN16776.1|  Putative AAA domain-containing protein C24B10.10c      1151   0.0      
gb|KHG09264.1|  ATPase family AAA domain-containing protein 1-A        1151   0.0      
ref|XP_006584736.1|  PREDICTED: uncharacterized AAA domain-contai...   1150   0.0      
ref|XP_010676392.1|  PREDICTED: uncharacterized protein LOC104892...   1149   0.0      
ref|XP_006584738.1|  PREDICTED: uncharacterized AAA domain-contai...   1149   0.0      
ref|XP_006300734.1|  hypothetical protein CARUB_v10019795mg            1148   0.0      
ref|NP_001117544.1|  transcription factor DUO1                         1146   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EYU23405.1|  hypothetical protein MIMGU_mgv1a001595mg               1146   0.0      
ref|XP_010676390.1|  PREDICTED: uncharacterized protein LOC104892...   1145   0.0      
ref|XP_006300735.1|  hypothetical protein CARUB_v10019795mg            1145   0.0      
ref|NP_849842.1|  transcription factor DUO1                            1142   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_564824.1|  transcription factor DUO1                            1142   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008451995.1|  PREDICTED: uncharacterized protein LOC103493134   1141   0.0      
ref|XP_006580548.1|  PREDICTED: uncharacterized AAA domain-contai...   1141   0.0      
ref|XP_010418461.1|  PREDICTED: katanin p60 ATPase-containing sub...   1140   0.0      
ref|XP_010662653.1|  PREDICTED: nuclear valosin-containing protei...   1140   0.0      
ref|XP_003538688.1|  PREDICTED: uncharacterized protein LOC100783137   1140   0.0      
ref|XP_010915761.1|  PREDICTED: lon protease homolog, mitochondri...   1139   0.0      
ref|XP_006580549.1|  PREDICTED: uncharacterized AAA domain-contai...   1139   0.0      
ref|XP_010418463.1|  PREDICTED: katanin p60 ATPase-containing sub...   1139   0.0      
gb|KEH21161.1|  P-loop nucleoside triphosphate hydrolase superfam...   1139   0.0      
ref|XP_008805644.1|  PREDICTED: uncharacterized protein LOC103718546   1138   0.0      
ref|XP_010418460.1|  PREDICTED: katanin p60 ATPase-containing sub...   1137   0.0      
gb|KDP25362.1|  hypothetical protein JCGZ_20518                        1137   0.0      
gb|KHM99935.1|  Putative AAA domain-containing protein C24B10.10c      1137   0.0      
gb|KHF99854.1|  Spastin                                                1137   0.0      
ref|XP_010418458.1|  PREDICTED: katanin p60 ATPase-containing sub...   1137   0.0      
ref|XP_010915762.1|  PREDICTED: lon protease homolog, mitochondri...   1136   0.0      
ref|XP_010430529.1|  PREDICTED: katanin p60 ATPase-containing sub...   1136   0.0      
emb|CDY08360.1|  BnaC09g12360D                                         1135   0.0      
ref|XP_010251600.1|  PREDICTED: uncharacterized protein LOC104593...   1135   0.0      
ref|XP_008810933.1|  PREDICTED: uncharacterized protein LOC103722...   1134   0.0      
emb|CDY38192.1|  BnaA09g11970D                                         1134   0.0      
ref|XP_006584739.1|  PREDICTED: uncharacterized AAA domain-contai...   1134   0.0      
ref|XP_010917020.1|  PREDICTED: uncharacterized protein LOC105041...   1132   0.0      
ref|XP_011003670.1|  PREDICTED: peroxisome biosynthesis protein P...   1132   0.0      
ref|XP_009112803.1|  PREDICTED: peroxisome biosynthesis protein PAS1   1132   0.0      
ref|XP_010418462.1|  PREDICTED: katanin p60 ATPase-containing sub...   1131   0.0      
ref|XP_009409439.1|  PREDICTED: peroxisome biosynthesis protein P...   1130   0.0      
ref|XP_004503659.1|  PREDICTED: fidgetin-like protein 1-like           1130   0.0      
ref|XP_006391667.1|  hypothetical protein EUTSA_v10023275mg            1129   0.0      
ref|XP_008810932.1|  PREDICTED: uncharacterized protein LOC103722...   1128   0.0      
ref|XP_008792387.1|  PREDICTED: calmodulin-interacting protein 11...   1128   0.0      
ref|XP_010473660.1|  PREDICTED: uncharacterized protein LOC104753079   1126   0.0      
ref|XP_010533620.1|  PREDICTED: spastin isoform X3                     1125   0.0      
ref|XP_010533618.1|  PREDICTED: spastin isoform X1                     1125   0.0      
ref|XP_010035182.1|  PREDICTED: cell division control protein 48 ...   1124   0.0      
ref|XP_006422074.1|  hypothetical protein CICLE_v10004310mg            1124   0.0      
ref|XP_008792386.1|  PREDICTED: calmodulin-interacting protein 11...   1123   0.0      
ref|XP_004164363.1|  PREDICTED: uncharacterized protein LOC101225930   1122   0.0      
ref|XP_004146536.1|  PREDICTED: uncharacterized protein LOC101213686   1122   0.0      
ref|XP_010035181.1|  PREDICTED: cell division control protein 48 ...   1121   0.0      
ref|XP_006573795.1|  PREDICTED: uncharacterized protein LOC100808...   1121   0.0      
ref|XP_008234810.1|  PREDICTED: putative cell division cycle ATPase    1120   0.0      
emb|CAN73743.1|  hypothetical protein VITISV_026769                    1120   0.0      Vitis vinifera
ref|XP_010924775.1|  PREDICTED: peroxisome biosynthesis protein P...   1120   0.0      
ref|XP_010917036.1|  PREDICTED: uncharacterized protein LOC105041...   1119   0.0      
ref|XP_011022599.1|  PREDICTED: uncharacterized protein LOC105124323   1118   0.0      
ref|XP_006573796.1|  PREDICTED: uncharacterized protein LOC100808...   1118   0.0      
ref|XP_007160120.1|  hypothetical protein PHAVU_002G294200g            1118   0.0      
ref|XP_004511541.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...   1118   0.0      
ref|XP_011076079.1|  PREDICTED: nuclear valosin-containing protei...   1116   0.0      
ref|XP_004511542.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...   1115   0.0      
ref|XP_007160121.1|  hypothetical protein PHAVU_002G294200g            1113   0.0      
ref|XP_009368710.1|  PREDICTED: nuclear valosin-containing protei...   1109   0.0      
emb|CDP05122.1|  unnamed protein product                               1109   0.0      
ref|XP_008360307.1|  PREDICTED: uncharacterized protein LOC103424023   1108   0.0      
ref|XP_006366648.1|  PREDICTED: uncharacterized protein LOC102581738   1107   0.0      
ref|XP_011047745.1|  PREDICTED: nuclear valosin-containing protei...   1106   0.0      
ref|XP_008376661.1|  PREDICTED: uncharacterized protein LOC103439818   1106   0.0      
gb|KDP22199.1|  hypothetical protein JCGZ_26030                        1101   0.0      
ref|XP_010924776.1|  PREDICTED: peroxisome biosynthesis protein P...   1100   0.0      
gb|KHG24797.1|  Spastin                                                1100   0.0      
ref|XP_004234206.1|  PREDICTED: uncharacterized protein LOC101260609   1098   0.0      
ref|XP_004308033.1|  PREDICTED: uncharacterized protein LOC101302117   1097   0.0      
ref|XP_002318353.2|  hypothetical protein POPTR_0012s01000g            1096   0.0      Populus trichocarpa [western balsam poplar]
gb|KGN49910.1|  hypothetical protein Csa_5G139870                      1095   0.0      
ref|XP_008437548.1|  PREDICTED: uncharacterized protein LOC103482929   1092   0.0      
ref|XP_011084471.1|  PREDICTED: uncharacterized protein LOC105166715   1090   0.0      
ref|XP_002304524.2|  hypothetical protein POPTR_0003s13350g            1089   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003533964.1|  PREDICTED: uncharacterized protein LOC100804099   1085   0.0      
ref|XP_010105714.1|  hypothetical protein L484_014202                  1084   0.0      
ref|XP_009800877.1|  PREDICTED: uncharacterized protein LOC104246700   1082   0.0      
ref|XP_003548135.1|  PREDICTED: spastin-like                           1082   0.0      
ref|XP_008655793.1|  PREDICTED: uncharacterized protein LOC103634999   1080   0.0      
ref|XP_009375558.1|  PREDICTED: putative cell division cycle ATPase    1079   0.0      
ref|XP_004967436.1|  PREDICTED: uncharacterized protein LOC101780417   1079   0.0      
ref|XP_007220610.1|  hypothetical protein PRUPE_ppa001598mg            1078   0.0      
ref|XP_009626478.1|  PREDICTED: uncharacterized protein LOC104117172   1077   0.0      
gb|AES94005.2|  P-loop nucleoside triphosphate hydrolase superfam...   1076   0.0      
gb|KHN19953.1|  Spastin                                                1073   0.0      
ref|XP_002454901.1|  hypothetical protein SORBIDRAFT_03g001130         1073   0.0      Sorghum bicolor [broomcorn]
ref|XP_002865936.1|  ATP binding protein                               1073   0.0      
ref|XP_006374291.1|  AAA-type ATPase family protein                    1072   0.0      
ref|XP_010671575.1|  PREDICTED: uncharacterized protein LOC104888335   1071   0.0      
ref|XP_010442834.1|  PREDICTED: uncharacterized protein LOC104725802   1070   0.0      
gb|AAF24564.1|AC007764_6  F22C12.12                                    1069   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010917029.1|  PREDICTED: uncharacterized protein LOC105041...   1068   0.0      
gb|EPS71448.1|  hypothetical protein M569_03307                        1067   0.0      
ref|NP_194529.4|  P-loop containing nucleoside triphosphate hydro...   1066   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010537130.1|  PREDICTED: putative ribosome biogenesis ATPa...   1066   0.0      
ref|XP_010445330.1|  PREDICTED: putative cell division cycle ATPase    1066   0.0      
gb|KFK26889.1|  hypothetical protein AALP_AA8G306800                   1065   0.0      
dbj|BAH19655.1|  AT5G52882                                             1065   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001042464.1|  Os01g0226400                                      1064   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_007152107.1|  hypothetical protein PHAVU_004G102900g            1064   0.0      
ref|XP_008673493.1|  PREDICTED: uncharacterized protein LOC103649551   1064   0.0      
ref|XP_003611047.1|  Spastin                                           1063   0.0      
ref|XP_010658531.1|  PREDICTED: calmodulin-interacting protein 11...   1063   0.0      
gb|EEC70216.1|  hypothetical protein OsI_00975                         1061   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001078747.1|  P-loop containing nucleoside triphosphate hy...   1061   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413006.1|  hypothetical protein EUTSA_v10024407mg            1060   0.0      
ref|XP_009132511.1|  PREDICTED: uncharacterized protein LOC103857110   1060   0.0      
ref|XP_009416406.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...   1058   0.0      
ref|XP_010482665.1|  PREDICTED: lon protease homolog, mitochondri...   1058   0.0      
ref|XP_006282839.1|  hypothetical protein CARUB_v10006764mg            1057   0.0      
emb|CDY19639.1|  BnaC09g28950D                                         1056   0.0      
emb|CDY56163.1|  BnaA03g12490D                                         1055   0.0      
ref|XP_006401767.1|  hypothetical protein EUTSA_v10012687mg            1055   0.0      
ref|XP_010448049.1|  PREDICTED: uncharacterized protein LOC104730...   1054   0.0      
ref|XP_009796700.1|  PREDICTED: transitional endoplasmic reticulu...   1053   0.0      
ref|XP_010433277.1|  PREDICTED: uncharacterized protein LOC104717...   1053   0.0      
ref|XP_010438518.1|  PREDICTED: uncharacterized protein LOC104722110   1051   0.0      
ref|XP_009796701.1|  PREDICTED: transitional endoplasmic reticulu...   1051   0.0      
ref|XP_004515406.1|  PREDICTED: putative cell division cycle ATPa...   1051   0.0      
emb|CDY51824.1|  BnaC03g15360D                                         1050   0.0      
ref|XP_009137753.1|  PREDICTED: uncharacterized protein LOC103861800   1049   0.0      
emb|CDJ26560.1|  unnamed protein product                               1049   0.0      
ref|XP_003565841.1|  PREDICTED: uncharacterized protein LOC100831422   1049   0.0      
ref|XP_010448047.1|  PREDICTED: uncharacterized protein LOC104730...   1048   0.0      
ref|XP_011047746.1|  PREDICTED: nuclear valosin-containing protei...   1046   0.0      
dbj|BAH19462.1|  AT1G64110                                             1046   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KEH25715.1|  P-loop nucleoside triphosphate hydrolase superfam...   1044   0.0      
ref|XP_009119823.1|  PREDICTED: calmodulin-interacting protein 11...   1043   0.0      
ref|XP_009119822.1|  PREDICTED: calmodulin-interacting protein 11...   1041   0.0      
ref|XP_009119821.1|  PREDICTED: calmodulin-interacting protein 11...   1041   0.0      
ref|XP_009144116.1|  PREDICTED: uncharacterized protein LOC103867777   1040   0.0      
gb|AAL32670.1|  similar to homeobox protein                            1040   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EEE54150.1|  hypothetical protein OsJ_00955                         1039   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010555700.1|  PREDICTED: uncharacterized protein LOC104825121   1035   0.0      
gb|EYU25172.1|  hypothetical protein MIMGU_mgv1a001471mg               1031   0.0      
dbj|BAK00929.1|  predicted protein                                     1030   0.0      
dbj|BAJ91550.1|  predicted protein                                     1029   0.0      
ref|XP_004145904.1|  PREDICTED: uncharacterized protein LOC101216426   1023   0.0      
ref|XP_007040380.1|  P-loop containing nucleoside triphosphate hy...   1017   0.0      
ref|XP_006282408.1|  hypothetical protein CARUB_v100258811mg           1011   0.0      
gb|EMT19774.1|  Spastin                                                1008   0.0      
gb|EYU19606.1|  hypothetical protein MIMGU_mgv1a001750mg               1000   0.0      
ref|XP_008792388.1|  PREDICTED: protein SAP1-like isoform X3            998   0.0      
ref|XP_009409440.1|  PREDICTED: spastin isoform X2                      997   0.0      
ref|XP_004160357.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    997   0.0      
ref|XP_008655280.1|  PREDICTED: uncharacterized protein LOC100383...    992   0.0      
ref|XP_006842930.1|  hypothetical protein AMTR_s00075p00158590          989   0.0      
ref|NP_001056452.1|  Os05g0584600                                       989   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656078.1|  PREDICTED: peroxisome biosynthesis protein P...    988   0.0      
gb|EEE64846.1|  hypothetical protein OsJ_19703                          988   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|NP_001169612.1|  uncharacterized protein LOC100383493               985   0.0      Zea mays [maize]
gb|EAY99206.1|  hypothetical protein OsI_21164                          983   0.0      Oryza sativa Indica Group [Indian rice]
dbj|BAE98739.1|  hypothetical protein                                   977   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|EPS65718.1|  hypothetical protein M569_09059                         976   0.0      
emb|CBI22605.3|  unnamed protein product                                974   0.0      
ref|XP_002441590.1|  hypothetical protein SORBIDRAFT_09g029900          974   0.0      Sorghum bicolor [broomcorn]
ref|XP_010662650.1|  PREDICTED: cell division control protein 48-...    971   0.0      
ref|XP_010230989.1|  PREDICTED: spermatogenesis-associated protei...    969   0.0      
gb|EMS62853.1|  Spastin                                                 968   0.0      
ref|XP_004961073.1|  PREDICTED: putative cell division cycle ATPa...    966   0.0      
gb|EMT26638.1|  Spastin                                                 964   0.0      
dbj|BAK00787.1|  predicted protein                                      961   0.0      
ref|XP_006655636.1|  PREDICTED: putative cell division cycle ATPa...    953   0.0      
ref|XP_006606152.1|  PREDICTED: peroxisomal biogenesis factor 6-like    951   0.0      
gb|KHN12924.1|  Fidgetin-like protein 1                                 951   0.0      
ref|XP_010230990.1|  PREDICTED: spermatogenesis-associated protei...    947   0.0      
ref|XP_006645663.1|  PREDICTED: uncharacterized protein LOC102720661    945   0.0      
emb|CDY49165.1|  BnaA10g06290D                                          940   0.0      
gb|EMS51643.1|  Spastin                                                 937   0.0      
gb|KEH21162.1|  P-loop nucleoside triphosphate hydrolase superfam...    934   0.0      
ref|XP_010482667.1|  PREDICTED: suppressor protein of bem1/bed5 d...    934   0.0      
ref|XP_009416408.1|  PREDICTED: ribosome biogenesis ATPase RIX7-l...    931   0.0      
ref|XP_009119824.1|  PREDICTED: spastin isoform X4                      916   0.0      
emb|CAB36769.1|  putative protein                                       908   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842611.1|  hypothetical protein AMTR_s00077p00173880          905   0.0      
ref|XP_011047747.1|  PREDICTED: peroxisomal biogenesis factor 6-l...    899   0.0      
ref|XP_004971479.1|  PREDICTED: spastin-like                            899   0.0      
ref|XP_002968827.1|  hypothetical protein SELMODRAFT_440620             895   0.0      
ref|XP_002974147.1|  hypothetical protein SELMODRAFT_442341             890   0.0      
ref|XP_004496507.1|  PREDICTED: uncharacterized protein LOC101505986    881   0.0      
ref|XP_010112603.1|  Uncharacterized AAA domain-containing protein      862   0.0      
ref|XP_007158542.1|  hypothetical protein PHAVU_002G1610001g            861   0.0      
ref|XP_006589516.1|  PREDICTED: peroxisomal biogenesis factor 6-like    864   0.0      
gb|KHN21801.1|  Fidgetin-like protein 1                                 863   0.0      
ref|XP_004967434.1|  PREDICTED: spastin-like                            853   0.0      
ref|XP_008655281.1|  PREDICTED: uncharacterized protein LOC100383...    835   0.0      
ref|XP_004496827.1|  PREDICTED: uncharacterized protein LOC101497517    836   0.0      
ref|XP_002869527.1|  AAA-type ATPase family protein                     823   0.0      
gb|ADN33778.1|  ATP binding protein                                     818   0.0      
gb|AES62422.2|  P-loop nucleoside triphosphate hydrolase superfam...    799   0.0      
ref|XP_004496508.1|  PREDICTED: uncharacterized AAA domain-contai...    796   0.0      
ref|XP_003592171.1|  Katanin p60 ATPase-containing subunit A-like...    788   0.0      
ref|XP_003569389.1|  PREDICTED: peroxisome biosynthesis protein P...    785   0.0      
ref|NP_001043616.1|  Os01g0623500                                       751   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EAY75016.1|  hypothetical protein OsI_02914                          749   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_004969211.1|  PREDICTED: ribosome biogenesis ATPase RIX7-like    746   0.0      
gb|AES62421.2|  P-loop nucleoside triphosphate hydrolase superfam...    743   0.0      
ref|XP_003592170.1|  Spastin                                            741   0.0      
gb|KDO76368.1|  hypothetical protein CISIN_1g007208mg                   716   0.0      
gb|EMS67284.1|  Spastin                                                 733   0.0      
gb|EMT26441.1|  Spastin                                                 694   0.0      
emb|CDX89214.1|  BnaA01g16790D                                          664   0.0      
gb|KHN47439.1|  Spastin                                                 625   0.0      
gb|KEH43666.1|  P-loop nucleoside triphosphate hydrolase superfam...    630   0.0      
ref|XP_006644385.1|  PREDICTED: katanin p60 ATPase-containing sub...    630   0.0      
ref|XP_002458124.1|  hypothetical protein SORBIDRAFT_03g027270          622   0.0      Sorghum bicolor [broomcorn]
emb|CDY29873.1|  BnaA03g48940D                                          574   0.0      
gb|KHN28202.1|  ATPase family AAA domain-containing protein 1-A         562   0.0      
gb|KFK23539.1|  hypothetical protein AALP_AAs65553U000100               544   1e-180   
emb|CDX92857.1|  BnaC07g41150D                                          557   4e-180   
emb|CDY19014.1|  BnaC01g20540D                                          553   2e-178   
dbj|BAJ99051.1|  predicted protein                                      537   9e-178   
ref|XP_010662651.1|  PREDICTED: cell division control protein 48-...    534   9e-171   
ref|XP_007143490.1|  hypothetical protein PHAVU_007G076300g             533   3e-170   
ref|XP_006347396.1|  PREDICTED: uncharacterized protein LOC102604053    538   8e-170   
emb|CBI22604.3|  unnamed protein product                                532   6e-169   
emb|CDX96166.1|  BnaC02g14850D                                          520   4e-166   
gb|AAN46212.1|  unknown protein                                         505   1e-165   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46211.1|  unknown protein                                         503   6e-165   Arabidopsis thaliana [mouse-ear cress]
gb|AAN46221.1|  unknown protein                                         495   5e-162   Arabidopsis lyrata [lyrate rockcress]
tpg|DAA45314.1|  TPA: hypothetical protein ZEAMMB73_512266              510   5e-161   
dbj|BAJ93489.1|  predicted protein                                      518   2e-160   
dbj|BAK02823.1|  predicted protein                                      516   9e-160   
ref|XP_002465290.1|  hypothetical protein SORBIDRAFT_01g035620          516   1e-159   Sorghum bicolor [broomcorn]
gb|EPS61247.1|  hypothetical protein M569_13551                         484   1e-157   
ref|XP_008660163.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    510   2e-157   
ref|XP_008655542.1|  PREDICTED: uncharacterized protein LOC103634735    510   3e-157   
ref|XP_010269523.1|  PREDICTED: uncharacterized protein LOC104606...    509   2e-155   
ref|XP_009781905.1|  PREDICTED: uncharacterized protein LOC104230...    508   3e-155   
ref|XP_009781904.1|  PREDICTED: uncharacterized protein LOC104230...    508   3e-155   
ref|XP_009781903.1|  PREDICTED: uncharacterized protein LOC104230...    508   3e-155   
ref|XP_010269522.1|  PREDICTED: uncharacterized protein LOC104606...    508   5e-155   
ref|XP_006359391.1|  PREDICTED: uncharacterized protein LOC102597...    507   5e-155   
ref|XP_006359390.1|  PREDICTED: uncharacterized protein LOC102597...    508   6e-155   
ref|XP_009598053.1|  PREDICTED: uncharacterized protein LOC104093...    506   2e-154   
ref|XP_009598052.1|  PREDICTED: uncharacterized protein LOC104093...    505   3e-154   
ref|XP_009598050.1|  PREDICTED: uncharacterized protein LOC104093...    505   3e-154   
ref|XP_006600025.1|  PREDICTED: spastin-like                            478   3e-154   
ref|XP_009596694.1|  PREDICTED: uncharacterized AAA domain-contai...    488   3e-154   
gb|EMS51930.1|  Protein MSP1                                            498   6e-154   
ref|XP_006307719.1|  hypothetical protein CARUB_v100081071mg            479   1e-153   
ref|XP_010481336.1|  PREDICTED: spastin-like                            488   1e-152   
gb|EYU46684.1|  hypothetical protein MIMGU_mgv1a000404mg                498   4e-152   
ref|NP_171788.3|  AAA-type ATPase family protein                        499   6e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011079691.1|  PREDICTED: uncharacterized protein LOC105163...    496   5e-151   
ref|XP_011079690.1|  PREDICTED: uncharacterized protein LOC105163...    496   7e-151   
ref|XP_011079689.1|  PREDICTED: uncharacterized protein LOC105163...    496   8e-151   
ref|XP_011082476.1|  PREDICTED: uncharacterized protein LOC105165229    495   2e-150   
gb|EYU42216.1|  hypothetical protein MIMGU_mgv1a001073mg                485   3e-150   
ref|XP_004495974.1|  PREDICTED: uncharacterized protein LOC101498262    494   3e-150   
dbj|BAF02143.1|  hypothetical protein                                   491   1e-149   
emb|CDP03506.1|  unnamed protein product                                493   1e-149   
ref|XP_002967737.1|  hypothetical protein SELMODRAFT_88110              475   2e-149   
ref|XP_010259604.1|  PREDICTED: uncharacterized protein LOC104598...    492   2e-149   
emb|CDM83444.1|  unnamed protein product                                480   2e-149   
ref|XP_010237446.1|  PREDICTED: uncharacterized protein LOC100840...    490   7e-149   
ref|XP_010259603.1|  PREDICTED: uncharacterized protein LOC104598...    491   8e-149   
ref|XP_010248970.1|  PREDICTED: uncharacterized protein LOC104591...    486   1e-148   
ref|XP_004984416.1|  PREDICTED: uncharacterized protein LOC101773921    486   2e-148   
ref|XP_006663097.1|  PREDICTED: uncharacterized protein LOC102715...    484   3e-148   
ref|XP_010237445.1|  PREDICTED: uncharacterized protein LOC100840...    489   3e-148   
ref|XP_010684534.1|  PREDICTED: uncharacterized protein LOC104899...    489   5e-148   
ref|XP_010684533.1|  PREDICTED: uncharacterized protein LOC104899...    489   5e-148   
gb|EMT13670.1|  Protein MSP1                                            479   6e-148   
ref|XP_008805746.1|  PREDICTED: uncharacterized protein LOC103718...    486   8e-148   
ref|XP_008805744.1|  PREDICTED: uncharacterized protein LOC103718...    486   9e-148   
ref|XP_006663096.1|  PREDICTED: uncharacterized protein LOC102715...    484   1e-147   
emb|CDP15013.1|  unnamed protein product                                486   1e-147   
ref|XP_010474879.1|  PREDICTED: uncharacterized protein LOC104754393    488   1e-147   
ref|XP_010248969.1|  PREDICTED: uncharacterized protein LOC104591...    487   2e-147   
ref|XP_006418290.1|  hypothetical protein EUTSA_v10006579mg             488   2e-147   
ref|XP_006418289.1|  hypothetical protein EUTSA_v10006579mg             488   2e-147   
gb|KHG01617.1|  ATPase family AAA domain-containing protein 1           487   3e-147   
ref|XP_010248968.1|  PREDICTED: uncharacterized protein LOC104591...    487   4e-147   
ref|XP_009797825.1|  PREDICTED: uncharacterized protein LOC104244168    486   5e-147   
ref|XP_008374259.1|  PREDICTED: uncharacterized protein LOC103437...    484   8e-147   
ref|XP_008374258.1|  PREDICTED: uncharacterized protein LOC103437...    484   8e-147   
ref|XP_008805743.1|  PREDICTED: uncharacterized protein LOC103718...    485   1e-146   
ref|XP_009375231.1|  PREDICTED: uncharacterized protein LOC103964...    484   1e-146   
ref|XP_009375232.1|  PREDICTED: uncharacterized protein LOC103964...    484   1e-146   
ref|XP_008374257.1|  PREDICTED: uncharacterized protein LOC103437...    484   2e-146   
ref|XP_010457286.1|  PREDICTED: uncharacterized protein LOC104738...    484   2e-146   
ref|XP_009375223.1|  PREDICTED: uncharacterized protein LOC103964...    483   3e-146   
ref|XP_009375230.1|  PREDICTED: uncharacterized protein LOC103964...    484   3e-146   
ref|XP_009375222.1|  PREDICTED: uncharacterized protein LOC103964...    483   4e-146   
ref|XP_010556748.1|  PREDICTED: uncharacterized protein LOC104825975    482   1e-145   
ref|XP_008239453.1|  PREDICTED: uncharacterized protein LOC103338...    481   2e-145   
ref|XP_007210914.1|  hypothetical protein PRUPE_ppa000404mg             481   2e-145   
ref|XP_008239454.1|  PREDICTED: uncharacterized protein LOC103338...    481   2e-145   
ref|XP_008239452.1|  PREDICTED: uncharacterized protein LOC103338...    481   4e-145   
ref|XP_002964298.1|  hypothetical protein SELMODRAFT_166381             460   2e-144   
gb|AFW60181.1|  hypothetical protein ZEAMMB73_551737                    454   5e-144   
gb|EPS63205.1|  hypothetical protein M569_11581                         451   1e-143   
dbj|BAJ99696.1|  predicted protein                                      465   1e-143   
ref|XP_010522785.1|  PREDICTED: uncharacterized protein LOC104801...    473   2e-143   
ref|XP_008386768.1|  PREDICTED: cell division control protein 48 ...    457   2e-143   
gb|KHN03731.1|  Protein MSP1                                            476   3e-143   
gb|KFK42647.1|  hypothetical protein AALP_AA1G022100                    476   3e-143   
gb|ABA95244.2|  AAA-type ATPase family protein, putative, expressed     459   6e-143   
ref|XP_010931645.1|  PREDICTED: uncharacterized protein LOC105052512    474   2e-142   
gb|AFW60180.1|  hypothetical protein ZEAMMB73_551737                    461   7e-142   
ref|XP_010542858.1|  PREDICTED: uncharacterized protein LOC104815...    472   1e-141   
ref|XP_010542859.1|  PREDICTED: uncharacterized protein LOC104815...    472   1e-141   
ref|XP_010542857.1|  PREDICTED: uncharacterized protein LOC104815...    472   1e-141   
gb|KEH43749.1|  elongation factor 1-alpha                               459   2e-141   
gb|AES62596.2|  elongation factor 1-alpha                               461   2e-141   
ref|XP_008800830.1|  PREDICTED: uncharacterized protein LOC103715088    471   3e-141   
gb|EMS55797.1|  Protein MSP1                                            453   2e-140   
gb|EMT05944.1|  ATPase family AAA domain-containing protein 1-A         453   3e-140   
ref|XP_010662652.1|  PREDICTED: probable 26S protease regulatory ...    449   9e-140   
ref|XP_010677895.1|  PREDICTED: uncharacterized protein LOC104893491    466   1e-139   
gb|KFK29023.1|  hypothetical protein AALP_AA7G078600                    463   2e-139   
gb|KFK29024.1|  hypothetical protein AALP_AA7G078600                    463   4e-139   
ref|XP_008677898.1|  PREDICTED: uncharacterized protein LOC103652...    462   2e-138   
ref|XP_008677897.1|  PREDICTED: uncharacterized protein LOC103652...    462   4e-138   
ref|XP_003592345.1|  Elongation factor 1-alpha                          454   2e-137   
ref|XP_010097306.1|  ATPase family AAA domain-containing protein 1      463   3e-137   
ref|XP_009385219.1|  PREDICTED: uncharacterized AAA domain-contai...    439   4e-137   
ref|XP_009383916.1|  PREDICTED: uncharacterized protein LOC103971584    451   6e-135   
ref|XP_009411682.1|  PREDICTED: uncharacterized protein LOC103993374    450   2e-134   
dbj|BAK03805.1|  predicted protein                                      426   3e-134   
ref|XP_009382545.1|  PREDICTED: uncharacterized protein LOC103970...    447   6e-134   
ref|XP_009382544.1|  PREDICTED: uncharacterized protein LOC103970...    448   1e-133   
tpg|DAA42397.1|  TPA: hypothetical protein ZEAMMB73_568864              427   2e-131   
emb|CAN71853.1|  hypothetical protein VITISV_007346                     424   2e-130   
ref|NP_001117220.2|  AAA-type ATPase family protein                     441   2e-130   
ref|XP_001757401.1|  predicted protein                                  414   3e-130   
ref|XP_008239455.1|  PREDICTED: uncharacterized protein LOC103338...    439   4e-130   
gb|AAC19276.1|  T14P8.7                                                 413   7e-130   
gb|KDO87284.1|  hypothetical protein CISIN_1g000858mg                   426   1e-129   
gb|EMS56463.1|  Spastin                                                 435   3e-129   
gb|EMT09704.1|  Spastin                                                 436   3e-129   
ref|XP_006440093.1|  hypothetical protein CICLE_v100185462mg            412   7e-128   
ref|XP_001752278.1|  predicted protein                                  406   1e-127   
ref|XP_004964071.1|  PREDICTED: spastin-like                            417   1e-127   
ref|XP_010319075.1|  PREDICTED: uncharacterized protein LOC101246...    431   2e-127   
ref|XP_010914433.1|  PREDICTED: uncharacterized protein LOC105039...    431   2e-127   
ref|XP_010319074.1|  PREDICTED: uncharacterized protein LOC101246...    431   3e-127   
ref|XP_002451231.1|  hypothetical protein SORBIDRAFT_05g026170          431   4e-127   
ref|XP_010914432.1|  PREDICTED: uncharacterized protein LOC105039...    430   5e-127   
gb|KDO87282.1|  hypothetical protein CISIN_1g000858mg                   426   5e-127   
ref|XP_010914431.1|  PREDICTED: uncharacterized protein LOC105039...    430   6e-127   
gb|EEE52523.1|  hypothetical protein OsJ_34736                          431   8e-127   
gb|EEC68582.1|  hypothetical protein OsI_36923                          430   8e-127   
ref|XP_006351505.1|  PREDICTED: uncharacterized protein LOC102596115    430   8e-127   
ref|XP_008801074.1|  PREDICTED: uncharacterized protein LOC103715...    429   9e-127   
gb|KHG14286.1|  ATPase family AAA domain-containing protein 1           431   1e-126   
ref|XP_004979903.1|  PREDICTED: uncharacterized protein LOC101767...    431   1e-126   
gb|EEE67800.1|  hypothetical protein OsJ_25538                          419   2e-126   
ref|XP_009762413.1|  PREDICTED: uncharacterized protein LOC104214...    428   2e-126   
ref|XP_010326579.1|  PREDICTED: uncharacterized protein LOC101250...    431   2e-126   
ref|XP_004160567.1|  PREDICTED: peroxisomal biogenesis factor 6-like    419   2e-126   
ref|XP_004247431.1|  PREDICTED: uncharacterized protein LOC101250...    430   2e-126   
ref|XP_004979902.1|  PREDICTED: uncharacterized protein LOC101767...    430   2e-126   
ref|XP_010914430.1|  PREDICTED: uncharacterized protein LOC105039...    430   2e-126   
ref|XP_004979901.1|  PREDICTED: uncharacterized protein LOC101767...    430   3e-126   
ref|XP_009762412.1|  PREDICTED: uncharacterized protein LOC104214...    428   3e-126   
ref|XP_006444294.1|  hypothetical protein CICLE_v10018538mg             430   3e-126   
ref|XP_009762411.1|  PREDICTED: uncharacterized protein LOC104214...    428   4e-126   
gb|KEH43221.1|  P-loop nucleoside triphosphate hydrolase superfam...    428   4e-126   
ref|XP_010663739.1|  PREDICTED: uncharacterized protein LOC100266...    429   4e-126   
ref|XP_002279926.2|  PREDICTED: uncharacterized protein LOC100266...    429   5e-126   
gb|EYU43054.1|  hypothetical protein MIMGU_mgv1a022759mg                425   6e-126   
gb|KCW58477.1|  hypothetical protein EUGRSUZ_H01157                     425   6e-126   
gb|AES61807.2|  P-loop nucleoside triphosphate hydrolase superfam...    429   7e-126   
ref|XP_011033559.1|  PREDICTED: uncharacterized protein LOC105132009    428   7e-126   
ref|XP_004292654.1|  PREDICTED: uncharacterized protein LOC101311652    429   7e-126   
gb|KDO87281.1|  hypothetical protein CISIN_1g000858mg                   426   7e-126   
ref|XP_003591556.1|  Katanin p60 ATPase-containing subunit A-like...    429   8e-126   
ref|XP_010921817.1|  PREDICTED: uncharacterized protein LOC105045286    427   8e-126   
ref|XP_009589951.1|  PREDICTED: uncharacterized protein LOC104087...    426   8e-126   
ref|XP_006658955.1|  PREDICTED: uncharacterized protein LOC102705092    424   8e-126   
ref|XP_008670652.1|  PREDICTED: uncharacterized protein LOC103647...    424   9e-126   
gb|KDO87280.1|  hypothetical protein CISIN_1g000858mg                   426   1e-125   
ref|XP_006352810.1|  PREDICTED: uncharacterized protein LOC102580...    428   1e-125   
gb|KCW58476.1|  hypothetical protein EUGRSUZ_H01157                     425   1e-125   
ref|XP_009385220.1|  PREDICTED: katanin p60 ATPase-containing sub...    411   1e-125   
ref|XP_006352811.1|  PREDICTED: uncharacterized protein LOC102580...    428   1e-125   
ref|XP_008670651.1|  PREDICTED: uncharacterized protein LOC103647...    424   1e-125   
ref|XP_007201764.1|  hypothetical protein PRUPE_ppa000530mg             425   1e-125   
ref|XP_002321014.1|  AAA-type ATPase family protein                     427   2e-125   
tpg|DAA41723.1|  TPA: hypothetical protein ZEAMMB73_184747              423   3e-125   
ref|XP_009589950.1|  PREDICTED: uncharacterized protein LOC104087...    426   3e-125   
ref|XP_009589949.1|  PREDICTED: uncharacterized protein LOC104087...    426   3e-125   
gb|KDO87276.1|  hypothetical protein CISIN_1g000858mg                   426   3e-125   
ref|XP_006413376.1|  hypothetical protein EUTSA_v10024252mg             425   4e-125   
tpg|DAA41725.1|  TPA: hypothetical protein ZEAMMB73_184747              424   4e-125   
gb|KDO87279.1|  hypothetical protein CISIN_1g000858mg                   426   5e-125   
ref|XP_010069947.1|  PREDICTED: uncharacterized protein LOC104456...    426   5e-125   
tpg|DAA41724.1|  TPA: hypothetical protein ZEAMMB73_184747              423   5e-125   
ref|XP_011008045.1|  PREDICTED: uncharacterized protein LOC105113...    426   5e-125   
ref|XP_011008046.1|  PREDICTED: uncharacterized protein LOC105113...    426   5e-125   
emb|CDX89933.1|  BnaA10g01490D                                          424   6e-125   
gb|KDO87275.1|  hypothetical protein CISIN_1g000858mg                   426   6e-125   
ref|XP_006444295.1|  hypothetical protein CICLE_v10018538mg             426   6e-125   
gb|AAF02877.1|AC009525_11  Unknown protein                              426   6e-125   
gb|KDO87278.1|  hypothetical protein CISIN_1g000858mg                   426   7e-125   
ref|XP_002301474.2|  AAA-type ATPase family protein                     426   7e-125   
ref|XP_008235052.1|  PREDICTED: uncharacterized protein LOC103333915    426   7e-125   
ref|XP_010323025.1|  PREDICTED: uncharacterized protein LOC101246...    426   8e-125   
ref|XP_006588598.1|  PREDICTED: uncharacterized protein LOC100794...    426   8e-125   
ref|XP_004242314.1|  PREDICTED: uncharacterized protein LOC101246...    426   8e-125   
ref|XP_006479928.1|  PREDICTED: uncharacterized protein LOC102620169    426   8e-125   
gb|KDP28140.1|  hypothetical protein JCGZ_13911                         424   1e-124   
gb|KHN46575.1|  ATPase family AAA domain-containing protein 1           425   1e-124   
ref|XP_010069946.1|  PREDICTED: uncharacterized protein LOC104456...    425   1e-124   
ref|XP_006588599.1|  PREDICTED: uncharacterized protein LOC100794...    425   1e-124   
ref|XP_011073023.1|  PREDICTED: uncharacterized protein LOC105158089    424   1e-124   
ref|XP_006575111.1|  PREDICTED: uncharacterized protein LOC100801477    425   2e-124   
emb|CDY32485.1|  BnaA09g51110D                                          422   2e-124   
ref|XP_010525328.1|  PREDICTED: uncharacterized protein LOC104803...    424   2e-124   
ref|XP_010525327.1|  PREDICTED: uncharacterized protein LOC104803...    424   2e-124   
ref|XP_002892133.1|  AAA-type ATPase family protein                     424   3e-124   
ref|XP_006588597.1|  PREDICTED: uncharacterized protein LOC100794...    424   3e-124   
gb|EEC82665.1|  hypothetical protein OsI_27291                          421   4e-124   
ref|XP_008366580.1|  PREDICTED: uncharacterized protein LOC103430221    412   4e-124   
ref|XP_006588596.1|  PREDICTED: uncharacterized protein LOC100794...    424   4e-124   
gb|KHN03730.1|  ATPase family AAA domain-containing protein 1           424   4e-124   
ref|XP_003536887.1|  PREDICTED: uncharacterized protein LOC100794...    424   4e-124   
ref|XP_008341674.1|  PREDICTED: uncharacterized protein LOC103404521    412   4e-124   
ref|XP_009119600.1|  PREDICTED: uncharacterized protein LOC103844...    423   5e-124   
gb|KDO52639.1|  hypothetical protein CISIN_1g000823mg                   414   5e-124   
ref|XP_004495973.1|  PREDICTED: uncharacterized protein LOC101497938    424   5e-124   
ref|NP_001060602.1|  Os07g0672500                                       419   8e-124   
ref|XP_006575114.1|  PREDICTED: uncharacterized protein LOC100800...    420   8e-124   
gb|KGN44925.1|  hypothetical protein Csa_7G396400                       420   8e-124   
ref|XP_009119599.1|  PREDICTED: uncharacterized protein LOC103844...    423   9e-124   
ref|XP_006575113.1|  PREDICTED: uncharacterized protein LOC100800...    420   1e-123   
ref|XP_007050880.1|  ATP binding protein, putative isoform 2            421   1e-123   
emb|CDY18129.1|  BnaC05g01520D                                          422   1e-123   
ref|XP_006664619.1|  PREDICTED: fidgetin-like protein 1-like            406   1e-123   
ref|XP_008451596.1|  PREDICTED: uncharacterized protein LOC103492...    422   2e-123   
ref|XP_002461189.1|  hypothetical protein SORBIDRAFT_02g042560          418   2e-123   
ref|XP_009342115.1|  PREDICTED: uncharacterized protein LOC103934...    421   2e-123   
ref|XP_008368993.1|  PREDICTED: uncharacterized protein LOC103432...    421   2e-123   
ref|XP_003591554.1|  Katanin p60 ATPase-containing subunit              421   2e-123   
ref|XP_006581870.1|  PREDICTED: uncharacterized protein LOC100778...    422   2e-123   
ref|XP_003591552.1|  Katanin p60 ATPase-containing subunit              422   2e-123   
ref|XP_003591553.1|  Katanin p60 ATPase-containing subunit              421   2e-123   
ref|XP_009342114.1|  PREDICTED: uncharacterized protein LOC103934...    421   3e-123   
ref|XP_002523054.1|  ATP binding protein, putative                      420   3e-123   
ref|XP_006578701.1|  PREDICTED: uncharacterized protein LOC100780...    421   3e-123   
ref|XP_007050879.1|  AAA-type ATPase family protein isoform 1           421   4e-123   
ref|XP_008451595.1|  PREDICTED: uncharacterized protein LOC103492...    422   4e-123   
ref|XP_008368992.1|  PREDICTED: uncharacterized protein LOC103432...    421   4e-123   
ref|XP_009342112.1|  PREDICTED: uncharacterized protein LOC103934...    421   4e-123   
ref|XP_009342111.1|  PREDICTED: uncharacterized protein LOC103934...    421   5e-123   
ref|XP_004136037.1|  PREDICTED: uncharacterized protein LOC101211144    421   7e-123   
ref|XP_010234132.1|  PREDICTED: uncharacterized protein LOC100835916    417   8e-123   
ref|XP_006848423.1|  hypothetical protein AMTR_s00013p00232570          421   9e-123   
ref|XP_009414467.1|  PREDICTED: uncharacterized protein LOC103995...    420   9e-123   
ref|XP_009414468.1|  PREDICTED: uncharacterized protein LOC103995...    420   9e-123   
gb|AGT17199.1|  hypothetical protein SHCRBa_098_E22_R_100               416   1e-122   
ref|XP_006575112.1|  PREDICTED: uncharacterized protein LOC100800...    419   1e-122   
ref|XP_010652173.1|  PREDICTED: uncharacterized protein LOC100260666    420   2e-122   
ref|XP_004297530.1|  PREDICTED: uncharacterized protein LOC101298792    419   2e-122   
gb|KHN46576.1|  Spastin                                                 419   2e-122   
emb|CBI36835.3|  unnamed protein product                                420   2e-122   
ref|XP_010422582.1|  PREDICTED: uncharacterized protein LOC104707...    419   3e-122   
ref|XP_010422583.1|  PREDICTED: uncharacterized protein LOC104707...    418   4e-122   
emb|CDY50381.1|  BnaCnng19130D                                          417   5e-122   
ref|XP_010456024.1|  PREDICTED: uncharacterized protein LOC104737...    419   5e-122   
ref|XP_002872834.1|  AAA-type ATPase family protein                     418   5e-122   
ref|XP_010429758.1|  PREDICTED: uncharacterized protein LOC104714...    418   5e-122   
emb|CDY22053.1|  BnaA09g00820D                                          417   6e-122   
ref|XP_010429750.1|  PREDICTED: uncharacterized protein LOC104714...    418   6e-122   
ref|XP_008386656.1|  PREDICTED: uncharacterized protein LOC103449148    418   6e-122   



>ref|XP_006343914.1| PREDICTED: fidgetin-like protein 1-like [Solanum tuberosum]
Length=834

 Score =  1266 bits (3277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 660/842 (78%), Positives = 738/842 (88%), Gaps = 9/842 (1%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKW-TGSSSNAVTVDIMEQEMLNTIVDGRDS  2747
             M+QKN+ LSALGVG+GVGVG GLASGQTVS+W +GS++N +T  IMEQEMLN I +G+DS
Sbjct  1     MEQKNMLLSALGVGIGVGVGIGLASGQTVSRWASGSAANVITPLIMEQEMLNLIANGKDS  60

Query  2746  KVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLA  2567
             KVTFDEFPYYLSEQTRVLLTSA+FVHL +ADFAKHTRNLSPASRTILLSGPAELYQQMLA
Sbjct  61    KVTFDEFPYYLSEQTRVLLTSASFVHLTNADFAKHTRNLSPASRTILLSGPAELYQQMLA  120

Query  2566  KALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQP  2387
             KALAHYF AKLLLLDVTDFSLK+QSKYG +  E SFKRSISETT+ RMS   GSFS+LQ 
Sbjct  121   KALAHYFNAKLLLLDVTDFSLKMQSKYGGTCKEYSFKRSISETTVGRMSGMFGSFSMLQS  180

Query  2386  KEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTS  2207
             KEE KG+LRRQSSGVDI SK  +GS   T LRRN+SASAN+N+++SY ++ N  PLMR S
Sbjct  181   KEENKGSLRRQSSGVDIGSK--DGSFIATNLRRNASASANLNDISSYGSSGNLAPLMRNS  238

Query  2206  SLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLI  2027
             S +FDE+LLIQ LYK++VKVSKT P+VLYLRD EK+LCRSEK+Y+L QKML++LSG+VLI
Sbjct  239   SWAFDERLLIQTLYKIIVKVSKTSPMVLYLRDVEKILCRSEKIYVLFQKMLKKLSGAVLI  298

Query  2026  LGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNH  1847
             LGSRIVDPG+DYRE+DERLSSVFPYN+EIKPPEEETHLVSWKSQLEEDMKM+Q+QDN+NH
Sbjct  299   LGSRIVDPGNDYREIDERLSSVFPYNLEIKPPEEETHLVSWKSQLEEDMKMIQFQDNRNH  358

Query  1846  IMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSK  1667
             IMEVL+ANDIEC+DLGSICM+DTM LSNYIEE+VVSAISYHLMNTKDPEYRN KLVISS 
Sbjct  359   IMEVLSANDIECEDLGSICMSDTMVLSNYIEEIVVSAISYHLMNTKDPEYRNGKLVISSS  418

Query  1666  SLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETG  1487
             SLSHG+++F+E K+A  KD +KLE++AE SK+    E  +  PE K E     G  PE  
Sbjct  419   SLSHGLDVFQEGKSAQ-KDTIKLEAQAETSKDALGREISTTKPEAKTE-----GVLPENK  472

Query  1486  saapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKE  1307
               A APAP   D   +  A K PEVPPDNEFEKRIRPEVIPA EIGVTFADIGALDE+KE
Sbjct  473   GEAEAPAPPVMDGNITTPAPKTPEVPPDNEFEKRIRPEVIPANEIGVTFADIGALDELKE  532

Query  1306  SLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTI  1127
             SL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTI
Sbjct  533   SLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTI  592

Query  1126  TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWD  947
             TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWD
Sbjct  593   TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWD  652

Query  946   GLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKV  767
             GLLTK GE+ILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE+I+KTLLAKE V   
Sbjct  653   GLLTKAGEKILVLAATNRPFDLDEAIIRRFERRIMVGLPSVENREMIMKTLLAKERVDDG  712

Query  766   LDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTA  587
             +D K+L TMTEGY+GSDLKNLCTTAAYRPVRELI+QERLKD++KK  A+E    G AP+ 
Sbjct  713   MDFKELGTMTEGYSGSDLKNLCTTAAYRPVRELIQQERLKDLDKKCRAEEAKKAGVAPST  772

Query  586   NEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTY  407
             + DK ++VITIRPLNM DF EAK QVAASFAA G+IM+ELKQWN  YGEGGSRKKEQL+Y
Sbjct  773   DADKEDKVITIRPLNMADFKEAKKQVAASFAAGGAIMSELKQWNESYGEGGSRKKEQLSY  832

Query  406   FL  401
             FL
Sbjct  833   FL  834



>ref|XP_004245559.1| PREDICTED: nuclear valosin-containing protein-like [Solanum lycopersicum]
Length=836

 Score =  1262 bits (3265),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 639/816 (78%), Positives = 712/816 (87%), Gaps = 9/816 (1%)
 Frame = -1

Query  2845  QTVSKW-TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             QTVS+W +GS++N +T  IMEQEMLN I +G+DSKVTFDEFPYYLSEQTRVLLTSA+FVH
Sbjct  29    QTVSRWASGSAANVITPLIMEQEMLNLIANGKDSKVTFDEFPYYLSEQTRVLLTSASFVH  88

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             L +ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QSK
Sbjct  89    LTNADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFNAKLLLLDVTDFSLKMQSK  148

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YG +  E SFKRSISETTL RMS   GS S+LQ KEE KG+LRRQSSGVDI SK  +GS 
Sbjct  149   YGGTCKEYSFKRSISETTLGRMSGMFGSLSMLQSKEENKGSLRRQSSGVDIGSK--DGSF  206

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
               T LRRN+SASAN+N+++SY ++ N  PLMR SS +FDEKLLIQ LYK++V+VSKT P+
Sbjct  207   ITTNLRRNASASANLNDISSYGSSGNLAPLMRNSSWAFDEKLLIQTLYKIIVRVSKTSPM  266

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             VLYLRD EK  CRSEK+Y+L QKML++LSG+VLILGSRIVDPG+DYRE+DERLSSVFPYN
Sbjct  267   VLYLRDVEKFFCRSEKIYVLFQKMLKKLSGAVLILGSRIVDPGNDYREIDERLSSVFPYN  326

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             +EIKPPEEETHLVSWK+QLEEDMKM+Q+QDN+NHIMEVL+ANDIEC+DLGSICM+DTM L
Sbjct  327   LEIKPPEEETHLVSWKTQLEEDMKMIQFQDNRNHIMEVLSANDIECEDLGSICMSDTMVL  386

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE+VVSAISYHLM TKDPEYRN KLVISS SLSHG+++F+E K+A  KD +KLE++
Sbjct  387   SNYIEEIVVSAISYHLMCTKDPEYRNGKLVISSSSLSHGLDVFQEGKSAR-KDSIKLEAQ  445

Query  1588  AELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             AE SK+ Q  E     PE K E     G  PE    A APAP   D   +  A K PE P
Sbjct  446   AETSKDAQGREISITKPEVKTE-----GVLPENKGEAEAPAPPVIDGNITTPAPKTPEAP  500

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EIGVTFADIGALDE+KESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  501   PDNEFEKRIRPEVIPANEIGVTFADIGALDELKESLQELVMLPLRRPDLFKGGLLKPCRG  560

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  561   ILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  620

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLTK GE+ILVLAATNRPFDLDEAI
Sbjct  621   IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTKSGEKILVLAATNRPFDLDEAI  680

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+ E RE+I+KTLLAKE V   +D K+LATMTEGY+GSDLKNLCTTAA
Sbjct  681   IRRFERRIMVGLPSVENREMIMKTLLAKERVDDGMDFKELATMTEGYSGSDLKNLCTTAA  740

Query  688   YRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQV  509
             YRPVRELI+QERLKD++KKR A+E    G AP+ + DK ++VITIRPLNM DF EAKNQV
Sbjct  741   YRPVRELIQQERLKDLDKKRRAEEVKKGGVAPSTDVDKEDKVITIRPLNMADFKEAKNQV  800

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFAA G+IM+ELKQWN  YGEGGSRKKEQL+YFL
Sbjct  801   AASFAAGGAIMSELKQWNESYGEGGSRKKEQLSYFL  836



>ref|XP_009598009.1| PREDICTED: probable spastin homolog Bm1_53365, partial [Nicotiana 
tomentosiformis]
Length=776

 Score =  1209 bits (3128),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 625/773 (81%), Positives = 681/773 (88%), Gaps = 8/773 (1%)
 Frame = -1

Query  2719  YLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGA  2540
             Y SEQTRVLLTSA+FVHL +ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYF A
Sbjct  12    YGSEQTRVLLTSASFVHLTNADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFNA  71

Query  2539  KLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLR  2360
             KLLLLDVTDFSLK+QSKYG +  E SFKRSISETTL RMS   GSFS+LQPKEE KGTLR
Sbjct  72    KLLLLDVTDFSLKMQSKYGGACKEYSFKRSISETTLGRMSGMFGSFSMLQPKEENKGTLR  131

Query  2359  RQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLL  2180
             RQSSGVDI SK  +G    T LRRN+SASAN++NLTSY T+ NP PL R S  SFDEKLL
Sbjct  132   RQSSGVDIGSK--DGLLKATNLRRNASASANLDNLTSYGTSGNPAPLARNSIWSFDEKLL  189

Query  2179  IQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPG  2000
             IQ LYKVLVKVSK+ PIVLYLRD EK+LCRSEK+Y+L QKML++LSG++L+LGSRIVDPG
Sbjct  190   IQTLYKVLVKVSKSSPIVLYLRDVEKVLCRSEKIYVLFQKMLKKLSGAILLLGSRIVDPG  249

Query  1999  DDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAAND  1820
             +DYRE+DERLSS+FPYN+EIKPPE+ETHLVSWKSQLEEDMKM+Q+QDN+NHIMEVL+AND
Sbjct  250   NDYREIDERLSSIFPYNLEIKPPEDETHLVSWKSQLEEDMKMIQFQDNRNHIMEVLSAND  309

Query  1819  IECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIF  1640
             IEC+DLGSICM+DT+ LSNYIEE+VVSAISYHLMNTKDPEYRN KLVISS SLSHG+ IF
Sbjct  310   IECEDLGSICMSDTIVLSNYIEEIVVSAISYHLMNTKDPEYRNGKLVISSSSLSHGLGIF  369

Query  1639  KEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapt  1460
             +E K++ GKD LKLE++AE SK+ Q  E     PE KA      G  PE+   A APAP 
Sbjct  370   QEGKSS-GKDTLKLEAQAETSKDAQGRETSITKPEAKA-----AGILPESKGEAEAPAPP  423

Query  1459  tkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLP  1280
              KD   S +  K PEVPPDNEFEKRIRPEVIPA EIGVTFADIGALDE+KESL ELVMLP
Sbjct  424   VKDGNISTSTPKPPEVPPDNEFEKRIRPEVIPASEIGVTFADIGALDELKESLQELVMLP  483

Query  1279  LRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDE  1100
             LRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDE
Sbjct  484   LRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIASEAGASFINVSMSTITSKWFGEDE  543

Query  1099  KNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGER  920
             KNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLTK GER
Sbjct  544   KNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTKAGER  603

Query  919   ILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATM  740
             ILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE+ILKTLLAKE V   LD K+LATM
Sbjct  604   ILVLAATNRPFDLDEAIIRRFERRIMVGLPSVENREMILKTLLAKEKVDDGLDFKELATM  663

Query  739   TEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVI  560
             TEGY+GSDLKNLCTTAAYRPVRELI+QERLKD+EKKR A+E  + G AP A ED  ++VI
Sbjct  664   TEGYSGSDLKNLCTTAAYRPVRELIQQERLKDLEKKRRAEEAKSAGVAPPAGEDTEDKVI  723

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             TIRPLNM+DF EAKNQVAASFAA GSIM+ELKQWN LYGEGGSRKKEQL+YFL
Sbjct  724   TIRPLNMEDFKEAKNQVAASFAAGGSIMSELKQWNELYGEGGSRKKEQLSYFL  776



>ref|XP_011073426.1| PREDICTED: nuclear valosin-containing protein-like [Sesamum indicum]
Length=815

 Score =  1209 bits (3127),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/816 (75%), Positives = 693/816 (85%), Gaps = 28/816 (3%)
 Frame = -1

Query  2845  QTVSKWTGSS-SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             QTV KW G+S  + V+   MEQEML+ IV+GRD+  TFD+FPYYLSEQTRVLLTSAAFVH
Sbjct  27    QTVGKWAGASIPSGVSPQTMEQEMLSLIVNGRDTNATFDQFPYYLSEQTRVLLTSAAFVH  86

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK ADF+KHTRNLSPASRTILLSGP E+YQQMLAKALAHYF AKLLLLDVTDFSLK+QSK
Sbjct  87    LKKADFSKHTRNLSPASRTILLSGPTEMYQQMLAKALAHYFEAKLLLLDVTDFSLKIQSK  146

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YG  + E+ FKRSISETTL+RMS  LGSFS+LQPK+E KGTLRRQSSG+D+ S G EGS 
Sbjct  147   YGCPK-ETCFKRSISETTLSRMSGLLGSFSMLQPKDEIKGTLRRQSSGIDLISSGQEGS-  204

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             NP    R ++++AN+NNL S +T +   P+MRTSS  FD+KL IQ LYKVL KV+K  PI
Sbjct  205   NPA-KLRRNASAANINNLASMSTPATSAPVMRTSSWCFDDKLFIQTLYKVLDKVAKISPI  263

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             +LYLRD +KLLCRSE+VYI+ QKML+RLSGSVLILGSRIVDP +DYR +DE++SSVFPYN
Sbjct  264   ILYLRDVDKLLCRSERVYIMFQKMLKRLSGSVLILGSRIVDPENDYRLVDEKISSVFPYN  323

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEI+PP+++ HLVSWKSQLEEDMKM+QYQDN+NHI+EVLAAND++CDDLGSIC+ADT+ L
Sbjct  324   IEIRPPDDDKHLVSWKSQLEEDMKMIQYQDNRNHIIEVLAANDLDCDDLGSICLADTIVL  383

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE+VVSAISYHL NTK+P+YRN KLVISS SLSHG++IF+E K++ GKD LKLE++
Sbjct  384   SNYIEEIVVSAISYHLTNTKEPDYRNGKLVISSASLSHGLSIFQEGKSS-GKDTLKLEAR  442

Query  1588  AELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             AE+ K T  G+     PE K E+ T   SK E                   TA K  ++P
Sbjct  443   AEMPKGTLDGDAVRSRPEGKPET-TGSESKSEDS-----------------TASKTTDIP  484

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLF+GGLLKPCRG
Sbjct  485   PDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFEGGLLKPCRG  544

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA EAGASFINVSMST+TSKWFGEDEKNVRALFTLAAKV+PTI
Sbjct  545   ILLFGPPGTGKTMLAKAIANEAGASFINVSMSTVTSKWFGEDEKNVRALFTLAAKVAPTI  604

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL+KPGERILVLAATNRPFDLDEAI
Sbjct  605   IFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSKPGERILVLAATNRPFDLDEAI  664

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+ E RE IL+TL++KE V + LD  +LA +TEGY+GSDLKNLC TAA
Sbjct  665   IRRFERRIMVGLPSVENREKILRTLVSKEKVEE-LDFMELAALTEGYSGSDLKNLCITAA  723

Query  688   YRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQV  509
             YRPVRELI+QERLKD EKK  A+E    G     + DK ERVITIRPLNM+DF EAK QV
Sbjct  724   YRPVRELIQQERLKDQEKKHKAKE----GQESKDDSDKKERVITIRPLNMEDFKEAKKQV  779

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFAAEGSIM ELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  780   AASFAAEGSIMGELKQWNDLYGEGGSRKKEQLSYFL  815



>emb|CDP12095.1| unnamed protein product [Coffea canephora]
Length=828

 Score =  1207 bits (3122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 627/818 (77%), Positives = 694/818 (85%), Gaps = 17/818 (2%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKWTG  SS N +T  ++E+EM+  +VDG+DSKVTFD+FPYYLSEQTRVLLTSAAF 
Sbjct  25    QTVSKWTGGGSSCNGLTPQVIEKEMMYLLVDGKDSKVTFDQFPYYLSEQTRVLLTSAAFF  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF KH RNLSPASRTILLSGPAE YQQMLAKALAHYF AKLLLLDVTDFSLK+Q+
Sbjct  85    HLKKADFHKHARNLSPASRTILLSGPAETYQQMLAKALAHYFEAKLLLLDVTDFSLKIQN  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG +  E+SFKRSISE TL R+S+  GSFS+LQPKEE +GTLRRQSSGVDI SKG +GS
Sbjct  145   KYGCTSKETSFKRSISEATLGRVSDLFGSFSMLQPKEEYQGTLRRQSSGVDIESKGTQGS  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              N   LRRN+SASANM++LTS  T+  P PL RTS  SFD+KLLIQ LYKVL KVSK+ P
Sbjct  205   LNVPKLRRNASASANMSSLTSNTTSVIPAPLKRTSGWSFDDKLLIQTLYKVLAKVSKSHP  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LYLRD E LLCRSE+VY+L QKML+RLSGSVLI+GSRIVD   DYRELDERLSSVFPY
Sbjct  265   IILYLRDVEMLLCRSERVYVLFQKMLKRLSGSVLIIGSRIVDASSDYRELDERLSSVFPY  324

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIK PE+ETHLV+W SQLEEDMKM+QYQD KNHI+EVLAANDI CDDLGS+ MADTM 
Sbjct  325   NIEIKAPEDETHLVNWNSQLEEDMKMIQYQDTKNHIVEVLAANDIMCDDLGSLRMADTMV  384

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNY+EE+VVSAISYHLM+TKDPEYRN KLVISS SLSHG +IF+E K+A GKD LKLE+
Sbjct  385   LSNYVEEIVVSAISYHLMHTKDPEYRNGKLVISSSSLSHGSSIFQEGKSA-GKDTLKLEA  443

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +AE+ K          G    A +   PGS+ +T     A   T KD  +S +A KAPEV
Sbjct  444   QAEMPK---------NGGGVNAIAEANPGSQTDT----EATVTTAKDGDASDSASKAPEV  490

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EI VTF DIGAL+EIK SL ELVMLPLRRPDLFKGG+LKPCR
Sbjct  491   PPDNEFEKRIRPEVIPASEINVTFEDIGALEEIKRSLQELVMLPLRRPDLFKGGILKPCR  550

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA+EAGASFIN SMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  551   GILLFGPPGTGKTMLAKAIAREAGASFINASMSTITSKWFGEDEKNVRALFTLAAKVSPT  610

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGL+TK GERILVLAATNRPFDLDEA
Sbjct  611   IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLMTKSGERILVLAATNRPFDLDEA  670

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ + RE+ILKTLL+KE V + LD K+LA MTEGY+GSD+KN CTTA
Sbjct  671   IIRRFERRIMVGLPSVDNREMILKTLLSKECVDESLDFKELAAMTEGYSGSDIKNFCTTA  730

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQ  512
             AYRPVRELI QE LKD+EKK   ++  NC  A +  EDK ERVITIRPLNM+DF EAKNQ
Sbjct  731   AYRPVRELIHQECLKDLEKKLGGEQRVNCEGATSTEEDKEERVITIRPLNMEDFKEAKNQ  790

Query  511   VAASFAAEGSIMNELKQWNNLYGEGGSRK-KEQLTYFL  401
             VAASFAAEG IM EL+QWN LYGEGGSRK  EQL+YFL
Sbjct  791   VAASFAAEGPIMTELRQWNELYGEGGSRKTTEQLSYFL  828



>ref|XP_010053194.1| PREDICTED: uncharacterized protein LOC104441703 [Eucalyptus grandis]
Length=843

 Score =  1203 bits (3112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/823 (74%), Positives = 696/823 (85%), Gaps = 12/823 (1%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKW G  SSS+++T + +E+EML  +VDGR+SKVTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  25    QTVSKWAGNASSSDSITAERVEKEMLRLVVDGRESKVTFDQFPYYLSEQTRVLLTSAAYV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  85    HLKHAEVSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG+   E SFKRS SE+TL R+S  LGSFSIL  KEE KG L RQ+SGVDI S+G EG 
Sbjct  145   KYGTGNKEYSFKRSPSESTLERLSGLLGSFSILPQKEEAKGNLWRQNSGVDIGSRGTEGP  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  LRRN+SASA + NL + +  SNP PL RTSSLSFDEKLLIQ+LYKVL  VSK  P
Sbjct  205   CNPPKLRRNASASATITNLATQSAPSNPAPLKRTSSLSFDEKLLIQSLYKVLAFVSKASP  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD EKLLCRS+++Y   QKML++LSGSVLILGSRI+DP  DY E+D+RL+++FPY
Sbjct  265   IVLYLRDVEKLLCRSQRIYNFFQKMLKKLSGSVLILGSRILDPDYDYSEVDDRLAALFPY  324

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E HLVSWKSQLE+DMKM+Q QDN+ HIMEVL+AND++CDDL SIC+ADTM 
Sbjct  325   NIEIRPPEDENHLVSWKSQLEDDMKMIQVQDNRIHIMEVLSANDLDCDDLESICVADTMV  384

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+V+SAISYHLMN KDP+YRN KL+IS +SLSHG+++F+E K++ GKD+LKLE+
Sbjct  385   LSNYIEEIVMSAISYHLMNNKDPDYRNGKLLISLESLSHGLSVFQEGKSS-GKDMLKLET  443

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSG-----TAV  1427
              AE SKE ++    +  PETKA+    P  + ++G+        +   + +G     T  
Sbjct  444   HAEKSKEAKAEGDATAKPETKAK---VPTPEKQSGTETKDGTKGSATVSKTGGDGAVTLS  500

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             K PEVPPDNEFEKRIRPEVIPA EIGVTF DIGALDE KESL ELVMLPLRRPDLF GGL
Sbjct  501   KHPEVPPDNEFEKRIRPEVIPANEIGVTFGDIGALDETKESLQELVMLPLRRPDLFHGGL  560

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPC+GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA
Sbjct  561   LKPCKGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  620

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPF
Sbjct  621   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPF  680

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVGLPT E RE+IL+TL+AKE V + LDLK++ATMTEGY+GSDLKN
Sbjct  681   DLDEAIIRRFERRIMVGLPTLENREMILRTLVAKERVEEGLDLKEIATMTEGYSGSDLKN  740

Query  706   LCTTAAYRPVRELIKQERLKDVEKK-RLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             LCTTAAYRPVRELI+QER K+ EK+ R A      G+  T    K ER +T+RPLNM+DF
Sbjct  741   LCTTAAYRPVRELIQQEREKEPEKQERAAGATGEEGNLDTKGASKEERTVTLRPLNMEDF  800

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AKNQVAASFAAEGSIM+ELKQWN LYG+GGSRKK+QLTYFL
Sbjct  801   RQAKNQVAASFAAEGSIMSELKQWNELYGDGGSRKKQQLTYFL  843



>gb|KCW77459.1| hypothetical protein EUGRSUZ_D01797 [Eucalyptus grandis]
Length=844

 Score =  1201 bits (3107),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/824 (74%), Positives = 696/824 (84%), Gaps = 13/824 (2%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKW G  SSS+++T + +E+EML  +VDGR+SKVTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  25    QTVSKWAGNASSSDSITAERVEKEMLRLVVDGRESKVTFDQFPYYLSEQTRVLLTSAAYV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  85    HLKHAEVSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG+   E SFKRS SE+TL R+S  LGSFSIL  KEE KG L RQ+SGVDI S+G EG 
Sbjct  145   KYGTGNKEYSFKRSPSESTLERLSGLLGSFSILPQKEEAKGNLWRQNSGVDIGSRGTEGP  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  LRRN+SASA + NL + +  SNP PL RTSSLSFDEKLLIQ+LYKVL  VSK  P
Sbjct  205   CNPPKLRRNASASATITNLATQSAPSNPAPLKRTSSLSFDEKLLIQSLYKVLAFVSKASP  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD EKLLCRS+++Y   QKML++LSGSVLILGSRI+DP  DY E+D+RL+++FPY
Sbjct  265   IVLYLRDVEKLLCRSQRIYNFFQKMLKKLSGSVLILGSRILDPDYDYSEVDDRLAALFPY  324

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E HLVSWKSQLE+DMKM+Q QDN+ HIMEVL+AND++CDDL SIC+ADTM 
Sbjct  325   NIEIRPPEDENHLVSWKSQLEDDMKMIQVQDNRIHIMEVLSANDLDCDDLESICVADTMV  384

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+V+SAISYHLMN KDP+YRN KL+IS +SLSHG+++F+E K++ GKD+LKLE+
Sbjct  385   LSNYIEEIVMSAISYHLMNNKDPDYRNGKLLISLESLSHGLSVFQEGKSS-GKDMLKLET  443

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSG-----TAV  1427
              AE SKE ++    +  PETKA+    P  + ++G+        +   + +G     T  
Sbjct  444   HAEKSKEAKAEGDATAKPETKAK---VPTPEKQSGTETKDGTKGSATVSKTGGDGAVTLS  500

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             K PEVPPDNEFEKRIRPEVIPA EIGVTF DIGALDE KESL ELVMLPLRRPDLF GGL
Sbjct  501   KHPEVPPDNEFEKRIRPEVIPANEIGVTFGDIGALDETKESLQELVMLPLRRPDLFHGGL  560

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPC+GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA
Sbjct  561   LKPCKGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  620

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPF
Sbjct  621   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPF  680

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVGLPT E RE+IL+TL+AKE V + LDLK++ATMTEGY+GSDLKN
Sbjct  681   DLDEAIIRRFERRIMVGLPTLENREMILRTLVAKERVEEGLDLKEIATMTEGYSGSDLKN  740

Query  706   LCTTAAYRPVRELIKQERLKDVEKK--RLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             LCTTAAYRPVRELI+QER K+ ++K  R A      G+  T    K ER +T+RPLNM+D
Sbjct  741   LCTTAAYRPVRELIQQEREKEPQEKQERAAGATGEEGNLDTKGASKEERTVTLRPLNMED  800

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             F +AKNQVAASFAAEGSIM+ELKQWN LYG+GGSRKK+QLTYFL
Sbjct  801   FRQAKNQVAASFAAEGSIMSELKQWNELYGDGGSRKKQQLTYFL  844



>ref|XP_010251598.1| PREDICTED: uncharacterized protein LOC104593453 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010251599.1| PREDICTED: uncharacterized protein LOC104593453 isoform X1 [Nelumbo 
nucifera]
Length=837

 Score =  1200 bits (3104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/816 (73%), Positives = 689/816 (84%), Gaps = 6/816 (1%)
 Frame = -1

Query  2845  QTVSKWTG-SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             QT+SKWT  SSSNA+T D +EQE++  +VDG++S VTFDEFPYYLSEQTRVLLTSAA++H
Sbjct  27    QTISKWTNLSSSNAITGDKIEQELMRQVVDGKESNVTFDEFPYYLSEQTRVLLTSAAYMH  86

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK A+F K+TRNLSPASRTILLSGPAE+YQQMLAKALAHYF AKLLLLDVTDFSLK+QSK
Sbjct  87    LKEANFCKYTRNLSPASRTILLSGPAEMYQQMLAKALAHYFEAKLLLLDVTDFSLKIQSK  146

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YG+   +SS KRSISET L RMS   GSFSIL  +E+ KG L RQSS +DI S+G EGS+
Sbjct  147   YGTGNKQSSLKRSISETALERMSSLFGSFSILPQREDTKGKLWRQSSALDIRSRGTEGSN  206

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             N +    N+S +A+++   S  T+ N   L RTSS +FD+KLL+++LYKVLV VSKT   
Sbjct  207   NTSKHHGNASVAADISRPASQCTSVNSASLKRTSSWAFDDKLLLRSLYKVLVSVSKTSAT  266

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             VLYLRD EKLL RS+ +Y L QKM ++LSG VLILGSRI+DPG+DY E+DERL+ +FPYN
Sbjct  267   VLYLRDVEKLLFRSQGIYTLFQKMFKQLSGPVLILGSRILDPGNDYGEVDERLTLLFPYN  326

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             I IKPPE+E+HLVSWK+QLEEDMKM+QYQDN+NHI EVLAAND+ECDDLGSIC+ADTM L
Sbjct  327   IVIKPPEDESHLVSWKTQLEEDMKMIQYQDNRNHITEVLAANDLECDDLGSICLADTMVL  386

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE++VSAISYHLMN KDPEYRN KLVISSKSLSHG++IF++ ++  GKD LKLE+ 
Sbjct  387   SNYIEEIIVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLSIFQDGESN-GKDTLKLEAN  445

Query  1588  AELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             AE  K+ +  E     PE+K E+  A  +K E   +AP      +++       KA EVP
Sbjct  446   AEPDKDPEGDEISGLKPESKVETLAAE-NKSEADKSAPVVKKDGENS---SAPAKASEVP  501

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA +IGVTF+DIGALDE+KESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  502   PDNEFEKRIRPEVIPASDIGVTFSDIGALDEVKESLQELVMLPLRRPDLFKGGLLKPCRG  561

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  562   ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  621

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEAI
Sbjct  622   IFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEAI  681

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+ E RE+IL+TLLAKE V + LD K+LA MTEGY+GSDLKNLCTTAA
Sbjct  682   IRRFERRIMVGLPSAENREMILRTLLAKEKVEEGLDFKELANMTEGYSGSDLKNLCTTAA  741

Query  688   YRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQV  509
             YRPVRELI+QE+LKD+E+K  A+   +   + T  E K ERVIT+RPLNM+D  +AKNQV
Sbjct  742   YRPVRELIQQEKLKDLERKHKAEGQNSEEASDTKEEGKEERVITLRPLNMEDMRQAKNQV  801

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFAAEGSIM ELKQWN LYGEGGSRKK+QL+YFL
Sbjct  802   AASFAAEGSIMGELKQWNELYGEGGSRKKQQLSYFL  837



>ref|XP_008239008.1| PREDICTED: LOW QUALITY PROTEIN: peroxisomal biogenesis factor 
6 [Prunus mume]
Length=839

 Score =  1190 bits (3079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 609/822 (74%), Positives = 694/822 (84%), Gaps = 16/822 (2%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKW G+   SNA+T D +EQE+L  IVDGRDSKVTFD+FPYYLSEQTRVL+TSAA+V
Sbjct  27    QTMSKWAGNDTLSNALTPDTVEQELLRQIVDGRDSKVTFDQFPYYLSEQTRVLITSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQ LAKALAHYF AKLLLLDVT+FSLK+QS
Sbjct  87    HLKCAEVSKYTRNLSPASRAILLSGPAELYQQQLAKALAHYFQAKLLLLDVTNFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGSS   SSFKRS SE TL R+S   GSFSI   +EE  GTLRRQSSGVDI S  +EGS
Sbjct  147   KYGSSNKASSFKRSTSEVTLERLSGLFGSFSIFPQREEPTGTLRRQSSGVDIRSSMVEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SNP+ LRRN+SASAN++NL S +T SN  PL RTSS SFDEKLLIQ+LY+VLV VS TCP
Sbjct  207   SNPSKLRRNASASANISNLASQSTPSNSAPLRRTSSWSFDEKLLIQSLYRVLVFVSNTCP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD +KLL RS+++Y L QKML++LSG+VLILGSRIVDPG+D RE+DERL+++FPY
Sbjct  267   IVLYLRDVDKLLSRSQRIYNLFQKMLKKLSGAVLILGSRIVDPGEDNREVDERLTALFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE E+HLVSWK+QLEEDMKM+Q QDNKNHIMEVL++ND++CDDLGSIC+ADT+ 
Sbjct  327   NIEIRPPENESHLVSWKTQLEEDMKMIQVQDNKNHIMEVLSSNDLDCDDLGSICIADTID  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISSKSLSHG+NIF+E K + GKD LKLE+
Sbjct  387   LSNYIEEIVVSAVSYHLMNNKDPEYRNGKLVISSKSLSHGLNIFQEGKYS-GKDTLKLEA  445

Query  1591  KAELSKETQSGEKGSKGP--ETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             KAE  KE  +G +G+ G   ETK ES+      PE  S         K    +   +   
Sbjct  446   KAETLKE--AGIEGAVGVNLETKTESAA-----PENKSGTETSTSAAKTDADNPIPISRA  498

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
              V  DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLF GGLLKP
Sbjct  499   SVKLDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFNGGLLKP  558

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPG+GKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  559   CRGILLFGPPGSGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  618

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+  G+RILVLAATNRPFDLD
Sbjct  619   PTIIFVDEVDSMLGQRTRFGEHEAMRKIKNEFMTHWDGLLSNQGDRILVLAATNRPFDLD  678

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRI+VGLPT E RE+IL+TLL+KE V   LD K+LATMTEG++GSDLKNLCT
Sbjct  679   EAIIRRFERRILVGLPTVENREMILRTLLSKEKVEARLDFKELATMTEGFSGSDLKNLCT  738

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED---KGERVITIRPLNMDDFM  527
             TAAYRPVRELI+ ER KD+EKK+ A+   N   AP+ N+    KG RV  +  LNM+DF 
Sbjct  739   TAAYRPVRELIQAEREKDLEKKQRAEGGQNPQGAPSINQAELWKG-RVQKLSHLNMEDFK  797

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +AK+QVAASFA+EG++MNELKQWN+ YGEGGSRK+EQLTYFL
Sbjct  798   QAKSQVAASFASEGAMMNELKQWNDQYGEGGSRKREQLTYFL  839



>ref|XP_004298846.1| PREDICTED: uncharacterized protein LOC101296861 [Fragaria vesca 
subsp. vesca]
Length=861

 Score =  1190 bits (3079),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 611/839 (73%), Positives = 704/839 (84%), Gaps = 28/839 (3%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKW G    +N +T D +EQEML  IVDGRDSKVTFD+FPYYL+EQTRVLLTSAA+V
Sbjct  27    QTMSKWAGYEGLANGITPDRVEQEMLRQIVDGRDSKVTFDQFPYYLNEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAE YQQ+LAKAL+HYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKRAEVSKYTRNLSPASRAILLSGPAENYQQLLAKALSHYFQAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG+    S+FKRS SE TL+R+S   GSFSI   KEE KGTLRRQSSGVD+ S+G+EGS
Sbjct  147   KYGTGNKASAFKRSTSEMTLDRLSGLFGSFSIFPQKEEPKGTLRRQSSGVDLGSRGLEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              N   LRRN+SA+AN++NL S  + SNP PL RTSS SFDE+L +Q+LYKVLV VSKT P
Sbjct  207   KNAPKLRRNASAAANISNLASQGSPSNPAPLKRTSSWSFDERLFLQSLYKVLVYVSKTTP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD + L  RS+++Y L QKML +LSG+VLILGSRIVD  +DYR++DERL+++FPY
Sbjct  267   IVLYLRDVDNLFSRSQRIYNLFQKMLDKLSGAVLILGSRIVDLDNDYRDVDERLTALFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PP+ E+HLVSWK+QLEEDMKM+Q QDNKNHIMEVL+AND++CDDLGSIC+ADTM 
Sbjct  327   NIEIRPPDNESHLVSWKTQLEEDMKMIQVQDNKNHIMEVLSANDLDCDDLGSICIADTMD  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LS+YIEE+VVSA+SYHLMN +DPEYRN KLVISSKSLSHG++IF+E K   GKD +KLE+
Sbjct  387   LSHYIEEIVVSAVSYHLMNNRDPEYRNGKLVISSKSLSHGLSIFQEGKFG-GKDTIKLEA  445

Query  1591  KAELSKETQSGEKGSKGP--ETKAESS----------TAPGSKPETGsaapapapttkda  1448
             +AE SKE  +G++G+ G   ETKA+SS           A   K E  +    PAP   D+
Sbjct  446   QAEFSKE--AGKEGTTGVNLETKADSSAPEDKSGAEIVASVVKSEPVTTKTEPAPVKTDS  503

Query  1447  tsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRP  1268
              +   A KAPEVP DNEFEKRIRPEVIPA EIGVTF+DIGA++EIKESL ELVMLPLRRP
Sbjct  504   DNPVPAFKAPEVP-DNEFEKRIRPEVIPANEIGVTFSDIGAMEEIKESLQELVMLPLRRP  562

Query  1267  DLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
             DLF GGLLKPCRGILLFGPPG+GKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVR
Sbjct  563   DLFNGGLLKPCRGILLFGPPGSGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVR  622

Query  1087  ALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVL  908
             ALFTLA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TK GERILVL
Sbjct  623   ALFTLASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKQGERILVL  682

Query  907   AATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGY  728
             AATNRPFDLDEAIIRRFERRI+VGLPTPE RE+I++TLLAKE V + LD K+LATMTEGY
Sbjct  683   AATNRPFDLDEAIIRRFERRILVGLPTPENREMIMRTLLAKEKVDERLDFKELATMTEGY  742

Query  727   TGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDA-----PTANEDKGE--  569
             +GSDLKNLCTTAAYRPVRELI+ ER KD+EKK+ A E  N  DA     P A  D  E  
Sbjct  743   SGSDLKNLCTTAAYRPVRELIQAEREKDLEKKKRAAEKQNQQDASEDPNPEAVSDTKEEP  802

Query  568   ---RVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
                RVI +RPLNM+D  +AKNQVAASFAAEG++MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  803   KEGRVIILRPLNMEDLRQAKNQVAASFAAEGAMMNELKQWNDLYGEGGSRKKEQLSYFL  861



>ref|XP_007210368.1| hypothetical protein PRUPE_ppa001321mg [Prunus persica]
 gb|EMJ11567.1| hypothetical protein PRUPE_ppa001321mg [Prunus persica]
Length=854

 Score =  1188 bits (3073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 607/836 (73%), Positives = 693/836 (83%), Gaps = 29/836 (3%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKW G+   SNA+T D +EQE+L  IVDGRDSKVTFD+FPYYLSEQTRVL+TSAA+V
Sbjct  27    QTMSKWAGNGTLSNALTPDTVEQELLRQIVDGRDSKVTFDQFPYYLSEQTRVLITSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQ LAKALAHYF AKLLLLDVT+FSLK+QS
Sbjct  87    HLKRAEVSKYTRNLSPASRAILLSGPAELYQQQLAKALAHYFQAKLLLLDVTNFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGSS   SSFKRS SE TL R+S   GSFSI   +EE  GTLRRQ+SGVDI S  +EGS
Sbjct  147   KYGSSNKASSFKRSTSEVTLERLSGLFGSFSIFPQREEPTGTLRRQNSGVDIRSSMVEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SNP+ LRRN+SAS N++NL S +T +N  PL RTSS SFDEKLLIQ+LY+VLV VS TCP
Sbjct  207   SNPSKLRRNASASGNISNLASQSTPANSAPLRRTSSWSFDEKLLIQSLYRVLVFVSNTCP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             +VLYLRD +KLL RS+++Y L QKML++LSG+VLILGSRIVD G+D RE+DERL+++FPY
Sbjct  267   VVLYLRDVDKLLSRSQRIYNLFQKMLKKLSGAVLILGSRIVDLGEDKREVDERLTALFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE E+HLVSW +QLEEDMKM+Q QDNKNHIMEVL++ND++CDDLGSIC+ADT+ 
Sbjct  327   NIEIRPPENESHLVSWNTQLEEDMKMIQVQDNKNHIMEVLSSNDLDCDDLGSICIADTID  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG+NIF+E K + GKD LKLE+
Sbjct  387   LSNYIEEIVVSAVSYHLMNNKDPEYRNGKLVISSNSLSHGLNIFQEGKYS-GKDTLKLEA  445

Query  1591  KAELSKETQSGEKGSKGP--ETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             KAE  KE  +G +G+ G   ETK ES+      PE  S A       K    +   +   
Sbjct  446   KAETLKE--AGIEGAVGVNLETKTESAA-----PENKSGAETSTSAAKTDADNPIPISRA  498

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
                 DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLF GGLLKP
Sbjct  499   SAELDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFNGGLLKP  558

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPG+GKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  559   CRGILLFGPPGSGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  618

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+  G+RILVLAATNRPFDLD
Sbjct  619   PTIIFVDEVDSMLGQRTRFGEHEAMRKIKNEFMTHWDGLLSNQGDRILVLAATNRPFDLD  678

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRI+VGLPT E RE+IL+TLL+KE V   LD K+LATMTEG++GSDLKNLCT
Sbjct  679   EAIIRRFERRILVGLPTVENREMILRTLLSKEKVEARLDFKELATMTEGFSGSDLKNLCT  738

Query  697   TAAYRPVRELIKQERLKDVEKKRLA------QECPNCGDA-----------PTANEDKGE  569
             TAAYRPVRELI+ ER KD+EKK+ A      Q  P+   A           P   E K E
Sbjct  739   TAAYRPVRELIQAEREKDLEKKQRAAGGQNPQGVPSINQAQSSEGQSPEAVPATKEHKEE  798

Query  568   RVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             RVIT+RPLNM+DF +AK+QVAASFA+EG++MNELKQWN+ YGEGGSRK+EQLTYFL
Sbjct  799   RVITLRPLNMEDFKQAKSQVAASFASEGAMMNELKQWNDQYGEGGSRKREQLTYFL  854



>ref|XP_006439446.1| hypothetical protein CICLE_v10018858mg [Citrus clementina]
 gb|ESR52686.1| hypothetical protein CICLE_v10018858mg [Citrus clementina]
Length=834

 Score =  1184 bits (3062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/819 (75%), Positives = 692/819 (84%), Gaps = 15/819 (2%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKW G+  S NAVT + ME+E+L  IVDGR+S +TFDEFPYYLS QTR LLTSAA+V
Sbjct  27    QTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  + +K+TRNLSPAS+ ILLSGPAELYQQMLAKALAH+F AKLLLLDVTDFSLK+QS
Sbjct  87    HLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG +  ES F+RS SE+ L R+S   GSFSIL  KEE +GTLRRQ SGVDI S+G EGS
Sbjct  147   KYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              N   LRRN+SASAN++NL S  + SN G L RTSS SFDEKLLIQ++Y+VL  VSKT P
Sbjct  207   FNHPALRRNASASANISNLAS-QSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSP  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IV+YLRD +KL+ +S++ Y L QKM+++L  SVLILGSRIVD  +D RE+D R++++FPY
Sbjct  266   IVVYLRDVDKLIFKSQRTYNLFQKMMKKLPASVLILGSRIVDLSNDQREVDGRVTALFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E HLVSWKSQLEEDMKMMQ +DN+NHIMEVL+AND++CDDL SI +ADTM 
Sbjct  326   NIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMV  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSA+SYHLMN KD +YRN KL+ISSKSLSHG++IF+E K A+GKD LKLE+
Sbjct  386   LSNYIEEIVVSAVSYHLMNNKDTDYRNGKLIISSKSLSHGLSIFQEGK-ASGKDTLKLEA  444

Query  1591  KAELSKETQSGEKGSKGPETKAESST-APGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +AE S E   G K +KGP+  A + T  P SK E      A AP     +S   A KAPE
Sbjct  445   QAEKSNE--GGRKEAKGPKPAAGTETMKPESKSEA--EKSAAAPNKDGDSSVPAAAKAPE  500

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIP+ EI VTFADIGAL+EIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  501   VPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKPC  560

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  561   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  620

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+KPGERILVLAATNRPFDLDE
Sbjct  621   TIIFVDEVDSMLGQRTRIGEHEAMRKIKNEFMTHWDGLLSKPGERILVLAATNRPFDLDE  680

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLPT E RE+IL+TLL KE VG+ LD K+LATMTEGYTGSDLKNLCTT
Sbjct  681   AIIRRFERRIMVGLPTVENREMILRTLLTKEKVGQGLDFKELATMTEGYTGSDLKNLCTT  740

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAK  518
             AAYR VRELI+QERLKD EKK+   E     DA  + ED K ERVIT+RPLNMDDF EAK
Sbjct  741   AAYRAVRELIQQERLKDTEKKQRTAE-----DASDSKEDIKEERVITLRPLNMDDFREAK  795

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFAAEGSIM+EL QWN+LYGEGGSRKKEQL+YFL
Sbjct  796   NQVAASFAAEGSIMSELTQWNDLYGEGGSRKKEQLSYFL  834



>ref|XP_011026962.1| PREDICTED: cell division control protein 48 homolog C-like [Populus 
euphratica]
Length=833

 Score =  1183 bits (3060),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/816 (74%), Positives = 686/816 (84%), Gaps = 10/816 (1%)
 Frame = -1

Query  2845  QTVSKWTGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             +TVSKW G +S+ V  + MEQE+L  ++DGRDS VTFD+FPYYLSEQTRVLLTSAA+ HL
Sbjct  27    KTVSKWRGDASDGVNSETMEQELLRQVIDGRDSGVTFDQFPYYLSEQTRVLLTSAAYFHL  86

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K A+ +K+TRNLSPASR ILLSGPAE YQQMLAKALAHYF AKLLLLD TDFSLK+QSKY
Sbjct  87    KHAEASKYTRNLSPASRAILLSGPAEPYQQMLAKALAHYFEAKLLLLDATDFSLKIQSKY  146

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G+++ ES FKRS SETTL R+S F GSFSIL  KEE   +L RQSSGVDIPS+G++ S N
Sbjct  147   GANK-ESLFKRSNSETTLERLSGFFGSFSILPQKEEPMRSLHRQSSGVDIPSRGLDSSYN  205

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P  LRRNSSA+AN++N  + +T +N  PL RTSS SFDEKLLIQ+LYKVLV VSKT PIV
Sbjct  206   PRKLRRNSSAAANLSNEITRSTPTNSAPLKRTSSWSFDEKLLIQSLYKVLVHVSKTSPIV  265

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD EK+L RS++ Y L QKM  +LSGSVLILGSR++D  +D RE+DE L+++FPYNI
Sbjct  266   LYLRDVEKILFRSKRTYNLFQKMFNKLSGSVLILGSRVLDQSNDSREVDEGLAALFPYNI  325

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EIKPP +ETHLVSWK++LEEDMKM+Q +DN+NHIMEVL+AND++CDDL S+C+ADTMALS
Sbjct  326   EIKPPGDETHLVSWKNKLEEDMKMIQVRDNRNHIMEVLSANDLDCDDLDSVCVADTMALS  385

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE+VVSAISYHLMN K PEYRN KLV+SSKSLSHG++IF+E K+  GKD +K+E++ 
Sbjct  386   NYIEEIVVSAISYHLMN-KHPEYRNGKLVVSSKSLSHGLSIFQESKSM-GKDSMKVEAQP  443

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT-AVKAPEVP  1409
             E SKE    E  +  PETKAE     G  PE  S     A   K    +   A KAPEVP
Sbjct  444   ETSKEAGGNETVAVKPETKAE-----GVNPENESEVEKKASGVKAVGENSLPASKAPEVP  498

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIP  EI VTF+DIGAL+E KESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  499   PDNEFEKRIRPEVIPPNEINVTFSDIGALEETKESLQELVMLPLRRPDLFKGGLLKPCRG  558

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  559   ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  618

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLT  G+RILVLAATNRPFDLDEAI
Sbjct  619   IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTHQGQRILVLAATNRPFDLDEAI  678

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+ E RE ILKTLL KE + + LD K+LATMTEGY+GSDLKNLCTTAA
Sbjct  679   IRRFERRIMVGLPSAENRERILKTLLGKEKM-EGLDFKELATMTEGYSGSDLKNLCTTAA  737

Query  688   YRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQV  509
             YRPVRELI+QERLKD+ KK+ A+     G+A    E K ERVIT+RPLNM+DF  AKNQV
Sbjct  738   YRPVRELIQQERLKDLVKKQRAEAAQKLGEATDTKEVKKERVITLRPLNMEDFKLAKNQV  797

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFAAEG+ MNEL+QWN LYGEGGSRKK+QLTYFL
Sbjct  798   AASFAAEGASMNELQQWNELYGEGGSRKKQQLTYFL  833



>ref|XP_002298002.2| hypothetical protein POPTR_0001s10050g [Populus trichocarpa]
 gb|EEE82807.2| hypothetical protein POPTR_0001s10050g [Populus trichocarpa]
Length=835

 Score =  1182 bits (3058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 608/818 (74%), Positives = 689/818 (84%), Gaps = 12/818 (1%)
 Frame = -1

Query  2845  QTVSKWTGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             +TVSKW G +S+ +  + MEQE+L  ++DGRDS VTFD+FPYYLSEQTRVLLTSAA+ HL
Sbjct  27    KTVSKWRGDASDGINSETMEQELLRQVIDGRDSGVTFDQFPYYLSEQTRVLLTSAAYFHL  86

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K A+ +K+TRNLSPASR ILLSGPAE YQQMLAKALAHYF AKLLLLD TDFSLK+QSKY
Sbjct  87    KHAEASKYTRNLSPASRAILLSGPAEPYQQMLAKALAHYFEAKLLLLDATDFSLKIQSKY  146

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G+++ ES FKRS SETTL R+S FLGSFSIL  KEE   +L RQSSGVDIPS+G++ S N
Sbjct  147   GANK-ESLFKRSNSETTLERLSGFLGSFSILPQKEEPMRSLYRQSSGVDIPSRGLDSSYN  205

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P  LRRNSSA+AN++N  + ++ +N  PL RTSS SFDEKLLIQ+LYKVLV VSKT PIV
Sbjct  206   PRKLRRNSSAAANLSNEITQSSPANTAPLKRTSSWSFDEKLLIQSLYKVLVHVSKTSPIV  265

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRDAEK+L RS++ Y L QKM  +LSGSVLILGSR++D  +D RE+DE L+++FPYNI
Sbjct  266   LYLRDAEKILFRSKRTYNLFQKMFNKLSGSVLILGSRVLDLSNDSREVDEGLTALFPYNI  325

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EIKPP +ETHLVSWK++LEEDMKM+Q +DN+NHIMEVL+AND++CDDL S+C+ADTMALS
Sbjct  326   EIKPPGDETHLVSWKNKLEEDMKMIQVRDNRNHIMEVLSANDLDCDDLDSVCVADTMALS  385

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE+VVSAISYHLMN K PEYRN KLV+SSKSLSHG++IF+E K+  GKD LK+E++A
Sbjct  386   NYIEEIVVSAISYHLMN-KYPEYRNGKLVVSSKSLSHGLSIFQESKSM-GKDSLKVEAQA  443

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT-AVKAPEVP  1409
             E SKE    E  +  PETKAE     G  PE  S     A   K    +   A KAPEVP
Sbjct  444   ETSKEAGGNETVAVKPETKAE-----GVNPENKSEVEKKASGVKAVGENSLPASKAPEVP  498

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIP  EI VTF+DIGAL+E KESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  499   PDNEFEKRIRPEVIPPNEINVTFSDIGALEETKESLQELVMLPLRRPDLFKGGLLKPCRG  558

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  559   ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  618

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLT  GERILVLAATNRPFDLDEAI
Sbjct  619   IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTNQGERILVLAATNRPFDLDEAI  678

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+ E RE ILKTLL KE + + LD K+LATMTEGY+GSDLKNLCTTAA
Sbjct  679   IRRFERRIMVGLPSAEHRERILKTLLGKEKM-EGLDFKELATMTEGYSGSDLKNLCTTAA  737

Query  688   YRPVRELIKQERLKDVE--KKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             YRPVRELI+QERLKD+   KK+ A+     G+A    E K ERVIT+RPLNM+DF  AKN
Sbjct  738   YRPVRELIQQERLKDLASVKKQRAEAAQKLGEATDTKEVKKERVITLRPLNMEDFKLAKN  797

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFAAEG+ MNEL+QWN LYGEGGSRKK+QLTYFL
Sbjct  798   QVAASFAAEGASMNELQQWNELYGEGGSRKKQQLTYFL  835



>ref|XP_007040379.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY24880.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 1 [Theobroma cacao]
Length=831

 Score =  1179 bits (3051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 605/816 (74%), Positives = 695/816 (85%), Gaps = 16/816 (2%)
 Frame = -1

Query  2836  SKWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             SKWTGS S A   +T++ ME+E+L  IVDGR+SKVTFD+FPYYLSEQT+ LLTSAA+VHL
Sbjct  28    SKWTGSGSGASTGITLERMEKELLRQIVDGRESKVTFDQFPYYLSEQTQALLTSAAYVHL  87

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K AD +K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF +KLLLLDVTDFSLK+QSKY
Sbjct  88    KHADVSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFESKLLLLDVTDFSLKIQSKY  147

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             GS + ESSFKRS SETTL R+S   GSFS+L  +EE KGTLRRQSSGVDI S+G+E   +
Sbjct  148   GSGK-ESSFKRSTSETTLERLSGIFGSFSLLS-QEEHKGTLRRQSSGVDIGSRGVE---D  202

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P  LRRN+SASAN+N+L S  T++NP PL  TSS SFD+KLLIQ+LYKVLV VSK  P+V
Sbjct  203   PPKLRRNASASANINSLASQCTSANPAPLRWTSSFSFDDKLLIQSLYKVLVYVSKATPLV  262

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD +KLL RS+++Y L Q+ML +LSG+VLILGSR+VD G+D RE+DERL+++FPYNI
Sbjct  263   LYLRDVDKLLFRSQRIYNLFQRMLNKLSGNVLILGSRVVDLGNDDREVDERLTAIFPYNI  322

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EI+PPE+E HLVSWKSQLE+DMKM+Q QDN+NHIMEVL+AND++CDDL SIC+ADTMALS
Sbjct  323   EIRPPEDEKHLVSWKSQLEKDMKMIQAQDNRNHIMEVLSANDLDCDDLDSICVADTMALS  382

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
              YIEEVVVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E K+  GKD LK E++ 
Sbjct  383   KYIEEVVVSAISYHLMNNKDPEYRNGKLMISSKSLSHGLSIFQEGKST-GKDTLKFEAET  441

Query  1585  ELSKETQSGEKGSKGPETKAES-STAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             + SKE  +GE  S G +T+++S ST P  K E          T  +  +   A K  EVP
Sbjct  442   KTSKE--AGEV-SVGAKTESKSGSTNPEKKSE---METTATATKTEGENPAPAPKVTEVP  495

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EI VTFADIGALDE KESL ELVMLPLRRPDLF+GGLLKPCRG
Sbjct  496   PDNEFEKRIRPEVIPANEIDVTFADIGALDETKESLQELVMLPLRRPDLFQGGLLKPCRG  555

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  556   ILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  615

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKP ERILVLAATNRPFDLDEAI
Sbjct  616   IFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPSERILVLAATNRPFDLDEAI  675

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+ + RE I +TLL+KE V   L+  +L +MTEGYTGSDLKNLCTTAA
Sbjct  676   IRRFERRIMVGLPSADNREKIFRTLLSKEKVVDGLNFSELVSMTEGYTGSDLKNLCTTAA  735

Query  688   YRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQV  509
             YRPVRELI+QERLKD+E+K+ A E  N  DA T  +   ER+IT+RPLN++DF +AKNQV
Sbjct  736   YRPVRELIQQERLKDLERKQKAAERQNTEDASTTKDGAEERIITLRPLNLEDFRQAKNQV  795

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASF++EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  796   AASFSSEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  831



>ref|XP_006476477.1| PREDICTED: nuclear valosin-containing protein-like [Citrus sinensis]
Length=834

 Score =  1179 bits (3049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/820 (74%), Positives = 690/820 (84%), Gaps = 17/820 (2%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKW G+  S NAVT + ME+E+L  IVDGR+S +TFDEFPYYLS QTR LLTSAA+V
Sbjct  27    QTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPAS+ ILLSGPAELYQQMLAKALAH+F AKLLLLDVTDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG +  ES F+RS SE+ L R+S   GSFSIL  KEE +GTLRRQ SGVDI S+G EGS
Sbjct  147   KYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              N   LRRN+SASAN++NL S  + SN G L RTSS SFDEKLLIQ++Y+VL  VSKT P
Sbjct  207   FNHPALRRNASASANISNLAS-QSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSP  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IV+YLRD +KL+ +S++ Y L QKM+++L  SVLILGSRIVD  +D RE+D R++++FPY
Sbjct  266   IVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E HLVSWKSQLEEDMKMMQ +DN+NHIMEVL+AND++CDDL SI +ADTM 
Sbjct  326   NIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMV  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             L NYIEE+VVSA+SYHLMN +D +YRN KL+ISSKSLSHG++IF+E K A+GKD LKLE+
Sbjct  386   LGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGK-ASGKDTLKLEA  444

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT--AVKAP  1418
             +AE S E   G K +KGP+  A +      KPE+ S A   A        S    A KAP
Sbjct  445   QAEKSNE--GGRKEAKGPKPAAGTEIM---KPESTSEAEKSAAAPNKDGDSSVPAAAKAP  499

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIP+ EI VTFADIGAL+EIKESL ELVMLPLRRPDLFKGGLLKP
Sbjct  500   EVPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKP  559

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  560   CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  619

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+KPGERILVLAATNRPFDLD
Sbjct  620   PTIIFVDEVDSMLGQRTRIGEHEAMRKIKNEFMTHWDGLLSKPGERILVLAATNRPFDLD  679

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLPT E RE+IL+TLL KE VG+ LD K+LATMTEGYTGSDLKNLCT
Sbjct  680   EAIIRRFERRIMVGLPTVENREMILRTLLTKEKVGQGLDFKELATMTEGYTGSDLKNLCT  739

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEA  521
             TAAYR VRELI+QERLKD EKK   Q  P   DA  + ED K ERVIT+RPLNMDDF EA
Sbjct  740   TAAYRAVRELIQQERLKDTEKK---QRTPE--DASDSKEDIKEERVITLRPLNMDDFREA  794

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFAAEGSIM+EL QWN+LYGEGGSRKKEQL+YFL
Sbjct  795   KNQVAASFAAEGSIMSELTQWNDLYGEGGSRKKEQLSYFL  834



>emb|CBI34411.3| unnamed protein product [Vitis vinifera]
Length=836

 Score =  1175 bits (3039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/820 (75%), Positives = 698/820 (85%), Gaps = 15/820 (2%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTVS+WTGS   SS+A+T + MEQE+L  +V+GR+SKVTFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QTVSRWTGSGSGSSDALTAEKMEQELLRQVVEGRESKVTFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+F+K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+Q
Sbjct  87    VHLKQAEFSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             +KYGS+  ESS KRSIS TTL R+S  LGS S++   EE KGTLRRQSSG+DI S+G + 
Sbjct  147   NKYGSASKESSMKRSISTTTLERVSSLLGSLSLIPQMEESKGTLRRQSSGMDIASRGRDC  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S NP  +RRN+SASANMNN+ S      P PL RTSS SFDEKLLIQ+LYKVLV VSKT 
Sbjct  207   SCNPPKIRRNASASANMNNMAS-QFAPYPAPLKRTSSWSFDEKLLIQSLYKVLVSVSKTS  265

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             P+VLY+RD EKLL RS+++Y L QKML +LSGS+LILGS+I+DP DDY ++D+RL+++FP
Sbjct  266   PLVLYIRDVEKLLSRSQRIYNLFQKMLNKLSGSILILGSQIIDPDDDYGDVDQRLTALFP  325

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E H VSWK+QLEEDMKM+Q QDNKNHI+EVLAAND++C DL SIC+ DTM
Sbjct  326   YNIEIRPPEDENHFVSWKTQLEEDMKMIQLQDNKNHIIEVLAANDLDCRDLDSICLEDTM  385

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSA+SYHLMN KD EY+N KLVISSKSL+HG+++F+E K+ + KD  KLE
Sbjct  386   VLSNYIEEIVVSAVSYHLMNNKDHEYKNGKLVISSKSLAHGLSLFQEGKSGS-KDTSKLE  444

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE SKE    E     P  KAES TAP +K E GS   A             A KAPE
Sbjct  445   AHAEPSKEAGGEEGAGVKPAAKAES-TAPENKNEAGSLIVAVKEGDNPI----PASKAPE  499

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLF+GGLLKPC
Sbjct  500   VPPDNEFEKRIRPEVIPASEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFEGGLLKPC  559

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  560   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  619

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDE
Sbjct  620   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDE  679

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE+I+KTLL+KE V + LD K+LATMTEGY+GSDLKNLCTT
Sbjct  680   AIIRRFERRIMVGLPSVENREMIMKTLLSKEKVAEGLDFKELATMTEGYSGSDLKNLCTT  739

Query  694   AAYRPVRELIKQERLKDVEKKRLAQE--CPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
             AAYRPVRELI+QERLKD+EKKR A++   P+  D     ED  ERVIT+RPLNM+DF  A
Sbjct  740   AAYRPVRELIQQERLKDLEKKRRAEQRLSPDDDD---VFEDTEERVITLRPLNMEDFRHA  796

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFAAEGSIM+ELKQWN+ YGEGGSRKK+QL+YFL
Sbjct  797   KNQVAASFAAEGSIMSELKQWNDSYGEGGSRKKQQLSYFL  836



>ref|XP_007038876.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
 gb|EOY23377.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Theobroma cacao]
Length=852

 Score =  1174 bits (3037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/833 (72%), Positives = 688/833 (83%), Gaps = 25/833 (3%)
 Frame = -1

Query  2845  QTVSKWTGSSS--NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKW G SS  + +T + +EQE++  +VDG+ S VTFD+FPYYLSE+TRVLLTSAA+V
Sbjct  27    QTVSKWAGKSSAEDGITGEQIEQELMRQVVDGKLSTVTFDDFPYYLSERTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
              LK  D +KHTRNLSP SR ILLSGPAELYQQMLAKALAH F +KLLLLD+TDFSLK+QS
Sbjct  87    QLKHNDVSKHTRNLSPVSRAILLSGPAELYQQMLAKALAHDFESKLLLLDITDFSLKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK---------------GTLRR  2357
             KYG ++ E SFKRSISE TL RM+   GSFS+L P+EE                 GTLRR
Sbjct  147   KYGCTKKEPSFKRSISEMTLERMNSLFGSFSLLLPREETSVLVLVILVLIKIFPTGTLRR  206

Query  2356  QSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLI  2177
             Q SG+DI S+ +EGSSN   LRRN+S +++M++++S  T +NP    RTSS  FD+KL +
Sbjct  207   QGSGIDIKSRAVEGSSNLPKLRRNASTASDMSSISSNCTLTNPASHKRTSSWCFDQKLFL  266

Query  2176  QALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGD  1997
             Q+LYKVLV VS+T  I+LYLRD EKLL RS+++Y L QK+L +LSGSVLILGSR++DP D
Sbjct  267   QSLYKVLVSVSETGSIILYLRDVEKLLLRSQRLYNLFQKLLNKLSGSVLILGSRMLDPED  326

Query  1996  DYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDI  1817
             D RE+D+RLS +FPYNIEIKPPE+ET L SWK+QLEEDMK++Q QDN+NHI EVLAAND+
Sbjct  327   DRREVDQRLSVLFPYNIEIKPPEDETRLDSWKAQLEEDMKVLQIQDNRNHIAEVLAANDL  386

Query  1816  ECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFK  1637
             ECDDLGSIC ADTM LSNYIEE+VVSAISYHLMN KDPEYRN KLVISSKSLSHG+NIF+
Sbjct  387   ECDDLGSICQADTMILSNYIEEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLNIFQ  446

Query  1636  EEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapaptt  1457
             E K+  GKD LKLE+ A+ +KE +  E      E+K+E+  A  SK ET        P  
Sbjct  447   EGKSC-GKDTLKLEANADSAKENEGEEAVGAKTESKSETP-ASESKSET----EKSIPAA  500

Query  1456  kdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPL  1277
             K    +  A KAPEVPPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPL
Sbjct  501   KKDGDNPPAPKAPEVPPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPL  560

Query  1276  RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK  1097
             RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEK
Sbjct  561   RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEK  620

Query  1096  NVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERI  917
             NVRALFTLAAKV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERI
Sbjct  621   NVRALFTLAAKVAPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKTGERI  680

Query  916   LVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMT  737
             LVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RELILKTLLAKE V + LD K+LATMT
Sbjct  681   LVLAATNRPFDLDEAIIRRFERRIMVGLPSIESRELILKTLLAKEKV-EDLDFKELATMT  739

Query  736   EGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVI  560
             EGY+GSDLKNLC TAAYRPVRELI+QERLKD+EKK+  +   +  DA  T  EDK ERVI
Sbjct  740   EGYSGSDLKNLCVTAAYRPVRELIQQERLKDLEKKKREEAGKSSEDASETKEEDKEERVI  799

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLN++D  +AKNQVAASFA+EGSIM ELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  800   TLRPLNLEDLRQAKNQVAASFASEGSIMGELKQWNDLYGEGGSRKKQQLTYFL  852



>ref|XP_010261418.1| PREDICTED: uncharacterized protein LOC104600262 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261419.1| PREDICTED: uncharacterized protein LOC104600262 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261420.1| PREDICTED: uncharacterized protein LOC104600262 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010261421.1| PREDICTED: uncharacterized protein LOC104600262 isoform X1 [Nelumbo 
nucifera]
Length=837

 Score =  1172 bits (3032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/815 (72%), Positives = 680/815 (83%), Gaps = 8/815 (1%)
 Frame = -1

Query  2839  VSKWTGSSS-NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             VSKWT  +S NA+T + +E E+   ++DG++S +TFDEFPYYLSEQTRVLLTSAA+VHLK
Sbjct  29    VSKWTNPNSPNAITGEQIENELQKQVIDGKESNITFDEFPYYLSEQTRVLLTSAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +K+TRNLSPASRTILLSGPAE+Y QMLAKALAHYF AKLLLLD TDFSLK+Q+KYG
Sbjct  89    QTDLSKYTRNLSPASRTILLSGPAEMYHQMLAKALAHYFEAKLLLLDATDFSLKIQNKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN-  2306
             S    SS KRSIS+ TL RMS  LGSFSIL PKE  KGTLRRQ+S ++I S+  EGS+N 
Sbjct  149   SGSKGSSLKRSISDATLERMSGLLGSFSILPPKE-TKGTLRRQNSVMEIRSRATEGSNNA  207

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P   R  S+A+A++N+     +  NP PL RTSS +FDEKLL+Q+LYKVLV VSKT PIV
Sbjct  208   PKHRRNASAAAADINSFALQCSPVNPAPLKRTSSWAFDEKLLVQSLYKVLVSVSKTSPIV  267

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD EKL+ RS+++Y L Q ML++LSGSVLILGSRI DPG+DY E+DERL+ +FPYNI
Sbjct  268   LYLRDVEKLIFRSQRIYTLFQTMLKKLSGSVLILGSRISDPGNDYNEVDERLALLFPYNI  327

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             E KPPE+E HL+SW++QLEEDMKM+QYQDN+NHI EVLAAND++CDDLGSIC+ADT+ LS
Sbjct  328   ETKPPEDENHLISWRAQLEEDMKMIQYQDNRNHITEVLAANDLDCDDLGSICLADTIVLS  387

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE++VSA+SYHLMN K+PE+RN +L+ISS+SLSHG++IF+E K   GKD LKL + +
Sbjct  388   NYIEEIIVSAVSYHLMNNKNPEFRNGRLIISSRSLSHGLSIFQEGKRG-GKDTLKLGANS  446

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPP  1406
             E +KE++        PE+K+  + AP +K E            K+  +    VK PE+PP
Sbjct  447   EPAKESEGDGIIGVKPESKS-GTPAPENKSEP---EKPVPLVKKEDENPPAPVKVPEIPP  502

Query  1405  DNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGI  1226
             DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPCRGI
Sbjct  503   DNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPCRGI  562

Query  1225  LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  1046
             LLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII
Sbjct  563   LLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  622

Query  1045  FVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAII  866
             FVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDLDEAII
Sbjct  623   FVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDLDEAII  682

Query  865   RRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAY  686
             RRFERRIMVGLP+ E RE IL+TLLAKE V + LD K+LATMTEGY+GSDLKNLCT AAY
Sbjct  683   RRFERRIMVGLPSIENREKILRTLLAKEKVEEGLDFKELATMTEGYSGSDLKNLCTMAAY  742

Query  685   RPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVA  506
             RPVRELI++ERLKD+E+KR   E  N  +A  A ED  ++VIT+RPLNM D   AKNQVA
Sbjct  743   RPVRELIQRERLKDLERKRREDEGLNLEEASNAKEDNEDKVITLRPLNMQDMKLAKNQVA  802

Query  505   ASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AS+AAEG+ M ELKQWN LYGEGGSRKK+QL+YFL
Sbjct  803   ASYAAEGASMGELKQWNELYGEGGSRKKQQLSYFL  837



>ref|XP_002513623.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF49026.1| ATP binding protein, putative [Ricinus communis]
Length=835

 Score =  1169 bits (3025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/818 (72%), Positives = 687/818 (84%), Gaps = 12/818 (1%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q++S+W     SS  VT + +EQE++  ++DGR+SKVTFDEFPYYLS+ TRV LTSAA++
Sbjct  27    QSMSRWGNGNGSSEDVTAEQIEQELMRQVLDGRNSKVTFDEFPYYLSDITRVSLTSAAYI  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +KHTRNLSPASR ILLSGPAELYQQMLAKA AHYF +KLLLLDV DFS+K+QS
Sbjct  87    HLKHSDVSKHTRNLSPASRAILLSGPAELYQQMLAKASAHYFESKLLLLDVADFSIKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ ESSFKRSISE T  RMS  LGSFSIL  +EE +GTL RQ+S +DI S+ +EG 
Sbjct  147   KYGCTKKESSFKRSISEVTFERMSSLLGSFSILPSREEIRGTLHRQNSNLDIKSRAMEGF  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +N   LRRN+SA++++++++S +T++NP  L R +S  FDEKL +QALYKVL+ +S+   
Sbjct  207   NNHIKLRRNASAASDISSISSQSTSTNPASLKRGNSWCFDEKLFLQALYKVLISISERSS  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LYLRD EK+L RSE++Y L  K L+RLSGSVLILGSR+VD  DD RE+DERL+ +FPY
Sbjct  267   VILYLRDVEKILLRSERIYSLFSKFLKRLSGSVLILGSRMVDHEDDCREVDERLTMLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWK+QLEEDMKM+Q+QDNKNHI+EVLAANDIECDDLGSIC ADTM 
Sbjct  327   NIEIKPPEDETHLVSWKTQLEEDMKMIQFQDNKNHIVEVLAANDIECDDLGSICHADTMV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             +SNYIEE+VVSAISYHLMN K PEYRN KLVISSKSLSHG++IF+E K+  GKD LKLE+
Sbjct  387   ISNYIEEIVVSAISYHLMNNKHPEYRNGKLVISSKSLSHGLSIFQEGKSG-GKDTLKLET  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
               E+ KE + GE G+ G +T+++S       P   +      P  K    +    K PEV
Sbjct  446   NGEVGKEIE-GE-GAVGAKTESKSEI-----PAADNKGEISVPGAKKDGENAVPAKTPEV  498

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLFKGGLLKPCR
Sbjct  499   PPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFKGGLLKPCR  558

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF+LAAKVSPT
Sbjct  559   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVSPT  618

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEA
Sbjct  619   IIFVDEVDSMLGQRTRIGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEA  678

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKTLLAKE   + LD K+LAT+TEGY+GSDLKNLC TA
Sbjct  679   IIRRFERRIMVGLPSIENREMILKTLLAKEKT-EDLDFKELATITEGYSGSDLKNLCVTA  737

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTAN-EDKGERVITIRPLNMDDFMEAKN  515
             AYRPVRELI+QERLKD  KK+ A+E  +  D  +   EDK E VIT+RPLNM+D  +AKN
Sbjct  738   AYRPVRELIQQERLKDKAKKQKAEEATSSEDTSSKKEEDKEEPVITLRPLNMEDMRQAKN  797

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGSIMNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  798   QVAASFASEGSIMNELKQWNDLYGEGGSRKKQQLTYFL  835



>ref|XP_010658526.1| PREDICTED: calmodulin-interacting protein 111 isoform X1 [Vitis 
vinifera]
Length=844

 Score =  1169 bits (3023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 616/828 (74%), Positives = 698/828 (84%), Gaps = 23/828 (3%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTVS+WTGS   SS+A+T + MEQE+L  +V+GR+SKVTFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QTVSRWTGSGSGSSDALTAEKMEQELLRQVVEGRESKVTFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+F+K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+Q
Sbjct  87    VHLKQAEFSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK--------GTLRRQSSGVD  2339
             +KYGS+  ESS KRSIS TTL R+S  LGS S++   EE K        GTLRRQSSG+D
Sbjct  147   NKYGSASKESSMKRSISTTTLERVSSLLGSLSLIPQMEESKALSKSSVGGTLRRQSSGMD  206

Query  2338  IPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKV  2159
             I S+G + S NP  +RRN+SASANMNN+ S      P PL RTSS SFDEKLLIQ+LYKV
Sbjct  207   IASRGRDCSCNPPKIRRNASASANMNNMAS-QFAPYPAPLKRTSSWSFDEKLLIQSLYKV  265

Query  2158  LVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELD  1979
             LV VSKT P+VLY+RD EKLL RS+++Y L QKML +LSGS+LILGS+I+DP DDY ++D
Sbjct  266   LVSVSKTSPLVLYIRDVEKLLSRSQRIYNLFQKMLNKLSGSILILGSQIIDPDDDYGDVD  325

Query  1978  ERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLG  1799
             +RL+++FPYNIEI+PPE+E H VSWK+QLEEDMKM+Q QDNKNHI+EVLAAND++C DL 
Sbjct  326   QRLTALFPYNIEIRPPEDENHFVSWKTQLEEDMKMIQLQDNKNHIIEVLAANDLDCRDLD  385

Query  1798  SICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
             SIC+ DTM LSNYIEE+VVSA+SYHLMN KD EY+N KLVISSKSL+HG+++F+E K+ +
Sbjct  386   SICLEDTMVLSNYIEEIVVSAVSYHLMNNKDHEYKNGKLVISSKSLAHGLSLFQEGKSGS  445

Query  1618  GKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsS  1439
              KD  KLE+ AE SKE    E     P  KAES TAP +K E GS   A           
Sbjct  446   -KDTSKLEAHAEPSKEAGGEEGAGVKPAAKAES-TAPENKNEAGSLIVAVKEGDNPI---  500

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
               A KAPEVPPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLF
Sbjct  501   -PASKAPEVPPDNEFEKRIRPEVIPASEIGVTFADIGAMDEIKESLQELVMLPLRRPDLF  559

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
             +GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  560   EGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALF  619

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAAT
Sbjct  620   TLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAAT  679

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRIMVGLP+ E RE+I+KTLL+KE V + LD K+LATMTEGY+GS
Sbjct  680   NRPFDLDEAIIRRFERRIMVGLPSVENREMIMKTLLSKEKVAEGLDFKELATMTEGYSGS  739

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQE--CPNCGDAPTANEDKGERVITIRPL  545
             DLKNLCTTAAYRPVRELI+QERLKD+EKKR A++   P+  D     ED  ERVIT+RPL
Sbjct  740   DLKNLCTTAAYRPVRELIQQERLKDLEKKRRAEQRLSPDDDD---VFEDTEERVITLRPL  796

Query  544   NMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NM+DF  AKNQVAASFAAEGSIM+ELKQWN+ YGEGGSRKK+QL+YFL
Sbjct  797   NMEDFRHAKNQVAASFAAEGSIMSELKQWNDSYGEGGSRKKQQLSYFL  844



>ref|XP_010261423.1| PREDICTED: uncharacterized protein LOC104600262 isoform X2 [Nelumbo 
nucifera]
Length=836

 Score =  1165 bits (3015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/815 (72%), Positives = 679/815 (83%), Gaps = 9/815 (1%)
 Frame = -1

Query  2839  VSKWTGSSS-NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             VSKWT  +S NA+T + +E E+   ++DG++S +TFDEFPYYLSEQTRVLLTSAA+VHLK
Sbjct  29    VSKWTNPNSPNAITGEQIENELQKQVIDGKESNITFDEFPYYLSEQTRVLLTSAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +K+TRNLSPASRTILLSGPAE+Y QMLAKALAHYF AKLLLLD TDFSLK+Q+KYG
Sbjct  89    QTDLSKYTRNLSPASRTILLSGPAEMYHQMLAKALAHYFEAKLLLLDATDFSLKIQNKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN-  2306
             S    SS KRSIS+ TL RMS  LGSFSIL PKE  KGTLRRQ+S ++I S+  EGS+N 
Sbjct  149   SGSKGSSLKRSISDATLERMSGLLGSFSILPPKE-TKGTLRRQNSVMEIRSRATEGSNNA  207

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P   R  S+A+A++N+     +  NP PL RTSS +FDEKLL+Q+LYKVLV VSKT PIV
Sbjct  208   PKHRRNASAAAADINSFALQCSPVNPAPLKRTSSWAFDEKLLVQSLYKVLVSVSKTSPIV  267

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD EKL+ RS+++Y L Q ML++LSGSVLILGSRI DPG+DY E+DERL+ +FPYNI
Sbjct  268   LYLRDVEKLIFRSQRIYTLFQTMLKKLSGSVLILGSRISDPGNDYNEVDERLALLFPYNI  327

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             E KPPE+E HL+SW++QLEEDMKM+QYQDN+NHI EVLAAND++CDDLGSIC+ADT+ LS
Sbjct  328   ETKPPEDENHLISWRAQLEEDMKMIQYQDNRNHITEVLAANDLDCDDLGSICLADTIVLS  387

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE++VSA+SYHLMN K+PE+RN +L+ISS+SLSHG++IF+E K   GKD LKL + +
Sbjct  388   NYIEEIIVSAVSYHLMNNKNPEFRNGRLIISSRSLSHGLSIFQEGKRG-GKDTLKLGANS  446

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPP  1406
             E +KE++        PE+K+  + AP +K E            K+  +    VK P +PP
Sbjct  447   EPAKESEGDGIIGVKPESKS-GTPAPENKSEP---EKPVPLVKKEDENPPAPVKVP-IPP  501

Query  1405  DNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGI  1226
             DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPCRGI
Sbjct  502   DNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPCRGI  561

Query  1225  LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  1046
             LLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII
Sbjct  562   LLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  621

Query  1045  FVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAII  866
             FVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDLDEAII
Sbjct  622   FVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDLDEAII  681

Query  865   RRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAY  686
             RRFERRIMVGLP+ E RE IL+TLLAKE V + LD K+LATMTEGY+GSDLKNLCT AAY
Sbjct  682   RRFERRIMVGLPSIENREKILRTLLAKEKVEEGLDFKELATMTEGYSGSDLKNLCTMAAY  741

Query  685   RPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVA  506
             RPVRELI++ERLKD+E+KR   E  N  +A  A ED  ++VIT+RPLNM D   AKNQVA
Sbjct  742   RPVRELIQRERLKDLERKRREDEGLNLEEASNAKEDNEDKVITLRPLNMQDMKLAKNQVA  801

Query  505   ASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AS+AAEG+ M ELKQWN LYGEGGSRKK+QL+YFL
Sbjct  802   ASYAAEGASMGELKQWNELYGEGGSRKKQQLSYFL  836



>ref|XP_009334490.1| PREDICTED: uncharacterized protein LOC103927306 [Pyrus x bretschneideri]
Length=839

 Score =  1158 bits (2995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/831 (72%), Positives = 684/831 (82%), Gaps = 34/831 (4%)
 Frame = -1

Query  2845  QTVSKWTGSSS--NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKWTG+ +  N VT D +EQE+L  IVDGRDSKVTFD+FPYYLSEQTRVL+TSAA+V
Sbjct  27    QTMSKWTGNDTMLNGVTPDRVEQELLRQIVDGRDSKVTFDQFPYYLSEQTRVLITSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQ LAKALAHYF AKLLLLDVTDFSLKVQS
Sbjct  87    HLKRAEVSKYTRNLSPASRAILLSGPAELYQQQLAKALAHYFQAKLLLLDVTDFSLKVQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEK-KGTLRRQSSGVDIPSKGIEG  2315
             KYG++   +SFKRS SE TL R+S   GSFS+   +EE  KG LRRQSSGVD+ S G+EG
Sbjct  147   KYGNTNKATSFKRSTSEVTLERLSGLFGSFSLFPQREEPPKGNLRRQSSGVDLGSSGLEG  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S  P  LRRN+SASAN++NL S +T +  G   RTSS SFDEKLLIQ+LY+VLV VS T 
Sbjct  207   SCKPCMLRRNASASANISNLASQSTPAISGEFKRTSSWSFDEKLLIQSLYRVLVFVSSTS  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD +KLL RS+++Y L QKML++LSG+VLILGSR+VD G D RE++ERL+++FP
Sbjct  267   PIVLYLRDVDKLLSRSQRIYNLFQKMLKKLSGAVLILGSRVVDLGSDNREVEERLTALFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE E+HLVSWK+QLEEDM+M+Q QDNKNHIMEVL+AND++CDDLGSIC+ADT+
Sbjct  327   YNIEIRPPENESHLVSWKTQLEEDMRMIQVQDNKNHIMEVLSANDLDCDDLGSICIADTI  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSA+S+HLMN KDPEYRN KLVISSKSLSHG+NIF+E K++ GKD +KL 
Sbjct  387   DLSNYIEEIVVSAVSHHLMNNKDPEYRNGKLVISSKSLSHGLNIFQEGKSS-GKDTMKLV  445

Query  1594  SKAELSKETQSGEKGSKG--PETKAESSTAPGS------KPETGsaapapapttkdatsS  1439
             +K E+ KE   G + S G   ETK ES+           KP+                 +
Sbjct  446   AKVEVPKE--GGNELSVGVTTETKTESTAPAAETAAAAAKPDA---------------DN  488

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
                V       DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLF
Sbjct  489   SIPVSRASAEFDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLF  548

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
              GGLLKPCRGILLFGPPG+GKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  549   NGGLLKPCRGILLFGPPGSGKTMLAKAIAGEAGASFINVSMSTITSKWFGEDEKNVRALF  608

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+  G+RILVLAAT
Sbjct  609   TLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLSNQGDRILVLAAT  668

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRI+VGLPT E RE+IL+TLL+KE V   LD K++ATMTEG++GS
Sbjct  669   NRPFDLDEAIIRRFERRILVGLPTVENREMILRTLLSKEKVEARLDFKEVATMTEGFSGS  728

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTAN-----EDKGERVITI  554
             DLKNLCTTAAYRPVRELI+ ER KD+EKK+ A +       P A      E K ERVIT+
Sbjct  729   DLKNLCTTAAYRPVRELIQAERKKDLEKKKTAAQDGAGERNPEAASVTKVEHKEERVITL  788

Query  553   RPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             RPLNM+DF +AKNQVAASFAAEG++MNELKQWN+LYGEGGSRK+EQL+YFL
Sbjct  789   RPLNMEDFKQAKNQVAASFAAEGAMMNELKQWNDLYGEGGSRKREQLSYFL  839



>ref|XP_002509882.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF51269.1| ATP binding protein, putative [Ricinus communis]
Length=796

 Score =  1157 bits (2992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/801 (74%), Positives = 669/801 (84%), Gaps = 9/801 (1%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYY---LSEQTRVLLTSAAFVHLKSADFAKHTRNLSPA  2621
             MEQEML  ++DGR+S +TFD+FPYY   L  QTR LLTSAA+VHLK A+ +K+TRNL+PA
Sbjct  1     MEQEMLRQVMDGRESGITFDQFPYYXXPLLSQTRALLTSAAYVHLKHAEVSKYTRNLAPA  60

Query  2620  SRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISE  2441
             SR ILLSGPAELYQQMLAKALAHYF  KLLLLD+TDFSLK+Q KYGS+  ESSFKR  SE
Sbjct  61    SRAILLSGPAELYQQMLAKALAHYFETKLLLLDITDFSLKIQGKYGSAMKESSFKRCTSE  120

Query  2440  TTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmn  2261
             +TL R+S F+GS S+   KEE +G LRRQ SG DI S+G+EG S+   LRRN+SA+AN++
Sbjct  121   STLERLSGFIGSLSMRPQKEEPRGRLRRQYSGADIASRGVEGPSDAPKLRRNASAAANIS  180

Query  2260  nltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEK  2081
             NL +  T +N  PL RTSS SFDEKLLIQ+LYKVLV VS+  P+VLY+RD +K L RS++
Sbjct  181   NLAAQPTPTNTAPLKRTSSWSFDEKLLIQSLYKVLVYVSRATPVVLYIRDVDKFLSRSQR  240

Query  2080  VYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWK  1901
             +  L QKML +LSGSVLILGS+IVD   D RELDERL ++FPYNIEI+PPE+ETHLVSWK
Sbjct  241   ICNLFQKMLNKLSGSVLILGSQIVDLSQDSRELDERLFTLFPYNIEIRPPEDETHLVSWK  300

Query  1900  SQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHL  1721
             SQLE DMK +Q QDNKNHIMEVL++ND++CDDL SIC+AD M LSNYIEE+VVSAISYHL
Sbjct  301   SQLEADMKKIQVQDNKNHIMEVLSSNDLDCDDLDSICVADAMVLSNYIEEIVVSAISYHL  360

Query  1720  MNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKG  1541
             MN KDPEYRN KLVISSKSLSHG++IF+E K+A  KD LKLE++AE+SK +   +     
Sbjct  361   MNNKDPEYRNGKLVISSKSLSHGLSIFQEGKSA-DKDTLKLEAQAEMSKVSYICDTIDLK  419

Query  1540  PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPA  1361
              ETK ++ T P ++ E    A        ++    TA K P+VPPDNEFEKRIRPEVIPA
Sbjct  420   TETKVDT-TKPDNRTEAEKLASGVKTDDDNSL---TASKVPDVPPDNEFEKRIRPEVIPA  475

Query  1360  KEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAK  1181
              EI VTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTM+AK
Sbjct  476   NEINVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMMAK  535

Query  1180  AIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRA  1001
             AIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R 
Sbjct  536   AIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRV  595

Query  1000  GEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPE  821
             GEHEAMRKIKNEFM+HWDGLLTKP ERILVLAATNRPFDLDEAIIRRFERRI+VGLP+PE
Sbjct  596   GEHEAMRKIKNEFMTHWDGLLTKPSERILVLAATNRPFDLDEAIIRRFERRILVGLPSPE  655

Query  820   QRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV  641
              RE I KTLLAKE V + L  K+LATMTEG+TGSDLKNLCTTAAYRPVRELIKQERLKD+
Sbjct  656   NREKIFKTLLAKEKVEEGLQFKELATMTEGFTGSDLKNLCTTAAYRPVRELIKQERLKDL  715

Query  640   EKKRLAQECPNCGD-APTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELK  464
             EKK+ A E    G  A T  E K ERVI +R LNM+DF  AKNQVAASFAAEGSIM+ELK
Sbjct  716   EKKQRAAEAQKSGQTADTKEEGKEERVIALRALNMEDFRHAKNQVAASFAAEGSIMSELK  775

Query  463   QWNNLYGEGGSRKKEQLTYFL  401
             QWN+LYGEGGSRKK+QL+YFL
Sbjct  776   QWNDLYGEGGSRKKQQLSYFL  796



>ref|XP_008377677.1| PREDICTED: uncharacterized protein LOC103440725 [Malus domestica]
Length=839

 Score =  1156 bits (2991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/831 (72%), Positives = 686/831 (83%), Gaps = 34/831 (4%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKWTG+   SN VT D +EQE+L  IVDGRDSKVTFD+FPYYLSEQTRVL+TSAA+V
Sbjct  27    QTMSKWTGNDTMSNGVTPDRVEQELLRQIVDGRDSKVTFDQFPYYLSEQTRVLITSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQ LAKALAHYF AKLLLLDVTDFSLKVQS
Sbjct  87    HLKRAEVSKYTRNLSPASRAILLSGPAELYQQQLAKALAHYFQAKLLLLDVTDFSLKVQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEK-KGTLRRQSSGVDIPSKGIEG  2315
             KYG++   SSFKRS SE TL R+S   GSFS+   +EE  KG L+RQSSGVD+ S G+EG
Sbjct  147   KYGNTNKASSFKRSTSEVTLERLSGLFGSFSLFPQREEPPKGNLQRQSSGVDLGSSGLEG  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S  P TLRRN+SASAN++NL S +T +  G   RTSS SFDEKLLIQ+LY+VLV VS T 
Sbjct  207   SCKPCTLRRNASASANISNLASQSTPAISGEFKRTSSWSFDEKLLIQSLYRVLVFVSSTS  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD +KLL RS+++Y L QKML++LSG+VLILGSR+VD G D RE++ERL+++FP
Sbjct  267   PIVLYLRDVDKLLSRSQRIYNLFQKMLKKLSGAVLILGSRVVDLGSDNREVEERLTALFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE E+HLVSWK+QLEEDM+M+Q QDNKNHIMEVL+AND++CDDLGSIC+ADT+
Sbjct  327   YNIEIRPPENESHLVSWKTQLEEDMRMIQVQDNKNHIMEVLSANDLDCDDLGSICIADTI  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSA+S+HLMN KDPEYRN KLVISSKSLSHG+NIF+E K++ GKD +KL 
Sbjct  387   DLSNYIEEIVVSAVSHHLMNNKDPEYRNGKLVISSKSLSHGLNIFQEGKSS-GKDTMKLV  445

Query  1594  SKAELSKETQSGEKGSKG--PETKAESSTAPGS------KPETGsaapapapttkdatsS  1439
             +KAE+ KE   G + S G   ET  ES+           KP+  +               
Sbjct  446   AKAEVPKE--GGNEVSVGVTTETITESTAPAAETAAAAAKPDADN---------------  488

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
                V       DNEFEKRIRPEVIPA EI VTFADIGALDEIKESL ELVMLPLRRPDLF
Sbjct  489   SIPVSRASAELDNEFEKRIRPEVIPANEISVTFADIGALDEIKESLQELVMLPLRRPDLF  548

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
              GGLLKPCRGILLFGPPG+GKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  549   NGGLLKPCRGILLFGPPGSGKTMLAKAIAGEAGASFINVSMSTITSKWFGEDEKNVRALF  608

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+  G+RILVLAAT
Sbjct  609   TLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLSNQGDRILVLAAT  668

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRI+VGLPT E RE+IL+TLL+KE V   LD K++ATMTEG++GS
Sbjct  669   NRPFDLDEAIIRRFERRILVGLPTVENREMILRTLLSKEKVEARLDFKEVATMTEGFSGS  728

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECP----NCGDAP-TANEDKGERVITI  554
             DL+NLCTTAAYRPVRELI+ ER KD+EKK+ A +      N   AP T  E K ERVIT+
Sbjct  729   DLRNLCTTAAYRPVRELIQAERKKDLEKKKTAAQDGAGERNPEAAPVTKVEHKEERVITL  788

Query  553   RPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             RPLNM+DF +AKNQVAASFAAEG++MNELKQWN+LYGEGGSRK+EQL+YFL
Sbjct  789   RPLNMEDFKQAKNQVAASFAAEGAMMNELKQWNDLYGEGGSRKREQLSYFL  839



>gb|EYU40052.1| hypothetical protein MIMGU_mgv1a025345mg [Erythranthe guttata]
Length=805

 Score =  1156 bits (2990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/822 (72%), Positives = 666/822 (81%), Gaps = 51/822 (6%)
 Frame = -1

Query  2845  QTVSKWTGSSSNA-----VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSA  2681
             Q V KW G    +     V+   ME+EML  I +GRDS +TFD+FPYYLSEQTRVLLTSA
Sbjct  28    QAVGKWAGGGGASIMGGGVSAKTMEEEMLGLIANGRDSNITFDQFPYYLSEQTRVLLTSA  87

Query  2680  AFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLK  2501
             AFVHLK  DF KHTRNLSPASRTILLSGPAELYQQMLAKALAHYF A LLLLDVTDFSLK
Sbjct  88    AFVHLKKGDFCKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFEANLLLLDVTDFSLK  147

Query  2500  VQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGI  2321
                         SFKRSISETTL RMSE LGSFSILQPKEE  GTLRRQSSGVD+ S G 
Sbjct  148   ------------SFKRSISETTLGRMSELLGSFSILQPKEESIGTLRRQSSGVDLGSIGQ  195

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             EGS NP+ LRRN+SA+AN+++L S +  ++  PL R SS  FD+KL +Q LYKVLV+VSK
Sbjct  196   EGS-NPSKLRRNASAAANIDDLASTSAPTSSAPLKRASSWCFDDKLFMQTLYKVLVEVSK  254

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
             T PI+LYLRD EKLLCRS+++YI+ QKML++LSGS+LILGSRIVDP  DYR LDE++SSV
Sbjct  255   TNPIILYLRDVEKLLCRSQRIYIMFQKMLKKLSGSILILGSRIVDPEKDYRLLDEKISSV  314

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             F YNIEIKPPE+ET LVSWKSQLEEDMKM++Y+DN+NHI EVLAAND++CDDLGSIC+AD
Sbjct  315   FCYNIEIKPPEDETRLVSWKSQLEEDMKMIKYRDNRNHISEVLAANDLDCDDLGSICLAD  374

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
              + LSNYIEE+VVSAISYHLMN K+PEYRN KLVISS SLS G+ IF+E K    KD LK
Sbjct  375   AIVLSNYIEEIVVSAISYHLMNAKEPEYRNGKLVISSTSLSRGLRIFQEGKFGGDKDSLK  434

Query  1600  LESKAELSKETQ-SGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAV-  1427
             LE++ E+SKE +   E      E K E +     K E                  G+AV 
Sbjct  435   LEAQGEVSKEKKVDAEAARSKTEIKDEKAGIASKKIE------------------GSAVA  476

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             K  E PPDNEFEKRIRPEVIPA+EIGVTFADIGALD+IK+SL ELVMLPL+RPDLF+GGL
Sbjct  477   KKTETPPDNEFEKRIRPEVIPAREIGVTFADIGALDDIKDSLQELVMLPLKRPDLFEGGL  536

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAA
Sbjct  537   LKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  596

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLG R+RAGEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPF
Sbjct  597   KVSPTIIFVDEVDSMLGHRNRAGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPF  656

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERR+MVGLP+ E RE IL+TLL+KE V + LD  +LAT T+G++GSDLKN
Sbjct  657   DLDEAIIRRFERRVMVGLPSVENREKILRTLLSKEKVDERLDFAELATTTDGFSGSDLKN  716

Query  706   LCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFM  527
             LC TAAYRPVRELI+QERLKD + K               + +K ERVITIRPLNM+DF 
Sbjct  717   LCVTAAYRPVRELIQQERLKDQKHK-------------AEDSEKKERVITIRPLNMEDFK  763

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             EAKNQVAASFAA GSIM ELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  764   EAKNQVAASFAAGGSIMAELKQWNDLYGEGGSRKKEQLSYFL  805



>ref|XP_002886363.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62622.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
Length=827

 Score =  1153 bits (2983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 606/826 (73%), Positives = 675/826 (82%), Gaps = 31/826 (4%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SSSNAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  22    QAVGKWAGGNSSSSNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  81

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  82    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  141

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S  
Sbjct  142   SKYGSGNTESSSFKRSPSESALEKLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS  201

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSN--PGPLMRTSSLSFDEKLLIQALYKVLVK  2150
             +EGSSNP  LRRNSSA+AN++NL    ++SN    PL R+SS SFDEKLLIQ+LYKVL  
Sbjct  202   MEGSSNPPKLRRNSSAAANISNLA---SSSNQVSAPLKRSSSWSFDEKLLIQSLYKVLAY  258

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDER  1973
             VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+
Sbjct  259   VSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEK  318

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             LS+VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI
Sbjct  319   LSAVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESI  378

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G+
Sbjct  379   SFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGK-AGGR  437

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             + LK ++K E SKE ++       PETK ES TA  SK E            K+  +   
Sbjct  438   EKLKQKTKEEKSKEQKAELAADIKPETKPESVTAASSKEEP----------EKETKAEKV  487

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
             A KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF G
Sbjct  488   APKAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDDIKESLQELVMLPLRRPDLFTG  547

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  548   GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  607

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  608   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  667

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGYTGSDL
Sbjct  668   PFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGYTGSDL  727

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG--ERVITIRPLNM  539
             KNLCTTAAYRPVRELI+QER+KD EKK+  +E    G+     ED+G  ERVIT+RPLN 
Sbjct  728   KNLCTTAAYRPVRELIQQERIKDTEKKK-QRETTKAGE-----EDEGQEERVITLRPLNR  781

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              DF EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  782   QDFKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  827



>gb|KHN16776.1| Putative AAA domain-containing protein C24B10.10c [Glycine soja]
Length=853

 Score =  1151 bits (2977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/833 (71%), Positives = 680/833 (82%), Gaps = 24/833 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V KW  +  SSNA+T + MEQEML  +VDGR+S  TFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVGKWGANTFSSNAITAEKMEQEMLRQVVDGRESNATFDKFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG S  ESSF+RS SETTL R+S+  GSFSI   +EE KG + R SSGVD+ S G E S
Sbjct  147   KYGFSNMESSFRRSTSETTLERLSDLFGSFSIFSQREEPKGKMNRPSSGVDLQSMGAEAS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  LRRN+S+S+N++ L S    +N  PL RT+S SFDEKLLIQ+LYKVL  VSKT P
Sbjct  207   CNPPILRRNASSSSNISGLASQTYPTNSVPLKRTTSWSFDEKLLIQSLYKVLAFVSKTYP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD ++LL +S+++Y L QKML++LSG VLILGSR++D G+DY E+DE+++S+FPY
Sbjct  267   IVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPVLILGSRVIDSGNDYEEVDEKINSLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E+HLVSWKSQLEED+KM+Q QDNKNHIMEVLAAND++CDDL SIC++DTM 
Sbjct  327   NIEIRPPEDESHLVSWKSQLEEDLKMIQVQDNKNHIMEVLAANDLDCDDLDSICVSDTMV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE++VSAISYHLM  KD EYRN KLVISS SLSH +NIF + K++  +D  KLE 
Sbjct  387   LSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDTSKLED  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +A +  E Q  E  +  PE K+E++ AP  K E  + +       + +     A KA EV
Sbjct  446   QA-VKSEKQIEEGTAMKPEAKSENA-APVKKAEAETLSSVGKTDGEKSV---PAPKAAEV  500

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVI A EI VTF+DIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  501   PPDNEFEKRIRPEVILANEIDVTFSDIGALDETKESLQELVMLPLRRPDLFTGGLLKPCR  560

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  561   GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  620

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  621   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDEA  680

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE IL+TLLAKE V   L+ K+LATMTEGYTGSDLKNLCTTA
Sbjct  681   IIRRFERRIMVGLPSVENREKILRTLLAKEKVDNELEFKELATMTEGYTGSDLKNLCTTA  740

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPN-----------CGDAPTA----NEDKGERV-I  560
             AYRPVRELI+QER+K ++KK+ A    N            G+   A     E K ERV I
Sbjct  741   AYRPVRELIQQERIKSLDKKQKASRGQNKDVQESRGQSVVGNTQDALDEEEEVKQERVII  800

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLNM DF EAKNQVAASFAAEG+ M ELKQWN+LYGEGGSRK++QL+YFL
Sbjct  801   TLRPLNMQDFKEAKNQVAASFAAEGAGMGELKQWNDLYGEGGSRKQQQLSYFL  853



>gb|KHG09264.1| ATPase family AAA domain-containing protein 1-A [Gossypium arboreum]
Length=816

 Score =  1151 bits (2977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/823 (72%), Positives = 677/823 (82%), Gaps = 45/823 (5%)
 Frame = -1

Query  2836  SKWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             +KWTG+ SN+   +T++ +E+E+L  IVDGR+S+VTFDEFPYYLSEQT+ LLTSAA+VHL
Sbjct  28    NKWTGTGSNSSTGITLERIEKELLRQIVDGRESQVTFDEFPYYLSEQTQALLTSAAYVHL  87

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K AD +K+TRNLSPAS+ ILLSGPAELYQQMLAKALAH+F +KLLLLD+       QSKY
Sbjct  88    KHADVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFESKLLLLDI-------QSKY  140

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             GS + ESSFKRS SE+TL R+S  LGSFS+L  +EE KGTLRRQSSGVDI S+G EG   
Sbjct  141   GSGQ-ESSFKRSTSESTLERLSGLLGSFSLLS-QEEPKGTLRRQSSGVDIGSRGTEG---  195

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P  LRR +S S N+N+L S  +  NP PL RTSSLSFDEKLLIQALYKVL+ VSK  PIV
Sbjct  196   PPKLRRYASVSENINSLASQCSPGNPAPLRRTSSLSFDEKLLIQALYKVLIYVSKASPIV  255

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD +KLL RS+++Y L QKML++LSG+VLILGS +VD  +D RE D+RLS++FPYNI
Sbjct  256   LYLRDVDKLLSRSQRIYNLFQKMLKKLSGNVLILGSCVVDLNNDDREFDDRLSAIFPYNI  315

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EI+PP +E HLVSWKSQLE+DMKM+Q QDN+NHIMEVL+AND++CDDL SIC+ADTMALS
Sbjct  316   EIRPPADEKHLVSWKSQLEKDMKMIQAQDNRNHIMEVLSANDLDCDDLDSICIADTMALS  375

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
              YIEEVVVSAISYHLMN KDPEYRN KLVISSKSLSHG++IF+E K+  GKD LK E ++
Sbjct  376   RYIEEVVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLSIFQEGKSI-GKDTLKREPQS  434

Query  1585  ELSKETQSG--------EKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTA  1430
             E  KET +G        + GSK PE K+E+ T P +K E                +   A
Sbjct  435   ETLKETGAGSVGVKLESKSGSKNPEKKSET-TLPATKAEG--------------ENPAPA  479

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              K PEVPPDNEFEKRIRPEVIPAKEI VTFADIGAL+E KESL ELVMLPLRRPDLFKGG
Sbjct  480   SKVPEVPPDNEFEKRIRPEVIPAKEIDVTFADIGALEETKESLQELVMLPLRRPDLFKGG  539

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  540   LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  599

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT+  ERILVLAATNRP
Sbjct  600   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLLTRQNERILVLAATNRP  659

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP  E RE I +TLL KE V   LD  +LA MTEGYTGSDLK
Sbjct  660   FDLDEAIIRRFERRIMVGLPGAENREKIFRTLLGKEKVEDGLDFAELALMTEGYTGSDLK  719

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLCTTAAYRPVRELI+QERLKD+E+K+   E  N  D         ERVIT+RPL+M+DF
Sbjct  720   NLCTTAAYRPVRELIQQERLKDLERKQRVVEVQNKEDGAE------ERVITLRPLSMEDF  773

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AKNQVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  774   RQAKNQVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  816



>ref|XP_006584736.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
isoform X1 [Glycine max]
 ref|XP_006584737.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
isoform X2 [Glycine max]
Length=853

 Score =  1150 bits (2974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/833 (71%), Positives = 680/833 (82%), Gaps = 24/833 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V KW  +  SSNA+T + MEQEML  +VDGR+S  TFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVGKWGANTFSSNAITAEKMEQEMLRQVVDGRESNATFDKFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG S  ESSF+RS SETTL R+S+  GSFSI   +EE KG + R SSGVD+ S G E S
Sbjct  147   KYGFSNMESSFRRSTSETTLERLSDLFGSFSIFSQREEPKGKMNRPSSGVDLQSMGAEAS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  LRRN+S+S+N++ L S    +N  PL RT+S SFDEKLLIQ+LYKVL  VSKT P
Sbjct  207   CNPPILRRNASSSSNISGLASQTYPTNSVPLKRTTSWSFDEKLLIQSLYKVLAFVSKTYP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD ++LL +S+++Y L QKML++LSG VLILGSR++D G+DY E+DE+++S+FPY
Sbjct  267   IVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPVLILGSRVIDSGNDYEEVDEKINSLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E+HLVSWKSQLEED+KM+Q QDNKNHIMEVLAAND++CDDL SIC++DTM 
Sbjct  327   NIEIRPPEDESHLVSWKSQLEEDLKMIQVQDNKNHIMEVLAANDLDCDDLDSICVSDTMV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE++VSAISYHLM  KD EYRN KLVISS SLSH +NIF + K++  +D  KLE 
Sbjct  387   LSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDTSKLED  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +A +  E Q  E  +  PE K+E++ AP  K E  + +       + +     A KA EV
Sbjct  446   QA-VKSEKQIEEGTAMKPEAKSENA-APVKKAEAETLSSVGKTDGEKSV---PAPKAAEV  500

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVI A EI VTF+DIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  501   PPDNEFEKRIRPEVILANEIDVTFSDIGALDETKESLQELVMLPLRRPDLFTGGLLKPCR  560

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  561   GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  620

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  621   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDEA  680

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE IL+TLLAKE V   L+ K++ATMTEGYTGSDLKNLCTTA
Sbjct  681   IIRRFERRIMVGLPSVENREKILRTLLAKEKVDNELEFKEIATMTEGYTGSDLKNLCTTA  740

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPN-----------CGDAPTA----NEDKGERV-I  560
             AYRPVRELI+QER+K ++KK+ A    N            G+   A     E K ERV I
Sbjct  741   AYRPVRELIQQERIKSLDKKQKASRGQNKDVQESRGQSVVGNTQDALDEEEEVKQERVII  800

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLNM DF EAKNQVAASFAAEG+ M ELKQWN+LYGEGGSRK++QL+YFL
Sbjct  801   TLRPLNMQDFKEAKNQVAASFAAEGAGMGELKQWNDLYGEGGSRKQQQLSYFL  853



>ref|XP_010676392.1| PREDICTED: uncharacterized protein LOC104892224 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=828

 Score =  1149 bits (2973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/847 (72%), Positives = 708/847 (84%), Gaps = 25/847 (3%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRD  2750
             MDQK L +SA+GVG+GVGVG GLASGQTVSKWTG  SSSN +T + MEQE+L  +VDGRD
Sbjct  1     MDQKQLLMSAVGVGIGVGVGLGLASGQTVSKWTGISSSSNVITGERMEQELLRMVVDGRD  60

Query  2749  SKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQML  2570
             +KVTFDEFPYYLSEQTRVLLTSAA  +L+  DF+K+TRNLSPASR ILLSGPAELYQQML
Sbjct  61    TKVTFDEFPYYLSEQTRVLLTSAACFYLRKGDFSKYTRNLSPASRAILLSGPAELYQQML  120

Query  2569  AKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQ  2390
             A+ALAH+F AKLLLLDVTDF LK+QSKYG + NESSFKRS SETTL R+S  LGSFS+L 
Sbjct  121   ARALAHFFQAKLLLLDVTDFVLKIQSKYGVN-NESSFKRSTSETTLERLSGLLGSFSLLP  179

Query  2389  PKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRT  2210
              KEE KG+LRRQSSGVDI S+  EGSSNP+ +RRN+SASAN+N+LTS  + +NP PL RT
Sbjct  180   AKEEPKGSLRRQSSGVDIASRNFEGSSNPSKIRRNASASANINDLTSQCSPTNPAPLKRT  239

Query  2209  SSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVL  2030
             SS S DEKLLIQ+LYKV+  VSK  PI+LYLRD + +L RS+K+Y L QKML+R SG VL
Sbjct  240   SSWSVDEKLLIQSLYKVMTSVSKAYPIILYLRDVDMILFRSQKLYRLFQKMLQRFSGPVL  299

Query  2029  ILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKN  1850
             ILGSRI     +  ++D+ L  +FPYNIEIKPPE+ETHLVSWKSQLEEDMKM+Q QDNKN
Sbjct  300   ILGSRITHQDSNDGDIDDMLVDLFPYNIEIKPPEDETHLVSWKSQLEEDMKMLQCQDNKN  359

Query  1849  HIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISS  1670
             HI EVLAAND+ECDDLGSI + DT+ LS +IEE+VVSAISYHLMN K  EYRN KL+ISS
Sbjct  360   HISEVLAANDVECDDLGSITVEDTLVLSKFIEEIVVSAISYHLMNNKH-EYRNGKLLISS  418

Query  1669  KSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSG---EKGSKGPETKA-ESSTAPGS  1502
             +SLSHG+++F+E K+A GKD +KLES+AE SK T +    E  + GPE K+ E+++ P S
Sbjct  419   QSLSHGLSVFQERKSA-GKDTMKLESRAEPSKGTLADIKPESKAAGPEKKSGEAASVPTS  477

Query  1501  KPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGAL  1322
             K + G+                   K+P++PPDNEFE+RIRPEVIPA EI V+F DIGAL
Sbjct  478   K-DVGNE--------------AAGPKSPDIPPDNEFERRIRPEVIPADEISVSFDDIGAL  522

Query  1321  DEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINV  1142
             ++IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINV
Sbjct  523   EKIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINV  582

Query  1141  SMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEF  962
             SMSTITSKWFGEDEKNVRALF+LAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEF
Sbjct  583   SMSTITSKWFGEDEKNVRALFSLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEF  642

Query  961   MSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKE  782
             M+HWDGL TK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE
Sbjct  643   MTHWDGLATKQGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVENRENILRTLLSKE  702

Query  781   TVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCG  602
              V + +D K++A MTEG++GSDLKNLCTTAAYRPVRELI+QERLKD+E K   +E  +  
Sbjct  703   KVEEGIDYKEIAIMTEGFSGSDLKNLCTTAAYRPVRELIQQERLKDLEGKTETEEGQSTA  762

Query  601   DAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKK  422
              A      K ERV+++RPLN++DF +AKNQVAASFA+ G+IMNELKQWN+LYGEGGSRKK
Sbjct  763   GAQKKKNSK-ERVVSLRPLNLEDFRDAKNQVAASFASGGAIMNELKQWNDLYGEGGSRKK  821

Query  421   EQLTYFL  401
             EQLTYFL
Sbjct  822   EQLTYFL  828



>ref|XP_006584738.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
isoform X3 [Glycine max]
Length=852

 Score =  1149 bits (2971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/833 (71%), Positives = 681/833 (82%), Gaps = 25/833 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V KW  +  SSNA+T + MEQEML  +VDGR+S  TFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVGKWGANTFSSNAITAEKMEQEMLRQVVDGRESNATFDKFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG S  ESSF+RS SETTL R+S+  GSFSI   +EE KG + R SSGVD+ S G E S
Sbjct  147   KYGFSNMESSFRRSTSETTLERLSDLFGSFSIFSQREEPKGKMNRPSSGVDLQSMGAEAS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  LRRN+S+S+N++ L S    +N  PL RT+S SFDEKLLIQ+LYKVL  VSKT P
Sbjct  207   CNPPILRRNASSSSNISGLASQTYPTNSVPLKRTTSWSFDEKLLIQSLYKVLAFVSKTYP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD ++LL +S+++Y L QKML++LSG VLILGSR++D G+DY E+DE+++S+FPY
Sbjct  267   IVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPVLILGSRVIDSGNDYEEVDEKINSLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E+HLVSWKSQLEED+KM+Q QDNKNHIMEVLAAND++CDDL SIC++DTM 
Sbjct  327   NIEIRPPEDESHLVSWKSQLEEDLKMIQVQDNKNHIMEVLAANDLDCDDLDSICVSDTMV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE++VSAISYHLM  KD EYRN KLVISS SLSH +NIF + K++  +D  KLE 
Sbjct  387   LSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDTSKLED  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +A  S++ + G   +  PE K+E++ AP  K E  + +       + +     A KA EV
Sbjct  446   QAVKSEQIEEG--TAMKPEAKSENA-APVKKAEAETLSSVGKTDGEKSV---PAPKAAEV  499

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVI A EI VTF+DIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  500   PPDNEFEKRIRPEVILANEIDVTFSDIGALDETKESLQELVMLPLRRPDLFTGGLLKPCR  559

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  560   GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  619

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  620   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDEA  679

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE IL+TLLAKE V   L+ K++ATMTEGYTGSDLKNLCTTA
Sbjct  680   IIRRFERRIMVGLPSVENREKILRTLLAKEKVDNELEFKEIATMTEGYTGSDLKNLCTTA  739

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPN-----------CGDAPTA----NEDKGERV-I  560
             AYRPVRELI+QER+K ++KK+ A    N            G+   A     E K ERV I
Sbjct  740   AYRPVRELIQQERIKSLDKKQKASRGQNKDVQESRGQSVVGNTQDALDEEEEVKQERVII  799

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLNM DF EAKNQVAASFAAEG+ M ELKQWN+LYGEGGSRK++QL+YFL
Sbjct  800   TLRPLNMQDFKEAKNQVAASFAAEGAGMGELKQWNDLYGEGGSRKQQQLSYFL  852



>ref|XP_006300734.1| hypothetical protein CARUB_v10019795mg [Capsella rubella]
 gb|EOA33632.1| hypothetical protein CARUB_v10019795mg [Capsella rubella]
Length=830

 Score =  1148 bits (2969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/823 (73%), Positives = 669/823 (81%), Gaps = 27/823 (3%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KWTG    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWTGVNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSK  2327
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S 
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGVDIKSS  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKV  2147
              +EGSSNP  LRRNSSA+AN++NL    ++SN  PL RTSS SFDEKLLIQ+LYKVL  V
Sbjct  207   SMEGSSNPPKLRRNSSAAANISNLA---SSSNQAPLKRTSSWSFDEKLLIQSLYKVLAYV  263

Query  2146  SKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERL  1970
             SK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+L
Sbjct  264   SKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEKL  323

Query  1969  SSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSIC  1790
             SSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI 
Sbjct  324   SSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESIS  383

Query  1789  MADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKD  1610
               DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G++
Sbjct  384   FEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGK-AGGRE  442

Query  1609  ILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTA  1430
              LK ++K E SKE ++       PETK ES T   SK E   AA                
Sbjct  443   KLKQKTKEEKSKEVKAELVADVKPETKPESVTTTSSKNEPEKAAEPEK-----------V  491

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
                 EVPPDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF GG
Sbjct  492   TPKQEVPPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTGG  551

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  552   LLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLA  611

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             +KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNRP
Sbjct  612   SKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNRP  671

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGSDLK
Sbjct  672   FDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSDLK  731

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLCTTAAYRPVRELI+QER+KD EKK+  +E    G+    +E K ERVIT+RPLN  DF
Sbjct  732   NLCTTAAYRPVRELIQQERIKDTEKKK-QRETSKAGE---EDEGKEERVITLRPLNRQDF  787

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  788   KEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  830



>ref|NP_001117544.1| transcription factor DUO1 [Arabidopsis thaliana]
 gb|AEE34198.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=827

 Score =  1146 bits (2965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/822 (73%), Positives = 673/822 (82%), Gaps = 28/822 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
             +EGSSNP  LRRNSSA+AN++NL    ++SN  PL R+SS SFDEKLL+Q+LYKVL  VS
Sbjct  207   MEGSSNPPKLRRNSSAAANISNLA---SSSNQAPLKRSSSWSFDEKLLVQSLYKVLAYVS  263

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERLS  1967
             K  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+LS
Sbjct  264   KANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEKLS  323

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             +VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI  
Sbjct  324   AVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESISF  383

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
              DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G++ 
Sbjct  384   EDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGK-AGGREK  442

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAV  1427
             LK ++K E SKE ++    S  PETK ES T   SK              K+A +     
Sbjct  443   LKQKTKEESSKEVKAE---SIKPETKTESVTTVSSK----------EEPEKEAKAEKVTP  489

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALDEIKESL ELVMLPLRRPDLF GGL
Sbjct  490   KAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRPDLFTGGL  549

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA+
Sbjct  550   LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAS  609

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNRPF
Sbjct  610   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNRPF  669

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGYTGSDLKN
Sbjct  670   DLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGYTGSDLKN  729

Query  706   LCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFM  527
             LCTTAAYRPVRELI+QER+KD EKK+  +E    G+    +E K ERVIT+RPLN  DF 
Sbjct  730   LCTTAAYRPVRELIQQERIKDTEKKK-QREPTKAGE---EDEGKEERVITLRPLNRQDFK  785

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  786   EAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  827



>gb|EYU23405.1| hypothetical protein MIMGU_mgv1a001595mg [Erythranthe guttata]
Length=788

 Score =  1146 bits (2964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/821 (72%), Positives = 666/821 (81%), Gaps = 66/821 (8%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V K TG  +SS  VT  ++EQEML+ + +GRDS VTFD+FPYYLSEQTRVLLTSAAFV
Sbjct  28    QAVGKLTGGATSSTGVTPHVLEQEMLSLLTNGRDSTVTFDQFPYYLSEQTRVLLTSAAFV  87

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+KH RNLSPASRTILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+ +
Sbjct  88    HLKKADFSKHMRNLSPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIMN  147

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGS   E S KRSISETTL RMSE  GSFS+LQP E K+G+LRR++S VD+ S  ++ +
Sbjct  148   KYGSPNKEISLKRSISETTLGRMSELFGSFSLLQPTEGKRGSLRRRNSVVDLRS-NVQEN  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP TLRRN+SASA++NNL +  TT       RTS+  FDEKL IQ LYKVLV VSKTCP
Sbjct  207   PNPGTLRRNASASADINNLGA--TTQAISASQRTSTWCFDEKLFIQTLYKVLVNVSKTCP  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD EKLLCRS++ Y+L QKML+RLSGS+LILGSRIV P +D REL E++SSVFPY
Sbjct  265   IVLYLRDIEKLLCRSQRGYVLFQKMLKRLSGSILILGSRIVQPENDGRELHEKISSVFPY  324

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI PP++E+HLVSWK+QLEEDMKM+QY+DNKNHI EVLAAND++C+DLGSIC+ DT+ 
Sbjct  325   NIEISPPDDESHLVSWKNQLEEDMKMIQYKDNKNHINEVLAANDLDCEDLGSICLTDTIV  384

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMNTK+P+YRN KLVISS SLSHG++IF+E K+   K+ +KLE+
Sbjct  385   LSNYIEEIVVSAISYHLMNTKEPDYRNGKLVISSTSLSHGLSIFQEGKSKV-KNTVKLEA  443

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +AE+ KE                                                     
Sbjct  444   QAEMPKEN----------------------------------------------------  451

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTFADIGALDE+KESL ELVMLPLRRPDLF+GGLLKPCR
Sbjct  452   PPDNEFEKRIRPEVIPANEIGVTFADIGALDELKESLQELVMLPLRRPDLFEGGLLKPCR  511

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  512   GILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  571

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR++AGEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEA
Sbjct  572   IIFVDEVDSMLGQRNKAGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEA  631

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERR+MVGLP+ + RE I++TLL+KE V + LD  +LATMTEGY+GSDLKNLC TA
Sbjct  632   IIRRFERRVMVGLPSVDNREKIMRTLLSKEKVDEGLDFMELATMTEGYSGSDLKNLCVTA  691

Query  691   AYRPVRELIKQERLKDVEKKRLA---QECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
             AYRPVRELI+QE LKD EK   +   QE  N  D     EDK ERVITIRPLNM DF EA
Sbjct  692   AYRPVRELIQQEMLKDKEKNHRSGEGQEGVNKSDI----EDKKERVITIRPLNMGDFKEA  747

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKE-QLTYFL  401
             KNQVAASFA+EGSIM ELKQWN+ YGEGGSRKKE QL+YFL
Sbjct  748   KNQVAASFASEGSIMTELKQWNDQYGEGGSRKKEQQLSYFL  788



>ref|XP_010676390.1| PREDICTED: uncharacterized protein LOC104892224 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=831

 Score =  1145 bits (2963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 612/850 (72%), Positives = 708/850 (83%), Gaps = 28/850 (3%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRD  2750
             MDQK L +SA+GVG+GVGVG GLASGQTVSKWTG  SSSN +T + MEQE+L  +VDGRD
Sbjct  1     MDQKQLLMSAVGVGIGVGVGLGLASGQTVSKWTGISSSSNVITGERMEQELLRMVVDGRD  60

Query  2749  SKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQML  2570
             +KVTFDEFPYYLSEQTRVLLTSAA  +L+  DF+K+TRNLSPASR ILLSGPAELYQQML
Sbjct  61    TKVTFDEFPYYLSEQTRVLLTSAACFYLRKGDFSKYTRNLSPASRAILLSGPAELYQQML  120

Query  2569  AKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQ  2390
             A+ALAH+F AKLLLLDVTDF LK+QSKYG + NESSFKRS SETTL R+S  LGSFS+L 
Sbjct  121   ARALAHFFQAKLLLLDVTDFVLKIQSKYGVN-NESSFKRSTSETTLERLSGLLGSFSLLP  179

Query  2389  PKEEKKGT---LRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPL  2219
              KEE KG+   LRRQSSGVDI S+  EGSSNP+ +RRN+SASAN+N+LTS  + +NP PL
Sbjct  180   AKEEPKGSIGSLRRQSSGVDIASRNFEGSSNPSKIRRNASASANINDLTSQCSPTNPAPL  239

Query  2218  MRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSG  2039
              RTSS S DEKLLIQ+LYKV+  VSK  PI+LYLRD + +L RS+K+Y L QKML+R SG
Sbjct  240   KRTSSWSVDEKLLIQSLYKVMTSVSKAYPIILYLRDVDMILFRSQKLYRLFQKMLQRFSG  299

Query  2038  SVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQD  1859
              VLILGSRI     +  ++D+ L  +FPYNIEIKPPE+ETHLVSWKSQLEEDMKM+Q QD
Sbjct  300   PVLILGSRITHQDSNDGDIDDMLVDLFPYNIEIKPPEDETHLVSWKSQLEEDMKMLQCQD  359

Query  1858  NKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLV  1679
             NKNHI EVLAAND+ECDDLGSI + DT+ LS +IEE+VVSAISYHLMN K  EYRN KL+
Sbjct  360   NKNHISEVLAANDVECDDLGSITVEDTLVLSKFIEEIVVSAISYHLMNNKH-EYRNGKLL  418

Query  1678  ISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSG---EKGSKGPETKA-ESSTA  1511
             ISS+SLSHG+++F+E K+A GKD +KLES+AE SK T +    E  + GPE K+ E+++ 
Sbjct  419   ISSQSLSHGLSVFQERKSA-GKDTMKLESRAEPSKGTLADIKPESKAAGPEKKSGEAASV  477

Query  1510  PGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADI  1331
             P SK + G+                   K+P++PPDNEFE+RIRPEVIPA EI V+F DI
Sbjct  478   PTSK-DVGNE--------------AAGPKSPDIPPDNEFERRIRPEVIPADEISVSFDDI  522

Query  1330  GALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASF  1151
             GAL++IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASF
Sbjct  523   GALEKIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASF  582

Query  1150  INVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIK  971
             INVSMSTITSKWFGEDEKNVRALF+LAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIK
Sbjct  583   INVSMSTITSKWFGEDEKNVRALFSLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIK  642

Query  970   NEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLL  791
             NEFM+HWDGL TK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL
Sbjct  643   NEFMTHWDGLATKQGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVENRENILRTLL  702

Query  790   AKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECP  611
             +KE V + +D K++A MTEG++GSDLKNLCTTAAYRPVRELI+QERLKD+E K   +E  
Sbjct  703   SKEKVEEGIDYKEIAIMTEGFSGSDLKNLCTTAAYRPVRELIQQERLKDLEGKTETEEGQ  762

Query  610   NCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGS  431
             +   A      K ERV+++RPLN++DF +AKNQVAASFA+ G+IMNELKQWN+LYGEGGS
Sbjct  763   STAGAQKKKNSK-ERVVSLRPLNLEDFRDAKNQVAASFASGGAIMNELKQWNDLYGEGGS  821

Query  430   RKKEQLTYFL  401
             RKKEQLTYFL
Sbjct  822   RKKEQLTYFL  831



>ref|XP_006300735.1| hypothetical protein CARUB_v10019795mg [Capsella rubella]
 gb|EOA33633.1| hypothetical protein CARUB_v10019795mg [Capsella rubella]
Length=832

 Score =  1145 bits (2961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/825 (73%), Positives = 670/825 (81%), Gaps = 29/825 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KWTG    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWTGVNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSK  2327
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S 
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGVDIKSS  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPG--PLMRTSSLSFDEKLLIQALYKVLV  2153
              +EGSSNP  LRRNSSA+AN++NL    ++SN G  PL RTSS SFDEKLLIQ+LYKVL 
Sbjct  207   SMEGSSNPPKLRRNSSAAANISNLA---SSSNQGSAPLKRTSSWSFDEKLLIQSLYKVLA  263

Query  2152  KVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDE  1976
              VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE
Sbjct  264   YVSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDE  323

Query  1975  RLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGS  1796
             +LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL S
Sbjct  324   KLSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLES  383

Query  1795  ICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAG  1616
             I   DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G
Sbjct  384   ISFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGK-AGG  442

Query  1615  KDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSG  1436
             ++ LK ++K E SKE ++       PETK ES T   SK E   AA              
Sbjct  443   REKLKQKTKEEKSKEVKAELVADVKPETKPESVTTTSSKNEPEKAAEPEK----------  492

Query  1435  TAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK  1256
                   EVPPDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF 
Sbjct  493   -VTPKQEVPPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFT  551

Query  1255  GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFT  1076
             GGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFT
Sbjct  552   GGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFT  611

Query  1075  LAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATN  896
             LA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATN
Sbjct  612   LASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATN  671

Query  895   RPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSD  716
             RPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGSD
Sbjct  672   RPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSD  731

Query  715   LKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMD  536
             LKNLCTTAAYRPVRELI+QER+KD EKK+  +E    G+    +E K ERVIT+RPLN  
Sbjct  732   LKNLCTTAAYRPVRELIQQERIKDTEKKK-QRETSKAGE---EDEGKEERVITLRPLNRQ  787

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             DF EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  788   DFKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  832



>ref|NP_849842.1| transcription factor DUO1 [Arabidopsis thaliana]
 gb|AEE34196.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=829

 Score =  1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/824 (73%), Positives = 673/824 (82%), Gaps = 30/824 (4%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSN--PGPLMRTSSLSFDEKLLIQALYKVLVK  2150
             +EGSSNP  LRRNSSA+AN++NL    ++SN    PL R+SS SFDEKLL+Q+LYKVL  
Sbjct  207   MEGSSNPPKLRRNSSAAANISNLA---SSSNQVSAPLKRSSSWSFDEKLLVQSLYKVLAY  263

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDER  1973
             VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+
Sbjct  264   VSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEK  323

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             LS+VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI
Sbjct  324   LSAVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESI  383

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G+
Sbjct  384   SFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGK-AGGR  442

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             + LK ++K E SKE ++    S  PETK ES T   SK              K+A +   
Sbjct  443   EKLKQKTKEESSKEVKAE---SIKPETKTESVTTVSSK----------EEPEKEAKAEKV  489

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
               KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALDEIKESL ELVMLPLRRPDLF G
Sbjct  490   TPKAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRPDLFTG  549

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  550   GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  609

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  610   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  669

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGYTGSDL
Sbjct  670   PFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGYTGSDL  729

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             KNLCTTAAYRPVRELI+QER+KD EKK+  +E    G+    +E K ERVIT+RPLN  D
Sbjct  730   KNLCTTAAYRPVRELIQQERIKDTEKKK-QREPTKAGE---EDEGKEERVITLRPLNRQD  785

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             F EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  786   FKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  829



>ref|NP_564824.1| transcription factor DUO1 [Arabidopsis thaliana]
 gb|AAL06985.1| At1g64110/F22C12_22 [Arabidopsis thaliana]
 gb|AAP21168.1| At1g64110/F22C12_22 [Arabidopsis thaliana]
 gb|AEE34197.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=824

 Score =  1142 bits (2953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/824 (73%), Positives = 673/824 (82%), Gaps = 30/824 (4%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  22    QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  81

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  82    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  141

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S  
Sbjct  142   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS  201

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSN--PGPLMRTSSLSFDEKLLIQALYKVLVK  2150
             +EGSSNP  LRRNSSA+AN++NL    ++SN    PL R+SS SFDEKLL+Q+LYKVL  
Sbjct  202   MEGSSNPPKLRRNSSAAANISNLA---SSSNQVSAPLKRSSSWSFDEKLLVQSLYKVLAY  258

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDER  1973
             VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+
Sbjct  259   VSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEK  318

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             LS+VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI
Sbjct  319   LSAVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESI  378

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G+
Sbjct  379   SFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGK-AGGR  437

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             + LK ++K E SKE ++    S  PETK ES T   SK              K+A +   
Sbjct  438   EKLKQKTKEESSKEVKAE---SIKPETKTESVTTVSSK----------EEPEKEAKAEKV  484

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
               KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALDEIKESL ELVMLPLRRPDLF G
Sbjct  485   TPKAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRPDLFTG  544

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  545   GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  604

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  605   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  664

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGYTGSDL
Sbjct  665   PFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGYTGSDL  724

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             KNLCTTAAYRPVRELI+QER+KD EKK+  +E    G+    +E K ERVIT+RPLN  D
Sbjct  725   KNLCTTAAYRPVRELIQQERIKDTEKKK-QREPTKAGE---EDEGKEERVITLRPLNRQD  780

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             F EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  781   FKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  824



>ref|XP_008451995.1| PREDICTED: uncharacterized protein LOC103493134 [Cucumis melo]
Length=832

 Score =  1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/821 (72%), Positives = 685/821 (83%), Gaps = 21/821 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V +W+ S  SSN +T D +EQEML  IVDGR+SKVTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVKQWSASNSSSNLITADKLEQEMLKHIVDGRESKVTFDDFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKFTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDITDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK-GTLRRQSSGVDIPSKGIEG  2315
             KYG+S  ES+FKRS SE+TL R+S   GSFSIL  +EE+K G+LRRQ SGV++ S G EG
Sbjct  147   KYGTSVKESAFKRSTSESTLERLSGLFGSFSILPSREEQKIGSLRRQRSGVELASWGNEG  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SSN   LRRN+SA+AN+NNL S      P  L   SS +F+EKLLIQ+LYKVL+ VSK  
Sbjct  207   SSNLPKLRRNASAAANINNLASQCNVDKPASLKHMSSWAFEEKLLIQSLYKVLLYVSKAN  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD ++ L +S +VY L  KML++LSGS+LILGSR ++  +DY E+DERLS++FP
Sbjct  267   PIVLYLRDVDRFLSKSNRVYNLFHKMLQKLSGSILILGSRTINSSNDYMEVDERLSALFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+H VSWKSQLEEDMK ++ QDN+NHIMEVL+ ND++CDDL SIC+ DT+
Sbjct  327   YNIEIRPPEDESHHVSWKSQLEEDMKSIKVQDNRNHIMEVLSDNDLDCDDLDSICVGDTL  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
             ALSNYIEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+  K+   K+ ++LE
Sbjct  387   ALSNYIEEIVVSAISYHLMNNKDPEYRNGKLIISSKSLSHGLSIFQAGKSTI-KNSVQLE  445

Query  1594  SKAELSKETQSGEKGSKGPETKAE--SSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             ++AE SK++ + +  +K     AE  S TAP +  +T                   AVKA
Sbjct  446   AQAEASKDSGAVKSEAKADTAAAEIRSETAPVAAAKTDGEMA------------APAVKA  493

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEVPPDNEFEKRIRPEVIPA EIGVTF+DIGA++EIK+SL ELVMLPLRRPDLF GGLLK
Sbjct  494   PEVPPDNEFEKRIRPEVIPANEIGVTFSDIGAMEEIKDSLQELVMLPLRRPDLFLGGLLK  553

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  554   PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  613

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGER+LVLAATNRPFDL
Sbjct  614   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERVLVLAATNRPFDL  673

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RE+IL TLL KE V + LD+K+LATMTEGY+GSDLKN C
Sbjct  674   DEAIIRRFERRIMVGLPSAENREMILTTLLGKEKVEEGLDMKELATMTEGYSGSDLKNFC  733

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPN-CGDAPTANEDKGERVITIRPLNMDDFME  524
              TAAYRPVRELI+QERLKDVEKKR A E  N  GD   A E K ERVIT+R LN++DF  
Sbjct  734   MTAAYRPVRELIQQERLKDVEKKRRAAEGQNKTGDG--AGESKEERVITLRALNIEDFRL  791

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFAAEG++M+ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  792   AKNQVAASFAAEGAMMSELKQWNELYGEGGSRKKQQLTYFL  832



>ref|XP_006580548.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
isoform X1 [Glycine max]
Length=854

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/834 (71%), Positives = 679/834 (81%), Gaps = 25/834 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V  W  +  SSNA+T + MEQEML  +VDGR+S VTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVGNWGANTFSSNAITAEKMEQEMLRQVVDGRESNVTFDKFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQS  146

Query  2491  KYGSSRN-ESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             KYG S N ESSFKRS SETTL R+S+  GSFSI   +EE K  + R SSGVD+ S G E 
Sbjct  147   KYGGSSNIESSFKRSTSETTLERLSDLFGSFSIFSQREEPKVKMNRPSSGVDLQSMGAEV  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S NP TL RN+S+S+N++ L S    +N  PL RT+S SFDEK+LI++L+KVL  VSKT 
Sbjct  207   SLNPPTLHRNASSSSNISGLASQTNPTNSVPLKRTTSWSFDEKILIESLHKVLAFVSKTY  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD ++LL +S+++Y L QKML++LSG +LILGSR++D G+DY E+DE+L+S+FP
Sbjct  267   PIVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPILILGSRVIDSGNDYEEVDEKLNSLFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+HLVSWKSQLEEDMKM+Q QDNKNHIMEVLAA D++CDDL SIC+ADTM
Sbjct  327   YNIEIRPPEDESHLVSWKSQLEEDMKMIQVQDNKNHIMEVLAATDLDCDDLDSICVADTM  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE++VSAISYHLM  KD EYRN KLVISS SLSH +NIF + K++  +D  KLE
Sbjct  387   ILSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDASKLE  445

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
               A +  E Q  E  +  PE K++++ AP  K E   +        + +     A KAPE
Sbjct  446   DHA-VKSEQQREEGTAMKPEVKSKNA-APVKKTEAEISTSVGKAGGEKSV---PAPKAPE  500

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VP DNEFEK+IRPEVIPA EI VTF+DIGALD+ KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  501   VPLDNEFEKQIRPEVIPANEIDVTFSDIGALDDTKESLQELVMLPLRRPDLFTGGLLKPC  560

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  561   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  620

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIF+DEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDE
Sbjct  621   TIIFLDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDE  680

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMV LP+ E RE IL+TLLAKE V   LD K+LATMTEGYTGSDLKNLCTT
Sbjct  681   AIIRRFERRIMVELPSVENREKILRTLLAKEKVDNELDFKELATMTEGYTGSDLKNLCTT  740

Query  694   AAYRPVRELIKQERLKDVEKKRLA--------QECP-------NCGDAPTANED-KGERV  563
             AAYRPVRELI+QERLK ++KK+ A        QE         N  DA    E+ K ERV
Sbjct  741   AAYRPVRELIQQERLKSLDKKQKAAKGQNKDVQESQGGQSILGNTQDAIDGEEEVKQERV  800

Query  562   ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             IT+ PLNM DF EAKNQVAASFAAEG+ M+E+KQWN+LYGEGGSRK++QL+YFL
Sbjct  801   ITLGPLNMQDFKEAKNQVAASFAAEGAGMSEMKQWNDLYGEGGSRKQQQLSYFL  854



>ref|XP_010418461.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X3 [Camelina sativa]
Length=828

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/824 (73%), Positives = 667/824 (81%), Gaps = 31/824 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPS  2330
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K   GTLRRQSSGVDI S
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAAGGTLRRQSSGVDIKS  206

Query  2329  KGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVK  2150
               IEGSSNP  LRRNSSA+AN++NL    ++SN  PL RTSS SFDEKLL+Q+LYKVL  
Sbjct  207   SSIEGSSNPPKLRRNSSAAANISNLA---SSSNQAPLKRTSSWSFDEKLLVQSLYKVLTY  263

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDER  1973
             VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIV+   DD  E+DE+
Sbjct  264   VSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVNLSSDDAEEIDEK  323

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI
Sbjct  324   LSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESI  383

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K+  G+
Sbjct  384   SFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGKSG-GR  442

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             + LK + K E SKE +S       PETK  S T   ++PE            K+A +   
Sbjct  443   EKLKQKPKEEQSKEAKSELAADVKPETKPGSVT---TEPE------------KEAKAEKV  487

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
               KAPE  PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF G
Sbjct  488   TPKAPEGAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTG  547

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  548   GLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTL  607

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  608   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  667

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGSDL
Sbjct  668   PFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSDL  727

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             KNLCTTAAYRPVRELI+ ER+KD EKK+  +E    G+    +E K ERVIT+RPLN  D
Sbjct  728   KNLCTTAAYRPVRELIQHERVKDTEKKKKQRETSKAGE---EDERKEERVITLRPLNRQD  784

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             F EAKNQVAASFAAEG  M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  785   FKEAKNQVAASFAAEGVGMGELKQWNELYGEGGSRKKEQLTYFL  828



>ref|XP_010662653.1| PREDICTED: nuclear valosin-containing protein-like [Vitis vinifera]
 emb|CBI22603.3| unnamed protein product [Vitis vinifera]
Length=837

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/819 (72%), Positives = 683/819 (83%), Gaps = 12/819 (1%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVS+WTG   S +A+T + +E E+L  +VDGR+SK+TFDEFPY+LSEQTRVLLTSAA+V
Sbjct  27    QTVSRWTGLNCSPDAITEEQIEHELLRQVVDGRESKITFDEFPYFLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +DF+KHTRNL+PASR ILLSGPAELYQQ LAKALAH+F AKLLLLDV DFSLK+Q 
Sbjct  87    HLKHSDFSKHTRNLAPASRAILLSGPAELYQQTLAKALAHFFEAKLLLLDVNDFSLKLQG  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + ESS K+SISETTL RMS FLGSFSIL  +EE KGTL RQSSG DI S+ +EG+
Sbjct  147   KYGCPKKESSSKKSISETTLGRMSSFLGSFSILPQREETKGTLSRQSSGADIKSRCMEGA  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +NP   RRN+S S++MN + S +TT +   + RTS+ +FDEK L+Q+L KVLV VS+   
Sbjct  207   NNPPKHRRNASTSSDMNTVASQSTTQSSAHVKRTSNWAFDEKRLLQSLCKVLVSVSEARS  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD EK L +S++ Y L QKML +LSGSVLILGSR++D  D+ RE+DER+  +FPY
Sbjct  267   IILYIRDVEKFLLQSDRFYKLFQKMLDKLSGSVLILGSRMLDNDDEGREVDERVGLLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+ PE+ET L SWKSQLEE++KM+Q+Q+NKNHI EVLAAND++CDDLGSIC AD+M 
Sbjct  327   NIEIRAPEDETRLDSWKSQLEEELKMLQFQENKNHIAEVLAANDLDCDDLGSICHADSMI  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+V+SAISYHLMN KDPEYRN KLVISSKSLSHG+NIF++ K+  GKD LKLE+
Sbjct  387   LSNYIEEIVISAISYHLMNNKDPEYRNGKLVISSKSLSHGLNIFQQGKSG-GKDTLKLET  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              AE SK+T+  E     PE KAE+S APGSK ET       +   K    +  A KA EV
Sbjct  446   NAESSKDTEGEESTGGKPEGKAETS-APGSKSET-----EKSALAKKDGENQPATKAAEV  499

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCR
Sbjct  500   PPDNEFEKRIRPEVIPANEIGVTFDDIGALSDIKESLQELVMLPLRRPDLFKGGLLKPCR  559

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  560   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  619

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  620   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKAGERILVLAATNRPFDLDEA  679

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC TA
Sbjct  680   IIRRFERRIMVGLPSVESREMILKTLLAKEK-AEDLDFKELATMTEGYTGSDLKNLCVTA  738

Query  691   AYRPVRELIKQER-LKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAK  518
             AYRPVREL++QER +KD EKK+ A E  +  DA     E K E+ I +RPLNM+D  +AK
Sbjct  739   AYRPVRELLQQERMMKDKEKKQKADEGQSSEDASDAKEEAKEEKEIVLRPLNMEDMRQAK  798

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVA+SFA+EG++MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  799   NQVASSFASEGAVMNELKQWNELYGEGGSRKKKQLTYFL  837



>ref|XP_003538688.1| PREDICTED: uncharacterized protein LOC100783137 [Glycine max]
 gb|KHN35054.1| Putative AAA domain-containing protein C24B10.10c [Glycine soja]
Length=839

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/819 (71%), Positives = 674/819 (82%), Gaps = 13/819 (2%)
 Frame = -1

Query  2839  VSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             V+KW     SSSN VT + ME+EML  +VDGR+SKVTFD+FPYYL EQTRVLLTSA +VH
Sbjct  28    VTKWGANENSSSNGVTPENMEREMLRLVVDGRESKVTFDQFPYYLREQTRVLLTSAGYVH  87

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK A+ ++HTRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLD+TDFSLK+QSK
Sbjct  88    LKHAEVSRHTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDLTDFSLKIQSK  147

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YG +  ESSFKRSISETTL R+SE  GSFSI Q + E KG   RQ SGV++ S   EGS+
Sbjct  148   YGFANKESSFKRSISETTLERLSELFGSFSIFQQRGEPKGNFPRQRSGVELLSMKTEGSN  207

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             NPT +RRN+SASAN+++L   +  +N  P    +S  FDEKLLIQ LYKVLV VSKT PI
Sbjct  208   NPTKMRRNASASANISSLALQSNPTNSAPQKHITSWPFDEKLLIQTLYKVLVYVSKTYPI  267

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             VLYLRD + LL RS+++Y L Q ML +L G +LILGSR++D G DYRE+DERL+S+FPYN
Sbjct  268   VLYLRDVDNLLYRSQRIYNLFQTMLNKLHGPILILGSRVLDYGSDYREVDERLASLFPYN  327

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEI PPE+E+ LVSWKSQ EEDMKM+Q QDN+NHIMEVLAAND++CDDL SIC+ADTM L
Sbjct  328   IEISPPEDESCLVSWKSQFEEDMKMIQIQDNRNHIMEVLAANDLDCDDLDSICVADTMVL  387

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE+VVSAISYHLMN+KDPEYRN KLVI   SLS  + IF+E K +   D LKLE++
Sbjct  388   SNYIEEIVVSAISYHLMNSKDPEYRNGKLVIPCNSLSRALGIFQEGKFSVN-DTLKLEAQ  446

Query  1588  AELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             A ++ E++ G  G   PE KAE+  APG K E+ ++        ++A       +  EVP
Sbjct  447   A-VTSESEEGAVGE--PEKKAENP-APGIKAESDTSTSVGKTDGENALPVSKVTQ--EVP  500

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EIGV F+D+GALDE KESL ELVMLPLRRPDLF+GGLLKPC+G
Sbjct  501   PDNEFEKRIRPEVIPANEIGVKFSDVGALDETKESLQELVMLPLRRPDLFRGGLLKPCKG  560

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  561   ILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  620

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+T  GERILVLAATNRPFDLDEAI
Sbjct  621   IFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTNSGERILVLAATNRPFDLDEAI  680

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVG+P+ E RE IL+TLLAKE V + LD K++ATMTEGY+GSDLKNLCTTAA
Sbjct  681   IRRFERRIMVGMPSVENREKILRTLLAKEKVDEKLDFKEVATMTEGYSGSDLKNLCTTAA  740

Query  688   YRPVRELIKQERLKDVEKKR--LAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAK  518
             YRPVRELI+QERLK +EKK+     +  +  +AP   E  + ERVIT+RPLNM DF EAK
Sbjct  741   YRPVRELIQQERLKTLEKKQKDAGGQNNDVQEAPDTEEKVQQERVITLRPLNMQDFKEAK  800

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +QVAAS+AAEG+ M+ELKQWN LYGEGGSRK+EQL+YFL
Sbjct  801   SQVAASYAAEGAGMSELKQWNELYGEGGSRKQEQLSYFL  839



>ref|XP_010915761.1| PREDICTED: lon protease homolog, mitochondrial isoform X1 [Elaeis 
guineensis]
Length=835

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/820 (71%), Positives = 682/820 (83%), Gaps = 14/820 (2%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVS+WT    SS+ +  + +E E++  +VDGRDSK+TF+EFP+YLSEQTRV+LTSAA+V
Sbjct  25    QTVSRWTAPARSSSGMLAEKIEHELMRLVVDGRDSKITFNEFPFYLSEQTRVVLTSAAYV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+K+ RNLSPAS+ I+LSGPAELYQQMLAKALAHYF AKLLLLDVT FSLK+QS
Sbjct  85    HLKQADFSKYMRNLSPASQAIILSGPAELYQQMLAKALAHYFEAKLLLLDVTAFSLKIQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGS+  ++SFKRSISETTL RMS  LGSFSIL  +EE KG+L RQ+S ++I S+G E +
Sbjct  145   KYGSATKDASFKRSISETTLERMSSLLGSFSILPQREEPKGSLHRQTSSLEIRSRGSEST  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S+   LRRN+SASA+M++L S     NP  L R+ S SFDEKLLIQALYKVL+ VSK+ P
Sbjct  205   SDIPKLRRNASASADMSSLLSQCPPVNPVTLKRSGSWSFDEKLLIQALYKVLLSVSKSDP  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD E LL RS+++Y L +KML++L+G VLILGSR+++   DYRE+DERL+ +FPY
Sbjct  265   IILYIRDIENLLFRSQRMYSLFRKMLKKLTGPVLILGSRVIEVDSDYREVDERLTLLFPY  324

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIK PE+ET LVSWKSQ+EEDMK++++QDN+NHI EVLAAND++CDDLGSIC+ADTM 
Sbjct  325   NIEIKQPEDETKLVSWKSQIEEDMKILRFQDNRNHITEVLAANDLDCDDLGSICLADTMV  384

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LS YIEE+VVSA+SYHLMN KDPEYRN KLVISSKSLSH +NIF+E + + GKD LKLE+
Sbjct  385   LSKYIEEIVVSAVSYHLMNNKDPEYRNEKLVISSKSLSHALNIFQENELS-GKDTLKLEA  443

Query  1591  KAELSKETQSGEKGSKGPETKAESST---APGSKPETGsaapapapttkdatsSGTAVKA  1421
               E  K  ++G++      TK+E+ +    P +K E+           KD   S    KA
Sbjct  444   NVEPMK--KAGKEEDTAVSTKSETKSEALPPENKSES------EKSVQKDGVGSCPPPKA  495

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIRPEVIPA EIGVTF DIGALD+IKESL ELVMLPLRRPDLFKGGLLK
Sbjct  496   PEVAPDNEFEKRIRPEVIPANEIGVTFDDIGALDDIKESLQELVMLPLRRPDLFKGGLLK  555

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  556   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  615

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLLTKP  RILVLAATNRPFDL
Sbjct  616   SPTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLTKPEVRILVLAATNRPFDL  675

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELIL+TLL+KE V + LD K+LATMTEGY+GSDLKNLC
Sbjct  676   DEAIIRRFERRIMVGLPSLESRELILRTLLSKEKVKEGLDYKELATMTEGYSGSDLKNLC  735

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
             TTAAYRPVRELI++ERLK++E K+ A    N  D      + GE  IT+RPLNM+D  +A
Sbjct  736   TTAAYRPVRELIQKERLKELETKQKAGGGENPSDTSETKVEDGEISITLRPLNMEDMRQA  795

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             K+QVAASFA EGSIM+ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  796   KSQVAASFAPEGSIMSELKQWNELYGEGGSRKKQQLTYFL  835



>ref|XP_006580549.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
isoform X2 [Glycine max]
Length=853

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/834 (70%), Positives = 680/834 (82%), Gaps = 26/834 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V  W  +  SSNA+T + MEQEML  +VDGR+S VTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVGNWGANTFSSNAITAEKMEQEMLRQVVDGRESNVTFDKFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQS  146

Query  2491  KYGSSRN-ESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             KYG S N ESSFKRS SETTL R+S+  GSFSI   +EE K  + R SSGVD+ S G E 
Sbjct  147   KYGGSSNIESSFKRSTSETTLERLSDLFGSFSIFSQREEPKVKMNRPSSGVDLQSMGAEV  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S NP TL RN+S+S+N++ L S    +N  PL RT+S SFDEK+LI++L+KVL  VSKT 
Sbjct  207   SLNPPTLHRNASSSSNISGLASQTNPTNSVPLKRTTSWSFDEKILIESLHKVLAFVSKTY  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD ++LL +S+++Y L QKML++LSG +LILGSR++D G+DY E+DE+L+S+FP
Sbjct  267   PIVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPILILGSRVIDSGNDYEEVDEKLNSLFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+HLVSWKSQLEEDMKM+Q QDNKNHIMEVLAA D++CDDL SIC+ADTM
Sbjct  327   YNIEIRPPEDESHLVSWKSQLEEDMKMIQVQDNKNHIMEVLAATDLDCDDLDSICVADTM  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE++VSAISYHLM  KD EYRN KLVISS SLSH +NIF + K++  +D  KLE
Sbjct  387   ILSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDASKLE  445

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
               A  S++ + G   +  PE K++++ AP  K E   +        + +     A KAPE
Sbjct  446   DHAVKSEQREEGT--AMKPEVKSKNA-APVKKTEAEISTSVGKAGGEKSV---PAPKAPE  499

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VP DNEFEK+IRPEVIPA EI VTF+DIGALD+ KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  500   VPLDNEFEKQIRPEVIPANEIDVTFSDIGALDDTKESLQELVMLPLRRPDLFTGGLLKPC  559

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  560   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  619

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIF+DEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDE
Sbjct  620   TIIFLDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDE  679

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMV LP+ E RE IL+TLLAKE V   LD K+LATMTEGYTGSDLKNLCTT
Sbjct  680   AIIRRFERRIMVELPSVENREKILRTLLAKEKVDNELDFKELATMTEGYTGSDLKNLCTT  739

Query  694   AAYRPVRELIKQERLKDVEKKRLA--------QECP-------NCGDAPTANED-KGERV  563
             AAYRPVRELI+QERLK ++KK+ A        QE         N  DA    E+ K ERV
Sbjct  740   AAYRPVRELIQQERLKSLDKKQKAAKGQNKDVQESQGGQSILGNTQDAIDGEEEVKQERV  799

Query  562   ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             IT+ PLNM DF EAKNQVAASFAAEG+ M+E+KQWN+LYGEGGSRK++QL+YFL
Sbjct  800   ITLGPLNMQDFKEAKNQVAASFAAEGAGMSEMKQWNDLYGEGGSRKQQQLSYFL  853



>ref|XP_010418463.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X5 [Camelina sativa]
Length=827

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/823 (73%), Positives = 667/823 (81%), Gaps = 30/823 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSK  2327
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S 
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGVDIKSS  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKV  2147
              IEGSSNP  LRRNSSA+AN++NL    ++SN  PL RTSS SFDEKLL+Q+LYKVL  V
Sbjct  207   SIEGSSNPPKLRRNSSAAANISNLA---SSSNQAPLKRTSSWSFDEKLLVQSLYKVLTYV  263

Query  2146  SKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERL  1970
             SK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIV+   DD  E+DE+L
Sbjct  264   SKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVNLSSDDAEEIDEKL  323

Query  1969  SSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSIC  1790
             SSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI 
Sbjct  324   SSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESIS  383

Query  1789  MADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKD  1610
               DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K+  G++
Sbjct  384   FEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGKSG-GRE  442

Query  1609  ILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTA  1430
              LK + K E SKE +S       PETK  S T   ++PE            K+A +    
Sbjct  443   KLKQKPKEEQSKEAKSELAADVKPETKPGSVT---TEPE------------KEAKAEKVT  487

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPE  PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF GG
Sbjct  488   PKAPEGAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTGG  547

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  548   LLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLA  607

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             +KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNRP
Sbjct  608   SKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNRP  667

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGSDLK
Sbjct  668   FDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSDLK  727

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLCTTAAYRPVRELI+ ER+KD EKK+  +E    G+    +E K ERVIT+RPLN  DF
Sbjct  728   NLCTTAAYRPVRELIQHERVKDTEKKKKQRETSKAGE---EDERKEERVITLRPLNRQDF  784

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              EAKNQVAASFAAEG  M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  785   KEAKNQVAASFAAEGVGMGELKQWNELYGEGGSRKKEQLTYFL  827



>gb|KEH21161.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=860

 Score =  1139 bits (2945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/833 (70%), Positives = 680/833 (82%), Gaps = 20/833 (2%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q VSKW  +   SSNAVT D +E EML  IVDGR+S VTFD+FPYYLSEQTRVLLTSAA+
Sbjct  30    QNVSKWGPNYSFSSNAVTADKIEHEMLRQIVDGRESNVTFDKFPYYLSEQTRVLLTSAAY  89

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+ +K+TRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLD+TDFSLK+Q
Sbjct  90    VHLKHAEVSKYTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDLTDFSLKIQ  149

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKGI  2321
              KYG+   E SFKRS SE+TL ++S+  GSFSI   +EE K  G + RQSSG+D+ S G 
Sbjct  150   GKYGTGNKEFSFKRSTSESTLEKLSDIFGSFSIFSQREEPKVSGKMNRQSSGMDLQSMGD  209

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             E S NP  LRRN+S+++N++ LTS +  +NP PL RT+S SFDEKLLIQ+LYKVL+ VSK
Sbjct  210   EASCNPPKLRRNASSTSNISGLTSQSNPTNPAPLKRTASWSFDEKLLIQSLYKVLLSVSK  269

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
             T PIVLYLRD ++LL RS+K+Y + QKML+RLSG +LILGSR++D G+++ ELDE+L+ +
Sbjct  270   TYPIVLYLRDVDRLLSRSQKIYNMFQKMLKRLSGPILILGSRVLDSGNEFEELDEKLTVL  329

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPY+IEI+PPE+E+HLVSWKSQLEEDMKM+Q QDNKNHI EVLAAND++CDDL SIC+ D
Sbjct  330   FPYDIEIRPPEDESHLVSWKSQLEEDMKMIQVQDNKNHITEVLAANDLDCDDLDSICVED  389

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             TM LSNYIEE++VSAIS+HLM  KD EYRN KL+IS  SLSH + IF++ K + G+D  K
Sbjct  390   TMVLSNYIEEIIVSAISHHLMKNKDLEYRNGKLIISCNSLSHALGIFRKGKFS-GRDTSK  448

Query  1600  LESKAELSKETQSGEKGSKGPETKAESST-APGSKP-ETGsaapapapttkdatsSGTAV  1427
             LE +A L  E  S  +    P  KAES+  A G+ P +   A  + +     A     A 
Sbjct  449   LEDQA-LKSEIPSVVETVAKPAVKAESAAPADGAAPVKKAEAEISTSVAKAGAEKPVAAS  507

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             KA EVPPDNEFEKRIRPEVIPA EI VTF+DIGAL+E KESL ELVMLPLRRPDLF GGL
Sbjct  508   KASEVPPDNEFEKRIRPEVIPANEIDVTFSDIGALEETKESLQELVMLPLRRPDLFTGGL  567

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA+
Sbjct  568   LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAS  627

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL TK GERILVLAATNRPF
Sbjct  628   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLTTKQGERILVLAATNRPF  687

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE V K +D K+LATMT+GYTGSDLKN
Sbjct  688   DLDEAIIRRFERRIMVGLPSVENREKILRTLLSKEKVDKEIDFKELATMTDGYTGSDLKN  747

Query  706   LCTTAAYRPVRELIKQERLKDVEKKRLA--QECPNCGDAPTANEDK---------GERVI  560
             LCTTAAYRPVRELI+QERLKD++KK+ A  ++  N  +A   N++           ERVI
Sbjct  748   LCTTAAYRPVRELIQQERLKDLDKKQKATKEQNKNTQEAKEQNKNSQEAKEDEVPQERVI  807

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLNM DF EAKNQVAASF+AEG+ M EL QWN LYGEGGSRK++QL+YFL
Sbjct  808   TLRPLNMQDFKEAKNQVAASFSAEGAGMGELTQWNELYGEGGSRKQKQLSYFL  860



>ref|XP_008805644.1| PREDICTED: uncharacterized protein LOC103718546 [Phoenix dactylifera]
Length=835

 Score =  1138 bits (2944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/820 (71%), Positives = 681/820 (83%), Gaps = 16/820 (2%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV++WT    SS+ +T + +E E++  +VDGRDSKVTF+EFP+YLSEQTRV+LTS A+V
Sbjct  27    QTVNRWTAPACSSSGMTAEKIEHELMRLVVDGRDSKVTFNEFPFYLSEQTRVVLTSTAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+K+ RNLSPAS+ I+LSGPAELYQQMLAKALAHYF AKLLLLDVTDFS K+QS
Sbjct  87    HLKQADFSKYMRNLSPASQAIILSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSRKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGS+  +SSFKRSISETTL RMS  LGSFSIL  +EE KG+L RQ S VDI S+G E +
Sbjct  147   KYGSATKDSSFKRSISETTLERMSSLLGSFSILPQREEPKGSLHRQRSSVDIRSRGTESA  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S+   LRRN+SASA++++L S     NP  L RT S SFDEKLLIQALYKVL+ VSK+ P
Sbjct  207   SDIPKLRRNASASADISSLLSQCPPVNPVTLKRTGSWSFDEKLLIQALYKVLLSVSKSDP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLY+RD E LL RS+++Y L +KML++L+G VLILGSR+++   DYRE+DERL+ +FPY
Sbjct  267   IVLYIRDVENLLFRSQRMYFLFRKMLKKLTGHVLILGSRVIEMDSDYREVDERLTLLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWKSQ+EEDMK++++QDN+NHI EVLAAND++CDDLGSIC+ADT+ 
Sbjct  327   NIEIKPPEDETHLVSWKSQMEEDMKILRFQDNRNHITEVLAANDLDCDDLGSICLADTLV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LS YIEE+VVSA+SYHLMN KDPEY++ KL+IS KSLSH +NIF+E + + GKD LKLE+
Sbjct  387   LSKYIEEIVVSAVSYHLMNNKDPEYKHGKLLISPKSLSHALNIFQENELS-GKDTLKLEA  445

Query  1591  KAELSKETQSGEKG-SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAV--KA  1421
               +  KE    +   +   ETK+E+   P +K E+          + +    G+    KA
Sbjct  446   NVDRMKEAGKEDTAVATKSETKSEAP-PPENKNES--------EKSVNKDGVGSCPLPKA  496

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIRPEVIPA EIGVTF DIGALD+IKESL ELVMLPLRRPDLFKGGLLK
Sbjct  497   PEVSPDNEFEKRIRPEVIPANEIGVTFDDIGALDDIKESLQELVMLPLRRPDLFKGGLLK  556

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  557   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  616

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLTKPG RILVLAATNRPFDL
Sbjct  617   SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTKPGVRILVLAATNRPFDL  676

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E R+LIL+TLL+K+ V + LD  +LATMTEGY+GSD+KNLC
Sbjct  677   DEAIIRRFERRIMVGLPSLESRKLILRTLLSKDKVEEGLDYTELATMTEGYSGSDIKNLC  736

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
             TTAAYRPVRELI++ERLK++E+KR A    N  D      + GE  IT+RPLNM+D   A
Sbjct  737   TTAAYRPVRELIQKERLKELERKRKAG-GENPSDTSEMKVEDGEISITLRPLNMEDMRLA  795

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             K+QVAASFA EGSIM+ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  796   KSQVAASFAPEGSIMSELKQWNELYGEGGSRKKQQLTYFL  835



>ref|XP_010418460.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X2 [Camelina sativa]
Length=829

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/825 (73%), Positives = 668/825 (81%), Gaps = 32/825 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSK  2327
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S 
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGVDIKSS  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPG--PLMRTSSLSFDEKLLIQALYKVLV  2153
              IEGSSNP  LRRNSSA+AN++NL    ++SN G  PL RTSS SFDEKLL+Q+LYKVL 
Sbjct  207   SIEGSSNPPKLRRNSSAAANISNLA---SSSNQGSAPLKRTSSWSFDEKLLVQSLYKVLT  263

Query  2152  KVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDE  1976
              VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIV+   DD  E+DE
Sbjct  264   YVSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVNLSSDDAEEIDE  323

Query  1975  RLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGS  1796
             +LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL S
Sbjct  324   KLSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLES  383

Query  1795  ICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAG  1616
             I   DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K+  G
Sbjct  384   ISFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGKSG-G  442

Query  1615  KDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSG  1436
             ++ LK + K E SKE +S       PETK  S T   ++PE            K+A +  
Sbjct  443   REKLKQKPKEEQSKEAKSELAADVKPETKPGSVT---TEPE------------KEAKAEK  487

Query  1435  TAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK  1256
                KAPE  PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF 
Sbjct  488   VTPKAPEGAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFT  547

Query  1255  GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFT  1076
             GGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFT
Sbjct  548   GGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFT  607

Query  1075  LAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATN  896
             LA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATN
Sbjct  608   LASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATN  667

Query  895   RPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSD  716
             RPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGSD
Sbjct  668   RPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSD  727

Query  715   LKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMD  536
             LKNLCTTAAYRPVRELI+ ER+KD EKK+  +E    G+    +E K ERVIT+RPLN  
Sbjct  728   LKNLCTTAAYRPVRELIQHERVKDTEKKKKQRETSKAGE---EDERKEERVITLRPLNRQ  784

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             DF EAKNQVAASFAAEG  M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  785   DFKEAKNQVAASFAAEGVGMGELKQWNELYGEGGSRKKEQLTYFL  829



>gb|KDP25362.1| hypothetical protein JCGZ_20518 [Jatropha curcas]
Length=844

 Score =  1137 bits (2942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/833 (71%), Positives = 678/833 (81%), Gaps = 33/833 (4%)
 Frame = -1

Query  2845  QTVSKWTGSSS-NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             QTV KWTG  S  A+T + +EQE+L  ++DGR+S VTFD FPYYLSEQTR LLTSAA+VH
Sbjct  27    QTVGKWTGRPSLTAITAENLEQEILRLVIDGRESGVTFDHFPYYLSEQTRALLTSAAYVH  86

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK A+ +K+TRNL+PASR ILLSGPAELYQQMLAKALAHYF  KLLLLDVTDFSLK+QSK
Sbjct  87    LKHAEVSKYTRNLAPASRAILLSGPAELYQQMLAKALAHYFETKLLLLDVTDFSLKIQSK  146

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKG------------TLRRQSSG  2345
             YG++  ESS KR  SE+ L R+S F+GS SI   KEE KG            +L R+  G
Sbjct  147   YGNAMKESSLKRCPSESALERLSGFIGSLSIRSQKEEPKGMINTSLFFIYCRSLTRKLQG  206

Query  2344  VDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALY  2165
             +    +G+EGSSN   LRRN+SA+AN+NNL +  T  N G L RTSS SFDEKL IQ++Y
Sbjct  207   M----RGLEGSSNAPKLRRNASAAANINNLATQCTPINKGSLKRTSSWSFDEKLFIQSIY  262

Query  2164  KVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRE  1985
             KVLV VSK  PIVLYLRD +KLL RS+++Y L +KML +LSGSVLILGS+IVD  DD  +
Sbjct  263   KVLVYVSKASPIVLYLRDIDKLLSRSQRIYNLFKKMLEKLSGSVLILGSQIVD--DDV-D  319

Query  1984  LDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDD  1805
             LDERL ++FPYNIEI+PPE+E  LVSWKSQLE DMKM+Q QDNKNHIMEVL++ND++CDD
Sbjct  320   LDERLLALFPYNIEIRPPEDENRLVSWKSQLEADMKMIQVQDNKNHIMEVLSSNDLDCDD  379

Query  1804  LGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKT  1625
             L SICMADTM LSNYIEE+VVSA+SYHLMN KDP+YRN KL+ISSKSLSHG++IF+E K+
Sbjct  380   LDSICMADTMILSNYIEEIVVSAVSYHLMNNKDPDYRNGKLLISSKSLSHGLSIFQEGKS  439

Query  1624  AAGKDILKLESKAELSKETQSGEKGSKG--PETKAESSTAPGSKPETGsaapapapttkd  1451
                  +LKLE++AE SKE  +G   + G  PETKA  +  P SK E              
Sbjct  440   VDKDTVLKLEAQAETSKEP-AGVVETTGVKPETKAADTVKPESKTEV-------EKVASG  491

Query  1450  atsSGTAVKAP--EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPL  1277
               + G  +  P  EVPPDNEFEKRIRPEVIPA EI V+F+DIGAL+EIKESL ELVMLPL
Sbjct  492   IKTDGDILLPPTKEVPPDNEFEKRIRPEVIPANEINVSFSDIGALEEIKESLQELVMLPL  551

Query  1276  RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK  1097
             RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK
Sbjct  552   RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK  611

Query  1096  NVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERI  917
             NVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TK GERI
Sbjct  612   NVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKQGERI  671

Query  916   LVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMT  737
             LVLAATNRPFDLDEAIIRRFERRI+VGLP+PE RE+IL+TLLAKE V   LD K+LA MT
Sbjct  672   LVLAATNRPFDLDEAIIRRFERRILVGLPSPENREMILRTLLAKEKVEGGLDFKELAVMT  731

Query  736   EGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVI  560
             EG+TGSDLKNLCTTAAYRPVRELIKQER+KD+EK++ A E    G      ED K ERVI
Sbjct  732   EGFTGSDLKNLCTTAAYRPVRELIKQERMKDMEKRQKAAEAQKSGKTVDRKEDSKEERVI  791

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLNM+DF +AKNQVAASFA++GSIM+ELKQWN+LYGEGGSRK EQL+YFL
Sbjct  792   TLRPLNMEDFRQAKNQVAASFASQGSIMSELKQWNDLYGEGGSRKTEQLSYFL  844



>gb|KHM99935.1| Putative AAA domain-containing protein C24B10.10c [Glycine soja]
Length=853

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/834 (70%), Positives = 680/834 (82%), Gaps = 26/834 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V  W  +  SSNA+T + MEQEML  +VDGR+S VTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVGNWGANTFSSNAITAEKMEQEMLRQVVDGRESNVTFDKFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQS  146

Query  2491  KYGSSRN-ESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             KYG S N ESSFKRS SETTL R+S+  GSFSI   +EE K  + R SSGVD+ S G E 
Sbjct  147   KYGGSSNIESSFKRSTSETTLERLSDLFGSFSIFSQREEPKVKMNRPSSGVDLQSMGAEV  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S NP TL RN+S+S+N++ L S    +N  PL RT+S SFDEK+LI++L+KVL  VSKT 
Sbjct  207   SLNPPTLHRNASSSSNISGLASQTNPTNSVPLKRTTSWSFDEKILIESLHKVLAFVSKTY  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD ++LL +S+++Y L QKML++LSG +LILGSR++D G+DY E+DE+L+S+FP
Sbjct  267   PIVLYLRDVDRLLYKSQRIYNLFQKMLKKLSGPILILGSRVIDSGNDYEEVDEKLNSLFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+HLVSWKSQLEEDMKM+Q QDNKNHIMEVLAA D++CDDL SIC+ADTM
Sbjct  327   YNIEIRPPEDESHLVSWKSQLEEDMKMIQVQDNKNHIMEVLAATDLDCDDLDSICVADTM  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE++VSAISYHLM  KD EYRN KLVISS SLSH +NIF + K++  +D  KLE
Sbjct  387   ILSNYIEEIIVSAISYHLMKNKDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDASKLE  445

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
               A  S++ + G   +  PE K++++ AP  K E   +        + +     A KAPE
Sbjct  446   DHAVKSEQREEGT--AMKPEVKSKNA-APVKKTEAEISTSVGKAGGEKSV---PAPKAPE  499

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VP DNEFEK+IRPEVIPA EI VTF+DIGALD+ KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  500   VPLDNEFEKQIRPEVIPANEIDVTFSDIGALDDTKESLQELVMLPLRRPDLFTGGLLKPC  559

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  560   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  619

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIF+DEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDE
Sbjct  620   TIIFLDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDE  679

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMV LP+ E RE IL+TLLAKE V   L+ K+LATMTEGYTGSDLKNLCTT
Sbjct  680   AIIRRFERRIMVELPSVENREKILRTLLAKEKVDNELEFKELATMTEGYTGSDLKNLCTT  739

Query  694   AAYRPVRELIKQERLKDVEKKRLA--------QECP-------NCGDAPTANED-KGERV  563
             AAYRPVRELI+QERLK ++KK+ A        QE         N  DA    E+ K ERV
Sbjct  740   AAYRPVRELIQQERLKSLDKKQKAAKGQNKDVQESQGGQSILGNTQDAIDGEEEVKQERV  799

Query  562   ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             IT+ PLNM DF EAKNQVAASFAAEG+ M+E+KQWN+LYGEGGSRK++QL+YFL
Sbjct  800   ITLGPLNMQDFKEAKNQVAASFAAEGAGMSEMKQWNDLYGEGGSRKQQQLSYFL  853



>gb|KHF99854.1| Spastin [Gossypium arboreum]
Length=837

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/819 (71%), Positives = 679/819 (83%), Gaps = 12/819 (1%)
 Frame = -1

Query  2845  QTVSKWTGSSS---NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTVSKW G+++   + +T + +EQE++  ++DG+ SKV+FD+FPYYLSE+T+ LLTS A+
Sbjct  27    QTVSKWAGNTTIADDGITGEQIEQELMRQVIDGKLSKVSFDDFPYYLSERTQALLTSTAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             V LK +D ++HTRNLSP S+ ILLSGPAELYQQMLAKALAH+F +KLLLLD+TDFSLK+Q
Sbjct  87    VQLKHSDVSRHTRNLSPVSKAILLSGPAELYQQMLAKALAHHFESKLLLLDITDFSLKMQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG ++ E + KRSISE TL RM+   GSFS+L P+EE  GTLRR  S VDI S+ +EG
Sbjct  147   SKYGCTKKEFALKRSISEMTLERMNGLFGSFSLLSPREEANGTLRRPGSAVDIKSRAVEG  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S+N   L RN SA+++M++++S + T NP    RTSS  FD+KL +Q+LYKVLV VS+T 
Sbjct  207   SNNHPKLHRNFSAASDMSSISSASVT-NPAVHKRTSSWCFDQKLFLQSLYKVLVSVSETG  265

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD EKLL +SE++Y L QK+L +L  S LILGSR++ P DDYRE+DERLS++FP
Sbjct  266   SIILYLRDVEKLLLQSERLYNLFQKLLNKLPHSALILGSRMLGPEDDYREVDERLSALFP  325

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEIKPPE+E +L SWK++LEEDMK++Q QDN+NHI EVLAAND+ECDDLGSIC ADTM
Sbjct  326   YNIEIKPPEDENNLDSWKAKLEEDMKVLQAQDNRNHIAEVLAANDLECDDLGSICYADTM  385

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              L NYIEE+VVSAISYHLMN KDPEYRN KLVISSKSLSHG+NIF+E K+  GKD LKLE
Sbjct  386   ILGNYIEEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLNIFQEGKSC-GKDTLKLE  444

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE SKE +  E  S   E K+++  + G K ET           K    +  A KAPE
Sbjct  445   TNAESSKEKEGEEAVSAKSEPKSDAPASEG-KSET----EKSLSGVKKDGENPPAAKAPE  499

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGA+D+IKESL ELVMLPLRRPDLF GGLLKPC
Sbjct  500   VPPDNEFEKRIRPEVIPANEIGVTFADIGAMDDIKESLQELVMLPLRRPDLFNGGLLKPC  559

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+P
Sbjct  560   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAP  619

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDE
Sbjct  620   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLLTKAGERILVLAATNRPFDLDE  679

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE+IL+TLLAKE V + LD K+LATMTEGY+GSDLKNLC T
Sbjct  680   AIIRRFERRIMVGLPSIESREIILRTLLAKEKV-EDLDFKELATMTEGYSGSDLKNLCIT  738

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAK  518
             AAYRPVRELIKQER KD E+KR  +   N  DA  T +E++ ERVI +RPLNM+D  +AK
Sbjct  739   AAYRPVRELIKQERFKDQERKRREEASKNSEDASDTKDENEEERVIALRPLNMEDMRQAK  798

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFA+EGS+M ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  799   NQVAASFASEGSVMAELKQWNDLYGEGGSRKKEQLTYFL  837



>ref|XP_010418458.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X1 [Camelina sativa]
 ref|XP_010418459.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X1 [Camelina sativa]
Length=830

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/826 (73%), Positives = 668/826 (81%), Gaps = 33/826 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPS  2330
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K   GTLRRQSSGVDI S
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAAGGTLRRQSSGVDIKS  206

Query  2329  KGIEGSSNPTTlrrnssasanmnnltSYNTTSNPG--PLMRTSSLSFDEKLLIQALYKVL  2156
               IEGSSNP  LRRNSSA+AN++NL    ++SN G  PL RTSS SFDEKLL+Q+LYKVL
Sbjct  207   SSIEGSSNPPKLRRNSSAAANISNLA---SSSNQGSAPLKRTSSWSFDEKLLVQSLYKVL  263

Query  2155  VKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELD  1979
               VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIV+   DD  E+D
Sbjct  264   TYVSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVNLSSDDAEEID  323

Query  1978  ERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLG  1799
             E+LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL 
Sbjct  324   EKLSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLE  383

Query  1798  SICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
             SI   DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K+  
Sbjct  384   SISFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGKSG-  442

Query  1618  GKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsS  1439
             G++ LK + K E SKE +S       PETK  S T   ++PE            K+A + 
Sbjct  443   GREKLKQKPKEEQSKEAKSELAADVKPETKPGSVT---TEPE------------KEAKAE  487

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
                 KAPE  PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF
Sbjct  488   KVTPKAPEGAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLF  547

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
              GGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  548   TGGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALF  607

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAAT
Sbjct  608   TLASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAAT  667

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGS
Sbjct  668   NRPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGS  727

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNM  539
             DLKNLCTTAAYRPVRELI+ ER+KD EKK+  +E    G+    +E K ERVIT+RPLN 
Sbjct  728   DLKNLCTTAAYRPVRELIQHERVKDTEKKKKQRETSKAGE---EDERKEERVITLRPLNR  784

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              DF EAKNQVAASFAAEG  M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  785   QDFKEAKNQVAASFAAEGVGMGELKQWNELYGEGGSRKKEQLTYFL  830



>ref|XP_010915762.1| PREDICTED: lon protease homolog, mitochondrial isoform X2 [Elaeis 
guineensis]
Length=825

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/820 (71%), Positives = 678/820 (83%), Gaps = 24/820 (3%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVS+WT    SS+ +  + +E E++  +VDGRDSK+TF+EFP+YLSEQTRV+LTSAA+V
Sbjct  25    QTVSRWTAPARSSSGMLAEKIEHELMRLVVDGRDSKITFNEFPFYLSEQTRVVLTSAAYV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+K+ RNLSPAS+ I+LSGPAELYQQMLAKALAHYF AKLLLLDVT FSLK+QS
Sbjct  85    HLKQADFSKYMRNLSPASQAIILSGPAELYQQMLAKALAHYFEAKLLLLDVTAFSLKIQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGS+  ++SFKRSISETTL RMS  LGSFSIL  +EE KG+L RQ+S ++I S+G E +
Sbjct  145   KYGSATKDASFKRSISETTLERMSSLLGSFSILPQREEPKGSLHRQTSSLEIRSRGSEST  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S+   LRRN+SASA+M++L S     NP  L R+ S SFDEKLLIQALYKVL+ VSK+ P
Sbjct  205   SDIPKLRRNASASADMSSLLSQCPPVNPVTLKRSGSWSFDEKLLIQALYKVLLSVSKSDP  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD E LL RS+++Y L +KML++L+G VLILGSR+++   DYRE+DERL+ +FPY
Sbjct  265   IILYIRDIENLLFRSQRMYSLFRKMLKKLTGPVLILGSRVIEVDSDYREVDERLTLLFPY  324

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIK PE+ET LVSWKSQ+EEDMK++++QDN+NHI EVLAAND++CDDLGSIC+ADTM 
Sbjct  325   NIEIKQPEDETKLVSWKSQIEEDMKILRFQDNRNHITEVLAANDLDCDDLGSICLADTMV  384

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LS YIEE+VVSA+SYHLMN KDPEYRN KLVISSKSLSH +NIF+E + + GKD LKLE+
Sbjct  385   LSKYIEEIVVSAVSYHLMNNKDPEYRNEKLVISSKSLSHALNIFQENELS-GKDTLKLEA  443

Query  1591  KAELSKETQSGEKGSKGPETKAESST---APGSKPETGsaapapapttkdatsSGTAVKA  1421
               E  K  ++G++      TK+E+ +    P +K E+                  +  K 
Sbjct  444   NVEPMK--KAGKEEDTAVSTKSETKSEALPPENKSES----------------EKSVQKD  485

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
              EV PDNEFEKRIRPEVIPA EIGVTF DIGALD+IKESL ELVMLPLRRPDLFKGGLLK
Sbjct  486   GEVAPDNEFEKRIRPEVIPANEIGVTFDDIGALDDIKESLQELVMLPLRRPDLFKGGLLK  545

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  546   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  605

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLLTKP  RILVLAATNRPFDL
Sbjct  606   SPTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLTKPEVRILVLAATNRPFDL  665

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELIL+TLL+KE V + LD K+LATMTEGY+GSDLKNLC
Sbjct  666   DEAIIRRFERRIMVGLPSLESRELILRTLLSKEKVKEGLDYKELATMTEGYSGSDLKNLC  725

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
             TTAAYRPVRELI++ERLK++E K+ A    N  D      + GE  IT+RPLNM+D  +A
Sbjct  726   TTAAYRPVRELIQKERLKELETKQKAGGGENPSDTSETKVEDGEISITLRPLNMEDMRQA  785

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             K+QVAASFA EGSIM+ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  786   KSQVAASFAPEGSIMSELKQWNELYGEGGSRKKQQLTYFL  825



>ref|XP_010430529.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Camelina 
sativa]
Length=828

 Score =  1136 bits (2939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/825 (72%), Positives = 669/825 (81%), Gaps = 33/825 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSASSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSK  2327
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S 
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGVDIKSS  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPG--PLMRTSSLSFDEKLLIQALYKVLV  2153
              +EGSSNP  LRRNSSA+AN++NL    ++SN G  PL RTSS SFDEKLL+Q+LYKVL 
Sbjct  207   SMEGSSNPPKLRRNSSAAANISNLA---SSSNQGSAPLKRTSSWSFDEKLLVQSLYKVLA  263

Query  2152  KVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDE  1976
              VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D  E+DE
Sbjct  264   YVSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAEEIDE  323

Query  1975  RLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGS  1796
             +LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL S
Sbjct  324   KLSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLES  383

Query  1795  ICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAG  1616
             I   DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K+  G
Sbjct  384   ISFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGKSG-G  442

Query  1615  KDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSG  1436
             ++ LK ++K E SKE +S       PETK  S T   ++PE            K+A +  
Sbjct  443   REKLKQKTKDEQSKEAKSELAADVKPETKPGSVT---TEPE------------KEAKAEK  487

Query  1435  TAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK  1256
                KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF 
Sbjct  488   VTPKAPEVAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFT  547

Query  1255  GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFT  1076
             GGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFT
Sbjct  548   GGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFT  607

Query  1075  LAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATN  896
             LA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATN
Sbjct  608   LASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATN  667

Query  895   RPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSD  716
             RPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGSD
Sbjct  668   RPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSD  727

Query  715   LKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMD  536
             LKNLCTTAAYRPVRELI+ ER+KD EKK+  +E    G+     ED   RVIT+RPLN  
Sbjct  728   LKNLCTTAAYRPVRELIQHERVKDTEKKK-QRETLRAGEEDEGKED---RVITLRPLNRQ  783

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             DF EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  784   DFKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  828



>emb|CDY08360.1| BnaC09g12360D [Brassica napus]
Length=831

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/823 (72%), Positives = 670/823 (81%), Gaps = 26/823 (3%)
 Frame = -1

Query  2845  QTVSKW-TG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW TG  +SSNAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWATGNSTSSNAVTADKMEKEVLRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSG+DI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGMDIKSSP  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
             +EGSSNP+ LRRNSSA+   N  +S N+     PL RTSS SFDEKLLIQ+LYKVL  VS
Sbjct  207   MEGSSNPSKLRRNSSAANISNLASSSNSA----PLKRTSSWSFDEKLLIQSLYKVLTYVS  262

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERLS  1967
             K  PIVLYLRD E LL RS++ Y L QK+L++LSG VLILGSRI+D   +D  E+DE+LS
Sbjct  263   KANPIVLYLRDIENLLFRSQRTYNLFQKLLQKLSGPVLILGSRIMDLSSEDAHEIDEKLS  322

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             +VFPYNI+I+PP++ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI  
Sbjct  323   AVFPYNIDIRPPDDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESISF  382

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
              DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A+G++ 
Sbjct  383   EDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGK-ASGREK  441

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAES-STAPGSKPETGsaapapapttkdatsSGTA  1430
             LK  +K + SKE ++    +  P+TK ES +TA  SK E            +  +     
Sbjct  442   LKQTAKEDKSKEPKAELAAAVKPDTKPESITTASSSKTEP---------EKETKSEKAAT  492

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KA EVPPDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF GG
Sbjct  493   PKAAEVPPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTGG  552

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  553   LLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLA  612

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             +KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNRP
Sbjct  613   SKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNRP  672

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE ILKTLLAKE V + LD K+L+ MTEGYTGSDLK
Sbjct  673   FDLDEAIIRRFERRIMVGLPSVENREKILKTLLAKEKVDENLDYKELSMMTEGYTGSDLK  732

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLCTTAAYRPVRELI+QER+KD EKK+  +      D    +E K ER+IT+RPLN  DF
Sbjct  733   NLCTTAAYRPVRELIQQERIKDTEKKKQRETTKTSED----DEGKEERIITLRPLNRQDF  788

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  789   KEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  831



>ref|XP_010251600.1| PREDICTED: uncharacterized protein LOC104593453 isoform X2 [Nelumbo 
nucifera]
Length=785

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/774 (74%), Positives = 652/774 (84%), Gaps = 5/774 (1%)
 Frame = -1

Query  2722  YYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFG  2543
             Y  +EQTRVLLTSAA++HLK A+F K+TRNLSPASRTILLSGPAE+YQQMLAKALAHYF 
Sbjct  17    YLPNEQTRVLLTSAAYMHLKEANFCKYTRNLSPASRTILLSGPAEMYQQMLAKALAHYFE  76

Query  2542  AKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTL  2363
             AKLLLLDVTDFSLK+QSKYG+   +SS KRSISET L RMS   GSFSIL  +E+ KG L
Sbjct  77    AKLLLLDVTDFSLKIQSKYGTGNKQSSLKRSISETALERMSSLFGSFSILPQREDTKGKL  136

Query  2362  RRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKL  2183
              RQSS +DI S+G EGS+N +    N+S +A+++   S  T+ N   L RTSS +FD+KL
Sbjct  137   WRQSSALDIRSRGTEGSNNTSKHHGNASVAADISRPASQCTSVNSASLKRTSSWAFDDKL  196

Query  2182  LIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDP  2003
             L+++LYKVLV VSKT   VLYLRD EKLL RS+ +Y L QKM ++LSG VLILGSRI+DP
Sbjct  197   LLRSLYKVLVSVSKTSATVLYLRDVEKLLFRSQGIYTLFQKMFKQLSGPVLILGSRILDP  256

Query  2002  GDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAAN  1823
             G+DY E+DERL+ +FPYNI IKPPE+E+HLVSWK+QLEEDMKM+QYQDN+NHI EVLAAN
Sbjct  257   GNDYGEVDERLTLLFPYNIVIKPPEDESHLVSWKTQLEEDMKMIQYQDNRNHITEVLAAN  316

Query  1822  DIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNI  1643
             D+ECDDLGSIC+ADTM LSNYIEE++VSAISYHLMN KDPEYRN KLVISSKSLSHG++I
Sbjct  317   DLECDDLGSICLADTMVLSNYIEEIIVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLSI  376

Query  1642  FKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapap  1463
             F++ ++  GKD LKLE+ AE  K+ +  E     PE+K E+  A  +K E   +AP    
Sbjct  377   FQDGESN-GKDTLKLEANAEPDKDPEGDEISGLKPESKVETLAAE-NKSEADKSAPVVKK  434

Query  1462  ttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVML  1283
               +++       KA EVPPDNEFEKRIRPEVIPA +IGVTF+DIGALDE+KESL ELVML
Sbjct  435   DGENS---SAPAKASEVPPDNEFEKRIRPEVIPASDIGVTFSDIGALDEVKESLQELVML  491

Query  1282  PLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGED  1103
             PLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGED
Sbjct  492   PLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGED  551

Query  1102  EKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGE  923
             EKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGE
Sbjct  552   EKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGE  611

Query  922   RILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLAT  743
             RILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE+IL+TLLAKE V + LD K+LA 
Sbjct  612   RILVLAATNRPFDLDEAIIRRFERRIMVGLPSAENREMILRTLLAKEKVEEGLDFKELAN  671

Query  742   MTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERV  563
             MTEGY+GSDLKNLCTTAAYRPVRELI+QE+LKD+E+K  A+   +   + T  E K ERV
Sbjct  672   MTEGYSGSDLKNLCTTAAYRPVRELIQQEKLKDLERKHKAEGQNSEEASDTKEEGKEERV  731

Query  562   ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             IT+RPLNM+D  +AKNQVAASFAAEGSIM ELKQWN LYGEGGSRKK+QL+YFL
Sbjct  732   ITLRPLNMEDMRQAKNQVAASFAAEGSIMGELKQWNELYGEGGSRKKQQLSYFL  785



>ref|XP_008810933.1| PREDICTED: uncharacterized protein LOC103722235 isoform X2 [Phoenix 
dactylifera]
Length=838

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/817 (71%), Positives = 680/817 (83%), Gaps = 7/817 (1%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV KW    SSS  VT + +E+E++  +VDGR+SKVTFDEFPYYLSE+TR LLTSAA+V
Sbjct  27    QTVGKWAAPASSSAGVTAENVEKELMRMVVDGRESKVTFDEFPYYLSEKTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +K+TRNLSPASR ILLSGPAELYQQ++AKALAH+F AKLLLLDVTDFSLKVQS
Sbjct  87    HLKQVDLSKYTRNLSPASRAILLSGPAELYQQIIAKALAHFFEAKLLLLDVTDFSLKVQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGSS  +S F+RS+SE TL RMS FLGS SIL  +EE KG+LRRQSS V++  +G + +
Sbjct  147   KYGSSNKDSFFRRSVSEATLERMSSFLGSLSILLQREEPKGSLRRQSSCVELRPRGSDSN  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S  + + +N+S SA+++ LTS     NP PL RTSS SFDEK+L+Q+LYKVLV VSK  P
Sbjct  207   SYTSKIHKNASVSADISGLTSQCAPINPVPLKRTSSWSFDEKILLQSLYKVLVSVSKINP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLY+RD E LL RS+++Y L QKML++LSG VLILGSR+++   DY ++D R+SS+FPY
Sbjct  267   IVLYIRDVENLLYRSQRIYSLFQKMLKKLSGPVLILGSRLLESDCDYSDMDGRVSSLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PP++ET LV+WKSQLEEDM+M+Q QDNKNHI EVLA ND+ECDDLGSIC+ADT  
Sbjct  327   NIEIRPPDDETRLVNWKSQLEEDMRMIQIQDNKNHIAEVLAENDLECDDLGSICLADTTV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSA+SY+LMN K PEYRN KLVISSKSLSH ++IF+E + ++ +D LKLE+
Sbjct  387   LSNYIEEIVVSAVSYNLMNNKVPEYRNGKLVISSKSLSHALSIFQEGRHSS-EDTLKLEA  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              AE  KET   E G+     K E S A  S PE  S A  PA   KDA SS    K PEV
Sbjct  446   NAESGKETVD-EDGAAVAAAKPEVS-AEVSPPEKKSEAEKPASAVKDAESSSLPPKTPEV  503

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
              PDNEFEKRIR EVIPA EIGVTF DIGALDEIKESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  504   APDNEFEKRIRQEVIPASEIGVTFNDIGALDEIKESLQELVMLPLRRPDLFTGGLLKPCR  563

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+PT
Sbjct  564   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAPT  623

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  624   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKSGERILVLAATNRPFDLDEA  683

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RELIL+ LL+KE V + LD K+LATMTEGY+GSDLKNLC TA
Sbjct  684   IIRRFERRIMVGLPSVESRELILRKLLSKEKVEE-LDYKELATMTEGYSGSDLKNLCVTA  742

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQ  512
             AYRPVRELI++ERLK++EK++ A+E  +  ++    E+ GE+ +T+RPLNM+D  +AKNQ
Sbjct  743   AYRPVRELIQRERLKELEKRK-AEEGDSLAESSENKEEDGEQTLTLRPLNMEDLRQAKNQ  801

Query  511   VAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             VAASFA EGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  802   VAASFAGEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  838



>emb|CDY38192.1| BnaA09g11970D [Brassica napus]
Length=831

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/823 (72%), Positives = 668/823 (81%), Gaps = 26/823 (3%)
 Frame = -1

Query  2845  QTVSKW-TG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW TG  +SSN VT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWATGNSTSSNTVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSG+DI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGMDIKSSP  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
             +EGSSNP+ LRRNSSA+   N  +S N+     PL RTSS SFDEKLLIQ+LYKVL  VS
Sbjct  207   MEGSSNPSKLRRNSSAANISNLASSSNSA----PLKRTSSWSFDEKLLIQSLYKVLTYVS  262

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERLS  1967
             K  PIVLYLRD E LL RS++ Y L QK+L++LSG VLILGSRIVD   +D  E+DE+LS
Sbjct  263   KANPIVLYLRDIENLLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAHEIDEKLS  322

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             +VFPYNI+I+PP++ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI  
Sbjct  323   AVFPYNIDIRPPDDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESISF  382

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
              DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A+G++ 
Sbjct  383   EDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGK-ASGREK  441

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAES-STAPGSKPETGsaapapapttkdatsSGTA  1430
             LK  +K + SKE ++    +  P+TK ES +TA  SK E            +  +     
Sbjct  442   LKQNAKEDKSKEPKAELAAAVKPDTKPESITTASSSKAEP---------EKEAKSEKAAT  492

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF GG
Sbjct  493   PKAPEVAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTGG  552

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  553   LLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLA  612

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             +KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNRP
Sbjct  613   SKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNRP  672

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRI+VGLP  E RE ILKTLLAKE V + LD K+L+ MTEGYTGSDLK
Sbjct  673   FDLDEAIIRRFERRILVGLPGVENREKILKTLLAKEEVDENLDYKELSMMTEGYTGSDLK  732

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLCTTAAYRPVRELI+QER+KD EKK+  +      D    +E K ER+IT+RPLN  DF
Sbjct  733   NLCTTAAYRPVRELIQQERIKDTEKKKQREATKTSED----DEGKEERIITLRPLNRQDF  788

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  789   KEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  831



>ref|XP_006584739.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
isoform X4 [Glycine max]
Length=807

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/813 (71%), Positives = 667/813 (82%), Gaps = 22/813 (3%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             MEQEML  +VDGR+S  TFD+FPYYLSEQTRVLLTSAA+VHLK A+ +K+TRNL+PASRT
Sbjct  1     MEQEMLRQVVDGRESNATFDKFPYYLSEQTRVLLTSAAYVHLKHAEVSKYTRNLAPASRT  60

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QSKYG S  ESSF+RS SETTL
Sbjct  61    ILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQSKYGFSNMESSFRRSTSETTL  120

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
              R+S+  GSFSI   +EE KG + R SSGVD+ S G E S NP  LRRN+S+S+N++ L 
Sbjct  121   ERLSDLFGSFSIFSQREEPKGKMNRPSSGVDLQSMGAEASCNPPILRRNASSSSNISGLA  180

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
             S    +N  PL RT+S SFDEKLLIQ+LYKVL  VSKT PIVLYLRD ++LL +S+++Y 
Sbjct  181   SQTYPTNSVPLKRTTSWSFDEKLLIQSLYKVLAFVSKTYPIVLYLRDVDRLLYKSQRIYN  240

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             L QKML++LSG VLILGSR++D G+DY E+DE+++S+FPYNIEI+PPE+E+HLVSWKSQL
Sbjct  241   LFQKMLKKLSGPVLILGSRVIDSGNDYEEVDEKINSLFPYNIEIRPPEDESHLVSWKSQL  300

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNT  1712
             EED+KM+Q QDNKNHIMEVLAAND++CDDL SIC++DTM LSNYIEE++VSAISYHLM  
Sbjct  301   EEDLKMIQVQDNKNHIMEVLAANDLDCDDLDSICVSDTMVLSNYIEEIIVSAISYHLMKN  360

Query  1711  KDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPET  1532
             KD EYRN KLVISS SLSH +NIF + K++  +D  KLE +A +  E Q  E  +  PE 
Sbjct  361   KDTEYRNGKLVISSNSLSHALNIFHKGKSSR-RDTSKLEDQA-VKSEKQIEEGTAMKPEA  418

Query  1531  KAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEI  1352
             K+E++ AP  K E  + +       + +     A KA EVPPDNEFEKRIRPEVI A EI
Sbjct  419   KSENA-APVKKAEAETLSSVGKTDGEKSV---PAPKAAEVPPDNEFEKRIRPEVILANEI  474

Query  1351  GVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  1172
              VTF+DIGALDE KESL ELVMLPLRRPDLF GGLLKPCRGILLFGPPGTGKTMLAKAIA
Sbjct  475   DVTFSDIGALDETKESLQELVMLPLRRPDLFTGGLLKPCRGILLFGPPGTGKTMLAKAIA  534

Query  1171  KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEH  992
             KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEH
Sbjct  535   KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEH  594

Query  991   EAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRE  812
             EAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE
Sbjct  595   EAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVENRE  654

Query  811   LILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKK  632
              IL+TLLAKE V   L+ K++ATMTEGYTGSDLKNLCTTAAYRPVRELI+QER+K ++KK
Sbjct  655   KILRTLLAKEKVDNELEFKEIATMTEGYTGSDLKNLCTTAAYRPVRELIQQERIKSLDKK  714

Query  631   RLAQECPN-----------CGDAPTA----NEDKGERV-ITIRPLNMDDFMEAKNQVAAS  500
             + A    N            G+   A     E K ERV IT+RPLNM DF EAKNQVAAS
Sbjct  715   QKASRGQNKDVQESRGQSVVGNTQDALDEEEEVKQERVIITLRPLNMQDFKEAKNQVAAS  774

Query  499   FAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             FAAEG+ M ELKQWN+LYGEGGSRK++QL+YFL
Sbjct  775   FAAEGAGMGELKQWNDLYGEGGSRKQQQLSYFL  807



>ref|XP_010917020.1| PREDICTED: uncharacterized protein LOC105041713 isoform X1 [Elaeis 
guineensis]
Length=842

 Score =  1132 bits (2929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/820 (70%), Positives = 677/820 (83%), Gaps = 9/820 (1%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKW    SSS  VT + +E+E++  +VDGR+ KVTFDEFPYYLSEQTR LLTSAA+V
Sbjct  27    QTVSKWAAPASSSAGVTAENIEKELMRMVVDGREGKVTFDEFPYYLSEQTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK AD +K TRNLSPAS+ ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKQADLSKFTRNLSPASQAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPSKGI  2321
             KYGSS  +S F+RS+SE TL RMS  LGSFSIL  +EE +   G+L RQ+S V++  +G 
Sbjct  147   KYGSSNKDSFFRRSVSEATLERMSSLLGSFSILAQREEPRVIAGSLHRQNSCVELRPRGS  206

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             + +S  T L +N+S SA+M+ LTS     NP PL R+SS SFDEK+L+Q+LYKVLV VSK
Sbjct  207   DSNSYMTKLHKNASVSADMHGLTSQCAPINPVPLKRSSSWSFDEKILLQSLYKVLVSVSK  266

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
             + P+VLY+RD E LL RS+++Y L QKML++L G VLILGSR+++   DYR++D R+ ++
Sbjct  267   SNPVVLYIRDVENLLYRSQRIYSLFQKMLKKLPGPVLILGSRLLESDGDYRDMDGRVGNL  326

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPYNIEIKPPE+ETHLVSWKSQLEEDM+M+Q QDN+NHI  VLA ND+ECDDLGSIC+ D
Sbjct  327   FPYNIEIKPPEDETHLVSWKSQLEEDMRMIQIQDNRNHITGVLAENDLECDDLGSICLVD  386

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             T+ LSNYIEE+VVSA+SYHLMN K+PEYRN KL+ISSKSLSHG++IF+E + + G+D LK
Sbjct  387   TVVLSNYIEEIVVSAVSYHLMNNKEPEYRNGKLIISSKSLSHGLSIFQESRRS-GEDTLK  445

Query  1600  LESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             LE+  E  KET   E G+     K E S A  S PE  S A  PA   KDA  S    K 
Sbjct  446   LEANVESGKETVD-EDGAAAAVAKPEVS-AEASPPEKKSEAEKPASAVKDADGSSLPPKT  503

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIR EVIPA EIGVTF DIGALDE+KESL ELVMLPLRRPDLF GGLLK
Sbjct  504   PEVAPDNEFEKRIRQEVIPASEIGVTFNDIGALDEVKESLQELVMLPLRRPDLFTGGLLK  563

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMST+TSKWFGEDEKNVRALFTLAAKV
Sbjct  564   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTVTSKWFGEDEKNVRALFTLAAKV  623

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             +PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM HWDGLLTK GERILVLAATNRPFDL
Sbjct  624   APTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMMHWDGLLTKSGERILVLAATNRPFDL  683

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELIL+ LL+KE V + LD +++AT TEGY+GSDLKNLC
Sbjct  684   DEAIIRRFERRIMVGLPSVESRELILRKLLSKEKVEE-LDYREIATTTEGYSGSDLKNLC  742

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
              TAAYRPVRELI++ERLK++EKK+ A+E  +  ++    E+ GE+ +T+RPLNM+D  +A
Sbjct  743   VTAAYRPVRELIQRERLKELEKKQKAEEGDSSAESSENREEDGEQTVTLRPLNMEDLRQA  802

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFA +GS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  803   KNQVAASFACDGSVMSELKQWNDLYGEGGSRKKQQLSYFL  842



>ref|XP_011003670.1| PREDICTED: peroxisome biosynthesis protein PAS1-like [Populus 
euphratica]
 ref|XP_011003671.1| PREDICTED: peroxisome biosynthesis protein PAS1-like [Populus 
euphratica]
Length=809

 Score =  1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/819 (70%), Positives = 665/819 (81%), Gaps = 38/819 (5%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VS+W G   S + VTV+ +EQE++  ++DGR+S+VTFDEFPYYLSE+ R+LLTSAAFV
Sbjct  25    QKVSRWAGGNGSVDGVTVEQIEQELMRQVLDGRESEVTFDEFPYYLSEKIRMLLTSAAFV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+KHTRNLSPASRTILLSGPAE Y QMLAKALA  F +KLLLLDV DFS+K+QS
Sbjct  85    HLKHADFSKHTRNLSPASRTILLSGPAEFYHQMLAKALACNFESKLLLLDVHDFSIKMQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + E SF  SIS  TL RMS   GSFSIL  KEE               ++G+EGS
Sbjct  145   KYGCIKKEPSFTSSISGFTLERMSSLFGSFSILSTKEE---------------TRGMEGS  189

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +NP  LRRN+S +++M+++ S + ++NP PL  +S+  FDEKL +Q+LY+VL  VS+   
Sbjct  190   NNPPKLRRNASTASDMSSIASQSASTNPAPLKHSSTWWFDEKLFLQSLYQVLASVSERNS  249

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LYLRDAEKLL +S+++Y L +KML++L G+VLILGSR++D  DD RE+DERL+ +FPY
Sbjct  250   IILYLRDAEKLLLQSQRMYTLFEKMLKKLPGNVLILGSRMLDQEDDCREVDERLALLFPY  309

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWK+QLEEDMK +Q+QDNKNHI EVLAANDIECDDL SIC ADTM 
Sbjct  310   NIEIKPPEDETHLVSWKAQLEEDMKKIQFQDNKNHIAEVLAANDIECDDLSSICHADTMV  369

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN KDPEYRN KLVISSKSLSHG++IF+E K+  GKD LKLE+
Sbjct  370   LSNYIEEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLSIFQEGKSD-GKDTLKLET  428

Query  1591  KAELSKETQSGEKGSKGPETKAESS-TAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
              A+  KET+  E      + K+E+  +  G+K ++ +                   K PE
Sbjct  429   SADAGKETEGEEAVGAKNDIKSETEKSVTGAKKDSENQP-----------------KTPE  471

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  472   VPPDNEFEKRIRPEVIPANEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPC  531

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  532   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  591

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDLDE
Sbjct  592   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDLDE  651

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE ILKTLL+KE   + LD K+LATMTEGY+GSDLKNLC  
Sbjct  652   AIIRRFERRIMVGLPSIESRERILKTLLSKEKT-EGLDFKELATMTEGYSGSDLKNLCVA  710

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAK  518
             AAYRPVREL++QER+KD EKK+ A+E  +  DA  T  E K E VI +RPLNMDD  +AK
Sbjct  711   AAYRPVRELLQQERVKDKEKKQKAEEGTSSDDAADTKEEGKEESVIILRPLNMDDMRQAK  770

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFA EGS+MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  771   NQVAASFATEGSVMNELKQWNELYGEGGSRKKQQLTYFL  809



>ref|XP_009112803.1| PREDICTED: peroxisome biosynthesis protein PAS1 [Brassica rapa]
 ref|XP_009112805.1| PREDICTED: peroxisome biosynthesis protein PAS1 [Brassica rapa]
 ref|XP_009112806.1| PREDICTED: peroxisome biosynthesis protein PAS1 [Brassica rapa]
Length=831

 Score =  1132 bits (2928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/824 (72%), Positives = 668/824 (81%), Gaps = 28/824 (3%)
 Frame = -1

Query  2845  QTVSKW-TG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW TG  +SSNAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWATGNSTSSNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSG+DI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGMDIKSSP  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
             +EGSSNP+ LRRNSSA+   N  +S N+     PL RTSS SFDEKLLIQ+LYKVL  VS
Sbjct  207   MEGSSNPSKLRRNSSAANISNLASSSNSA----PLKRTSSWSFDEKLLIQSLYKVLTYVS  262

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERLS  1967
             K  PIVLYLRD E LL RS++ Y L QK+L++LSG VLILGSRIVD   +D  E+DE+LS
Sbjct  263   KANPIVLYLRDIENLLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAHEIDEKLS  322

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             +VFPYNI+I+PP++ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI  
Sbjct  323   AVFPYNIDIRPPDDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESISF  382

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
              DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A+G++ 
Sbjct  383   EDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGK-ASGREK  441

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPET--GsaapapapttkdatsSGT  1433
             LK   K + SKE          P+ +  ++  P SKPE+   +++    P  +  +    
Sbjct  442   LKQNVKEDTSKE----------PKAELAAAVKPDSKPESVIAASSSKTEPEKEAKSEKAA  491

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
               KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF G
Sbjct  492   TPKAPEVAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTG  551

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  552   GLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTL  611

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  612   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  671

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRI+VGLP  E RE ILKTLLAKE V + LD K+L+ MTEGYTGSDL
Sbjct  672   PFDLDEAIIRRFERRILVGLPGVENREKILKTLLAKEEVDENLDYKELSMMTEGYTGSDL  731

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             KNLCTTAAYRPVRELI+QER+KD EKK+  +      D    +E K ER+IT+RPLN  D
Sbjct  732   KNLCTTAAYRPVRELIQQERIKDTEKKKQREATKTSED----DEGKEERIITLRPLNRQD  787

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             F EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  788   FKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  831



>ref|XP_010418462.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like isoform 
X4 [Camelina sativa]
Length=828

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/826 (72%), Positives = 668/826 (81%), Gaps = 35/826 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPS  2330
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K   GTLRRQSSGVDI S
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAAGGTLRRQSSGVDIKS  206

Query  2329  KGIEGSSNPTTlrrnssasanmnnltSYNTTSNPG--PLMRTSSLSFDEKLLIQALYKVL  2156
               IEGSSNP  LRRNSSA+AN++NL    ++SN G  PL RTSS SFDEKLL+Q+LYKVL
Sbjct  207   SSIEGSSNPPKLRRNSSAAANISNLA---SSSNQGSAPLKRTSSWSFDEKLLVQSLYKVL  263

Query  2155  VKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELD  1979
               VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIV+   DD  E+D
Sbjct  264   TYVSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVNLSSDDAEEID  323

Query  1978  ERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLG  1799
             E+LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL 
Sbjct  324   EKLSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLE  383

Query  1798  SICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
             SI   DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K+  
Sbjct  384   SISFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSTSLSHGFSLFREGKSG-  442

Query  1618  GKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsS  1439
             G++ LK + K E SKE +S       PETK  S T   ++PE            K+A + 
Sbjct  443   GREKLKQKPKEEQSKEAKSELAADVKPETKPGSVT---TEPE------------KEAKAE  487

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
                 KAPE  PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF
Sbjct  488   KVTPKAPEGAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLF  547

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
              GGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  548   TGGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALF  607

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAAT
Sbjct  608   TLASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAAT  667

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGS
Sbjct  668   NRPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGS  727

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNM  539
             DLKNLCTTAAYRPVRELI+ ER+KD +KK+  +E    G+    +E K ERVIT+RPLN 
Sbjct  728   DLKNLCTTAAYRPVRELIQHERVKDTKKKQ--RETSKAGE---EDERKEERVITLRPLNR  782

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              DF EAKNQVAASFAAEG  M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  783   QDFKEAKNQVAASFAAEGVGMGELKQWNELYGEGGSRKKEQLTYFL  828



>ref|XP_009409439.1| PREDICTED: peroxisome biosynthesis protein PAS1 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=839

 Score =  1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/821 (71%), Positives = 673/821 (82%), Gaps = 14/821 (2%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTVS+W      S + VT + +EQE+   +V+G+DSKVTFD+FPYYLSEQTRV+LTSAA+
Sbjct  27    QTVSRWAAPQPGSFSGVTCENIEQELKRLVVEGKDSKVTFDQFPYYLSEQTRVILTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK ADF+K+TRNLSPASR IL+SGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+Q
Sbjct  87    VHLKQADFSKYTRNLSPASRAILVSGPAELYQQMLAKALAHYFEAKLLLLDITDFSLKIQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGT--LRRQSSGVDIPSKGI  2321
             SKYGS+  +S+FKRSISETTL RMS   GS SI+  +EE K T  L RQSSG +I ++  
Sbjct  147   SKYGSAPKDSTFKRSISETTLERMSGLFGSLSIMPQREEPKVTRNLHRQSSGFEINARS-  205

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             E +SN   LRRN+SASA+M+ L +     NP  L RT S SFDEKLL+Q+LYKVL  +SK
Sbjct  206   ESTSNAPKLRRNASASADMSCLGTQCPPLNPALLKRTISWSFDEKLLVQSLYKVLHSISK  265

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
               PIVLYLRD + LL  S+++Y L +K+L+R+SG VLILGSR V+ G D+RE+DE+LS +
Sbjct  266   NSPIVLYLRDVDSLLFISKRMYSLFEKLLKRISGQVLILGSRKVEAGSDFREVDEKLSLL  325

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPYNIEIKPPE+ETHLVSWK+QLEEDMKM+Q+QDN+NHI EVLA ND++CDDLGSIC+ D
Sbjct  326   FPYNIEIKPPEDETHLVSWKAQLEEDMKMIQFQDNRNHITEVLARNDLDCDDLGSICLTD  385

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             TM LS YIEE+VVSAISYHLMN  DPEYRN KLVISSKSLSH ++IF+E K  A K   +
Sbjct  386   TMVLSKYIEEIVVSAISYHLMNNTDPEYRNGKLVISSKSLSHALSIFQENKLNA-KGTAQ  444

Query  1600  LESKAELSKET-QSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
             LE  A+  KE+ +     +K  ETK E+S  P SK E   + P     +          K
Sbjct  445   LEGSADSMKESGKEDSTSAKKSETKTEAS-PPESKTELDKSVPVVKKDSVVP---SQPPK  500

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             APEV PDNEFEKRIRPEVIPA EIGVTF DIGALD+IKESL ELVMLPLRRPDLFKGGLL
Sbjct  501   APEVAPDNEFEKRIRPEVIPASEIGVTFDDIGALDDIKESLQELVMLPLRRPDLFKGGLL  560

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK
Sbjct  561   KPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  620

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTI+FVDEVDSMLGQRSR GEHEAMRKIKNEFM+HWDGLLTKP ERILVLAATNRPFD
Sbjct  621   VSPTIVFVDEVDSMLGQRSRVGEHEAMRKIKNEFMTHWDGLLTKPEERILVLAATNRPFD  680

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RELIL+TLL+KE V + LD K+LATMTEGY+GSDLKNL
Sbjct  681   LDEAIIRRFERRIMVGLPSQESRELILRTLLSKEKVEEKLDFKELATMTEGYSGSDLKNL  740

Query  703   CTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFME  524
             CTTAAYRPVRELI++ERLK++E+K+ A++  N  +A     +  E  I +RPLNM+D  +
Sbjct  741   CTTAAYRPVRELIQKERLKELERKKKAED--NQAEASETKAEDREETIVLRPLNMEDMKQ  798

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFAAEGSIM+ELKQWN LYG+GGSRKK+QLTYFL
Sbjct  799   AKNQVAASFAAEGSIMSELKQWNELYGDGGSRKKQQLTYFL  839



>ref|XP_004503659.1| PREDICTED: fidgetin-like protein 1-like [Cicer arietinum]
Length=852

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/831 (70%), Positives = 671/831 (81%), Gaps = 21/831 (3%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q+VSKW  +    SNAVT D  E EML  +VDGR+S VTFD+FPYYLSEQTRVLLTSAA+
Sbjct  27    QSVSKWGPNYSFPSNAVTADKFEHEMLRQVVDGRESNVTFDKFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+Q
Sbjct  87    VHLKHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFEAKLLLLDLTDFSLKIQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYGS   E SFKRS SE+TL ++S+  GSFSI   +EE KG + RQSSG+D+ S G E 
Sbjct  147   SKYGSGNKEYSFKRSTSESTLEKLSDLFGSFSIFPQREEPKGKMHRQSSGMDLQSMGGEA  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S NP  LRRN+S+S+N++ LT  + ++N  PL RTSS SFDEKLLIQ+LYKVL+ VSK  
Sbjct  207   SCNPPKLRRNASSSSNISGLTLQSNSTNSAPLKRTSSWSFDEKLLIQSLYKVLLSVSKRD  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD ++LLCRS+++Y + QKML++LSG +LILGSR++D G ++ E+DE+L+ +FP
Sbjct  267   PIVLYLRDVDRLLCRSQQIYNMFQKMLKKLSGPILILGSRVLDSGKEFEEIDEKLTLLFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             Y+IEI+PPE+E+ LVSWKSQLEEDMKM+Q QDNKNHI EVLAAND++CDDL SIC+ADTM
Sbjct  327   YDIEIRPPEDESRLVSWKSQLEEDMKMIQVQDNKNHITEVLAANDLDCDDLDSICVADTM  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE++VSA+S+HLM  KD EYRN KL+IS  SLSH +NIF++++   GKD  K E
Sbjct  387   VLSNYIEEIIVSALSHHLMKNKDLEYRNGKLIISCNSLSHALNIFQKKEKFCGKDTSKSE  446

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
              +A  S+    GE   K P  KAE++          S + A     K    S    KA E
Sbjct  447   DQALKSETPSVGETVVK-PAVKAENAAPEKKAEAAVSTSVAKTGVEKSVPPS----KASE  501

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
               PDNEFEKRIRPEVIPA EI VTF+DIGAL+E KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  502   ASPDNEFEKRIRPEVIPANEIDVTFSDIGALEETKESLQELVMLPLRRPDLFTGGLLKPC  561

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  562   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  621

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TK GERILVLAATNRPFDLDE
Sbjct  622   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKQGERILVLAATNRPFDLDE  681

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIM+GLP+ E RE IL+TLLAKE V K +D K+LATMTEGYTGSDLKN CTT
Sbjct  682   AIIRRFERRIMIGLPSVENREKILRTLLAKEKVDKEIDFKELATMTEGYTGSDLKNFCTT  741

Query  694   AAYRPVRELIKQERLKDVEKKRLA------------QECPNCGDAPTANED-KGERVITI  554
             AAYRPVRELI+QERLKD++KK+ A            +E    G+   A E  + ERVIT+
Sbjct  742   AAYRPVRELIQQERLKDLDKKQKATKEHNKDIQDRQEEQSMVGNTQGAKEKLQHERVITL  801

Query  553   RPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             RPLNM DF EAKNQVAASFA EG+ M+EL QWN LYGEGGSRK++QL+YFL
Sbjct  802   RPLNMQDFKEAKNQVAASFAVEGAGMSELMQWNELYGEGGSRKQKQLSYFL  852



>ref|XP_006391667.1| hypothetical protein EUTSA_v10023275mg [Eutrema salsugineum]
 gb|ESQ28953.1| hypothetical protein EUTSA_v10023275mg [Eutrema salsugineum]
Length=828

 Score =  1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/822 (71%), Positives = 664/822 (81%), Gaps = 27/822 (3%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW   T +S+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWATGTSTSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNES-SFKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS+  ES SFKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVD+ S+ 
Sbjct  147   SKYGSANTESLSFKRSPSESALEQLSGLFSSFSILPQREEPKAGGTLRRQSSGVDLKSRS  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
                ++ P   R +S+A+ +        ++SN  PL RTSS SFDEKLLIQ+LYKVL  VS
Sbjct  207   PMDNNPPKLRRNSSAANVSNLA-----SSSNSAPLKRTSSWSFDEKLLIQSLYKVLAYVS  261

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDERLS  1967
             K  PIVLYLRD E LL RS++ Y L QK+L++LSG VLILGSRIVD   +D  E+DE+L+
Sbjct  262   KANPIVLYLRDIENLLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSNEDAHEIDEKLT  321

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             +VFPYNI+I+PPE+E HLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI  
Sbjct  322   AVFPYNIDIRPPEDENHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESISF  381

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
              DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+EEK A+G++ 
Sbjct  382   EDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSASLSHGFSLFREEK-ASGREK  440

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAV  1427
             LK + K + SKE ++       P TK+ES T   SK E            K+A S   A 
Sbjct  441   LKQKPKEDKSKEVKAEVAAVFKPGTKSESVTTTTSKNEP----------EKEAKSEKVAT  490

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             KAPEVPPDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF GGL
Sbjct  491   KAPEVPPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLFTGGL  550

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLA+
Sbjct  551   LKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAS  610

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNRPF
Sbjct  611   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNRPF  670

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVGLP+ E RE IL+TLLAKE V + LD K+LA MT+GYTGSDLKN
Sbjct  671   DLDEAIIRRFERRIMVGLPSVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGSDLKN  730

Query  706   LCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFM  527
             LCTTAAYRPVRELI+QER+KD EKK+  +      D     E K ER+IT+RPLN  DF 
Sbjct  731   LCTTAAYRPVRELIQQERIKDTEKKKQRETTKASED----EEGKEERIITLRPLNRQDFK  786

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  787   EAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  828



>ref|XP_008810932.1| PREDICTED: uncharacterized protein LOC103722235 isoform X1 [Phoenix 
dactylifera]
Length=841

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/820 (71%), Positives = 680/820 (83%), Gaps = 10/820 (1%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV KW    SSS  VT + +E+E++  +VDGR+SKVTFDEFPYYLSE+TR LLTSAA+V
Sbjct  27    QTVGKWAAPASSSAGVTAENVEKELMRMVVDGRESKVTFDEFPYYLSEKTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +K+TRNLSPASR ILLSGPAELYQQ++AKALAH+F AKLLLLDVTDFSLKVQS
Sbjct  87    HLKQVDLSKYTRNLSPASRAILLSGPAELYQQIIAKALAHFFEAKLLLLDVTDFSLKVQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPSKGI  2321
             KYGSS  +S F+RS+SE TL RMS FLGS SIL  +EE K   G+LRRQSS V++  +G 
Sbjct  147   KYGSSNKDSFFRRSVSEATLERMSSFLGSLSILLQREEPKVIAGSLRRQSSCVELRPRGS  206

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             + +S  + + +N+S SA+++ LTS     NP PL RTSS SFDEK+L+Q+LYKVLV VSK
Sbjct  207   DSNSYTSKIHKNASVSADISGLTSQCAPINPVPLKRTSSWSFDEKILLQSLYKVLVSVSK  266

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
               PIVLY+RD E LL RS+++Y L QKML++LSG VLILGSR+++   DY ++D R+SS+
Sbjct  267   INPIVLYIRDVENLLYRSQRIYSLFQKMLKKLSGPVLILGSRLLESDCDYSDMDGRVSSL  326

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPYNIEI+PP++ET LV+WKSQLEEDM+M+Q QDNKNHI EVLA ND+ECDDLGSIC+AD
Sbjct  327   FPYNIEIRPPDDETRLVNWKSQLEEDMRMIQIQDNKNHIAEVLAENDLECDDLGSICLAD  386

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             T  LSNYIEE+VVSA+SY+LMN K PEYRN KLVISSKSLSH ++IF+E + ++ +D LK
Sbjct  387   TTVLSNYIEEIVVSAVSYNLMNNKVPEYRNGKLVISSKSLSHALSIFQEGRHSS-EDTLK  445

Query  1600  LESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             LE+ AE  KET   E G+     K E S A  S PE  S A  PA   KDA SS    K 
Sbjct  446   LEANAESGKETVD-EDGAAVAAAKPEVS-AEVSPPEKKSEAEKPASAVKDAESSSLPPKT  503

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIR EVIPA EIGVTF DIGALDEIKESL ELVMLPLRRPDLF GGLLK
Sbjct  504   PEVAPDNEFEKRIRQEVIPASEIGVTFNDIGALDEIKESLQELVMLPLRRPDLFTGGLLK  563

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  564   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  623

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             +PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDL
Sbjct  624   APTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKSGERILVLAATNRPFDL  683

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELIL+ LL+KE V + LD K+LATMTEGY+GSDLKNLC
Sbjct  684   DEAIIRRFERRIMVGLPSVESRELILRKLLSKEKVEE-LDYKELATMTEGYSGSDLKNLC  742

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
              TAAYRPVRELI++ERLK++EK++ A+E  +  ++    E+ GE+ +T+RPLNM+D  +A
Sbjct  743   VTAAYRPVRELIQRERLKELEKRK-AEEGDSLAESSENKEEDGEQTLTLRPLNMEDLRQA  801

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFA EGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  802   KNQVAASFAGEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  841



>ref|XP_008792387.1| PREDICTED: calmodulin-interacting protein 111-like isoform X2 
[Phoenix dactylifera]
Length=824

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/843 (70%), Positives = 692/843 (82%), Gaps = 21/843 (2%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRD  2750
             MDQK++ +SA+G+G+GVGVG GL SGQTV K     +SS  VT + +E+E++  ++DGR 
Sbjct  1     MDQKHILMSAVGLGLGVGVGLGLVSGQTVGKLVAPANSSAGVTAENIEKELMRQVLDGRA  60

Query  2749  SKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQML  2570
             S VTFDEFPYYLSEQTR +LTSAA+VHLK  D +K+TRNLSPASR ILLSGPAELYQQML
Sbjct  61    STVTFDEFPYYLSEQTRAILTSAAYVHLKQVDLSKYTRNLSPASRAILLSGPAELYQQML  120

Query  2569  AKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQ  2390
             AKALAHYF AKLLLLDVTDFSLK+QSKYGSS  +S F+RS+SE TL R+S  LGS SIL 
Sbjct  121   AKALAHYFEAKLLLLDVTDFSLKIQSKYGSSNKDSFFRRSVSEATLERISSLLGSVSILL  180

Query  2389  PKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRT  2210
              +EE KG+LRRQSS +++  +  + +S+   LR+N+S SA+MN LTS     NP PL RT
Sbjct  181   QREEPKGSLRRQSSSLELRPRASDSNSSMPGLRKNASVSADMNGLTSQCAPVNPAPLKRT  240

Query  2209  SSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVL  2030
             SS SF +K+L+Q+LYKVL  VSK+ PIVLY+RD E L+ RS+++Y L QKML+ LSG VL
Sbjct  241   SSWSFGDKVLLQSLYKVLASVSKSNPIVLYVRDVENLVYRSQRIYSLFQKMLKNLSGPVL  300

Query  2029  ILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKN  1850
             ILGSR+++   DYR++D R++S+FPYNIEIKPPE+ETHLVSWKSQLEEDMKM+Q QDN+N
Sbjct  301   ILGSRLLESDSDYRDVDGRVNSLFPYNIEIKPPEDETHLVSWKSQLEEDMKMIQIQDNRN  360

Query  1849  HIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISS  1670
             HI EVLAAND+ CDDLG IC+ADTM LSNYIEE+VVSA+SYHLMN K+PEYRN KLVISS
Sbjct  361   HITEVLAANDLACDDLGCICLADTMVLSNYIEEIVVSAVSYHLMNNKEPEYRNGKLVISS  420

Query  1669  KSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPET  1490
             KSLSHG++IF+E + + G+D +KLE+  E  KE  + E G+     +     APG K   
Sbjct  421   KSLSHGLSIFQESRLS-GEDTIKLEANVESGKEAVN-EDGAAA-AVEKAEKMAPGVKDSE  477

Query  1489  GsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIK  1310
             GS                   KAPEV PDNEFEKRIRPEVIPA EIGVTF DIGALDEIK
Sbjct  478   GS---------------SLPPKAPEVSPDNEFEKRIRPEVIPANEIGVTFNDIGALDEIK  522

Query  1309  ESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMST  1130
             ESL ELVMLPLRRPDLF GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMST
Sbjct  523   ESLQELVMLPLRRPDLFNGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMST  582

Query  1129  ITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHW  950
             ITSKWFGEDEKNVRALFTLAAKV+P IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HW
Sbjct  583   ITSKWFGEDEKNVRALFTLAAKVAPAIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHW  642

Query  949   DGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGK  770
             DGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RELI++ LL+KE V +
Sbjct  643   DGLLTKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESRELIVRKLLSKEKVEE  702

Query  769   VLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPT  590
              LD K+LATMTEGY+GSDLKNLC TAAYRPVRELI++ERLK++EK++ A+E  +  +   
Sbjct  703   GLDYKELATMTEGYSGSDLKNLCVTAAYRPVRELIQRERLKELEKQK-AEEVESSAERSE  761

Query  589   ANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLT  410
               E+ GE+ IT+RPLNM+D  +AKNQVAASFAAEGS+M+ELKQWN+L+GEGGSRKK+QL+
Sbjct  762   NREEDGEQAITLRPLNMEDLRQAKNQVAASFAAEGSVMSELKQWNDLHGEGGSRKKQQLS  821

Query  409   YFL  401
             YFL
Sbjct  822   YFL  824



>ref|XP_010473660.1| PREDICTED: uncharacterized protein LOC104753079 [Camelina sativa]
 ref|XP_010473662.1| PREDICTED: uncharacterized protein LOC104753079 [Camelina sativa]
Length=829

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/826 (72%), Positives = 668/826 (81%), Gaps = 34/826 (4%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             Q V KW G    SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA
Sbjct  27    QAVGKWAGGNSSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +K+ RNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+
Sbjct  87    YVHLKHFDASKYARNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKI  146

Query  2497  QSKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPS  2330
             QSKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K   GTLRRQSSGVDI S
Sbjct  147   QSKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREEPKAAGGTLRRQSSGVDITS  206

Query  2329  KGIEGSSNPTTlrrnssasanmnnltSYNTTSNPG--PLMRTSSLSFDEKLLIQALYKVL  2156
               +EGSSNP  LRRNSSA+AN++NL    ++SN G  PL R+SS SFDEK+L+Q+LYKVL
Sbjct  207   SSMEGSSNPPKLRRNSSAAANISNLA---SSSNQGSAPLKRSSSWSFDEKILVQSLYKVL  263

Query  2155  VKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELD  1979
               VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D  E+D
Sbjct  264   AYVSKANPIVLYLRDVENFLFRSQRTYNLFQKILQKLSGPVLILGSRIVDLSSEDADEID  323

Query  1978  ERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLG  1799
             E+LSSVFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL 
Sbjct  324   EKLSSVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLE  383

Query  1798  SICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
             SI   DT  LSNYIEE+VVSA+SYHLMN K PEYRN KLVISS SLSHG ++F+E K+  
Sbjct  384   SISFEDTKVLSNYIEEIVVSALSYHLMNNKYPEYRNGKLVISSTSLSHGFSLFREGKSG-  442

Query  1618  GKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsS  1439
             G++ LK +SK E SKE +S       PETK  S T   ++PE            K+A + 
Sbjct  443   GREKLKQKSKEEQSKEAKSELTADVKPETKPGSVT---TEPE------------KEAKAE  487

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
                 KAPE  PDNEFEKRIRPEVIPA+EI VTF DIGALD+IKESL ELVMLPLRRPDLF
Sbjct  488   KVTPKAPEGAPDNEFEKRIRPEVIPAEEINVTFEDIGALDDIKESLQELVMLPLRRPDLF  547

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
              GGLLKPCRGILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  548   TGGLLKPCRGILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALF  607

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAAT
Sbjct  608   TLASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAAT  667

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MT+GYTGS
Sbjct  668   NRPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTDGYTGS  727

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNM  539
             DLKNLCTTAAYRPVRELI+ ER+KD EKK+  +E    G+    +E K ERVIT+R LN 
Sbjct  728   DLKNLCTTAAYRPVRELIQHERVKDTEKKK-QRETSKAGE---EDEGKEERVITLRALNR  783

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              DF EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRKKEQLTYFL
Sbjct  784   QDFKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRKKEQLTYFL  829



>ref|XP_010533620.1| PREDICTED: spastin isoform X3 [Tarenaya hassleriana]
Length=824

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/824 (71%), Positives = 668/824 (81%), Gaps = 35/824 (4%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTV KW GS   S+N VT + ME+EML  +VDGR+ +VTFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QTVGKWAGSNTPSTNGVTAEKMEKEMLRQVVDGRECEVTFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK ++ +++TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDVTDF+LK+Q
Sbjct  87    VHLKHSEASRYTRNLSPASRAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFALKIQ  146

Query  2494  SKYGS-SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDI-PSKGI  2321
             SKYG  S++ S   RS SE+ L ++S +L SFS+L  +EE KGTLRRQSSGVDI  S G+
Sbjct  147   SKYGGMSQDSSLLHRSPSESALEKLSGYLSSFSLLSQREEPKGTLRRQSSGVDIRSSGGM  206

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             EGS NP  LRRN+S +A M+ L     +SNP  L RTSS SFDEKL IQ+LYKVL  VSK
Sbjct  207   EGSGNPPKLRRNASEAAGMSKLL----SSNPASLKRTSSWSFDEKLFIQSLYKVLAYVSK  262

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD---PGDDYRELDERL  1970
             T PIV+YLRD + LL RS+++YIL QK++++LSG VLILGSRIV+    GD+ RE+DE+L
Sbjct  263   TTPIVVYLRDIDHLLFRSQRIYILFQKLIKKLSGPVLILGSRIVNLSNDGDEGREIDEKL  322

Query  1969  SSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSIC  1790
             S+VF YNIEI+PPE+E HLVSWKSQLE+DMKM+Q QDN+NHI+EVL+ ND+ CDDL SI 
Sbjct  323   SAVFTYNIEIQPPEDENHLVSWKSQLEQDMKMIQAQDNRNHIIEVLSENDVVCDDLESIL  382

Query  1789  MADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKD  1610
             + DT  LSNYIEE+VVSAISYHLMN KDPEYRN KLVISSKSLSHG ++FKE K+     
Sbjct  383   LEDTKLLSNYIEEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGFSLFKEGKSGG---  439

Query  1609  ILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTA  1430
                 + K +  K  +   K     E+K +S    GSK E+         +      +  A
Sbjct  440   ----QEKRKSGKTREDEPKKDLKAESKPDSGNTEGSKNES-------EKSGSPPKPASPA  488

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPE+P DNEFEKRIRPEVIPA EI VTF DIGALD+IKESL ELVMLPLRRPDLFKGG
Sbjct  489   PKAPEIPLDNEFEKRIRPEVIPADEINVTFNDIGALDDIKESLQELVMLPLRRPDLFKGG  548

Query  1249  -LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
              LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  549   GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  608

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             AAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNR
Sbjct  609   AAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLMTKPGERILVLAATNR  668

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP+ E RE IL+TLLAKE   + LD K+LA MTEGYTGSDL
Sbjct  669   PFDLDEAIIRRFERRIMVGLPSVENREKILRTLLAKEKAEEGLDFKELAMMTEGYTGSDL  728

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             KNLCTTAAYRPVRELI+QERLKD EKK         G  PT +E +GERVIT+RPL+M D
Sbjct  729   KNLCTTAAYRPVRELIQQERLKDTEKK--------SGGGPTEDEVRGERVITLRPLSMPD  780

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             F EAK QVAASFAAEGSIM ELKQWN+LYGEGGSRKKEQLTYF+
Sbjct  781   FKEAKTQVAASFAAEGSIMAELKQWNDLYGEGGSRKKEQLTYFM  824



>ref|XP_010533618.1| PREDICTED: spastin isoform X1 [Tarenaya hassleriana]
 ref|XP_010533619.1| PREDICTED: spastin isoform X2 [Tarenaya hassleriana]
Length=826

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/826 (71%), Positives = 668/826 (81%), Gaps = 37/826 (4%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTV KW GS   S+N VT + ME+EML  +VDGR+ +VTFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QTVGKWAGSNTPSTNGVTAEKMEKEMLRQVVDGRECEVTFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK ++ +++TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDVTDF+LK+Q
Sbjct  87    VHLKHSEASRYTRNLSPASRAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFALKIQ  146

Query  2494  SKYGS-SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSK---  2327
             SKYG  S++ S   RS SE+ L ++S +L SFS+L  +EE KGTLRRQSSGVDI S    
Sbjct  147   SKYGGMSQDSSLLHRSPSESALEKLSGYLSSFSLLSQREEPKGTLRRQSSGVDIRSSCSG  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKV  2147
             G+EGS NP  LRRN+S +A M+ L     +SNP  L RTSS SFDEKL IQ+LYKVL  V
Sbjct  207   GMEGSGNPPKLRRNASEAAGMSKLL----SSNPASLKRTSSWSFDEKLFIQSLYKVLAYV  262

Query  2146  SKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD---PGDDYRELDE  1976
             SKT PIV+YLRD + LL RS+++YIL QK++++LSG VLILGSRIV+    GD+ RE+DE
Sbjct  263   SKTTPIVVYLRDIDHLLFRSQRIYILFQKLIKKLSGPVLILGSRIVNLSNDGDEGREIDE  322

Query  1975  RLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGS  1796
             +LS+VF YNIEI+PPE+E HLVSWKSQLE+DMKM+Q QDN+NHI+EVL+ ND+ CDDL S
Sbjct  323   KLSAVFTYNIEIQPPEDENHLVSWKSQLEQDMKMIQAQDNRNHIIEVLSENDVVCDDLES  382

Query  1795  ICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAG  1616
             I + DT  LSNYIEE+VVSAISYHLMN KDPEYRN KLVISSKSLSHG ++FKE K+   
Sbjct  383   ILLEDTKLLSNYIEEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGFSLFKEGKSGG-  441

Query  1615  KDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSG  1436
                   + K +  K  +   K     E+K +S    GSK E+         +      + 
Sbjct  442   ------QEKRKSGKTREDEPKKDLKAESKPDSGNTEGSKNES-------EKSGSPPKPAS  488

Query  1435  TAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK  1256
              A KAPE+P DNEFEKRIRPEVIPA EI VTF DIGALD+IKESL ELVMLPLRRPDLFK
Sbjct  489   PAPKAPEIPLDNEFEKRIRPEVIPADEINVTFNDIGALDDIKESLQELVMLPLRRPDLFK  548

Query  1255  GG-LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
             GG LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  549   GGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  608

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAAT
Sbjct  609   TLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLMTKPGERILVLAAT  668

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLLAKE   + LD K+LA MTEGYTGS
Sbjct  669   NRPFDLDEAIIRRFERRIMVGLPSVENREKILRTLLAKEKAEEGLDFKELAMMTEGYTGS  728

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNM  539
             DLKNLCTTAAYRPVRELI+QERLKD EKK         G  PT +E +GERVIT+RPL+M
Sbjct  729   DLKNLCTTAAYRPVRELIQQERLKDTEKK--------SGGGPTEDEVRGERVITLRPLSM  780

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              DF EAK QVAASFAAEGSIM ELKQWN+LYGEGGSRKKEQLTYF+
Sbjct  781   PDFKEAKTQVAASFAAEGSIMAELKQWNDLYGEGGSRKKEQLTYFM  826



>ref|XP_010035182.1| PREDICTED: cell division control protein 48 homolog C isoform 
X2 [Eucalyptus grandis]
 gb|KCW46478.1| hypothetical protein EUGRSUZ_K00303 [Eucalyptus grandis]
Length=837

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/848 (70%), Positives = 689/848 (81%), Gaps = 18/848 (2%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTGSS---SNAVTVDIMEQEMLNTIVDGR  2753
             M+QKN+ LSAL VG+GVGVG GLASGQTVS+W G     +  VT + +EQE+L  IVDGR
Sbjct  1     MEQKNVLLSALSVGLGVGVGLGLASGQTVSRWVGGGNCPAGEVTAEKIEQELLRQIVDGR  60

Query  2752  DSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQM  2573
             +S V FDEFPYYLSEQTR LLTSAA+VHLK +D +KH RNLSPASRTILLSGPAELYQQM
Sbjct  61    ESTVKFDEFPYYLSEQTRALLTSAAYVHLKHSDLSKHARNLSPASRTILLSGPAELYQQM  120

Query  2572  LAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSIL  2393
             LAKAL+H+F +KLLLLDVT+FSLK+Q+KYG +  E SFKRSISE T +RMS  L SFS  
Sbjct  121   LAKALSHFFESKLLLLDVTEFSLKMQNKYGITNKEPSFKRSISEATFDRMSSLLSSFSGA  180

Query  2392  QPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMR  2213
              P+++K+G + RQSS  DI S+ +E SSNP   RRN+SA ++ +++ S  T  N G   R
Sbjct  181   PPRDQKRG-MSRQSSSTDIRSRAMEESSNPPKHRRNASAMSDTSSVYSEGTPINSGLPKR  239

Query  2212  TSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSV  2033
                L FDE++ +Q+LYKVLV VS+T PI+LYLRDAEKLL +S+++  L  KM+++LSG+V
Sbjct  240   LGKLCFDERVFLQSLYKVLVSVSETAPIILYLRDAEKLLLQSDRLQKLFHKMVQKLSGAV  299

Query  2032  LILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNK  1853
             LILGSR +D  DDYRE+DERLS +FPYNIEI+PPE+ET+LVSWK+QLEEDMKM+Q QDNK
Sbjct  300   LILGSRKLDTDDDYREVDERLSLLFPYNIEIRPPEDETNLVSWKAQLEEDMKMLQVQDNK  359

Query  1852  NHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVIS  1673
             NHI EVLA NDI CDDLGSIC +DTM L NYIEE+VVSA+SYHLMN K+PEYRN KLVIS
Sbjct  360   NHIAEVLAENDIICDDLGSICHSDTMVLGNYIEEIVVSALSYHLMNNKEPEYRNGKLVIS  419

Query  1672  SKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPE  1493
             S+SLSHG+NIF+E K+   K  LKLE  +E SKE + GE  S   ++K ++S  P +K E
Sbjct  420   SESLSHGLNIFEEGKSG-DKHSLKLEQNSESSKEKE-GEAVSAKTDSKPDNS-GPETKSE  476

Query  1492  TGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEI  1313
             T          +          KAPEV PDNEFEKRIRPEVIPA EIGVTFADIGA+DE 
Sbjct  477   T------EKSASAAKKDVDNPSKAPEVAPDNEFEKRIRPEVIPANEIGVTFADIGAMDET  530

Query  1312  KESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMS  1133
             KESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMS
Sbjct  531   KESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMS  590

Query  1132  TITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSH  953
             TITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+H
Sbjct  591   TITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAH  650

Query  952   WDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVG  773
             WDGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE+ILKTLLAKE V 
Sbjct  651   WDGLLTKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSIESREMILKTLLAKEVVA  710

Query  772   KVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP  593
               LD K+LA MTEGY+GSDLKNLC TAAYRPVR+LI+QER K +EKKR A+E  +  + P
Sbjct  711   D-LDYKELAAMTEGYSGSDLKNLCVTAAYRPVRDLIQQERQKSLEKKRRAKEAESSEEVP  769

Query  592   TANEDKGERV----ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRK  425
                E+K E      I +RPL+M+D  +AKNQVAASFA+EGS+M ELKQWN+LYGEGGSRK
Sbjct  770   DTKEEKEENKDEEPIALRPLSMEDLRQAKNQVAASFASEGSVMAELKQWNDLYGEGGSRK  829

Query  424   KEQLTYFL  401
             K+QLTYFL
Sbjct  830   KKQLTYFL  837



>ref|XP_006422074.1| hypothetical protein CICLE_v10004310mg [Citrus clementina]
 ref|XP_006490605.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
[Citrus sinensis]
 gb|ESR35314.1| hypothetical protein CICLE_v10004310mg [Citrus clementina]
 gb|KDO56845.1| hypothetical protein CISIN_1g003231mg [Citrus sinensis]
Length=837

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/803 (71%), Positives = 674/803 (84%), Gaps = 13/803 (2%)
 Frame = -1

Query  2806  VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLS  2627
             V+ + +E+E++  ++DG+D K TFDEFPYYLSE+TR+LLTSAA+VHLK ++ +KHTRNLS
Sbjct  47    VSGEQIEKELMRQVLDGKDIKTTFDEFPYYLSERTRMLLTSAAYVHLKHSEISKHTRNLS  106

Query  2626  PASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSI  2447
             PASRTILLSGPAELYQQMLAKALAH+F +KLLLLDV DFSLK+Q+KYG +R E SFKRSI
Sbjct  107   PASRTILLSGPAELYQQMLAKALAHFFESKLLLLDVNDFSLKMQNKYGCARKEPSFKRSI  166

Query  2446  SETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasan  2267
             SE TL RMS  LGSFS L P+EE KGTL RQSS VD+ S+ +EGSS    L ++   +++
Sbjct  167   SEMTLERMSGLLGSFSKLPPREENKGTLHRQSSNVDLKSRCMEGSS---FLPKHRRNASD  223

Query  2266  mnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
             M++++S   + +P PL R SS  FDEKL +Q+LYKVLV +++T  ++LYLRD +KLL +S
Sbjct  224   MSSISSLGASPSPAPLKRISSWCFDEKLFLQSLYKVLVSITETSSVILYLRDVDKLLFQS  283

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
             ++ Y LL K+L++LSGSVL+LGSR+++P DD R++DERL+ +FPYN+E+K PE+ETHLV+
Sbjct  284   QRFYNLLDKLLKKLSGSVLVLGSRMLEPEDDCRDVDERLTILFPYNLEVKLPEDETHLVN  343

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             WK++LEEDMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM LSNYIEE+VVSAIS+
Sbjct  344   WKAKLEEDMKVLQFQDNKNHIAEVLAANDLECDDLGSICQADTMVLSNYIEEIVVSAISH  403

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGS  1547
             HLM+ +DPEYRN KLVISSKSLSHG++IF+E K   GKD LK+E+ A+ +KET     G 
Sbjct  404   HLMDNEDPEYRNGKLVISSKSLSHGLSIFQECKRF-GKDSLKMETNADGAKET-----GE  457

Query  1546  KGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVI  1367
             +    K ES   P S  E+ S      P  K  + +    KAPE PPDNEFEKRIRPEVI
Sbjct  458   EAVTAKTESKENPAS--ESRSEMEKSVPVVKKDSENPPPAKAPEFPPDNEFEKRIRPEVI  515

Query  1366  PAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTML  1187
             PA EIGVTFADIGAL+EIKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTML
Sbjct  516   PANEIGVTFADIGALNEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTML  575

Query  1186  AKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRS  1007
             AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+
Sbjct  576   AKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRT  635

Query  1006  RAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPT  827
             R GEHEAMRKIKNEFM+HWDGLLT+ GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+
Sbjct  636   RVGEHEAMRKIKNEFMTHWDGLLTRNGERILVLAATNRPFDLDEAIIRRFERRIMVGLPS  695

Query  826   PEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLK  647
              E RE+ILKTLLAKE V + LD K+LA MTEGY+GSDLKNLC TAAYRPVRELI++ER K
Sbjct  696   AENREMILKTLLAKEKV-EDLDFKELAAMTEGYSGSDLKNLCVTAAYRPVRELIQEERKK  754

Query  646   DVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNE  470
             D+EKK+  +   +  DA  T  E K ERVIT+RPLNM+D  +AKNQVAASFA+EGS+MNE
Sbjct  755   DMEKKKREEAAKSSEDASETKEEAKEERVITLRPLNMEDMRQAKNQVAASFASEGSVMNE  814

Query  469   LKQWNNLYGEGGSRKKEQLTYFL  401
             LKQWN+LYGEGGSRKKEQLTYFL
Sbjct  815   LKQWNDLYGEGGSRKKEQLTYFL  837



>ref|XP_008792386.1| PREDICTED: calmodulin-interacting protein 111-like isoform X1 
[Phoenix dactylifera]
Length=825

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/844 (70%), Positives = 692/844 (82%), Gaps = 22/844 (3%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRD  2750
             MDQK++ +SA+G+G+GVGVG GL SGQTV K     +SS  VT + +E+E++  ++DGR 
Sbjct  1     MDQKHILMSAVGLGLGVGVGLGLVSGQTVGKLVAPANSSAGVTAENIEKELMRQVLDGRA  60

Query  2749  SKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQML  2570
             S VTFDEFPYYLSEQTR +LTSAA+VHLK  D +K+TRNLSPASR ILLSGPAELYQQML
Sbjct  61    STVTFDEFPYYLSEQTRAILTSAAYVHLKQVDLSKYTRNLSPASRAILLSGPAELYQQML  120

Query  2569  AKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQ  2390
             AKALAHYF AKLLLLDVTDFSLK+QSKYGSS  +S F+RS+SE TL R+S  LGS SIL 
Sbjct  121   AKALAHYFEAKLLLLDVTDFSLKIQSKYGSSNKDSFFRRSVSEATLERISSLLGSVSILL  180

Query  2389  PKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRT  2210
              +EE KG+LRRQSS +++  +  + +S+   LR+N+S SA+MN LTS     NP PL RT
Sbjct  181   QREEPKGSLRRQSSSLELRPRASDSNSSMPGLRKNASVSADMNGLTSQCAPVNPAPLKRT  240

Query  2209  SSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVL  2030
             SS SF +K+L+Q+LYKVL  VSK+ PIVLY+RD E L+ RS+++Y L QKML+ LSG VL
Sbjct  241   SSWSFGDKVLLQSLYKVLASVSKSNPIVLYVRDVENLVYRSQRIYSLFQKMLKNLSGPVL  300

Query  2029  ILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKN  1850
             ILGSR+++   DYR++D R++S+FPYNIEIKPPE+ETHLVSWKSQLEEDMKM+Q QDN+N
Sbjct  301   ILGSRLLESDSDYRDVDGRVNSLFPYNIEIKPPEDETHLVSWKSQLEEDMKMIQIQDNRN  360

Query  1849  HIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISS  1670
             HI EVLAAND+ CDDLG IC+ADTM LSNYIEE+VVSA+SYHLMN K+PEYRN KLVISS
Sbjct  361   HITEVLAANDLACDDLGCICLADTMVLSNYIEEIVVSAVSYHLMNNKEPEYRNGKLVISS  420

Query  1669  KSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPET  1490
             KSLSHG++IF+E + + G+D +KLE+  E  KE  + E G+     +     APG K   
Sbjct  421   KSLSHGLSIFQESRLS-GEDTIKLEANVESGKEAVN-EDGAAA-AVEKAEKMAPGVKDSE  477

Query  1489  GsaapapapttkdatsSGTAVKAP-EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEI  1313
             GS                   KAP EV PDNEFEKRIRPEVIPA EIGVTF DIGALDEI
Sbjct  478   GS---------------SLPPKAPQEVSPDNEFEKRIRPEVIPANEIGVTFNDIGALDEI  522

Query  1312  KESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMS  1133
             KESL ELVMLPLRRPDLF GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMS
Sbjct  523   KESLQELVMLPLRRPDLFNGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMS  582

Query  1132  TITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSH  953
             TITSKWFGEDEKNVRALFTLAAKV+P IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+H
Sbjct  583   TITSKWFGEDEKNVRALFTLAAKVAPAIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTH  642

Query  952   WDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVG  773
             WDGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RELI++ LL+KE V 
Sbjct  643   WDGLLTKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESRELIVRKLLSKEKVE  702

Query  772   KVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP  593
             + LD K+LATMTEGY+GSDLKNLC TAAYRPVRELI++ERLK++EK++ A+E  +  +  
Sbjct  703   EGLDYKELATMTEGYSGSDLKNLCVTAAYRPVRELIQRERLKELEKQK-AEEVESSAERS  761

Query  592   TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQL  413
                E+ GE+ IT+RPLNM+D  +AKNQVAASFAAEGS+M+ELKQWN+L+GEGGSRKK+QL
Sbjct  762   ENREEDGEQAITLRPLNMEDLRQAKNQVAASFAAEGSVMSELKQWNDLHGEGGSRKKQQL  821

Query  412   TYFL  401
             +YFL
Sbjct  822   SYFL  825



>ref|XP_004164363.1| PREDICTED: uncharacterized protein LOC101225930 [Cucumis sativus]
Length=832

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/821 (71%), Positives = 681/821 (83%), Gaps = 21/821 (3%)
 Frame = -1

Query  2845  QTVSKWT--GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V +W+   SSSN +T D +EQEML  IVDGR+SKVTFD+FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVKQWSTSHSSSNLITADKLEQEMLKHIVDGRESKVTFDDFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QS
Sbjct  87    HLKHAEVSKFTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDITDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK-GTLRRQSSGVDIPSKGIEG  2315
             KYG+S  ES FKRS SE+TL R+S   GSFS+L  +E++K G+LRRQ SGV++ S G EG
Sbjct  147   KYGTSVKESCFKRSTSESTLERLSGLFGSFSMLPSREDQKIGSLRRQRSGVELASWGNEG  206

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SS    LRRN+SA+AN+NNL S         L   SS +F+EKLL+Q+LYKVL+ VSK  
Sbjct  207   SSILPKLRRNASAAANINNLASQCNVDKSASLKHMSSWAFEEKLLVQSLYKVLLYVSKAN  266

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD ++ L +S +VY L  KML++LSGS+LILGSR +D  +DY E+DERLS++FP
Sbjct  267   PIVLYLRDVDRFLSKSNRVYNLFHKMLQKLSGSILILGSRTIDSSNDYMEVDERLSALFP  326

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+H VSWKSQLEEDMK ++ QDN+NHIMEVL+ ND++CDDL SIC+ DT+
Sbjct  327   YNIEIRPPEDESHHVSWKSQLEEDMKSIKVQDNRNHIMEVLSDNDLDCDDLDSICVGDTL  386

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
             ALSNYIEE+VVSAISYHLMN+KD EYRN KL+ISSKSLSHG+ IF+  K+ + K+ ++LE
Sbjct  387   ALSNYIEEIVVSAISYHLMNSKDAEYRNGKLIISSKSLSHGLGIFQAGKSTS-KNSVQLE  445

Query  1594  SKAELSKETQSGEKGSKGPETKAE--SSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             ++   SK++ + +  +K     AE  S TAP +  +             D  ++  AVKA
Sbjct  446   AQTGASKDSGAVKSEAKADTAAAEIRSETAPVAAAKI------------DGETAAPAVKA  493

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEVPPDNEFEKRIRPEVIPA EIGVTF+DIGA++EIK+SL ELVMLPLRRPDLF GGLLK
Sbjct  494   PEVPPDNEFEKRIRPEVIPANEIGVTFSDIGAMEEIKDSLQELVMLPLRRPDLFLGGLLK  553

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  554   PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  613

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGER+LVLAATNRPFDL
Sbjct  614   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLLTKPGERVLVLAATNRPFDL  673

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RE+IL TLL KE V + LD K+LATMTEGY+GSDLKN C
Sbjct  674   DEAIIRRFERRIMVGLPSAENREMILTTLLGKEKVEEGLDKKELATMTEGYSGSDLKNFC  733

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPN-CGDAPTANEDKGERVITIRPLNMDDFME  524
              TAAYRPVRELI+QERLKDVEKKR A E  N  GD   A E K ERVIT+R LNM+DF  
Sbjct  734   MTAAYRPVRELIQQERLKDVEKKRRAAEGQNKTGDG--AGESKEERVITLRALNMEDFKL  791

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFAAEG++M+EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  792   AKNQVAASFAAEGAMMSELRQWNELYGEGGSRKKQQLTYFL  832



>ref|XP_004146536.1| PREDICTED: uncharacterized protein LOC101213686 [Cucumis sativus]
 gb|KGN53364.1| hypothetical protein Csa_4G050190 [Cucumis sativus]
Length=831

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/820 (72%), Positives = 680/820 (83%), Gaps = 20/820 (2%)
 Frame = -1

Query  2845  QTVSKW-TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             Q+V +W T  SSN +T D +EQEML  IVDGR+SKVTFD+FPYYLSEQTRVLLTSAA+VH
Sbjct  27    QSVKQWSTSHSSNLITADKLEQEMLKHIVDGRESKVTFDDFPYYLSEQTRVLLTSAAYVH  86

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK A+ +K TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QSK
Sbjct  87    LKHAEVSKFTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDITDFSLKIQSK  146

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK-GTLRRQSSGVDIPSKGIEGS  2312
             YG+S  ES FKRS SE+TL R+S   GSFS+L  +E++K G+LRRQ SGV++ S G EGS
Sbjct  147   YGTSVKESCFKRSTSESTLERLSGLFGSFSMLPSREDQKIGSLRRQRSGVELASWGNEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S    LRRN+SA+AN+NNL S         L   SS +F+EKLL+Q+LYKVL+ VSK  P
Sbjct  207   SVLPKLRRNASAAANINNLASQCNVDKSASLKHMSSWAFEEKLLVQSLYKVLLYVSKANP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD ++ L +S +VY L  KML++LSGS+LILGSR +D  +DY E+DERLS++FPY
Sbjct  267   IVLYLRDVDRFLSKSNRVYNLFHKMLQKLSGSILILGSRTIDSSNDYMEVDERLSALFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E+H VSWKSQLEEDMK ++ QDN+NHIMEVL+ ND++CDDL SIC+ DT+A
Sbjct  327   NIEIRPPEDESHHVSWKSQLEEDMKSIKVQDNRNHIMEVLSDNDLDCDDLDSICVGDTLA  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN+KD EYRN KL+ISSKSLSHG+ IF+  K+ + K+ ++LE+
Sbjct  387   LSNYIEEIVVSAISYHLMNSKDAEYRNGKLIISSKSLSHGLGIFQAGKSTS-KNSVQLEA  445

Query  1591  KAELSKETQSGEKGSKGPETKAE--SSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             +   SK++ + +  +K     AE  S TAP +  +             D  ++  AVKAP
Sbjct  446   QTGASKDSGAVKSEAKADTAAAEIRSETAPVAAAKI------------DGETAAPAVKAP  493

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIPA EIGVTF+DIGA++EIK+SL ELVMLPLRRPDLF GGLLKP
Sbjct  494   EVPPDNEFEKRIRPEVIPANEIGVTFSDIGAMEEIKDSLQELVMLPLRRPDLFLGGLLKP  553

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  554   CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  613

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGER+LVLAATNRPFDLD
Sbjct  614   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLLTKPGERVLVLAATNRPFDLD  673

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ E RE+IL TLL KE V + LD K+LATMTEGY+GSDLKN C 
Sbjct  674   EAIIRRFERRIMVGLPSAENREMILTTLLGKEKVEEGLDKKELATMTEGYSGSDLKNFCM  733

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPN-CGDAPTANEDKGERVITIRPLNMDDFMEA  521
             TAAYRPVRELI+QERLKDVEKKR A E  N  GD   A E K ERVIT+R LNM+DF  A
Sbjct  734   TAAYRPVRELIQQERLKDVEKKRRAAEGQNKTGDG--AGESKEERVITLRALNMEDFKLA  791

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFAAEG++M+EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  792   KNQVAASFAAEGAMMSELRQWNELYGEGGSRKKQQLTYFL  831



>ref|XP_010035181.1| PREDICTED: cell division control protein 48 homolog C isoform 
X1 [Eucalyptus grandis]
Length=838

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/849 (70%), Positives = 689/849 (81%), Gaps = 19/849 (2%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTGSS---SNAVTVDIMEQEMLNTIVDGR  2753
             M+QKN+ LSAL VG+GVGVG GLASGQTVS+W G     +  VT + +EQE+L  IVDGR
Sbjct  1     MEQKNVLLSALSVGLGVGVGLGLASGQTVSRWVGGGNCPAGEVTAEKIEQELLRQIVDGR  60

Query  2752  DSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQM  2573
             +S V FDEFPYYLSEQTR LLTSAA+VHLK +D +KH RNLSPASRTILLSGPAELYQQM
Sbjct  61    ESTVKFDEFPYYLSEQTRALLTSAAYVHLKHSDLSKHARNLSPASRTILLSGPAELYQQM  120

Query  2572  LAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSIL  2393
             LAKAL+H+F +KLLLLDVT+FSLK+Q+KYG +  E SFKRSISE T +RMS  L SFS  
Sbjct  121   LAKALSHFFESKLLLLDVTEFSLKMQNKYGITNKEPSFKRSISEATFDRMSSLLSSFSGA  180

Query  2392  QPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPL-M  2216
              P+++K+G + RQSS  DI S+ +E SSNP   RRN+SA ++ +++ S  T  N   L  
Sbjct  181   PPRDQKRG-MSRQSSSTDIRSRAMEESSNPPKHRRNASAMSDTSSVYSEGTPINSAGLPK  239

Query  2215  RTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGS  2036
             R   L FDE++ +Q+LYKVLV VS+T PI+LYLRDAEKLL +S+++  L  KM+++LSG+
Sbjct  240   RLGKLCFDERVFLQSLYKVLVSVSETAPIILYLRDAEKLLLQSDRLQKLFHKMVQKLSGA  299

Query  2035  VLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDN  1856
             VLILGSR +D  DDYRE+DERLS +FPYNIEI+PPE+ET+LVSWK+QLEEDMKM+Q QDN
Sbjct  300   VLILGSRKLDTDDDYREVDERLSLLFPYNIEIRPPEDETNLVSWKAQLEEDMKMLQVQDN  359

Query  1855  KNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVI  1676
             KNHI EVLA NDI CDDLGSIC +DTM L NYIEE+VVSA+SYHLMN K+PEYRN KLVI
Sbjct  360   KNHIAEVLAENDIICDDLGSICHSDTMVLGNYIEEIVVSALSYHLMNNKEPEYRNGKLVI  419

Query  1675  SSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKP  1496
             SS+SLSHG+NIF+E K+   K  LKLE  +E SKE + GE  S   ++K ++S  P +K 
Sbjct  420   SSESLSHGLNIFEEGKSG-DKHSLKLEQNSESSKEKE-GEAVSAKTDSKPDNS-GPETKS  476

Query  1495  ETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDE  1316
             ET          +          KAPEV PDNEFEKRIRPEVIPA EIGVTFADIGA+DE
Sbjct  477   ET------EKSASAAKKDVDNPSKAPEVAPDNEFEKRIRPEVIPANEIGVTFADIGAMDE  530

Query  1315  IKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSM  1136
              KESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSM
Sbjct  531   TKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSM  590

Query  1135  STITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMS  956
             STITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+
Sbjct  591   STITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMA  650

Query  955   HWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETV  776
             HWDGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE+ILKTLLAKE V
Sbjct  651   HWDGLLTKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSIESREMILKTLLAKEVV  710

Query  775   GKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDA  596
                LD K+LA MTEGY+GSDLKNLC TAAYRPVR+LI+QER K +EKKR A+E  +  + 
Sbjct  711   AD-LDYKELAAMTEGYSGSDLKNLCVTAAYRPVRDLIQQERQKSLEKKRRAKEAESSEEV  769

Query  595   PTANEDKGERV----ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSR  428
             P   E+K E      I +RPL+M+D  +AKNQVAASFA+EGS+M ELKQWN+LYGEGGSR
Sbjct  770   PDTKEEKEENKDEEPIALRPLSMEDLRQAKNQVAASFASEGSVMAELKQWNDLYGEGGSR  829

Query  427   KKEQLTYFL  401
             KK+QLTYFL
Sbjct  830   KKKQLTYFL  838



>ref|XP_006573795.1| PREDICTED: uncharacterized protein LOC100808011 isoform X1 [Glycine 
max]
Length=839

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/826 (69%), Positives = 668/826 (81%), Gaps = 27/826 (3%)
 Frame = -1

Query  2839  VSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             V+KW     SSSN VT + ME+EM   +VDGR+SKVTFD+FPYYL EQTRVLLTSAA+VH
Sbjct  28    VTKWGANEYSSSNGVTPENMEREMQRLVVDGRESKVTFDQFPYYLREQTRVLLTSAAYVH  87

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK A+ +++TRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLD+TDFSLK+QS+
Sbjct  88    LKHAEVSRYTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDLTDFSLKIQSR  147

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YGS+  ESSFKRS SETTL R+S+  GSFSI Q +E  KG   RQ SGVD+ S   EGSS
Sbjct  148   YGSANKESSFKRSTSETTLERLSDLFGSFSIFQQREVPKGNFHRQCSGVDLRSLQAEGSS  207

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             NP  +RRN+SASAN+++L S +  +N  P    +S  FDEKLLIQ LYKVLV VSKT PI
Sbjct  208   NPPKMRRNASASANISSLASQSNPTNSAPQKHITSWPFDEKLLIQTLYKVLVYVSKTYPI  267

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             VLYLRD + LL RS+++Y L Q ML +L G +LILGSR++D G DY+E++ERL+S+FPYN
Sbjct  268   VLYLRDVDNLLNRSQRIYNLFQTMLNKLHGPILILGSRVLDSGSDYKEVNERLASLFPYN  327

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEI PPE+E+ L+SWKSQ EEDMK +Q QDN+NHIMEVLAAND++CDDL SIC+ADT+ L
Sbjct  328   IEISPPEDESCLMSWKSQFEEDMKKIQIQDNRNHIMEVLAANDLDCDDLDSICVADTVVL  387

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE+VVSAISY+LMN+KDPEYRN KLVI   SLSH + IF+E K +  +D LKLE++
Sbjct  388   SNYIEEIVVSAISYYLMNSKDPEYRNGKLVIPCNSLSHALGIFQEGKFSV-RDTLKLEAQ  446

Query  1588  AELSKETQSG-----EKGSKGP--ETKAESSTAPGSKPETGsaapapapttkdatsSGTA  1430
             A  S++ + G     EK ++ P  + KAES T+  S  +T      P             
Sbjct  447   AVTSQQREEGALVEPEKKAENPASDIKAESDTSSTSVVKTDGENAVPESKV---------  497

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
                 EVPPDNEFEKRIRPEVIPA EIGV F+D+GALDE KESL ELVMLPLRRPDLF+GG
Sbjct  498   ----EVPPDNEFEKRIRPEVIPANEIGVKFSDVGALDETKESLQELVMLPLRRPDLFRGG  553

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPC+GILLFGPPGTGKTMLAKAIA E+GASFINVSMST+TSKWFGEDEKNVRALFTLA
Sbjct  554   LLKPCKGILLFGPPGTGKTMLAKAIASESGASFINVSMSTVTSKWFGEDEKNVRALFTLA  613

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+T  GERILVLAATNRP
Sbjct  614   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTNSGERILVLAATNRP  673

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVG+P+ E RE IL+TLLAKE V + LD K++ATM EGY+GSDLK
Sbjct  674   FDLDEAIIRRFERRIMVGMPSVENREKILRTLLAKEKVDEKLDFKEVATMAEGYSGSDLK  733

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPN--CGDA-PTANEDKGERVITIRPLNM  539
             NLCTTAAYRPVRELI+QERLK +EKK+      N    DA  T  E + ERVIT+RPLNM
Sbjct  734   NLCTTAAYRPVRELIQQERLKTLEKKQQGAGGQNNDVQDALDTEEEVQQERVITLRPLNM  793

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              DF EAK+QVAAS+AAEG+ MNELKQWN LYGEGGSRK++QL+YFL
Sbjct  794   QDFKEAKSQVAASYAAEGAGMNELKQWNELYGEGGSRKQQQLSYFL  839



>ref|XP_008234810.1| PREDICTED: putative cell division cycle ATPase [Prunus mume]
Length=822

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/825 (69%), Positives = 659/825 (80%), Gaps = 39/825 (5%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VSKW     S++ VT + +EQE++  ++ GRDSKVTF+EFPYYL E+TR+LLTSAA+V
Sbjct  27    QAVSKWVNGNCSADEVTAEQIEQELMRQVLPGRDSKVTFEEFPYYLRERTRMLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +KHTRNLSPASR ILLSGPAELY QMLAKALAH+F +KLLLLD+TDFS+K+QS
Sbjct  87    HLKHSDLSKHTRNLSPASRAILLSGPAELYHQMLAKALAHHFESKLLLLDITDFSIKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ E   KRS SE T+ RMS  LGSFSIL    + KGTL RQSS  D+ S+G EG 
Sbjct  147   KYGCAKREPYLKRSFSEVTMERMSSLLGSFSILPSSGDSKGTLCRQSSTTDLKSRGAEGP  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +N T  R  SSAS   +  +    TS+  PL R +S  FDEK+ +Q+LYKVL  +S+T  
Sbjct  207   NNSTLQRNASSASDMSSFSSKCAPTSS-APLKRVTSWCFDEKIFLQSLYKVLASISETGS  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD EKL  +S ++Y L  KML+RLSGSVLILGSR++D  DD +E+DERL+ +FPY
Sbjct  266   IILYIRDVEKLFLQSRRLYNLFNKMLKRLSGSVLILGSRMLDAEDDCKEVDERLAGLFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI PPE+ETHLVSWK+QLEEDMKM+Q+ DNKNHI EVLA+ND+ECDDLGSIC ADTM 
Sbjct  326   NIEISPPEDETHLVSWKAQLEEDMKMIQFHDNKNHIAEVLASNDLECDDLGSICHADTMV  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLM  KDPEYRN KLVISS SLSHG++IF+E K+  GKD LKLE+
Sbjct  386   LSNYIEEIVVSAISYHLMQKKDPEYRNGKLVISSTSLSHGLSIFQEGKSG-GKDSLKLET  444

Query  1591  KAELSKETQSGEK-GSK------GPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
              A+ +KET+  E  G+K      GP  K +S   P  K E                    
Sbjct  445   NADSNKETEGEEAVGAKTETEKSGPAVKKDSENPPPPKVE--------------------  484

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
                   V PDNEFEKRIRPEVIPA EIGVTFADIGALD+IKESL ELVMLPLRRPDLFKG
Sbjct  485   ------VAPDNEFEKRIRPEVIPANEIGVTFADIGALDDIKESLQELVMLPLRRPDLFKG  538

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  539   GLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTL  598

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             AAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNR
Sbjct  599   AAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKTGERILVLAATNR  658

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERR+MVGLP+ E RE+ILKTLL+KE V + LD K+LATMTEGY+GSDL
Sbjct  659   PFDLDEAIIRRFERRVMVGLPSVENREMILKTLLSKEKV-ENLDFKELATMTEGYSGSDL  717

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMD  536
             KNLC TAAYRPV +LI+QER KD+EKK+   +  +  DA  T  E+K +R IT+R LNM+
Sbjct  718   KNLCVTAAYRPVMKLIQQERQKDMEKKKREAQGKSTEDASETKEEEKEDREITLRALNME  777

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             D  +AKNQVAASFA+EGS+M+ELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  778   DMRQAKNQVAASFASEGSVMSELKQWNDLYGEGGSRKKQQLTYFL  822



>emb|CAN73743.1| hypothetical protein VITISV_026769 [Vitis vinifera]
Length=825

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/819 (72%), Positives = 673/819 (82%), Gaps = 24/819 (3%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVS+WTG   S +A+T + +E E+L  +VDGR+SK+TFDEFPY+LSEQTRVLLTSAA+V
Sbjct  27    QTVSRWTGLNCSPDAITEEQIEHELLRQVVDGRESKITFDEFPYFLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +DF+KHTRNL+PASR ILLSGPAELYQQ LAKALAH+F AKLLLLDV DFSLK   
Sbjct  87    HLKHSDFSKHTRNLAPASRAILLSGPAELYQQTLAKALAHFFEAKLLLLDVNDFSLKSSK  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             K            SISETTL RMS FLGSFSIL  +EE KGTL RQSSG DI S+ +EG+
Sbjct  147   K------------SISETTLGRMSSFLGSFSILPQREETKGTLSRQSSGADIKSRCMEGA  194

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +NP   RRN+S S++MN + S +TT +   + RTS+ +FDEK L+Q+L KVLV VS+   
Sbjct  195   NNPPKHRRNASTSSDMNTVASQSTTQSSAHVKRTSNWAFDEKRLLQSLCKVLVSVSEARS  254

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD EK L +S++ Y L QKML +LSGSVLILGSR++D  D+ RE+DER+  +FPY
Sbjct  255   IILYIRDVEKFLLQSDRFYKLFQKMLDKLSGSVLILGSRMLDNDDEGREVDERVGLLFPY  314

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+ PE+ET L SWKSQLEE++KM+Q+Q+NKNHI EVLAAND++CDDLGSIC AD+M 
Sbjct  315   NIEIRAPEDETRLDSWKSQLEEELKMLQFQENKNHIAEVLAANDLDCDDLGSICHADSMI  374

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+V+SAISYHLMN KDPEYRN KLVISSKSLSHG+NIF++ K+  GKD LKLE+
Sbjct  375   LSNYIEEIVISAISYHLMNNKDPEYRNGKLVISSKSLSHGLNIFQQGKSG-GKDTLKLET  433

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              AE SK+T+  E     PE KAE+S APGSK ET       +   K    +  A KA EV
Sbjct  434   NAESSKDTEGEESTGGKPEGKAETS-APGSKSET-----EKSALAKKDGENQPATKAAEV  487

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCR
Sbjct  488   PPDNEFEKRIRPEVIPANEIGVTFDDIGALSDIKESLQELVMLPLRRPDLFKGGLLKPCR  547

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  548   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  607

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  608   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKAGERILVLAATNRPFDLDEA  667

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC TA
Sbjct  668   IIRRFERRIMVGLPSVESREMILKTLLAKEK-AEDLDFKELATMTEGYTGSDLKNLCVTA  726

Query  691   AYRPVRELIKQER-LKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAK  518
             AYRPVREL++QER +KD EKK+ A E  +  DA     E K E+ I +RPLNM+D  +AK
Sbjct  727   AYRPVRELLQQERMMKDKEKKQKADEGQSSEDASDAKEEAKEEKEIVLRPLNMEDMRQAK  786

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVA+SFA+EG++MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  787   NQVASSFASEGAVMNELKQWNELYGEGGSRKKKQLTYFL  825



>ref|XP_010924775.1| PREDICTED: peroxisome biosynthesis protein PAS1-like isoform 
X1 [Elaeis guineensis]
Length=839

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/830 (70%), Positives = 674/830 (81%), Gaps = 32/830 (4%)
 Frame = -1

Query  2845  QTVSKW--TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV KW    SS   VT + +E+E++  ++DGRDSKVTFDEFPYYLSEQTR +LTSAA+V
Sbjct  27    QTVGKWGAPASSYAGVTAENIEKELMRQVLDGRDSKVTFDEFPYYLSEQTRAILTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKQLDLSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGSS  +S F+RSISE TL +MS  LGS SIL  +EE KG+LRRQSS +++  +G + +
Sbjct  147   KYGSSNKDSFFRRSISEATLEKMSSLLGSLSILPHREEPKGSLRRQSSSLELRPRGSDSN  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S+   LR+N+S S +MN LTS     NP PL RTSS SFD+K+L+Q+LYKVLV VSK+ P
Sbjct  207   SSMPRLRKNASVSTDMNGLTSQCAPVNPVPLKRTSSWSFDDKVLLQSLYKVLVSVSKSKP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLY+RD E LL RS ++Y L QKML +LSG VLILGSR+++   DY ++D R+SS+FPY
Sbjct  267   IVLYVRDVENLLYRSRRIYSLFQKMLEKLSGPVLILGSRLLESDSDYTDVDGRVSSLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+E HLVSWKSQLEEDMKM+Q QDN+NHI EVLA ND+ECDDLG IC+ADT+ 
Sbjct  327   NIEIKPPEDEAHLVSWKSQLEEDMKMIQIQDNRNHITEVLAENDLECDDLGCICLADTIV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VV+A+SYHLMN K+PEYRN KLVISSKSLSHG++IF+E + + G+D +KLE+
Sbjct  387   LSNYIEEIVVAAVSYHLMNNKEPEYRNGKLVISSKSLSHGLSIFQECRLS-GEDAIKLEA  445

Query  1591  KAELSKETQ-------SGEKGSKG-----PETKAESS-TAPGSKPETGsaapapapttkd  1451
               E  KE         + EK  +G     PE K+E+  TAPG K   GS           
Sbjct  446   NVESGKEAVNEDGAAVAAEKAERGAEVLPPENKSEAEKTAPGVKDSEGS-----------  494

Query  1450  atsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRR  1271
                     KAPEV PDNEFEKRIRPEVIPA EIGVTF DIGALDEIKESL ELVMLPLRR
Sbjct  495   ----SLPPKAPEVSPDNEFEKRIRPEVIPANEIGVTFNDIGALDEIKESLQELVMLPLRR  550

Query  1270  PDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNV  1091
             PDLF GGLLKPCRGILLFGP GTGKTMLAKAIA EAG+SFINVSMSTITSKWFGEDEKNV
Sbjct  551   PDLFNGGLLKPCRGILLFGPSGTGKTMLAKAIANEAGSSFINVSMSTITSKWFGEDEKNV  610

Query  1090  RALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILV  911
             RALFTLA+KV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT+ GERILV
Sbjct  611   RALFTLASKVAPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTRSGERILV  670

Query  910   LAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEG  731
             LAATNRPFDLDEAIIRRFERRIMVGLP+ + RELIL+ LL+KE V + LD K+LATMTEG
Sbjct  671   LAATNRPFDLDEAIIRRFERRIMVGLPSVDSRELILRKLLSKEKVEEGLDYKELATMTEG  730

Query  730   YTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIR  551
             Y+GSDLKNLC TAAYRPVRELI++ERLK++EK++ A E      A    E+ GE+ I +R
Sbjct  731   YSGSDLKNLCVTAAYRPVRELIQRERLKELEKRK-AGEGEGSAGASENREEDGEKTIILR  789

Query  550   PLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             PLNM+D  +AKNQVAASFAAEGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  790   PLNMEDLRQAKNQVAASFAAEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  839



>ref|XP_010917036.1| PREDICTED: uncharacterized protein LOC105041713 isoform X3 [Elaeis 
guineensis]
Length=808

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/820 (69%), Positives = 664/820 (81%), Gaps = 43/820 (5%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKW    SSS  VT + +E+E++  +VDGR+ KVTFDEFPYYLSEQTR LLTSAA+V
Sbjct  27    QTVSKWAAPASSSAGVTAENIEKELMRMVVDGREGKVTFDEFPYYLSEQTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK AD +K TRNLSPAS+ ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKQADLSKFTRNLSPASQAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPSKGI  2321
             KYGSS  +S F+RS+SE TL RMS  LGSFSIL  +EE +   G+L RQ+S V++  +G 
Sbjct  147   KYGSSNKDSFFRRSVSEATLERMSSLLGSFSILAQREEPRVIAGSLHRQNSCVELRPRGS  206

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             + +S  T L +N+S SA+M+ LTS     NP PL R+SS SFDEK+L+Q+LYKVLV VSK
Sbjct  207   DSNSYMTKLHKNASVSADMHGLTSQCAPINPVPLKRSSSWSFDEKILLQSLYKVLVSVSK  266

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
             + P+VLY+RD E LL RS+++Y L QKML++L G VLILGSR+++   DYR++D R+ ++
Sbjct  267   SNPVVLYIRDVENLLYRSQRIYSLFQKMLKKLPGPVLILGSRLLESDGDYRDMDGRVGNL  326

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPYNIEIKPPE+ETHLVSWKSQLEEDM+M+Q QDN+NHI  VLA ND+ECDDLGSIC+ D
Sbjct  327   FPYNIEIKPPEDETHLVSWKSQLEEDMRMIQIQDNRNHITGVLAENDLECDDLGSICLVD  386

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             T+ LSNYIEE+VVSA+SYHLMN K+PEYRN KL+ISSKSLSHG++IF+E + + G+D LK
Sbjct  387   TVVLSNYIEEIVVSAVSYHLMNNKEPEYRNGKLIISSKSLSHGLSIFQESRRS-GEDTLK  445

Query  1600  LESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             LE+  E  KET              + + A  +KPE                        
Sbjct  446   LEANVESGKET-----------VDEDGAAAAVAKPE------------------------  470

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
              EV PDNEFEKRIR EVIPA EIGVTF DIGALDE+KESL ELVMLPLRRPDLF GGLLK
Sbjct  471   -EVAPDNEFEKRIRQEVIPASEIGVTFNDIGALDEVKESLQELVMLPLRRPDLFTGGLLK  529

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMST+TSKWFGEDEKNVRALFTLAAKV
Sbjct  530   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTVTSKWFGEDEKNVRALFTLAAKV  589

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             +PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM HWDGLLTK GERILVLAATNRPFDL
Sbjct  590   APTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMMHWDGLLTKSGERILVLAATNRPFDL  649

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELIL+ LL+KE V + LD +++AT TEGY+GSDLKNLC
Sbjct  650   DEAIIRRFERRIMVGLPSVESRELILRKLLSKEKVEE-LDYREIATTTEGYSGSDLKNLC  708

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
              TAAYRPVRELI++ERLK++EKK+ A+E  +  ++    E+ GE+ +T+RPLNM+D  +A
Sbjct  709   VTAAYRPVRELIQRERLKELEKKQKAEEGDSSAESSENREEDGEQTVTLRPLNMEDLRQA  768

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFA +GS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  769   KNQVAASFACDGSVMSELKQWNDLYGEGGSRKKQQLSYFL  808



>ref|XP_011022599.1| PREDICTED: uncharacterized protein LOC105124323 [Populus euphratica]
Length=834

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/822 (71%), Positives = 676/822 (82%), Gaps = 19/822 (2%)
 Frame = -1

Query  2845  QTVSKWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             +TVSKW G +++A   +  + MEQE+L  ++DGR+S VTFD+FPYY SEQTRVLLTSAA+
Sbjct  25    KTVSKWRGDAASACKGINSETMEQELLEQVIDGRESGVTFDQFPYYRSEQTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+ +K+TR LSPASRTILLSGPAE Y QMLAKALAH+F AK LLLD TDFSLK+Q
Sbjct  85    VHLKHAEVSKYTRKLSPASRTILLSGPAEPYLQMLAKALAHFFEAKFLLLDATDFSLKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG+++ ES FKR  SETTL R+S F GSFSIL  KEE KGTLRRQSSGVDIPS+G++ 
Sbjct  145   SKYGANK-ESLFKRFTSETTLERLSGFFGSFSILPQKEEPKGTLRRQSSGVDIPSRGLDS  203

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S NP  +RRNSSA+AN++N  + +T +N  P    SS SFDEK+L+Q+LYKVLV VSKT 
Sbjct  204   SHNPPKIRRNSSAAANLSNEFTQSTPANTAPSRHMSSWSFDEKILVQSLYKVLVYVSKTS  263

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD EK+  RS ++Y L QKM  +LSGSVLILGSR+V+  +D RE+DERL+++FP
Sbjct  264   PIVLYLRDVEKISFRSNRIYNLFQKMFDKLSGSVLILGSRVVNLSNDSREVDERLTALFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEIKPPE+ETHLVS+K++LEEDMKM+Q +DN+NHI+EVL+AND++CDDL S+C+ADTM
Sbjct  324   YNIEIKPPEDETHLVSFKNRLEEDMKMIQVRDNRNHIVEVLSANDLDCDDLDSVCVADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
             ALSNYIEE+VVSAISYHLMN+K PEYRN KLV+SSK LSHG++IF+E K+  GKD LKLE
Sbjct  384   ALSNYIEEIVVSAISYHLMNSKYPEYRNEKLVVSSKGLSHGLSIFQESKST-GKDSLKLE  442

Query  1594  SKAELSK---ETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
             +KAE SK      + + G+K     AE+ +    K  +G  A               A K
Sbjct  443   AKAETSKVLCTHVTMKPGTKAVGVNAENKSE-AEKKASGVKADGEDSL--------PASK  493

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             A  VPPDNEFEKRIRPEVIP  EI VTF DIGAL+E KESL ELVMLPLRRPDLFKG LL
Sbjct  494   ARGVPPDNEFEKRIRPEVIPPNEINVTFTDIGALEETKESLQELVMLPLRRPDLFKGELL  553

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK
Sbjct  554   KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  613

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLT  G+RILVLAATNRPFD
Sbjct  614   VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTHQGQRILVLAATNRPFD  673

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEA+IRRFERRIMVGLP+ E RE ILKTLL KE V + +D K+LATMTEGY+GSDLKNL
Sbjct  674   LDEAMIRRFERRIMVGLPSSEHRESILKTLLGKEKV-EGIDFKKLATMTEGYSGSDLKNL  732

Query  703   CTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFM  527
             CTTAAYRPVRELI+QERLKD+ K + A+     G+A  T  E+K ERVI +RPL MDDF 
Sbjct  733   CTTAAYRPVRELIQQERLKDLVKNQRAEAAQKLGEATDTKGEEKEERVINLRPLTMDDFE  792

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              AKNQVAASFAA G+ MNELKQWN L+GEGGSRKK+QL YFL
Sbjct  793   LAKNQVAASFAAGGASMNELKQWNELFGEGGSRKKQQLAYFL  834



>ref|XP_006573796.1| PREDICTED: uncharacterized protein LOC100808011 isoform X2 [Glycine 
max]
 gb|KHN25668.1| ATPase family AAA domain-containing protein 1-A [Glycine soja]
Length=838

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 572/825 (69%), Positives = 666/825 (81%), Gaps = 26/825 (3%)
 Frame = -1

Query  2839  VSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             V+KW     SSSN VT + ME+EM   +VDGR+SKVTFD+FPYYL EQTRVLLTSAA+VH
Sbjct  28    VTKWGANEYSSSNGVTPENMEREMQRLVVDGRESKVTFDQFPYYLREQTRVLLTSAAYVH  87

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             LK A+ +++TRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLD+TDFSLK+QS+
Sbjct  88    LKHAEVSRYTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDLTDFSLKIQSR  147

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YGS+  ESSFKRS SETTL R+S+  GSFSI Q +E  KG   RQ SGVD+ S   EGSS
Sbjct  148   YGSANKESSFKRSTSETTLERLSDLFGSFSIFQQREVPKGNFHRQCSGVDLRSLQAEGSS  207

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             NP  +RRN+SASAN+++L S +  +N  P    +S  FDEKLLIQ LYKVLV VSKT PI
Sbjct  208   NPPKMRRNASASANISSLASQSNPTNSAPQKHITSWPFDEKLLIQTLYKVLVYVSKTYPI  267

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             VLYLRD + LL RS+++Y L Q ML +L G +LILGSR++D G DY+E++ERL+S+FPYN
Sbjct  268   VLYLRDVDNLLNRSQRIYNLFQTMLNKLHGPILILGSRVLDSGSDYKEVNERLASLFPYN  327

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEI PPE+E+ L+SWKSQ EEDMK +Q QDN+NHIMEVLAAND++CDDL SIC+ADT+ L
Sbjct  328   IEISPPEDESCLMSWKSQFEEDMKKIQIQDNRNHIMEVLAANDLDCDDLDSICVADTVVL  387

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE+VVSAISY+LMN+KDPEYRN KLVI   SLSH + IF+E K +  +D LKLE++
Sbjct  388   SNYIEEIVVSAISYYLMNSKDPEYRNGKLVIPCNSLSHALGIFQEGKFSV-RDTLKLEAQ  446

Query  1588  AELSKETQSG----EKGSKGP--ETKAESSTAPGSKPETGsaapapapttkdatsSGTAV  1427
             A  S+  +      EK ++ P  + KAES T+  S  +T      P              
Sbjct  447   AVTSQREEGALVEPEKKAENPASDIKAESDTSSTSVVKTDGENAVPESKV----------  496

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
                EVPPDNEFEKRIRPEVIPA EIGV F+D+GALDE KESL ELVMLPLRRPDLF+GGL
Sbjct  497   ---EVPPDNEFEKRIRPEVIPANEIGVKFSDVGALDETKESLQELVMLPLRRPDLFRGGL  553

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPC+GILLFGPPGTGKTMLAKAIA E+GASFINVSMST+TSKWFGEDEKNVRALFTLAA
Sbjct  554   LKPCKGILLFGPPGTGKTMLAKAIASESGASFINVSMSTVTSKWFGEDEKNVRALFTLAA  613

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+T  GERILVLAATNRPF
Sbjct  614   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTNSGERILVLAATNRPF  673

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVG+P+ E RE IL+TLLAKE V + LD K++ATM EGY+GSDLKN
Sbjct  674   DLDEAIIRRFERRIMVGMPSVENREKILRTLLAKEKVDEKLDFKEVATMAEGYSGSDLKN  733

Query  706   LCTTAAYRPVRELIKQERLKDVEKKRLAQECPN--CGDA-PTANEDKGERVITIRPLNMD  536
             LCTTAAYRPVRELI+QERLK +EKK+      N    DA  T  E + ERVIT+RPLNM 
Sbjct  734   LCTTAAYRPVRELIQQERLKTLEKKQQGAGGQNNDVQDALDTEEEVQQERVITLRPLNMQ  793

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             DF EAK+QVAAS+AAEG+ MNELKQWN LYGEGGSRK++QL+YFL
Sbjct  794   DFKEAKSQVAASYAAEGAGMNELKQWNELYGEGGSRKQQQLSYFL  838



>ref|XP_007160120.1| hypothetical protein PHAVU_002G294200g [Phaseolus vulgaris]
 gb|ESW32114.1| hypothetical protein PHAVU_002G294200g [Phaseolus vulgaris]
Length=853

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/831 (71%), Positives = 677/831 (81%), Gaps = 24/831 (3%)
 Frame = -1

Query  2839  VSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             V KW  +S  SNA+T + MEQEML  +VDGR+S VTF++FPYYLSEQTRVLLTS A+VHL
Sbjct  29    VGKWGANSFSSNAITAEKMEQEMLRQVVDGRESNVTFEKFPYYLSEQTRVLLTSVAYVHL  88

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QSKY
Sbjct  89    KHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFDAKLLLLDLTDFSLKIQSKY  148

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             GSS  ESSFKRS SETTL R+S+ +GSFSI   +EE KG + R SSG+D+ S G E S N
Sbjct  149   GSSNKESSFKRSTSETTLERLSDLIGSFSIFSQREEPKGKMYRPSSGMDLQSMGAEASCN  208

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P  LRRN+S+S+N++ L S    +N  PL RT+S SFDEKLLIQ+LYKVLV VSKT PIV
Sbjct  209   PPPLRRNASSSSNISGLASQTNATNSAPLKRTTSWSFDEKLLIQSLYKVLVFVSKTYPIV  268

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD +KLL + +++Y L QKML++LSG +LILGSR++D G+DY E++E+L S+FPY +
Sbjct  269   LYLRDVDKLLYKWQRIYYLFQKMLKKLSGPILILGSRVIDCGNDYEEVNEKLDSLFPYTV  328

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             E++PPE+E+ LVSWKSQLEEDMKM+Q QDN+NHIMEVLAAND++ DDL SIC+ DTM LS
Sbjct  329   EVRPPEDESRLVSWKSQLEEDMKMIQVQDNRNHIMEVLAANDLDSDDLDSICVEDTMVLS  388

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE++VSAIS HLM  KDPEYRN KL+ISS SLSH ++IF + K++ G D LKLE +A
Sbjct  389   NYIEEIIVSAISCHLMKNKDPEYRNGKLLISSNSLSHALSIFHKGKSSKG-DTLKLEDQA  447

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPP  1406
              +  E Q  E       TK+E++ AP  K E   +       ++ +     A KAPEVPP
Sbjct  448   -VKSEKQREEGTDMKSGTKSENA-APVKKAEAEISTSVAKAASEKSV---PAPKAPEVPP  502

Query  1405  DNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGI  1226
             DNEFEKRIRPEVIPA EI VTF+DIGALDE KESL ELVMLPLRRPDLF GGLLKPCRGI
Sbjct  503   DNEFEKRIRPEVIPANEIDVTFSDIGALDETKESLQELVMLPLRRPDLFTGGLLKPCRGI  562

Query  1225  LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  1046
             LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII
Sbjct  563   LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  622

Query  1045  FVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAII  866
             FVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEAII
Sbjct  623   FVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDEAII  682

Query  865   RRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAY  686
             RRFERRIMV LP+ E RE ILKTLLAKE V   LD K+LA MTEGYTGSDLKNLCTTAAY
Sbjct  683   RRFERRIMVPLPSVENREKILKTLLAKEKVDNELDFKELANMTEGYTGSDLKNLCTTAAY  742

Query  685   RPVRELIKQERLKDVEKKRLAQECPN------CGDAPTA--NED--------KGERVITI  554
             RPVRELI+QERLK ++KK+ A +  N       G+   A  N+D        + ERVIT+
Sbjct  743   RPVRELIQQERLKSLDKKQKAAKKQNDYVKDSQGEPSIAGTNQDGTSGEEEIEQERVITL  802

Query  553   RPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             RPLN  DF EAKNQVAASFAAEG+ M+ELKQWN+LYGEGGSRK++QL+YFL
Sbjct  803   RPLNKQDFKEAKNQVAASFAAEGAGMSELKQWNDLYGEGGSRKQQQLSYFL  853



>ref|XP_004511541.1| PREDICTED: ribosome biogenesis ATPase RIX7-like isoform X1 [Cicer 
arietinum]
Length=835

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/818 (70%), Positives = 660/818 (81%), Gaps = 12/818 (1%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V+KW  +  SSNA+T + +E EML  IVDGR+S VTFD FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVTKWGANPFSSNAITPEKIEHEMLRLIVDGRESNVTFDNFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +++TRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKHAEVSRYTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             +YGS+  E++FKRS SE TL R+S+  GSFSI   +EE+KG + RQSSGVD+ S   EGS
Sbjct  147   RYGSANKETTFKRSASEKTLERLSDLFGSFSIFPQREERKGKIHRQSSGVDLRSMETEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S P   R  S+++   N     N T N  P    S+ SFDE+LLIQ LYKVLV VSKT P
Sbjct  207   SIPPIRRNASASANISNLGLQNNPT-NSAPGKHISNWSFDERLLIQTLYKVLVFVSKTYP  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD +KLLCRS+++  L Q ML +LSG +LILGS ++D G+D +E+DE L+S+FPY
Sbjct  266   IVLYLRDVDKLLCRSQRISKLFQTMLTKLSGPILILGSLVLDSGNDCKEVDETLTSLFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E+ LVSWKSQ EEDMK +Q QDNKNHIMEVLAAND++C DL S+C+ DTM 
Sbjct  326   NIEIRPPEDESRLVSWKSQFEEDMKKIQIQDNKNHIMEVLAANDLDCHDLDSVCVEDTML  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN K+PEYRN KLV+   SLSH + IF+  K + G+D LKLE+
Sbjct  386   LSNYIEEIVVSAISYHLMNNKEPEYRNGKLVVPCNSLSHALGIFQAGKFS-GRDTLKLEA  444

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +A  S++ + G      PE K+  S APG K E            +++  +  A    EV
Sbjct  445   QAVTSEQREEGV--VVKPEGKS-GSAAPGIKTEAEIPTSVGKTDGENSVPASKA----EV  497

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTF+DIGAL+E KESL ELVMLPLRRPDLF+GGLLKPCR
Sbjct  498   PPDNEFEKRIRPEVIPANEIGVTFSDIGALEETKESLQELVMLPLRRPDLFEGGLLKPCR  557

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  558   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  617

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+ WDGL +KP +RILVLAATNRPFDLDEA
Sbjct  618   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTSWDGLTSKPEDRILVLAATNRPFDLDEA  677

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE I+KTLLAKE V + LD K+LATMTEGY+GSDLKNLCTTA
Sbjct  678   IIRRFERRIMVGLPSVENRENIMKTLLAKEKVDEGLDFKELATMTEGYSGSDLKNLCTTA  737

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAKN  515
             AYRPVRELI++E  KD EKK+   E  N  DA    E+ K ERVIT+RPLNM DF  AK+
Sbjct  738   AYRPVRELIQKEIQKDSEKKKKDAEGQNSEDAQDGEEEVKQERVITLRPLNMQDFKVAKS  797

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  798   QVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  835



>ref|XP_011076079.1| PREDICTED: nuclear valosin-containing protein-like [Sesamum indicum]
Length=838

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 566/818 (69%), Positives = 668/818 (82%), Gaps = 11/818 (1%)
 Frame = -1

Query  2839  VSKWTGSSSNAVTVDI----MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             V +WTG SS+AV   I    +E E+L  + DG++SKVTF++FPYYLSE+TRVLLT+AA+V
Sbjct  27    VGRWTGGSSSAVREGISAEEIELELLKLVSDGKESKVTFEDFPYYLSERTRVLLTNAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +KHTRNLSPASR ILLSGPAELYQQMLAKALAHYF AKL+LLD+ DFSLK+QS
Sbjct  87    HLKHFDVSKHTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLILLDINDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ + S KRSISE TL RMS FLGSFSIL    + +GTL RQ SG+D   +  EG 
Sbjct  147   KYGLTKKDPSLKRSISEATLERMSSFLGSFSILPHTIDNRGTLPRQRSGLDATIRNTEGV  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +N    RR SS S++M+++++ +++SNP    R SS SFDE+  +Q+LYKV+V VS+T  
Sbjct  207   NNSLRHRRTSSVSSDMSSISALSSSSNPALSKRISSWSFDERAFLQSLYKVMVSVSQTSC  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY+RD E+   +S ++Y L  K+L++++GSVL+LGSRI+D  +D  E+DERL  +FPY
Sbjct  267   VILYIRDVERNFLQSSRIYKLFDKLLKKITGSVLVLGSRILDLDEDSGEVDERLRLLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+ETHLVSWK+QLEEDM+ +Q QDNKNHI EVLA ND+ECDDLGSIC ADTM 
Sbjct  327   NIEIRPPEDETHLVSWKTQLEEDMRRIQLQDNKNHIAEVLAENDLECDDLGSICHADTMV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN K+PEYRN KLVISS SLSHG++IF+  K+  GKD LK+++
Sbjct  387   LSNYIEEIVVSAISYHLMNNKNPEYRNGKLVISSNSLSHGLSIFQGGKSG-GKDTLKMDT  445

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              AE  K T+  E     PE+K+E+ T+     E+   A     +TK    +    K PE 
Sbjct  446   NAECFKGTEVKENAGAKPESKSENPTS-----ESRGEAEKSTSSTKSDGENAVISKPPEA  500

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTF+DIGALDEIKESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  501   PPDNEFEKRIRPEVIPANEIGVTFSDIGALDEIKESLQELVMLPLRRPDLFNGGLLKPCR  560

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  561   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  620

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEA
Sbjct  621   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEA  680

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+IL+TLLAKE V + LD K+LA MTEGY+GSDLKNLC TA
Sbjct  681   IIRRFERRIMVGLPSVENREMILRTLLAKENVEEDLDFKELAAMTEGYSGSDLKNLCVTA  740

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAKN  515
             AYRPVRELI+QER KD EKK+   E  +  DA   NE+ K E+VI++RPLNM+D  +AKN
Sbjct  741   AYRPVRELIQQERQKDKEKKQRDVEGESSKDASATNEETKEEKVISLRPLNMEDMRQAKN  800

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+M+ELKQWN LYGEGGSRKK+QL+YFL
Sbjct  801   QVAASFASEGSVMSELKQWNELYGEGGSRKKQQLSYFL  838



>ref|XP_004511542.1| PREDICTED: ribosome biogenesis ATPase RIX7-like isoform X2 [Cicer 
arietinum]
Length=834

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 571/818 (70%), Positives = 660/818 (81%), Gaps = 13/818 (2%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q+V+KW  +  SSNA+T + +E EML  IVDGR+S VTFD FPYYLSEQTRVLLTSAA+V
Sbjct  27    QSVTKWGANPFSSNAITPEKIEHEMLRLIVDGRESNVTFDNFPYYLSEQTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +++TRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKHAEVSRYTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             +YGS+  E++FKRS SE TL R+S+  GSFSI   +EE+KG + RQSSGVD+ S   EGS
Sbjct  147   RYGSANKETTFKRSASEKTLERLSDLFGSFSIFPQREERKGKIHRQSSGVDLRSMETEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S P   R  S+++   N     N T N  P    S+ SFDE+LLIQ LYKVLV VSKT P
Sbjct  207   SIPPIRRNASASANISNLGLQNNPT-NSAPGKHISNWSFDERLLIQTLYKVLVFVSKTYP  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD +KLLCRS+++  L Q ML +LSG +LILGS ++D G+D +E+DE L+S+FPY
Sbjct  266   IVLYLRDVDKLLCRSQRISKLFQTMLTKLSGPILILGSLVLDSGNDCKEVDETLTSLFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E+ LVSWKSQ EEDMK +Q QDNKNHIMEVLAAND++C DL S+C+ DTM 
Sbjct  326   NIEIRPPEDESRLVSWKSQFEEDMKKIQIQDNKNHIMEVLAANDLDCHDLDSVCVEDTML  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN K+PEYRN KLV+   SLSH + IF+  K + G+D LKLE+
Sbjct  386   LSNYIEEIVVSAISYHLMNNKEPEYRNGKLVVPCNSLSHALGIFQAGKFS-GRDTLKLEA  444

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +A ++ E + G      PE K+  S APG K E            +++  +  A    EV
Sbjct  445   QA-VTSEREEGV--VVKPEGKS-GSAAPGIKTEAEIPTSVGKTDGENSVPASKA----EV  496

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGVTF+DIGAL+E KESL ELVMLPLRRPDLF+GGLLKPCR
Sbjct  497   PPDNEFEKRIRPEVIPANEIGVTFSDIGALEETKESLQELVMLPLRRPDLFEGGLLKPCR  556

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  557   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  616

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+ WDGL +KP +RILVLAATNRPFDLDEA
Sbjct  617   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTSWDGLTSKPEDRILVLAATNRPFDLDEA  676

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE I+KTLLAKE V + LD K+LATMTEGY+GSDLKNLCTTA
Sbjct  677   IIRRFERRIMVGLPSVENRENIMKTLLAKEKVDEGLDFKELATMTEGYSGSDLKNLCTTA  736

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAKN  515
             AYRPVRELI++E  KD EKK+   E  N  DA    E+ K ERVIT+RPLNM DF  AK+
Sbjct  737   AYRPVRELIQKEIQKDSEKKKKDAEGQNSEDAQDGEEEVKQERVITLRPLNMQDFKVAKS  796

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  797   QVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  834



>ref|XP_007160121.1| hypothetical protein PHAVU_002G294200g [Phaseolus vulgaris]
 gb|ESW32115.1| hypothetical protein PHAVU_002G294200g [Phaseolus vulgaris]
Length=855

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/833 (70%), Positives = 677/833 (81%), Gaps = 26/833 (3%)
 Frame = -1

Query  2839  VSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             V KW  +S  SNA+T + MEQEML  +VDGR+S VTF++FPYYLSEQTRVLLTS A+VHL
Sbjct  29    VGKWGANSFSSNAITAEKMEQEMLRQVVDGRESNVTFEKFPYYLSEQTRVLLTSVAYVHL  88

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K A+ +K+TRNL+PASRTILLSGPAELYQQMLAKALAHYF AKLLLLD+TDFSLK+QSKY
Sbjct  89    KHAEVSKYTRNLAPASRTILLSGPAELYQQMLAKALAHYFDAKLLLLDLTDFSLKIQSKY  148

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKGIEGS  2312
             GSS  ESSFKRS SETTL R+S+ +GSFSI   +EE K  G + R SSG+D+ S G E S
Sbjct  149   GSSNKESSFKRSTSETTLERLSDLIGSFSIFSQREEPKVAGKMYRPSSGMDLQSMGAEAS  208

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  LRRN+S+S+N++ L S    +N  PL RT+S SFDEKLLIQ+LYKVLV VSKT P
Sbjct  209   CNPPPLRRNASSSSNISGLASQTNATNSAPLKRTTSWSFDEKLLIQSLYKVLVFVSKTYP  268

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLYLRD +KLL + +++Y L QKML++LSG +LILGSR++D G+DY E++E+L S+FPY
Sbjct  269   IVLYLRDVDKLLYKWQRIYYLFQKMLKKLSGPILILGSRVIDCGNDYEEVNEKLDSLFPY  328

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
              +E++PPE+E+ LVSWKSQLEEDMKM+Q QDN+NHIMEVLAAND++ DDL SIC+ DTM 
Sbjct  329   TVEVRPPEDESRLVSWKSQLEEDMKMIQVQDNRNHIMEVLAANDLDSDDLDSICVEDTMV  388

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE++VSAIS HLM  KDPEYRN KL+ISS SLSH ++IF + K++ G D LKLE 
Sbjct  389   LSNYIEEIIVSAISCHLMKNKDPEYRNGKLLISSNSLSHALSIFHKGKSSKG-DTLKLED  447

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             +A +  E Q  E       TK+E++ AP  K E   +       ++ +     A KAPEV
Sbjct  448   QA-VKSEKQREEGTDMKSGTKSENA-APVKKAEAEISTSVAKAASEKSV---PAPKAPEV  502

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EI VTF+DIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  503   PPDNEFEKRIRPEVIPANEIDVTFSDIGALDETKESLQELVMLPLRRPDLFTGGLLKPCR  562

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  563   GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  622

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  623   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKQGERILVLAATNRPFDLDEA  682

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMV LP+ E RE ILKTLLAKE V   LD K+LA MTEGYTGSDLKNLCTTA
Sbjct  683   IIRRFERRIMVPLPSVENREKILKTLLAKEKVDNELDFKELANMTEGYTGSDLKNLCTTA  742

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPN------CGDAPTA--NED--------KGERVI  560
             AYRPVRELI+QERLK ++KK+ A +  N       G+   A  N+D        + ERVI
Sbjct  743   AYRPVRELIQQERLKSLDKKQKAAKKQNDYVKDSQGEPSIAGTNQDGTSGEEEIEQERVI  802

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             T+RPLN  DF EAKNQVAASFAAEG+ M+ELKQWN+LYGEGGSRK++QL+YFL
Sbjct  803   TLRPLNKQDFKEAKNQVAASFAAEGAGMSELKQWNDLYGEGGSRKQQQLSYFL  855



>ref|XP_009368710.1| PREDICTED: nuclear valosin-containing protein-like [Pyrus x bretschneideri]
Length=833

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/827 (69%), Positives = 678/827 (82%), Gaps = 32/827 (4%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VSKW     S++ VT + +EQE++  +VDGRDSKVTF+EFPYYL E+TR+LLTSAA+V
Sbjct  27    QAVSKWVNGNCSADEVTAEQIEQELMRQVVDGRDSKVTFEEFPYYLRERTRMLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +KHTRNLSPASR ILLSGPAELY QMLAKALAHYF +KLLLLD+TDFS+K+QS
Sbjct  87    HLKHSDLSKHTRNLSPASRAILLSGPAELYHQMLAKALAHYFESKLLLLDITDFSIKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ ES  KRSISE TL +MS  LGSFS+L  + + KG L RQSS  D+ S+G EG 
Sbjct  147   KYGCAKRESHHKRSISEVTLEQMSNLLGSFSMLPSRGDTKGALFRQSSSSDLKSRGTEG-  205

Query  2311  SNPT-TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
               PT TL+RN+S++++M++++S + + +  PL R S   FDEKL + +LYKVL  +S+T 
Sbjct  206   --PTRTLQRNASSASDMSSISSKSASPSSAPLKRVSKWCFDEKLFLLSLYKVLSSISETG  263

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LY+RD EKL  +S ++Y L  KM++RLSGSVLILGSR+VD  DD +E+DE+L+ +FP
Sbjct  264   SIILYIRDVEKLFLQSRRLYNLFNKMVKRLSGSVLILGSRMVDAEDDCKEVDEKLAVLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+ETHLVSWKSQLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDETHLVSWKSQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+V+SA+SYHLM  KDPEYRN KLVISS+SLSHG++IF+E K+  GKD LKLE
Sbjct  384   VLSNYIEEIVISALSYHLMQNKDPEYRNGKLVISSRSLSHGLSIFQEGKSG-GKDSLKLE  442

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP-  1418
             + A+ +K+T+  E      E+K+E++ AP +K E                 SG  VK   
Sbjct  443   TNADSNKKTEGEEAVGAKTESKSETA-APENKGEA--------------EKSGPVVKKDS  487

Query  1417  --------EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDL  1262
                     EV PDNEFEKRIRPEVIPA EIGVTFADIGALD+IKESL ELVMLPLRRPDL
Sbjct  488   ENPPPPKVEVAPDNEFEKRIRPEVIPANEIGVTFADIGALDDIKESLQELVMLPLRRPDL  547

Query  1261  FKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRAL  1082
             FKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRAL
Sbjct  548   FKGGLLKPCRGILLFGPPGTGKTMLAKAIASEAGASFINVSMSTITSKWFGEDEKNVRAL  607

Query  1081  FTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAA  902
             FTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAA
Sbjct  608   FTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKTGERILVLAA  667

Query  901   TNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTG  722
             TNRPFDLDEAIIRRFERR+M+GLP+ E RE+IL+TLL+KE V + LD K+LATMTEGY+G
Sbjct  668   TNRPFDLDEAIIRRFERRVMIGLPSVENREMILRTLLSKERV-ENLDFKELATMTEGYSG  726

Query  721   SDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLN  542
             SDLKNLC TAAYRPVRELIKQER KD+EKK+   E  +  +A    E++ ERVIT+R LN
Sbjct  727   SDLKNLCVTAAYRPVRELIKQERQKDMEKKKKDAEEKSTEEASEPKEEEEERVITLRALN  786

Query  541   MDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             M+D  +AKNQVAASFA+EGS+M+ELKQWN LYGEGGSRKK+QLTYF+
Sbjct  787   MEDMRQAKNQVAASFASEGSVMSELKQWNELYGEGGSRKKQQLTYFM  833



>emb|CDP05122.1| unnamed protein product [Coffea canephora]
Length=840

 Score =  1109 bits (2869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 573/828 (69%), Positives = 677/828 (82%), Gaps = 26/828 (3%)
 Frame = -1

Query  2845  QTVSKWTG----SSSNA--------VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQT  2702
             QTVS+W+G    S +NA        +T D ++ E+L  I+ G+DS+V+FD+FPYYLSE+T
Sbjct  26    QTVSRWSGINNYSDNNAWATAAPDGITGDQIQLELLRLIIPGKDSQVSFDDFPYYLSERT  85

Query  2701  RVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLD  2522
             RVLLTSAA+VHL+  D  KHTRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLD
Sbjct  86    RVLLTSAAYVHLRHLDAIKHTRNLSPASRAILLSGPAELYQQMLAKALAHHFDAKLLLLD  145

Query  2521  VTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGV  2342
             +TDFSLK+QSKYG+++ E SFKRSISE TL +MS  LGSFSI+    + +GTL RQSSG 
Sbjct  146   ITDFSLKMQSKYGTAKREPSFKRSISELTLEKMSSLLGSFSIIANSVDNRGTLARQSSGF  205

Query  2341  DIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYK  2162
             D   +  EG ++    RRNSS S++M++++S +++SN  P  R +S  FDEK+ +Q+L+K
Sbjct  206   DSKLRHTEGVNHSLKHRRNSSVSSDMSSISSQSSSSNSAPPKRITSWCFDEKIFLQSLHK  265

Query  2161  VLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYREL  1982
             VLV VSK+  I+LY+RD E+LL +S ++  L  +ML++L+GS+++LGSR++DP DD  ++
Sbjct  266   VLVSVSKSSCIILYIRDVERLLLQSSRLCKLFDRMLKKLTGSIVVLGSRMLDPEDDCGDV  325

Query  1981  DERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDL  1802
             DER+S +FPY+IEI+PPE+ETHLVSWK+QLEEDMK +Q QDNKNHI EVL AND+ CDDL
Sbjct  326   DERISLLFPYDIEIRPPEDETHLVSWKAQLEEDMKKIQIQDNKNHIAEVLEANDLVCDDL  385

Query  1801  GSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTA  1622
             GSIC ADT+ LSNYIEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E K  
Sbjct  386   GSICQADTVILSNYIEEIVVSAISYHLMNNKDPEYRNGKLLISSKSLSHGLSIFQEGK--  443

Query  1621  AGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdats  1442
              GKD +KLE+ AE SK    G +G +    K+E +    +K ET           K    
Sbjct  444   GGKDTIKLEASAESSK----GPEGEENVGLKSEPNPTSENKTET------EKSVPKKDGE  493

Query  1441  SGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDL  1262
             +  A KAP+VPPDNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDL
Sbjct  494   NPPAPKAPDVPPDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDL  553

Query  1261  FKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRAL  1082
             F+GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRAL
Sbjct  554   FQGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRAL  613

Query  1081  FTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAA  902
             FTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLTKPGERILVLAA
Sbjct  614   FTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAA  673

Query  901   TNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTG  722
             TNRPFDLDEAIIRRFERRIMVGLP+ E RE+IL+TLL+KE V + LD K+LA MTEGY+G
Sbjct  674   TNRPFDLDEAIIRRFERRIMVGLPSVESREMILRTLLSKEKV-EDLDFKELAAMTEGYSG  732

Query  721   SDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPL  545
             SDLKNLC TAAYRPVRELI+QER KD+EKK+ A+E  +  DA   NE+ K E VI +RPL
Sbjct  733   SDLKNLCITAAYRPVRELIQQERKKDMEKKQRAEEGQSSEDADDRNEEAKEESVIALRPL  792

Query  544   NMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NM D  +AKNQVAASFA+EGSIM ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  793   NMGDIRQAKNQVAASFASEGSIMAELKQWNDLYGEGGSRKKQQLSYFL  840



>ref|XP_008360307.1| PREDICTED: uncharacterized protein LOC103424023 [Malus domestica]
Length=838

 Score =  1108 bits (2866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/825 (71%), Positives = 672/825 (81%), Gaps = 23/825 (3%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKWTG+   SN VT D +EQE+L  IVDGRDSKVTFD+FPYYLSEQTR L+TSAA+V
Sbjct  27    QTMSKWTGNDTMSNGVTPDRVEQELLRQIVDGRDSKVTFDQFPYYLSEQTRALITSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K+TRNLSPASR ILLSGPAELYQQ LAKAL+HYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKRAEVSKYTRNLSPASRAILLSGPAELYQQ-LAKALSHYFQAKLLLLDVTDFSLKIQS  145

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEK-KGTLRRQSSGVDIPSKGIEG  2315
             KYG++   SSFKRS SE  L R+S   GSFS+   +EE  +GTLRRQSS VD+ S G+EG
Sbjct  146   KYGNTNKASSFKRSTSEVALERLSGLFGSFSLFPRREEPPEGTLRRQSSVVDLGSSGLEG  205

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S  P  LRRN+SASAN++NL S +T +N     R SS SFDEKLLIQ+LY+VLV VS T 
Sbjct  206   SCKPCMLRRNASASANISNLASQSTPANSDEFKRASSWSFDEKLLIQSLYRVLVFVSSTS  265

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PIVLYLRD +KLL RS+ +Y L QKML++LSG+VLILGSRIVD   D RE +ERL+++FP
Sbjct  266   PIVLYLRDVDKLLSRSQTIYNLFQKMLKKLSGAVLILGSRIVDLSGDNREAEERLTALFP  325

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE E+ LVSWK+QLE+DM+M+Q QDNKNHIMEVL+AND++CDDLGSIC+ADT+
Sbjct  326   YNIEIRPPENESLLVSWKTQLEKDMRMIQVQDNKNHIMEVLSANDLDCDDLGSICIADTI  385

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSN IEE+VVSA+SYHLMN KDPEYRN KL+ISS SLSHG++IF +E  ++GKD +KLE
Sbjct  386   DLSNCIEEIVVSAVSYHLMNNKDPEYRNGKLIISSNSLSHGLSIF-QEGISSGKDTMKLE  444

Query  1594  SKAELSKETQSGEKGSKG--PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             +KAE+ KE   G + S G   ETK +S+           AA   A   K    +   V  
Sbjct  445   AKAEVPKE--GGTEVSVGVMTETKTKSTAT---------AAETTAAAAKMEADNSIPVSR  493

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
                  D+EFEKRI+PEVIPA EI VTFADIGA+DEIKESL ELVMLPL RPDLF GGLLK
Sbjct  494   ASAEVDDEFEKRIKPEVIPANEIVVTFADIGAMDEIKESLQELVMLPLHRPDLFSGGLLK  553

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPG+GKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  554   PCRGILLFGPPGSGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  613

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM HWDGLL+  G+RILVLAATNRPFDL
Sbjct  614   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMIHWDGLLSSQGDRILVLAATNRPFDL  673

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRI+VGLPT E RE+IL+TLL KE V   LD  +LATMTEG++GSDLKNLC
Sbjct  674   DEAIIRRFERRILVGLPTVENREMILRTLLLKEKVEARLDFMELATMTEGFSGSDLKNLC  733

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTA-----NEDKGERVITIRPLNMD  536
             TTAAYRPVRELIK E  KD++KK+ A +       P A      E K ERVIT+RPLNM+
Sbjct  734   TTAAYRPVRELIKAESKKDLDKKKRAAQDALGERNPEAVPETEEEPKEERVITLRPLNME  793

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             DF +AKNQVAASFA+EGS+MNELKQWN+LYGEGGSRKKE+LTYFL
Sbjct  794   DFKQAKNQVAASFASEGSMMNELKQWNDLYGEGGSRKKEKLTYFL  838



>ref|XP_006366648.1| PREDICTED: uncharacterized protein LOC102581738 [Solanum tuberosum]
Length=830

 Score =  1107 bits (2864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/816 (69%), Positives = 671/816 (82%), Gaps = 11/816 (1%)
 Frame = -1

Query  2845  QTVSKWTGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             Q V+KWT +++  +T D +E+E+   I+DG+ +K+TF++FPYYLSE+TRVLLTSAA+VHL
Sbjct  25    QAVNKWT-NAAQGITPDQIEKELRRLIIDGKLTKITFEDFPYYLSERTRVLLTSAAYVHL  83

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
                D +KHTRNLSPASR ILLSGPAELYQQ LAKALAH+F AKLLLLD+TDFSLK+QSKY
Sbjct  84    NHLDVSKHTRNLSPASRAILLSGPAELYQQTLAKALAHHFDAKLLLLDLTDFSLKMQSKY  143

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G  + ES FKRSISE+TL R+S  LGSFSIL  +E    T  RQ+ G D  S+  EG+SN
Sbjct  144   GIFKKESVFKRSISESTLGRLSSLLGSFSILPARETNGVTYSRQTVGFDSKSRNREGASN  203

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
                 RR +S S+++++++S ++ SNP P+ R +S S DEK  +Q+L+KVLV +S+T  ++
Sbjct  204   SLKHRRTASVSSDISSISSESSASNPAPIKRVNSWSLDEKAFLQSLFKVLVSISETSRVI  263

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LY+RD ++ L +S + Y L  +ML+++SGSVL+LGSR+ +  DD  E+DE+LS +FPYNI
Sbjct  264   LYIRDVDRHL-QSPRAYKLFDRMLKKISGSVLVLGSRMFEHEDDCEEVDEKLSLLFPYNI  322

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EI PPE+ETHL  WK+QL EDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM LS
Sbjct  323   EISPPEDETHLTDWKTQLAEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTMVLS  382

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE+V+SAIS+HLMN+KDPEYRN KL+ISS SLSHG+ +F++ K+   +D LK+E+ A
Sbjct  383   NYIEEIVISAISHHLMNSKDPEYRNGKLLISSNSLSHGLGVFQDGKSGC-RDSLKMEANA  441

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPP  1406
             ELSK+    + G K PE+K+E+ T+     E+   A    P+TK      +A KAPEV P
Sbjct  442   ELSKDAAVDDIGLK-PESKSENPTS-----ESKGEAEKSGPSTKKDGEISSASKAPEVIP  495

Query  1405  DNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGI  1226
             DNEFEKRIRPEVIP+ EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPCRGI
Sbjct  496   DNEFEKRIRPEVIPSHEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPCRGI  555

Query  1225  LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  1046
             LLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI+
Sbjct  556   LLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIV  615

Query  1045  FVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAII  866
             FVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEAII
Sbjct  616   FVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEAII  675

Query  865   RRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAY  686
             RRFERRIMVGLP  E RE IL+TLLAKE V + LD K+L  MTEGY+GSDLKNLCTTAAY
Sbjct  676   RRFERRIMVGLPAAENREKILRTLLAKEKV-EDLDFKELGVMTEGYSGSDLKNLCTTAAY  734

Query  685   RPVRELIKQERLKDVEKKRLAQECPNC-GDAPTANEDKGERVITIRPLNMDDFMEAKNQV  509
             RPVRELI+QER KD+EKKR A+E  +  G++    E   ERVIT+RPLNM+D  +AKNQV
Sbjct  735   RPVRELIQQERKKDLEKKRSAEEGQSAEGNSDEKEEAAEERVITLRPLNMEDMRQAKNQV  794

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFA+EGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  795   AASFASEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  830



>ref|XP_011047745.1| PREDICTED: nuclear valosin-containing protein-like isoform X1 
[Populus euphratica]
Length=809

 Score =  1106 bits (2860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/818 (70%), Positives = 657/818 (80%), Gaps = 38/818 (5%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VS+W G   S + VT + +EQE++  +VDGRDSKVTFDEFPYYLSE+T++LLTSAAFV
Sbjct  27    QKVSRWAGGCGSIDGVTAEQIEQELMRQVVDGRDSKVTFDEFPYYLSEKTQMLLTSAAFV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+KHTRNLSPASR ILLSGPAE Y QMLAKALAH F +KLLLLDV+DFS+K+QS
Sbjct  87    HLKHADFSKHTRNLSPASRAILLSGPAEFYLQMLAKALAHNFESKLLLLDVSDFSMKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG S+ ESSFKRSIS  TL RMS   GSFSIL PKEE               ++G EGS
Sbjct  147   KYGCSKKESSFKRSISGVTLERMSSLFGSFSILSPKEE---------------TRGKEGS  191

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN   LRRN+S +++M+++TS +++ NP PL   SS  FDE L +++LY+VLV VS+   
Sbjct  192   SNSPKLRRNTSTASDMSSMTSQSSSMNPAPLKHPSSWCFDENLFLRSLYQVLVSVSERSS  251

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LYLRD EKLL +S+++Y LL K+L++LSG+VLILGSR++D  DD +E D RL+ +FPY
Sbjct  252   IILYLRDVEKLLLQSQRMYNLLDKLLKKLSGNVLILGSRMLDQEDDCKEADGRLAMLFPY  311

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWK+QLEEDMK +Q+QDNKNHI EVLAANDIECDDL SIC ADTM 
Sbjct  312   NIEIKPPEDETHLVSWKAQLEEDMKKIQFQDNKNHIAEVLAANDIECDDLSSICHADTMV  371

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE-  1595
             LSNYIEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E K+  GKD LKLE 
Sbjct  372   LSNYIEEIVVSAISYHLMNNKDPEYRNGKLLISSKSLSHGLSIFQEGKSD-GKDTLKLEI  430

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +     +       G+K      +  +  G+K                        KAPE
Sbjct  431   NAEAGKEAEGEEPDGAKNDSKTEKEKSVTGAKDSENQP------------------KAPE  472

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  473   VPPDNEFEKRIRPEVIPANEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPC  532

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  533   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  592

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDE
Sbjct  593   TIIFVDEVDSMLGQRTRFGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDE  652

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE ILKTL++KE   + LD K+LATMTEGYTGSDLKNLC T
Sbjct  653   AIIRRFERRIMVGLPSIESRERILKTLMSKEKT-EDLDFKELATMTEGYTGSDLKNLCVT  711

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AAYRPVREL++QER+KD EKK+ A+   +   A T  E K E +I +RPLNMDD  +AKN
Sbjct  712   AAYRPVRELLQQERVKDKEKKQKAEGTSSEDAADTKEEGKEESMIILRPLNMDDMRQAKN  771

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVA+SFA EG++MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  772   QVASSFATEGAVMNELKQWNELYGEGGSRKKQQLTYFL  809



>ref|XP_008376661.1| PREDICTED: uncharacterized protein LOC103439818 [Malus domestica]
Length=830

 Score =  1106 bits (2860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/828 (69%), Positives = 679/828 (82%), Gaps = 37/828 (4%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VSKW     S++ VT + +EQE++  +VDGRDSKVTF+EFPYYL E+TR+LLTSAA+V
Sbjct  27    QAVSKWVNGNCSADEVTAEQIEQELMRQVVDGRDSKVTFEEFPYYLRERTRMLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +KHTRNLSPASR ILLSGPAELY QMLAKALAHYF +KLLLLD+TDFS+K+QS
Sbjct  87    HLKHSDLSKHTRNLSPASRAILLSGPAELYHQMLAKALAHYFESKLLLLDITDFSIKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ ES  KRSISE TL +MS  LGSFS+L  + + KGTL RQSS  D+ S+G EG 
Sbjct  147   KYGCAKRESHHKRSISEVTLEQMSNLLGSFSMLPSRGDTKGTLFRQSSSSDLKSRGTEG-  205

Query  2311  SNPT-TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
               PT TL+RN+S++++M++++S + + +  P+ R S+  FDEKL +Q+LYKVL  +S+T 
Sbjct  206   --PTGTLQRNASSASDMSSMSSKSASPSSAPIKRVSNWCFDEKLFLQSLYKVLSSISETG  263

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD EKL  +S ++Y L  KML+RLSGSVLILGSR+VD  DD +E+DE+L+ +FP
Sbjct  264   SIILYLRDVEKLFLQSRRIYNLFNKMLKRLSGSVLILGSRMVDAEDDCKEVDEKLAVLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+ETHLVSWKSQLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDETHLVSWKSQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+V+SA+SYHLM  KDPEYRN KLVISS+SLSHG++IF+E     GK  LKLE
Sbjct  384   VLSNYIEEIVISALSYHLMQNKDPEYRNGKLVISSRSLSHGLSIFQE-----GKSSLKLE  438

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP-  1418
             + A+ +K+T+  E      E+K+E++ AP +K E                 SG AVK   
Sbjct  439   TNADSNKKTEGEEAVGAKTESKSETA-APENKGEA--------------EKSGPAVKKDS  483

Query  1417  --------EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDL  1262
                     EV PDNEFEKRIRPEVIPA EIGVTFADIGALD+IKESL ELVMLPLRRPDL
Sbjct  484   ENPPPPKVEVAPDNEFEKRIRPEVIPAXEIGVTFADIGALDDIKESLQELVMLPLRRPDL  543

Query  1261  FKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRAL  1082
             FKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRAL
Sbjct  544   FKGGLLKPCRGILLFGPPGTGKTMLAKAIASEAGASFINVSMSTITSKWFGEDEKNVRAL  603

Query  1081  FTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAA  902
             FTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAA
Sbjct  604   FTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKTGERILVLAA  663

Query  901   TNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTG  722
             TNRPFDLDEAIIRRFERR+MVGLP+ E RE+IL+TLL+KE V + LD K+LAT+TEGY+G
Sbjct  664   TNRPFDLDEAIIRRFERRVMVGLPSVENREMILRTLLSKEKV-ENLDFKELATITEGYSG  722

Query  721   SDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGER-VITIRPL  545
             SDLKNLC TAAYRPVREL+KQER KD+EKK+   E  +  +A    E++ E  VIT+RPL
Sbjct  723   SDLKNLCVTAAYRPVRELLKQERQKDMEKKKKDAEEKSTEEASEPKEEEKEEGVITLRPL  782

Query  544   NMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NM+D  +AKNQVAASFA+EGS+M+ELKQWN LYGEGGSRKK+QLTYF+
Sbjct  783   NMEDMRQAKNQVAASFASEGSVMSELKQWNELYGEGGSRKKQQLTYFM  830



>gb|KDP22199.1| hypothetical protein JCGZ_26030 [Jatropha curcas]
Length=830

 Score =  1101 bits (2848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/824 (70%), Positives = 676/824 (82%), Gaps = 29/824 (4%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q++S+W G   S + VT + +EQE++  ++ GR+S VTFDEFPYYLS+ TRV LTS+AF+
Sbjct  27    QSMSRWAGGNGSPDYVTSEQIEQELMRQVLKGRESGVTFDEFPYYLSDVTRVSLTSSAFI  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +K+TRNLSPAS+ ILLSG AE YQQMLAKALAHYF +KLLLLDV DFS+K+QS
Sbjct  87    HLKHSDVSKYTRNLSPASKAILLSGTAEPYQQMLAKALAHYFESKLLLLDVNDFSIKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + ESSFKRSISE T+ RMS    SFS+L  ++E  GTLRRQ S +DI S+ +EG 
Sbjct  147   KYGCIKKESSFKRSISEATIERMSSLFSSFSVLPSRQETTGTLRRQGSNLDIKSRAMEGL  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN   LRRN+SA+++M++++S + ++NP  L R S+  FDEKL +++LYK L+ +S+   
Sbjct  207   SNHGKLRRNASAASDMSSISSQSASTNPASLKRVSNWCFDEKLFLESLYKTLISISERSS  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LYLRD EKLL +SE++YIL  K L++LSGS+LILGS IVD  DD +E+DERL+ +FPY
Sbjct  267   VILYLRDVEKLLLQSERMYILFSKFLKKLSGSILILGSHIVDQEDDCKEVDERLTMLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWK++LEED+KM+Q+QDNKNHI+EVLAANDIECDDL SIC ADT+ 
Sbjct  327   NIEIKPPEDETHLVSWKAKLEEDIKMIQFQDNKNHIVEVLAANDIECDDLASICHADTIV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN+KDPEYRN KLVISSKSLSHG++IF+E KT  GKD LK+E+
Sbjct  387   LSNYIEEIVVSAISYHLMNSKDPEYRNGKLVISSKSLSHGLSIFQEGKTG-GKDTLKMET  445

Query  1591  KAELSKETQSGEK-GSK----GPETKAE-SSTAPGSKPETGsaapapapttkdatsSGTA  1430
                + +E Q  E  G+K     PE+K E   + PG K +                     
Sbjct  446   NG-VGEEAQGEEAVGAKTETSSPESKGEIDKSVPGVKKDGE-----------------NP  487

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
               A EVPPDNEFEKRIRPEVIP  EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGG
Sbjct  488   PAAKEVPPDNEFEKRIRPEVIPPSEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGG  547

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF+LA
Sbjct  548   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFSLA  607

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRP
Sbjct  608   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRP  667

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE+ILKTLLAKE   + LD K+LA MTEGY+GSDLK
Sbjct  668   FDLDEAIIRRFERRIMVGLPSIENREMILKTLLAKEKT-EDLDFKELAAMTEGYSGSDLK  726

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTAN-EDKGERVITIRPLNMDD  533
             N C TAAYRPVREL++QE LKD EKK+ A+E  +  DA +A  EDK E++IT+RPLNM+D
Sbjct  727   NFCVTAAYRPVRELVQQEGLKDKEKKKKAEEGTSSEDASSAKEEDKEEQLITLRPLNMED  786

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
               +AKNQVAASFA+EGSIMNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  787   MRQAKNQVAASFASEGSIMNELKQWNELYGEGGSRKKQQLTYFL  830



>ref|XP_010924776.1| PREDICTED: peroxisome biosynthesis protein PAS1-like isoform 
X2 [Elaeis guineensis]
Length=827

 Score =  1100 bits (2846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/830 (69%), Positives = 663/830 (80%), Gaps = 44/830 (5%)
 Frame = -1

Query  2845  QTVSKW--TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV KW    SS   VT + +E+E++  ++DGRDSKVTFDEFPYYLSEQTR +LTSAA+V
Sbjct  27    QTVGKWGAPASSYAGVTAENIEKELMRQVLDGRDSKVTFDEFPYYLSEQTRAILTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKQLDLSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYGSS  +S F+RSISE TL +MS  LGS SIL  +EE KG+LRRQSS +++  +G + +
Sbjct  147   KYGSSNKDSFFRRSISEATLEKMSSLLGSLSILPHREEPKGSLRRQSSSLELRPRGSDSN  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S+   LR+N+S S +MN LTS     NP PL RTSS SFD+K+L+Q+LYKVLV VSK+ P
Sbjct  207   SSMPRLRKNASVSTDMNGLTSQCAPVNPVPLKRTSSWSFDDKVLLQSLYKVLVSVSKSKP  266

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IVLY+RD E LL RS ++Y L QKML +LSG VLILGSR+++   DY ++D R+SS+FPY
Sbjct  267   IVLYVRDVENLLYRSRRIYSLFQKMLEKLSGPVLILGSRLLESDSDYTDVDGRVSSLFPY  326

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+E HLVSWKSQLEEDMKM+Q QDN+NHI EVLA ND+ECDDLG IC+ADT+ 
Sbjct  327   NIEIKPPEDEAHLVSWKSQLEEDMKMIQIQDNRNHITEVLAENDLECDDLGCICLADTIV  386

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VV+A+SYHLMN K+PEYRN KLVISSK LS             G+D +KLE+
Sbjct  387   LSNYIEEIVVAAVSYHLMNNKEPEYRNGKLVISSKRLS-------------GEDAIKLEA  433

Query  1591  KAELSKETQ-------SGEKGSKG-----PETKAESS-TAPGSKPETGsaapapapttkd  1451
               E  KE         + EK  +G     PE K+E+  TAPG K   GS           
Sbjct  434   NVESGKEAVNEDGAAVAAEKAERGAEVLPPENKSEAEKTAPGVKDSEGS-----------  482

Query  1450  atsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRR  1271
                     KAPEV PDNEFEKRIRPEVIPA EIGVTF DIGALDEIKESL ELVMLPLRR
Sbjct  483   ----SLPPKAPEVSPDNEFEKRIRPEVIPANEIGVTFNDIGALDEIKESLQELVMLPLRR  538

Query  1270  PDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNV  1091
             PDLF GGLLKPCRGILLFGP GTGKTMLAKAIA EAG+SFINVSMSTITSKWFGEDEKNV
Sbjct  539   PDLFNGGLLKPCRGILLFGPSGTGKTMLAKAIANEAGSSFINVSMSTITSKWFGEDEKNV  598

Query  1090  RALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILV  911
             RALFTLA+KV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT+ GERILV
Sbjct  599   RALFTLASKVAPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTRSGERILV  658

Query  910   LAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEG  731
             LAATNRPFDLDEAIIRRFERRIMVGLP+ + RELIL+ LL+KE V + LD K+LATMTEG
Sbjct  659   LAATNRPFDLDEAIIRRFERRIMVGLPSVDSRELILRKLLSKEKVEEGLDYKELATMTEG  718

Query  730   YTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIR  551
             Y+GSDLKNLC TAAYRPVRELI++ERLK++EK++ A E      A    E+ GE+ I +R
Sbjct  719   YSGSDLKNLCVTAAYRPVRELIQRERLKELEKRK-AGEGEGSAGASENREEDGEKTIILR  777

Query  550   PLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             PLNM+D  +AKNQVAASFAAEGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  778   PLNMEDLRQAKNQVAASFAAEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  827



>gb|KHG24797.1| Spastin [Gossypium arboreum]
Length=818

 Score =  1100 bits (2844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/818 (69%), Positives = 663/818 (81%), Gaps = 29/818 (4%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKWTG  SS + +T D +EQE++  +VDG+ S VTFD+FPYYLSE+TRVLLTSAA+V
Sbjct  27    QTVSKWTGKFSSDDGITGDQIEQELMRQVVDGKRSNVTFDDFPYYLSERTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
              LK +D  +HTRNLSP S+ ILLSGPAELYQQMLAKALAHYF +KLLLLD+TDFS K+QS
Sbjct  87    QLKHSDVHRHTRNLSPVSKAILLSGPAELYQQMLAKALAHYFESKLLLLDITDFSFKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ ESSFKRSISE TL+RM+   GSFS+L  +EE        SS  D+ S+ +EGS
Sbjct  147   KYGCTKKESSFKRSISEMTLDRMNSLFGSFSLLSSREEP-------SSSNDMKSRAVEGS  199

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN   LRR+ S+ ++MN+++S    SNP    RT    FDEK  +Q+LYKVLV VS+T  
Sbjct  200   SNHQKLRRSGSSLSDMNSMSSNGAPSNPASNKRTV-WCFDEKFFLQSLYKVLVSVSETGS  258

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LYLRD +KLL +S+++Y L QK L +LSGSVL+LGSR+++P D+ +E+DERLS +FP 
Sbjct  259   IILYLRDVDKLLLQSKRLYDLFQKFLNKLSGSVLVLGSRMLEPEDECKEVDERLSRLFPC  318

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ET L  WK++LEEDMK +Q QDN+NHI EVLAAND+ECDDLGSIC ADTM 
Sbjct  319   NIEIKPPEDETCLDDWKAKLEEDMKTLQIQDNRNHIAEVLAANDLECDDLGSICQADTMV  378

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYI+E+V+SAISYHLMN KDPEYRN KLVISS+SLSHG+NIF+E ++  GKD LKLE 
Sbjct  379   LSNYIQEIVISAISYHLMNNKDPEYRNGKLVISSESLSHGLNIFQEGESC-GKDTLKLEK  437

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              A+ S++    +  +   E+K+E+  +  +K + G                  A KA EV
Sbjct  438   NAD-SRKGNEPKSDAGVNESKSENDKSISAKKKDGENP--------------PAPKA-EV  481

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPAK+IGVTF DIGAL+E KESL ELVMLPLRRPDLF GGLLKPC+
Sbjct  482   PPDNEFEKRIRPEVIPAKDIGVTFNDIGALNETKESLQELVMLPLRRPDLFNGGLLKPCK  541

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+PT
Sbjct  542   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAPT  601

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEA
Sbjct  602   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKAGERILVLAATNRPFDLDEA  661

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+IL+TLL+KE   + LD K+LATMTEGY+GSDLKNLC TA
Sbjct  662   IIRRFERRIMVGLPSIESREMILRTLLSKEK-AENLDYKELATMTEGYSGSDLKNLCVTA  720

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAKN  515
             AYRPVRELI+QERLKD EKKR  +   +  +   + E+ K ERVIT+RPLNM+D  +AKN
Sbjct  721   AYRPVRELIQQERLKDQEKKRQEEAGKSTENVTESKEEHKEERVITLRPLNMEDMRQAKN  780

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+M ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  781   QVAASFASEGSVMAELKQWNELYGEGGSRKKQQLTYFL  818



>ref|XP_004234206.1| PREDICTED: uncharacterized protein LOC101260609 [Solanum lycopersicum]
Length=826

 Score =  1098 bits (2839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/818 (68%), Positives = 667/818 (82%), Gaps = 19/818 (2%)
 Frame = -1

Query  2845  QTVSKWTGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             Q V+KWT ++   +T + +E+E+   I+DG+ +K+TFD+FPYYLSE+TRVLLTSAA+VHL
Sbjct  25    QAVNKWT-NAPEGITPEQIEKELRRLILDGKFTKITFDDFPYYLSERTRVLLTSAAYVHL  83

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
                D +K+TRNLSPASR ILLSGPAELYQQ LAKALAH+F AKLLLLD+TDFSLK+QSKY
Sbjct  84    NHLDVSKYTRNLSPASRAILLSGPAELYQQTLAKALAHHFDAKLLLLDLTDFSLKMQSKY  143

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G  + ES+FKRS SE+TL R+S  LGSFSIL  +E    T  RQ+ GVD  S+  EG+SN
Sbjct  144   GIFKKESAFKRSTSESTLGRLSSLLGSFSILSARETSGVTYSRQTVGVDSKSRNREGASN  203

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
                 RRN+S S+++++++S ++ SNP P+ R +S S DEK  +Q+L+KVLV +S+T  ++
Sbjct  204   SLKHRRNASVSSDISSISSESSASNPAPIKRVNSWSLDEKAFLQSLFKVLVSISETSRVI  263

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LY+RD ++ L +S + Y L  +ML++LSGS L+LGSR+ +  D+  E+DE+L  +FPYNI
Sbjct  264   LYIRDVDRHL-QSPRAYKLFDRMLKKLSGSALVLGSRMFEHEDECEEVDEKLRLLFPYNI  322

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             +I+PPE+ETHL  WK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM LS
Sbjct  323   DIRPPEDETHLTDWKTQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTMVLS  382

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE+V+SAIS+HLMN+KDPEYRN KL+ISS SLSHG+ +F++ K+   +  LK+E+ A
Sbjct  383   NYIEEIVISAISHHLMNSKDPEYRNGKLLISSNSLSHGLGVFQDGKSGC-RGSLKMEANA  441

Query  1585  ELSKETQSGEKGSKGPETKAESSTA--PGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             ELSK+    + G K PE+K+E+ T+   G  P T           K      +A KAPEV
Sbjct  442   ELSKDAAMDDIGLK-PESKSENPTSESKGEAPST-----------KKDGEISSASKAPEV  489

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
              PDNEFEKRIRPEVIP+ EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  490   IPDNEFEKRIRPEVIPSHEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPCR  549

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  550   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  609

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             I+FVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEA
Sbjct  610   IVFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEA  669

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+L  MTEGY+GSDLKNLCTTA
Sbjct  670   IIRRFERRIMVGLPAAENREKILRTLLAKEKV-EDLDFKELGVMTEGYSGSDLKNLCTTA  728

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNC-GDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AYRPVRELI+QER KD+EKKR  +E  +  G++    E   ERVIT+RPLNM+D  +AKN
Sbjct  729   AYRPVRELIQQERKKDLEKKRRTEEEQSAEGNSDKKEEASEERVITLRPLNMEDMRQAKN  788

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  789   QVAASFASEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  826



>ref|XP_004308033.1| PREDICTED: uncharacterized protein LOC101302117 [Fragaria vesca 
subsp. vesca]
Length=828

 Score =  1097 bits (2836),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 574/816 (70%), Positives = 669/816 (82%), Gaps = 20/816 (2%)
 Frame = -1

Query  2839  VSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             V+KW    SSS+ VT + +EQE++  ++D RDSKVTF+EFPYYL E+TR+LLTSAA+VHL
Sbjct  30    VNKWVNGNSSSDEVTAEQIEQELMRQVLDMRDSKVTFEEFPYYLRERTRMLLTSAAYVHL  89

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K +D +KHTRNLSPASR ILLSGPAELY QMLAKALAH F +KLLLLDVTDFS+K+QSKY
Sbjct  90    KHSDLSKHTRNLSPASRAILLSGPAELYHQMLAKALAHVFESKLLLLDVTDFSIKIQSKY  149

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G ++ ES  KRSISE TL RMS   GSFS+L    E KG+L RQSS  D+ S+  EG SN
Sbjct  150   GCTKKESFHKRSISEATLERMSGLFGSFSMLPSSGETKGSLVRQSSAADLISRSSEGPSN  209

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
               TL+RN+S+ +++++++S + ++N  PL R SS  FDE+L +Q+LYKVL  +S++  I+
Sbjct  210   HRTLKRNASSISDISSISSKSASANTAPLKRMSSWCFDERLFLQSLYKVLSSLSESGSII  269

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD EKL  +S+++Y L  KML +LSGSVLILGSR++D  DD + +DERLS++F YNI
Sbjct  270   LYLRDVEKLFLQSKRLYNLFSKMLNKLSGSVLILGSRMLDAEDDSK-VDERLSALFTYNI  328

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EI PP++ET+LVSWK+QLEEDMK +Q+QDNKNHI EVLAAND+ECDDLGSIC ADT+ LS
Sbjct  329   EISPPDDETNLVSWKAQLEEDMKRIQFQDNKNHIAEVLAANDLECDDLGSICHADTVVLS  388

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
             NYIEE+VVSAISYHLM  KDPEYRN KLVISS SLS G++IF+E K   GKD LKLE+ A
Sbjct  389   NYIEEIVVSAISYHLMENKDPEYRNGKLVISSMSLSQGLSIFQEGK-CGGKDSLKLETNA  447

Query  1585  ELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPP  1406
             + +KET   E+ S   E+K+E++    +K E                S        EVPP
Sbjct  448   DSNKET---EEVSGKTESKSETAEKSDNKNEA-----------VKKESENPPPPKVEVPP  493

Query  1405  DNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGI  1226
             DNEFEKRIRPEVIPA EIGV+FADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPCRGI
Sbjct  494   DNEFEKRIRPEVIPASEIGVSFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPCRGI  553

Query  1225  LLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  1046
             LLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII
Sbjct  554   LLFGPPGTGKTMLAKAIASEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTII  613

Query  1045  FVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAII  866
             FVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEAII
Sbjct  614   FVDEVDSMLGQRTRVGEHEAMRKIKNEFMAHWDGLLTKSGERILVLAATNRPFDLDEAII  673

Query  865   RRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAY  686
             RRFERR+MVGLP+ E RE+ILKTLLAKE V + LD K+LATMTEGY+GSDLKNLC TAAY
Sbjct  674   RRFERRVMVGLPSVENREMILKTLLAKEKV-ENLDFKELATMTEGYSGSDLKNLCVTAAY  732

Query  685   RPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAKNQV  509
             RPVRELI+QERLKD EKK+ A+      DA  +  E+K ERVIT+R L+M+D  +AKNQV
Sbjct  733   RPVRELIQQERLKDQEKKKKAEAAKTTEDASDSKEEEKEERVITLRSLSMEDMRQAKNQV  792

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFAAEGS+MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  793   AASFAAEGSVMNELKQWNDLYGEGGSRKKEQLTYFL  828



>ref|XP_002318353.2| hypothetical protein POPTR_0012s01000g [Populus trichocarpa]
 gb|EEE96573.2| hypothetical protein POPTR_0012s01000g [Populus trichocarpa]
Length=841

 Score =  1096 bits (2835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 575/844 (68%), Positives = 663/844 (79%), Gaps = 58/844 (7%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSE--QTRVLLTSAA  2678
             Q VS+W G   S + VTV+ +EQE++  ++DGR+S+VTFDEFPYYL +  + R+LLTSAA
Sbjct  27    QKVSRWAGGNGSIDGVTVEQIEQELMRQVLDGRESEVTFDEFPYYLRQDNKIRMLLTSAA  86

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             FVHLK ADF+KHTRNLSPASRTILLSGPAE Y QMLAKALAH F +KLLLLDV DFS+KV
Sbjct  87    FVHLKHADFSKHTRNLSPASRTILLSGPAEFYHQMLAKALAHNFESKLLLLDVHDFSIKV  146

Query  2497  -QSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSK--  2327
               + +    +  SF  SIS  TL RMS   GSFSIL  KEE      R S  + +PS   
Sbjct  147   TMNNFFFKPSLHSFTSSISGFTLERMSSLFGSFSILSTKEET-----RYSQALPLPSAWM  201

Query  2326  --------GIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQA  2171
                     G+EGS+NP  LRRN+S +++M++++S + ++NP PL  +SS  FDEKL +Q+
Sbjct  202   SSVNLMCWGMEGSNNPPKLRRNASTASDMSSISSQSASTNPAPLKHSSSWCFDEKLFLQS  261

Query  2170  LYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDY  1991
             LY+VL  VS+   I+LYLRDAEK+L +S+++Y L +KML++LSG+VLILGSR++D  DD 
Sbjct  262   LYQVLASVSERNSIILYLRDAEKILLQSQRMYTLFEKMLKKLSGNVLILGSRMLDQEDDC  321

Query  1990  RELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIEC  1811
             RE+DERL+ +FPYNIEIKPPE+ETHLVSWK+QLEEDMK +Q QD KNHI EVLAANDIEC
Sbjct  322   REVDERLALLFPYNIEIKPPEDETHLVSWKAQLEEDMKKIQIQDTKNHIAEVLAANDIEC  381

Query  1810  DDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEE  1631
             DD  SIC ADTM LSNYIEE+VVSAISYHLMN KDPEYRN KLVISSKSLSHG++IF+E 
Sbjct  382   DDFSSICHADTMVLSNYIEEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLSIFQEG  441

Query  1630  KTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkd  1451
             K+  GKD LKLE+ AE  K    G K     ET+    +  G+K ++             
Sbjct  442   KSD-GKDTLKLETNAEAGKAV--GAKNDIKSETE---KSVTGAKKDSE------------  483

Query  1450  atsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRR  1271
                     K PEVPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPLRR
Sbjct  484   -----NQPKTPEVPPDNEFEKRIRPEVIPANEIGVTFADIGALDETKESLQELVMLPLRR  538

Query  1270  PDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNV  1091
             PDLF GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNV
Sbjct  539   PDLFNGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNV  598

Query  1090  RALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILV  911
             RALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILV
Sbjct  599   RALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILV  658

Query  910   LAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEG  731
             LAATNRPFDLDEAIIRRFERRIMVGLP+ E RE ILKTLL+KE   + LD K+LATMTEG
Sbjct  659   LAATNRPFDLDEAIIRRFERRIMVGLPSIESRERILKTLLSKEKT-EGLDFKELATMTEG  717

Query  730   YTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP------TANED---  578
             Y+GSDLKNLC TAAYRPVREL++QER+KD EKK+ A+E  +  DA       T++ED   
Sbjct  718   YSGSDLKNLCVTAAYRPVRELLQQERVKDKEKKQKAEEGTSSEDAADTKEEGTSSEDAAD  777

Query  577   -----KGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQL  413
                  K E VI +RPLNMDD  +AKNQVAASFA EGS+MNELKQWN LYGEGGSRKK+QL
Sbjct  778   KKEEGKEESVIILRPLNMDDMRQAKNQVAASFATEGSVMNELKQWNELYGEGGSRKKQQL  837

Query  412   TYFL  401
             TYFL
Sbjct  838   TYFL  841



>gb|KGN49910.1| hypothetical protein Csa_5G139870 [Cucumis sativus]
Length=873

 Score =  1095 bits (2831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 563/859 (66%), Positives = 660/859 (77%), Gaps = 56/859 (7%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G   SS+ +T   +EQE++  ++DG++S VTF EFPYYLSE+TRVLL SAA+V
Sbjct  27    QAVGKWVGGNGSSDEITGQNIEQELIRQLLDGKNSNVTFAEFPYYLSERTRVLLMSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +KHTRNLSPASR ILLSGP ELYQQMLAKALAH+F +KLLLLDV+DFSLK+QS
Sbjct  87    HLKHCDISKHTRNLSPASRAILLSGPTELYQQMLAKALAHHFESKLLLLDVSDFSLKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + +SSF+RSISE TL RMS   GSFSIL      +G LRRQSS  DI S+  + S
Sbjct  147   KYGCPKKDSSFRRSISEVTLERMSSVWGSFSILPTSGNTRGNLRRQSSTTDIQSRCSDSS  206

Query  2311  SN-PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SN P   R  S+AS   +  ++Y +T N     RT++  FDEKL +Q+LYKVLV VS+T 
Sbjct  207   SNLPKLRRNASAASDISSISSNYGST-NSASAKRTNTWCFDEKLFLQSLYKVLVSVSETT  265

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD E+LL +S+++Y L  + L +LSGS+L+LGSR+VD  +D  ++D+RL+++F 
Sbjct  266   SIILYLRDVERLLLKSQRIYNLFHRFLNKLSGSILVLGSRMVDVENDCGDVDDRLTNLFR  325

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             Y++EI+PPE+E HLVSWK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  326   YSVEIRPPEDENHLVSWKAQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  385

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSAISYHLMN +DPEYRN KL+ISSKSLSHG+ IF +E  + GKD LKLE
Sbjct  386   VLSNYIEEIVVSAISYHLMNNRDPEYRNGKLLISSKSLSHGLGIF-QEGNSEGKDTLKLE  444

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE SKE Q  E      E+K+E+   P ++ E                      KAPE
Sbjct  445   TNAESSKEAQRDEAVGAKTESKSEN---PATEAEKSVPIVKKYVENVPPQ------KAPE  495

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             +PPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  496   IPPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFKGGLLKPC  555

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  556   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  615

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLT+  ERILVLAATNRPFDLDE
Sbjct  616   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTRNDERILVLAATNRPFDLDE  675

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RELIL+TLL+KE   + LD K+LATMTEGY+GSDLKNLC T
Sbjct  676   AIIRRFERRIMVGLPSVESRELILRTLLSKEK-AEDLDFKELATMTEGYSGSDLKNLCVT  734

Query  694   AAYRPVRELIKQERLKDVEKKRLA------------------------------------  623
             AAYRPVREL++QERLKD+EKK+                                      
Sbjct  735   AAYRPVRELLQQERLKDLEKKQREKKEKEKQKEKEKEEEMEKEKQKEEKETETKNETGNE  794

Query  622   ---QECPNCGDAPTANED--KGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQW  458
                +E  N  +  T  ++  + ++ I +R LNMDD  +AKNQVAASFA+EGS+MNELKQW
Sbjct  795   NGKKENENNSEEVTGTKETEQDKQAIILRHLNMDDMRQAKNQVAASFASEGSVMNELKQW  854

Query  457   NNLYGEGGSRKKEQLTYFL  401
             N+LYGEGGSRKK+QLTYFL
Sbjct  855   NDLYGEGGSRKKQQLTYFL  873



>ref|XP_008437548.1| PREDICTED: uncharacterized protein LOC103482929 [Cucumis melo]
Length=867

 Score =  1092 bits (2823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 564/853 (66%), Positives = 659/853 (77%), Gaps = 50/853 (6%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G   SS+ +T   +EQE++  ++DG++S VTF EFPYYLSE+TRVLL SAA+V
Sbjct  27    QAVGKWVGGNGSSDEITGQKIEQELIRQLLDGKNSNVTFAEFPYYLSERTRVLLMSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +KHTRNLSPASR ILLSGP ELYQQMLAKALAH+F +KLLLLDV+DFSLK+QS
Sbjct  87    HLKHCDISKHTRNLSPASRAILLSGPTELYQQMLAKALAHHFESKLLLLDVSDFSLKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + ES F+RSISE TL RMS   GSFSIL      +G LRRQSS  DI S+  + S
Sbjct  147   KYGCPKKESLFRRSISEVTLERMSSVWGSFSILPTSGNTRGNLRRQSSTTDIQSRCTDSS  206

Query  2311  SN-PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SN P   R  S+AS   +  ++Y +T N     RT++  FDEKL +Q+LYKVLV VS+T 
Sbjct  207   SNLPKLRRNASAASDISSISSNYGST-NSASAKRTNTWCFDEKLFLQSLYKVLVSVSETS  265

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD E+LL +S+++Y L  + L +LSGSVL+LGSR+VD  +D  ++D+RL+++F 
Sbjct  266   SIILYLRDVERLLLKSQRMYNLFHRFLNKLSGSVLVLGSRMVDVENDCGDVDDRLTNLFR  325

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             Y++EI+PPE+E HLVSWK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  326   YSVEIRPPEDENHLVSWKAQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  385

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSAISYHLMN +DPEYRN KL+ISSKSLSHG++IF +E  + GKD LKLE
Sbjct  386   VLSNYIEEIVVSAISYHLMNNRDPEYRNGKLLISSKSLSHGLSIF-QEGNSEGKDTLKLE  444

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE SKE Q  E      E+K+E+  A   K           P  K    +    KAPE
Sbjct  445   TNAESSKEAQRDEAVGVKTESKSENPAAEAEK---------SVPIVKKDVENVPPQKAPE  495

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             +PPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  496   IPPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFKGGLLKPC  555

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  556   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  615

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLT+  ERILVLAATNRPFDLDE
Sbjct  616   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTRNDERILVLAATNRPFDLDE  675

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RELIL+TLL+KE   + LD K+LATMTEGY+GSDLKNLC T
Sbjct  676   AIIRRFERRIMVGLPSVESRELILRTLLSKEK-AEDLDFKELATMTEGYSGSDLKNLCVT  734

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP--------------------------  593
             AAYRPVREL++QERLKD+EKK+  ++     +                            
Sbjct  735   AAYRPVRELLQQERLKDLEKKQRERKEKEKEEEMEKEKQKEEKETETKNETGNENEKKEK  794

Query  592   ---------TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGE  440
                      T   ++ ++ I +R LNMDD  +AKNQVAASFA+EGS+MNELKQWN+LYGE
Sbjct  795   ENNSEEVTGTKETEQDKQAIILRHLNMDDMRQAKNQVAASFASEGSVMNELKQWNDLYGE  854

Query  439   GGSRKKEQLTYFL  401
             GGSRKK+QLTYFL
Sbjct  855   GGSRKKQQLTYFL  867



>ref|XP_011084471.1| PREDICTED: uncharacterized protein LOC105166715 [Sesamum indicum]
Length=837

 Score =  1090 bits (2818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/801 (68%), Positives = 651/801 (81%), Gaps = 14/801 (2%)
 Frame = -1

Query  2797  DIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPAS  2618
             D M+ E+L  +VDG++SKVTFD+FPYYLS++TRVLLTSAA+VHL   D +KHTRNLSPAS
Sbjct  49    DEMQLELLRLVVDGKESKVTFDDFPYYLSQRTRVLLTSAAYVHLNHLDVSKHTRNLSPAS  108

Query  2617  RTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISET  2438
             R ILLSGPAELYQQMLAKALAH+F AKLLLLD+TDFSLK+QSKYG ++ +SS  RSISE 
Sbjct  109   RAILLSGPAELYQQMLAKALAHHFEAKLLLLDITDFSLKMQSKYGIAKKDSSLHRSISEA  168

Query  2437  TLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTT-lrrnssasanmn  2261
             TL RMS FLGSF+IL  +E+ +GT  RQSSG+D  ++  EG +N     R +S +S   +
Sbjct  169   TLERMSSFLGSFTILPSREDNRGTPWRQSSGLDATARNTEGVNNSLKPRRSSSVSSDMCS  228

Query  2260  nltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEK  2081
             +++  +++SN  P  R +S SFDEK+L+ +LYKVLV +S+   ++LY+RD ++LL +S +
Sbjct  229   SISFQSSSSNAAPSKRVNSWSFDEKVLLHSLYKVLVSLSQNSRVILYIRDVDRLLLQSSR  288

Query  2080  VYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWK  1901
             ++    +ML+ LSGSVL+LGSR++DP +D  E+D+R+S +FPYNIEI+PPE+E HLVSWK
Sbjct  289   IHKFFGRMLKELSGSVLVLGSRMLDPAEDSVEVDDRISLLFPYNIEIRPPEDENHLVSWK  348

Query  1900  SQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHL  1721
             +QLEEDMK +Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM LSNYIEE+VVSAISYHL
Sbjct  349   AQLEEDMKKIQFQDNKNHIAEVLAANDLECDDLGSICDADTMVLSNYIEEIVVSAISYHL  408

Query  1720  MNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKG  1541
              N KDPEYRN KL+IS+ SLSHG++IF++ K+  GK  LK+ +   L K+    +     
Sbjct  409   TNNKDPEYRNGKLLISADSLSHGLSIFQDGKSG-GKYTLKMGTSGGLFKDADGTDNTGSK  467

Query  1540  PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPA  1361
             PE K+E+ +    KP           +TK    + +  K  EVPPDNEFEKRIRPEVIP 
Sbjct  468   PEAKSENKSE-AEKP---------ISSTKTDGENASISKPLEVPPDNEFEKRIRPEVIPP  517

Query  1360  KEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAK  1181
              EIGVTFADIGALDEIKESL ELVMLPLRRPDLF GGLLKPCRGILLFGPPGTGKTMLAK
Sbjct  518   NEIGVTFADIGALDEIKESLQELVMLPLRRPDLFNGGLLKPCRGILLFGPPGTGKTMLAK  577

Query  1180  AIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRA  1001
             AIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R 
Sbjct  578   AIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRV  637

Query  1000  GEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPE  821
             GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E
Sbjct  638   GEHEAMRKIKNEFMTHWDGLLTKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVE  697

Query  820   QRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV  641
              RE+IL+TLL+KE    + D K+LATMTEGY+GSDLKNLC TAAYRPVRELI+QER KD 
Sbjct  698   NREMILRTLLSKEKAEDI-DFKELATMTEGYSGSDLKNLCVTAAYRPVRELIQQERQKDK  756

Query  640   EKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELK  464
             EKK+  +E  +  DA    E+ K E+VI++RPLNM+D  +AKNQVAASFA+EGSIM ELK
Sbjct  757   EKKQRDEEGQSFEDASAPKEETKEEKVISLRPLNMEDMRQAKNQVAASFASEGSIMAELK  816

Query  463   QWNNLYGEGGSRKKEQLTYFL  401
             QWN LYGEGGSRKK+QL+YFL
Sbjct  817   QWNELYGEGGSRKKQQLSYFL  837



>ref|XP_002304524.2| hypothetical protein POPTR_0003s13350g [Populus trichocarpa]
 gb|EEE79503.2| hypothetical protein POPTR_0003s13350g [Populus trichocarpa]
Length=825

 Score =  1089 bits (2816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 576/827 (70%), Positives = 661/827 (80%), Gaps = 38/827 (5%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             +TVSKW G   S+S  +  + MEQE+L                     +QTRVLLTSAA+
Sbjct  25    KTVSKWRGDAASASKGINSETMEQELLK--------------------QQTRVLLTSAAY  64

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             V+LK A+ +K+TRNLSPASRTILLSGPAE YQQMLAKALAH+F AKLLLLD TDFSLK  
Sbjct  65    VYLKHAEASKYTRNLSPASRTILLSGPAEPYQQMLAKALAHFFEAKLLLLDATDFSLKAS  124

Query  2494  S------KYG--SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVD  2339
             S       YG  S   ++ F+RS SETTL R+S F GSFSIL  KEE KGTLRRQSSGVD
Sbjct  125   SCSCFPMAYGFLSLFKKNLFRRSTSETTLERLSGFFGSFSILPQKEEPKGTLRRQSSGVD  184

Query  2338  IPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKV  2159
             IPS+G++ S NP  +RRNSSA+AN++N  + +T +N  P    SS SFDEKLL+Q+LYKV
Sbjct  185   IPSRGLDSSHNPPKIRRNSSAAANLSNEITQSTPANTAPSRHMSSWSFDEKLLVQSLYKV  244

Query  2158  LVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELD  1979
             LV VSKT PIVLYLRD EK+  RS ++Y L QKM  +LSGSVLILGSR+V+  +D RE+D
Sbjct  245   LVYVSKTSPIVLYLRDVEKISFRSNRIYNLFQKMFDKLSGSVLILGSRVVNLSNDSREVD  304

Query  1978  ERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLG  1799
             ERL+++FPYNIEIKPPE+ETHLVS+K++LEEDMKM+Q +DN+NH+MEVL+AND++CDDL 
Sbjct  305   ERLTALFPYNIEIKPPEDETHLVSFKNRLEEDMKMIQVRDNRNHVMEVLSANDLDCDDLD  364

Query  1798  SICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
             S+C+ADTMALSNYIEE+V+SAISYHLMN K PEYRN KL +SSKSLSHG++IF+E K+  
Sbjct  365   SVCVADTMALSNYIEEIVLSAISYHLMNNKYPEYRNGKLFVSSKSLSHGLSIFQESKST-  423

Query  1618  GKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsS  1439
             GKD LKLE+KAE SKE    E  +  P TKAE   A  +K E    A A     +D+   
Sbjct  424   GKDSLKLEAKAETSKEKGKNETVTMKPGTKAEGVNAE-NKSEVEKKASAVKADGEDSL--  480

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
              +A KA  VPPDNEFEKRIRPEVIP+ EI VTF DIGAL+E KESL ELVMLPLRRPDLF
Sbjct  481   -SASKARGVPPDNEFEKRIRPEVIPSNEINVTFTDIGALEETKESLQELVMLPLRRPDLF  539

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
             KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  540   KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  599

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLT  G+RILVLAAT
Sbjct  600   TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTHQGQRILVLAAT  659

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEA+IRRFERRIMVGLP+ E RE ILKTLL KE   + +D K+LATMT GY+GS
Sbjct  660   NRPFDLDEAMIRRFERRIMVGLPSSEHRESILKTLLGKEK-EEGIDFKKLATMTVGYSGS  718

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLN  542
             DLKNLCTTAAYRPVRELI+QE LKD+ K + A+     G+A  T  E+K ERVI +RPL 
Sbjct  719   DLKNLCTTAAYRPVRELIQQEILKDLVKNQRAEAAQKSGEATDTKGEEKEERVINLRPLT  778

Query  541   MDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             M+DF  AKNQVAASFAAEG+ MNELKQWN LYGEGGSRKK+QL YFL
Sbjct  779   MEDFELAKNQVAASFAAEGASMNELKQWNELYGEGGSRKKQQLAYFL  825



>ref|XP_003533964.1| PREDICTED: uncharacterized protein LOC100804099 [Glycine max]
Length=817

 Score =  1085 bits (2806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/818 (68%), Positives = 664/818 (81%), Gaps = 35/818 (4%)
 Frame = -1

Query  2833  KWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKS  2660
             KW G +  S+ ++V+++ QE+ N +V+GR S VTF++FPYYLSE+T+ LLTSAA+VHLKS
Sbjct  28    KWIGGNRDSDELSVELIVQELKNLVVEGRSSNVTFEDFPYYLSERTQALLTSAAYVHLKS  87

Query  2659  ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS  2480
               F+KHTRNL PASR ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q+K+G 
Sbjct  88    LHFSKHTRNLPPASRAILLSGPAEPYQQMLAKALAHYFESKLLLLDITDFSVKLQNKFGC  147

Query  2479  SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPT  2300
             SR E SFKRSISE TL RMS   GSFS++    E +G LR+QSS           SSNP 
Sbjct  148   SRKEPSFKRSISEVTLERMSGLFGSFSMISSTGETRGILRQQSSAF--------VSSNPP  199

Query  2299  TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLY  2120
              LRRN+SAS+++++ +S    + P PL RTSSL FDEKL +Q+LYK+LV +++T  I+LY
Sbjct  200   KLRRNASASSDISSTSSQCGPTFPAPLKRTSSLCFDEKLFVQSLYKLLVFITETSSIILY  259

Query  2119  LRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEI  1940
             +RD EKL+ +S ++Y LLQKM+++LSGSVLILGS+I+D  DD +E+DER S++FPYNIEI
Sbjct  260   IRDVEKLVLQSPRLYNLLQKMIKKLSGSVLILGSQILDSEDDCKEVDERFSALFPYNIEI  319

Query  1939  KPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNY  1760
             K PE+ETHL SWK QLE+DMK +Q+QDN+NHI EVLAANDI+CDDL SIC  DT+ LSNY
Sbjct  320   KAPEDETHLGSWKGQLEKDMKDIQFQDNRNHIAEVLAANDIDCDDLNSICHGDTILLSNY  379

Query  1759  IEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAEL  1580
             IEE+VVSA+SYHLMNTKDPEYRN KLVIS+ SLSHG+++F+E K++   ++   ES  E 
Sbjct  380   IEEIVVSALSYHLMNTKDPEYRNGKLVISANSLSHGLSLFQEGKSSG--NLKTNESNKEN  437

Query  1579  SKETQSGEKG-----SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + E  +G K      ++ PE K+E+  +     + G                 T  KA E
Sbjct  438   AGEDITGAKNEVKCDNQAPENKSETEKSIPVTKKDGENP--------------TPAKA-E  482

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VP DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  483   VP-DNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPC  541

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+P
Sbjct  542   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAP  601

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT P E+ILVLAATNRPFDLDE
Sbjct  602   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTGPNEQILVLAATNRPFDLDE  661

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRI+VGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC T
Sbjct  662   AIIRRFERRILVGLPSVENREMILKTLLAKEK-HENLDFKELATMTEGYTGSDLKNLCIT  720

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AAYRPVRELI+QERLKD+EKK+   E  +  DA + N+DK E+ IT+RPLNM+D  +AK+
Sbjct  721   AAYRPVRELIQQERLKDMEKKKREAEGQSSEDA-SNNKDKEEQEITLRPLNMEDMRQAKS  779

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  780   QVAASFASEGSVMNELKQWNDLYGEGGSRKKQQLTYFL  817



>ref|XP_010105714.1| hypothetical protein L484_014202 [Morus notabilis]
 gb|EXC05934.1| hypothetical protein L484_014202 [Morus notabilis]
Length=815

 Score =  1084 bits (2804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/832 (68%), Positives = 646/832 (78%), Gaps = 59/832 (7%)
 Frame = -1

Query  2845  QTVSKWT---GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q+V KW     SSS+ V+ D +E E++  ++DGR+SKVTFD+FPYYLSE+TRVLLTSAA 
Sbjct  26    QSVGKWVKGNSSSSDLVSADQIEHELIRLVLDGRESKVTFDDFPYYLSEKTRVLLTSAAH  85

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHL+ ++F+KHTRNLSPASR ILLSGPAELY QMLAKALAH+F +KLLLLDV  FSLK+Q
Sbjct  86    VHLRHSEFSKHTRNLSPASRAILLSGPAELYHQMLAKALAHHFKSKLLLLDVNAFSLKMQ  145

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSK--GI  2321
             SKYG ++ E+S  RSISE  + R+S   GSFSIL    + +G  R   +G D  S   G+
Sbjct  146   SKYGCAKREASLNRSISEVAMERVSNLFGSFSILPSSGDTRGVKRNNKTG-DASSSDMGV  204

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
               S    T                     N   L   SS  FDEK  IQ+LY V+   S+
Sbjct  205   MASKYAPT---------------------NSASLKHASSWCFDEKDFIQSLYTVVASKSE  243

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDY-RELDERLSS  1964
             T  I+LY+RD EKLL +S++ Y LLQKML++LSGSVLILGS+++D  D+Y RE+DERLS 
Sbjct  244   TRSIILYIRDIEKLLLQSQRFYNLLQKMLKKLSGSVLILGSQMLDTEDNYCREVDERLSV  303

Query  1963  VFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMA  1784
             +FPYN+EIKPPE+ETHLVSWK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDL SIC A
Sbjct  304   LFPYNVEIKPPEDETHLVSWKAQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLASICHA  363

Query  1783  DTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDIL  1604
             DTM LSNYIEE+VV+AISYHLM+ +DPEYRN KLVISSKSLSHG++IF+E K+   KD L
Sbjct  364   DTMVLSNYIEEIVVTAISYHLMHNRDPEYRNGKLVISSKSLSHGLSIFQEGKSGE-KDSL  422

Query  1603  KLESKAELSKETQSGEKGSK--------GPETK--AESSTAPGSKPETGsaapapapttk  1454
             KLE  AE SK+ +    G+K        GPE K  AE S + G K               
Sbjct  423   KLEKNAESSKDGEGEAVGAKTESKCESQGPENKNEAEKSVSSGKKDSE------------  470

Query  1453  datsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLR  1274
                    A  A EVPPDNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLR
Sbjct  471   ------NAPPAKEVPPDNEFEKRIRPEVIPASEIGVTFADIGALDEIKESLQELVMLPLR  524

Query  1273  RPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKN  1094
             RPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKN
Sbjct  525   RPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKN  584

Query  1093  VRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERIL  914
             VRALF+LAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERIL
Sbjct  585   VRALFSLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERIL  644

Query  913   VLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTE  734
             VLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE V + LD K+LATMTE
Sbjct  645   VLAATNRPFDLDEAIIRRFERRIMVGLPSVENRETILRTLLSKEKV-ENLDFKELATMTE  703

Query  733   GYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTAN-EDKGERVIT  557
             GYTGSDLKNLC TAAYRPVREL++QER KD+EKK+   E  +   A +   EDK ERVIT
Sbjct  704   GYTGSDLKNLCVTAAYRPVRELLQQEREKDMEKKKKDSEGSSSEGASSKKEEDKEERVIT  763

Query  556   IRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +R LNM+D  +AKNQVAASFA+EGSIMNELKQWN  YGEGGSRK++QLTYFL
Sbjct  764   LRALNMEDMRQAKNQVAASFASEGSIMNELKQWNESYGEGGSRKRQQLTYFL  815



>ref|XP_009800877.1| PREDICTED: uncharacterized protein LOC104246700 [Nicotiana sylvestris]
Length=827

 Score =  1082 bits (2797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/818 (68%), Positives = 666/818 (81%), Gaps = 18/818 (2%)
 Frame = -1

Query  2845  QTVSKWTGSSSNA--VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V+KWTG +S A  +T D +EQE+   IVDG+ +KV+F++FPY+LSE+TRVLLTSAA+V
Sbjct  25    QAVNKWTGGNSAAEGITADQIEQELRRLIVDGKHTKVSFEDFPYFLSERTRVLLTSAAYV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HL   D +KHTRNLSPASR ILLSGPAELYQQ LAKALAH+F AKLLLLD+TDF+LK+QS
Sbjct  85    HLNHLDVSKHTRNLSPASRAILLSGPAELYQQTLAKALAHHFDAKLLLLDLTDFTLKMQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + ES+FKRS SE+ L R S  +GSFSIL  +E   GT  RQ++  D  S+  EG+
Sbjct  145   KYGIFKKESAFKRSTSESMLGRWSSLIGSFSILPARENNGGTFSRQTTAFDAKSRNREGA  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN    RR +S S+++++++S + +SNP P  R +S S DEK  +Q+LYKVLV VS+   
Sbjct  205   SNSIKHRRTASVSSDISSISSDSCSSNPAPTKRVNSWSIDEKAFLQSLYKVLVSVSENNR  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY+RD ++ L +  +VY L  +ML++LSGSVL+LGSR+ +  DD  E+DE+L  +FPY
Sbjct  265   VILYIRDVDRHL-QPPRVYKLFDRMLKKLSGSVLVLGSRMFEHEDDCEEVDEKLGLLFPY  323

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+ETHL  WK+QL++DMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADT+ 
Sbjct  324   NIEIRPPEDETHLTDWKTQLDKDMKMIQFQDNKNHIAEVLAANDLECDDLGSICQADTVV  383

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+V+SAISYHLMN+KDPEYRN KL+ISS SLSHG+N+F++ K+   +D LK+E+
Sbjct  384   LSNYIEEIVISAISYHLMNSKDPEYRNGKLLISSNSLSHGLNVFQDGKSGC-RDSLKMEA  442

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              AE SK+T  G+ G K PETK+ + T+  SK E           +  +      +KAPEV
Sbjct  443   NAETSKDT--GDIGLK-PETKSGNPTSE-SKGEA--------EKSVPSAKKDGEIKAPEV  490

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
              PDNEFEKRIRPEVIP+ EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  491   LPDNEFEKRIRPEVIPSNEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPCR  550

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  551   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  610

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEA
Sbjct  611   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEA  670

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGY+GSDLKNLCTTA
Sbjct  671   IIRRFERRIMVGLPAAENREKILRTLLAKEKV-EDLDFKELAAMTEGYSGSDLKNLCTTA  729

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG-ERVITIRPLNMDDFMEAKN  515
             AYRPVRELI+QER KD+EKKR A E  +  D     E+   ERVI +RPLNM+D  +AKN
Sbjct  730   AYRPVRELIQQERKKDMEKKRRADEGQSAEDHSDEKEEATEERVIALRPLNMEDMRQAKN  789

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  790   QVAASFASEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  827



>ref|XP_003548135.1| PREDICTED: spastin-like [Glycine max]
Length=817

 Score =  1082 bits (2797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/818 (68%), Positives = 656/818 (80%), Gaps = 35/818 (4%)
 Frame = -1

Query  2833  KWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKS  2660
             KW G +  S+ ++V+ + QE+ N +V+GRD  VTF++FPYYLSE+T+VLLTSAA+VHLK 
Sbjct  28    KWVGGNRDSDELSVEQIVQELKNLVVEGRDGNVTFEDFPYYLSERTQVLLTSAAYVHLKH  87

Query  2659  ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS  2480
               F+KHTRNL PASR ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q+K+G 
Sbjct  88    LHFSKHTRNLPPASRAILLSGPAEPYQQMLAKALAHYFESKLLLLDITDFSVKLQNKFGC  147

Query  2479  SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPT  2300
             SR E SFKRSISE TL RMS   GSFS+L    E +G LR+QSS           SSNP 
Sbjct  148   SRKEPSFKRSISEATLERMSGLFGSFSMLSSTGETRGILRQQSSA--------SVSSNPP  199

Query  2299  TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLY  2120
              LRRN+SAS ++++ +S    + P PL  TSSL FDEKL +Q+LYK+LV +++T  I+LY
Sbjct  200   KLRRNASASYDISSTSSQCGPTFPAPLKHTSSLCFDEKLFVQSLYKLLVSITETGSIILY  259

Query  2119  LRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEI  1940
             +RD EKL+ +S ++Y LLQKM+++LSGSVLILGS+I+D  DD +E+DERL+ +FPYNIEI
Sbjct  260   IRDVEKLILQSPRLYNLLQKMIKKLSGSVLILGSQILDSEDDCKEVDERLTVLFPYNIEI  319

Query  1939  KPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNY  1760
             K PE+ETHL  WK QLE+DMK +Q+QDN+NHI EVLAANDI+CDDL SIC ADT+ LSNY
Sbjct  320   KAPEDETHLGCWKGQLEKDMKDIQFQDNRNHIAEVLAANDIDCDDLNSICHADTILLSNY  379

Query  1759  IEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAEL  1580
             IEE+VVSA+SYHLMNTKDPEYRN KLVIS+ SLSHG+++F+E K++   ++   ES  E 
Sbjct  380   IEEIVVSALSYHLMNTKDPEYRNGKLVISANSLSHGLSLFQEGKSSG--NLKTNESNKEN  437

Query  1579  SKETQSGEKG-----SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             S E  +G K      ++ PE K+E+  +     + G                   + A  
Sbjct  438   SGEDITGAKNEMKCDNQAPENKSETEKSIPITKKDGE----------------NPIPAKV  481

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
               PDNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  482   EVPDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPC  541

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+P
Sbjct  542   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAP  601

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT P E+ILVLAATNRPFDLDE
Sbjct  602   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTGPNEQILVLAATNRPFDLDE  661

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRI+VGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC T
Sbjct  662   AIIRRFERRILVGLPSVENREMILKTLLAKEK-HENLDFKELATMTEGYTGSDLKNLCIT  720

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AAYRPVRELI+QER+KD+EKK+   E  +  DA + N+DK E+ IT+RPLNM+D  +AK 
Sbjct  721   AAYRPVRELIQQERMKDMEKKKREAEGQSSEDA-SNNKDKEEKEITLRPLNMEDMRQAKT  779

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+MNELK WN+LYGEGGSRKK+QLTYFL
Sbjct  780   QVAASFASEGSVMNELKHWNDLYGEGGSRKKQQLTYFL  817



>ref|XP_008655793.1| PREDICTED: uncharacterized protein LOC103634999 [Zea mays]
 gb|AFW80462.1| hypothetical protein ZEAMMB73_735596 [Zea mays]
Length=846

 Score =  1080 bits (2792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/817 (68%), Positives = 653/817 (80%), Gaps = 24/817 (3%)
 Frame = -1

Query  2809  AVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNL  2630
              VTVD +EQ++   +VDG D+KVTFDEFPYYLSEQTRV+LTSAA+VHLK AD +K+TRNL
Sbjct  40    GVTVDRVEQDLRRLLVDGADTKVTFDEFPYYLSEQTRVVLTSAAYVHLKQADISKYTRNL  99

Query  2629  SPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSS-RNESSFKR  2453
             +PASRTILLSGPAELYQQMLA+ALAHYF AKLLLLD TDF +K+ SKYG+    E + KR
Sbjct  100   APASRTILLSGPAELYQQMLARALAHYFQAKLLLLDPTDFLIKIHSKYGTGGSTEKTVKR  159

Query  2452  SISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssas  2273
             SISETTL R+S  LGS SIL  KE+ KGT+RRQSS +D+  +  E  SN T LRRN+S S
Sbjct  160   SISETTLERVSGLLGSLSILPQKEQPKGTIRRQSSMMDVKLRSSESMSNLTKLRRNASTS  219

Query  2272  anmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLC  2093
             ++M+++ S   +++  PL R+SS +FDEK+L+QALYKVL+ VSK  P+VLY+RD EK L 
Sbjct  220   SDMSSMASQGPSTSTAPLRRSSSWTFDEKILVQALYKVLLSVSKKYPVVLYIRDVEKFLH  279

Query  2092  RSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHL  1913
             +S K+Y+L +K+L +L G VLILGSRIVD   D  E D+RL+ +FPYNIEIKPPE E HL
Sbjct  280   KSPKMYLLFEKLLNKLEGPVLILGSRIVDMNSD-EESDDRLTVLFPYNIEIKPPENENHL  338

Query  1912  VSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAI  1733
             VSW SQLEEDMKM+Q+QDN+NHIMEVLA ND+ECDDLGSIC++DTM LS YIEE+VVSA+
Sbjct  339   VSWNSQLEEDMKMIQFQDNRNHIMEVLAENDLECDDLGSICLSDTMCLSKYIEEIVVSAV  398

Query  1732  SYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEK  1553
             SYHLMN KDPEYRN KLV+S+KSLSH + IF+  K +  KD +KLE+  +  K   + EK
Sbjct  399   SYHLMNNKDPEYRNGKLVLSTKSLSHALEIFQGNKIS-DKDSMKLEATDDALK---AAEK  454

Query  1552  GSKGPETKAESSTAPG------------SKPETGsaapapapttkdatsSGTAVKAPEVP  1409
              +     K+E+ +A              +     +         +   +     KAPEV 
Sbjct  455   ATAPTTAKSETKSATSLPPARAPAAAAAAPASAPAPRIESKTELEKKDNPPPVAKAPEVT  514

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EIGV+F DIGALD+IKESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  515   PDNEFEKRIRPEVIPANEIGVSFDDIGALDDIKESLQELVMLPLRRPDLFKGGLLKPCRG  574

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  575   ILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  634

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P +RILVLAATNRPFDLDEAI
Sbjct  635   IFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQRILVLAATNRPFDLDEAI  694

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAA  689
             IRRFERRIMVGLP+   RELI++ LL+KE V + LD K+LATMTEGY+GSDLKNLCTTAA
Sbjct  695   IRRFERRIMVGLPSMGSRELIMRRLLSKEKVDEGLDFKELATMTEGYSGSDLKNLCTTAA  754

Query  688   YRPVRELIKQERLKDVEKKRLAQ-ECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQ  512
             YRPVRELI++ER K++EK +  + E P+  D P   + + E  I +RPLNM D  EAKNQ
Sbjct  755   YRPVRELIQKERKKELEKLKCEKGETPS--DPP---KKEKEETIILRPLNMTDLKEAKNQ  809

Query  511   VAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             VAASFAAEG+IM+EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  810   VAASFAAEGAIMSELRQWNELYGEGGSRKKQQLTYFL  846



>ref|XP_009375558.1| PREDICTED: putative cell division cycle ATPase [Pyrus x bretschneideri]
Length=830

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 567/825 (69%), Positives = 666/825 (81%), Gaps = 31/825 (4%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VS W     S++ VT + +EQE++  +VDGRDSKVTF+EFPYYL E+TR+LLTSAA+V
Sbjct  27    QAVSNWVNGNCSADEVTAEQIEQELMRQVVDGRDSKVTFEEFPYYLRERTRMLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +KHTRNLSPASR ILLSGPAELY QMLAKALAH+F +KLLLLD+TDFS+ +QS
Sbjct  87    HLKHSDLSKHTRNLSPASRAILLSGPAELYHQMLAKALAHHFESKLLLLDITDFSITIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ ES  KRSISE TL +MS  LGSFS+L    + KG L +QSS  D+ S+G EG 
Sbjct  147   KYGCAKRESHHKRSISEVTLEQMSNLLGSFSMLPSSRDTKGALCQQSSSSDLKSRGTEG-  205

Query  2311  SNPT-TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
               PT TL+RN+S++++M++++S + + +  PL R ++  FDEKL + +LYKVL  +S+T 
Sbjct  206   --PTRTLQRNASSASDMSSISSKSASPSSAPLKRMNNWCFDEKLFLLSLYKVLSSMSETG  263

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+L LRD EKL  +S + Y L  KML+RLSGSVLILGSR VD  DD +E+DE+L+++FP
Sbjct  264   SIILCLRDVEKLFLQSRRFYNLFNKMLKRLSGSVLILGSRTVDTEDDCKEVDEKLAALFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI PPE+ETHLVSWK+QLEEDMKM+Q+ DNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEISPPEDETHLVSWKAQLEEDMKMIQFHDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              +SNYIEE+V+SAISYHLM  KDPEYRN KLVISS SLSHG++IF+E K+  GKD LKLE
Sbjct  384   VVSNYIEEIVISAISYHLMQNKDPEYRNGKLVISSTSLSHGLSIFQEGKSG-GKDSLKLE  442

Query  1594  SKAELSKETQSGEK-GSK----GPETKAESS-TAPGSKPETGsaapapapttkdatsSGT  1433
             + A+ +KET+  E  G+K     PE K E+  + PG K ++                   
Sbjct  443   TNADSNKETEGEEAVGAKSETVAPENKGEAEKSGPGVKKDS----------------ENP  486

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
                  EV PDNEFEKRIRPEVIPA EIGVTFADIGALD+IKESL ELVMLPLRRPDLFKG
Sbjct  487   PPPKLEVAPDNEFEKRIRPEVIPANEIGVTFADIGALDDIKESLQELVMLPLRRPDLFKG  546

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  547   GLLKPCRGILLFGPPGTGKTMLAKAIASEAGASFINVSMSTITSKWFGEDEKNVRALFTL  606

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             AAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNR
Sbjct  607   AAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKTGERILVLAATNR  666

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERR+MVGLP+ E RE+ILKTLL+KE V + LD K+LATMTEGY+GSDL
Sbjct  667   PFDLDEAIIRRFERRVMVGLPSVENREMILKTLLSKEKV-ENLDFKELATMTEGYSGSDL  725

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNC-GDAPTANEDKGERVITIRPLNMD  536
             KNLC TAAYRPVRELI+QER KDVEKK+   +       +    E+K E VIT+R LNM+
Sbjct  726   KNLCVTAAYRPVRELIQQERQKDVEKKKKDAKEKGTEEASEPKEEEKEEHVITLRVLNME  785

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             D  +AKNQVAASFA+EGS+M+ELKQWN L+GEGGSRKK+QLTYFL
Sbjct  786   DMRQAKNQVAASFASEGSVMSELKQWNELFGEGGSRKKQQLTYFL  830



>ref|XP_004967436.1| PREDICTED: uncharacterized protein LOC101780417 [Setaria italica]
Length=851

 Score =  1079 bits (2790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 560/822 (68%), Positives = 653/822 (79%), Gaps = 28/822 (3%)
 Frame = -1

Query  2812  NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRN  2633
             + VTV+ +EQE+   +VDG +SK TFDEFPYYLSEQTRV+LTSAA+VHLK AD +++TRN
Sbjct  40    DGVTVERVEQELRRLLVDGAESKATFDEFPYYLSEQTRVVLTSAAYVHLKQADISRYTRN  99

Query  2632  LSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSS-RNESSFK  2456
             L+PASR ILLSGPAELYQQMLAKALAHYF AKLLLLD TDF +K+ SKYG+    E  FK
Sbjct  100   LAPASRAILLSGPAELYQQMLAKALAHYFQAKLLLLDPTDFLIKIHSKYGTGGSTEQPFK  159

Query  2455  RSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssa  2276
             RSISETT  R++  LGS SIL  KE+ K T+RRQSS  D+  +  E  SN   LRRN+S 
Sbjct  160   RSISETTFERVTGLLGSLSILPQKEQPKETIRRQSSMTDVKLRSSESMSNLPKLRRNAST  219

Query  2275  sanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLL  2096
             S++M++L S   ++N  PL R SS +FDEK+L+QALYKVL  VSK  PIVLY+RD EK L
Sbjct  220   SSDMSSLASQGPSTNTAPLRRASSWTFDEKILVQALYKVLHSVSKKYPIVLYIRDVEKFL  279

Query  2095  CRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETH  1916
              +S K+Y+L +K+L +L G VL+LGSRIV+   D  ELD+RL+ +FPYNIEIKPPE E H
Sbjct  280   HKSPKMYLLFEKLLNKLEGPVLVLGSRIVEMDVD-EELDDRLTVLFPYNIEIKPPENENH  338

Query  1915  LVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSA  1736
             LVSW SQLEEDMKM+Q+QDN+NHI+EVLA ND+ECDDLGSIC++DT+ LS YIEE+VVSA
Sbjct  339   LVSWNSQLEEDMKMIQFQDNRNHILEVLAENDLECDDLGSICLSDTIGLSKYIEEIVVSA  398

Query  1735  ISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGE  1556
             +SYHLMN ++PEYRN KLVIS+KSLSH + IF+E K +  KD LKLE  A+  K   + E
Sbjct  399   VSYHLMNNREPEYRNGKLVISAKSLSHALEIFQENKMS-DKDSLKLEVTADALK---AAE  454

Query  1555  KGSKGPETKAESSTAPGSKP---------------ETGsaapapapttkdatsSGTAVKA  1421
             KG+     K+E+  A    P                  + A    P  +   S   A KA
Sbjct  455   KGTAPTAAKSETKPATLLPPVRPPAAASAAPAAAAAAAAPAVESKPAPEKKDSPPPAAKA  514

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEVPPDNEFEKRIRPEVIPA EIGV+F DIGALD+IKESLHELVMLPLRRPDLFKGGLLK
Sbjct  515   PEVPPDNEFEKRIRPEVIPANEIGVSFDDIGALDDIKESLHELVMLPLRRPDLFKGGLLK  574

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  575   PCRGILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  634

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P +RILVLAATNRPFDL
Sbjct  635   SPTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQRILVLAATNRPFDL  694

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELI++ LL+KE V + LD K+LATMTEGY+GSDLKNLC
Sbjct  695   DEAIIRRFERRIMVGLPSMESRELIMRRLLSKEKVDEGLDFKELATMTEGYSGSDLKNLC  754

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGER--VITIRPLNMDDFM  527
             TTAAYRPVRELI++ER K++EK +  +     G AP+ +  K E+   I +RPLNM D  
Sbjct  755   TTAAYRPVRELIQKERKKELEKLKREK-----GGAPSDSTKKKEKEEPIILRPLNMTDLK  809

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             EAKNQVAASFAAEG+IM EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  810   EAKNQVAASFAAEGAIMGELRQWNELYGEGGSRKKQQLTYFL  851



>ref|XP_007220610.1| hypothetical protein PRUPE_ppa001598mg [Prunus persica]
 gb|EMJ21809.1| hypothetical protein PRUPE_ppa001598mg [Prunus persica]
Length=795

 Score =  1078 bits (2789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/825 (67%), Positives = 648/825 (79%), Gaps = 66/825 (8%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VSKW     S++ VT + +EQE++  ++DGR+SKVTF+EFPYYL E+TR+LLTSAA+V
Sbjct  27    QAVSKWVNGNCSADEVTAEQIEQELMRQVLDGRNSKVTFEEFPYYLRERTRMLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK +D +KHTRNLSPASR ILLSGPAELY Q+LAKALAHYF +KLLLLD+TDFS+K   
Sbjct  87    HLKHSDLSKHTRNLSPASRAILLSGPAELYHQVLAKALAHYFESKLLLLDITDFSIKY--  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
                        KRSISE T+ RMS  LGSFSIL    + KG  R                
Sbjct  145   ----------LKRSISEVTMERMSSLLGSFSILPSSGDSKGKRR----------------  178

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              N +TL+RN+S++++M++ +S    ++  PL R +S  FDEKL +Q+LYKVL  +S+T  
Sbjct  179   PNNSTLQRNASSASDMSSFSSKCAPTSSAPLKRVTSWCFDEKLFLQSLYKVLASISETGS  238

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD EKL  +S ++Y L  KML+RLSGSVLILGSR++D  DD +E+DERL+ +FPY
Sbjct  239   IILYIRDVEKLFLQSRRLYNLFNKMLKRLSGSVLILGSRMLDAEDDCKEVDERLAGLFPY  298

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI PPE+ETHLVSWK+QLEEDMKM+Q+ DNKNHI EVLA+ND+ECDDLGSIC ADTM 
Sbjct  299   NIEISPPEDETHLVSWKAQLEEDMKMIQFHDNKNHIAEVLASNDLECDDLGSICHADTMV  358

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLM  KDPEYRN KLVISS SLSHG++IF+E K+  GKD LKLE+
Sbjct  359   LSNYIEEIVVSAISYHLMQNKDPEYRNGKLVISSTSLSHGLSIFQEGKSG-GKDSLKLET  417

Query  1591  KAELSKETQSGEK-GSK------GPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
              A+ +KET+  E  G+K      GP  K +S   P  K E                    
Sbjct  418   NADSNKETEGEEAVGAKTETEKSGPAVKKDSENPPPPKVE--------------------  457

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
                   V PDNEFEKRIRPEVIPA EIGVTFADIGALD+IKESL ELVMLPLRRPDLFKG
Sbjct  458   ------VAPDNEFEKRIRPEVIPANEIGVTFADIGALDDIKESLQELVMLPLRRPDLFKG  511

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  512   GLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTL  571

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             AAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNR
Sbjct  572   AAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKTGERILVLAATNR  631

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERR+MVGLP+ E RE+ILKTLL+KE V + LD K+LATMTEGY+GSDL
Sbjct  632   PFDLDEAIIRRFERRVMVGLPSVENREMILKTLLSKEKV-ENLDFKELATMTEGYSGSDL  690

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMD  536
             KNLC TAAYRPVRELI+QER KD+EKK+   +  +  DA  T  E+K ++ IT+R LNM+
Sbjct  691   KNLCVTAAYRPVRELIQQERQKDMEKKKREAQGKSTEDASETKEEEKEDQEITLRALNME  750

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             D  +AKNQVAASFA+EGS+M+ELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  751   DMRQAKNQVAASFASEGSVMSELKQWNDLYGEGGSRKKQQLTYFL  795



>ref|XP_009626478.1| PREDICTED: uncharacterized protein LOC104117172 [Nicotiana tomentosiformis]
Length=824

 Score =  1077 bits (2786),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 559/818 (68%), Positives = 664/818 (81%), Gaps = 21/818 (3%)
 Frame = -1

Query  2845  QTVSKWTGSSSNA--VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V+KWTG +S A  +T D +EQE+    VDG+ +KV+F +FPY+LSE+TRVLLTSAA+V
Sbjct  25    QAVNKWTGGNSAAEGITADQIEQELRRLFVDGKHTKVSFADFPYFLSERTRVLLTSAAYV  84

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HL   D +KHTRNLSPASR ILLSGPAELYQQ LAKALAH+F AKLLLLD+TDF+LK+QS
Sbjct  85    HLNHLDVSKHTRNLSPASRAILLSGPAELYQQTLAKALAHHFDAKLLLLDLTDFTLKMQS  144

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + ES+FKRS SE+ L R S  +GSFSIL  +E   GT  RQ++  D  S+  EG+
Sbjct  145   KYGIFKKESAFKRSTSESMLGRWSSLIGSFSILPARENNGGTFSRQTTAFDAKSRNREGA  204

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN    RR +S S+++++++S + +SNP P  R +S S DEK L+Q+LYKVLV VS+   
Sbjct  205   SNSLKHRRTASVSSDISSISSDSCSSNPAPTKRVNSWSIDEKALLQSLYKVLVSVSENSR  264

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY+RD ++ L +  +VY L  +ML++LSGSVL+LGSR+ +  DD  E+DE+L  +FPY
Sbjct  265   VILYIRDVDRHL-QPPRVYKLFDRMLKKLSGSVLVLGSRMFEHEDDCEEVDEKLGLLFPY  323

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             +IEI+PPE+ETHL  WK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADT+ 
Sbjct  324   SIEIRPPEDETHLTDWKTQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICRADTVV  383

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+V+SAISYHLMN+KDPEYRN KL+ISS SLSHG+++F++ K+   +D LK+E+
Sbjct  384   LSNYIEEIVISAISYHLMNSKDPEYRNGKLLISSNSLSHGLSVFQDGKSGC-RDSLKMEA  442

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              AE SK+T     G K PETK+E+ T+  SK E           +  +      +KAPEV
Sbjct  443   NAETSKDT-----GLK-PETKSENPTSE-SKGEA--------EKSVPSAKKDGEIKAPEV  487

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
              PDNEFEKRIRPEVIP+ EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPCR
Sbjct  488   LPDNEFEKRIRPEVIPSNEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPCR  547

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  548   GILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  607

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDEA
Sbjct  608   IIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDEA  667

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP  E RE ILKTLLAKE V + LD K+LA MTEGY+GSDLKNLCTTA
Sbjct  668   IIRRFERRIMVGLPAAENREKILKTLLAKEKV-EDLDFKELAAMTEGYSGSDLKNLCTTA  726

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG-ERVITIRPLNMDDFMEAKN  515
             AYRPVRELI+QER KD++KK+ A E  +  D     E+   ERVI +RPLNM+D  +AKN
Sbjct  727   AYRPVRELIQQERKKDMKKKQRADEGQSTEDHSDEKEEATEERVIALRPLNMEDMKQAKN  786

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+M+ELKQWN+LYGEGGSRKK+QL+YFL
Sbjct  787   QVAASFASEGSVMSELKQWNDLYGEGGSRKKQQLSYFL  824



>gb|AES94005.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=832

 Score =  1076 bits (2783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/808 (69%), Positives = 645/808 (80%), Gaps = 12/808 (1%)
 Frame = -1

Query  2821  SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKH  2642
             SSSNA+T D +E EML  +VDGR+S VTFD FPYYLSEQTRVLLTSAA+VHLK A+ +K+
Sbjct  36    SSSNALTPDKIENEMLRLVVDGRESNVTFDNFPYYLSEQTRVLLTSAAYVHLKHAEVSKY  95

Query  2641  TRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESS  2462
             TRNL+PASRTILLSGPAELYQQ+LAKAL HYF AKLLL DVTDFSLK+QS+YGSS  E+S
Sbjct  96    TRNLAPASRTILLSGPAELYQQVLAKALTHYFEAKLLLFDVTDFSLKIQSRYGSSNCETS  155

Query  2461  FKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrns  2282
             F RS SET L R+S+  GSF++   +EE +G + RQSSG D+     EGS +      ++
Sbjct  156   FTRSTSETALARLSDLFGSFALFPQREENQGKIHRQSSGSDLRQMEAEGSYSKLRRNASA  215

Query  2281  sasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEK  2102
             SA+ +   L S  T S PG     +   FDEK+LIQ LYKVL+ VSKT PIVLY+RDA+K
Sbjct  216   SANISSIGLQSNPTNSAPGK--HITGWPFDEKILIQTLYKVLLYVSKTYPIVLYMRDADK  273

Query  2101  LLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEE  1922
             LLCRS+++Y L Q ML +LSG +LI+GSRI+D G++ + +DE L+S+FPYNIEIKPPE+E
Sbjct  274   LLCRSQRIYKLFQTMLTKLSGPILIIGSRILDSGNECKRVDEMLTSLFPYNIEIKPPEDE  333

Query  1921  THLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVV  1742
             + LVSWKSQ E DMK +Q QDNKNHIMEVLAAND++C DL SIC+ADTM LSNYIEE++V
Sbjct  334   SRLVSWKSQFEADMKKIQIQDNKNHIMEVLAANDLDCHDLDSICVADTMVLSNYIEEIIV  393

Query  1741  SAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQS  1562
             SAISYH+M  K+PEYRN KL+I   SLSH + IF+  K    +D LKLE++A  S++ + 
Sbjct  394   SAISYHIMKNKEPEYRNGKLIIPCNSLSHALGIFQAGKFG-DRDSLKLEAQAVTSEKKEE  452

Query  1561  GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRI  1382
             G   +  PE K ES  AP  K E            +++  +  A    EVP DNEFEKRI
Sbjct  453   G--AAVKPEGKTESP-APAVKTEAEIPTSVRKTDGENSVPASKA----EVP-DNEFEKRI  504

Query  1381  RPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGT  1202
             RPEVIPA EIGVTF+DIGALDE K+SL ELVMLPLRRPDLF+GGLLKPCRGILLFGPPGT
Sbjct  505   RPEVIPANEIGVTFSDIGALDETKDSLQELVMLPLRRPDLFEGGLLKPCRGILLFGPPGT  564

Query  1201  GKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSM  1022
             GKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSM
Sbjct  565   GKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSM  624

Query  1021  LGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIM  842
             LGQR+R GEHEAMRKIKNEFMS+WDGL +K  +RILVLAATNRPFDLDEAIIRRFERRIM
Sbjct  625   LGQRTRVGEHEAMRKIKNEFMSNWDGLTSKSEDRILVLAATNRPFDLDEAIIRRFERRIM  684

Query  841   VGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK  662
             VGLP+ E RE IL+TLLAKE V   LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI+
Sbjct  685   VGLPSAENRENILRTLLAKEKVHGGLDFKELATMTEGYSGSDLKNLCTTAAYRPVRELIQ  744

Query  661   QERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAKNQVAASFAAEG  485
             QE  KD +KK+   E  N  DA  A E+ + ERVIT+RPLNM DF  AK+QVAASFAAEG
Sbjct  745   QEIQKDSQKKKKDAEGQNSQDAQDAKEEVEQERVITLRPLNMQDFKMAKSQVAASFAAEG  804

Query  484   SIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             + MNEL+QWN+LYGEGGSRKKEQL+YFL
Sbjct  805   AGMNELRQWNDLYGEGGSRKKEQLSYFL  832



>gb|KHN19953.1| Spastin [Glycine soja]
Length=817

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/818 (67%), Positives = 654/818 (80%), Gaps = 35/818 (4%)
 Frame = -1

Query  2833  KWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKS  2660
             KW G +  S+ ++V+ + QE+ N +V+GRD  VTF++FPYYLSE+T+VLLTSAA+VHLK 
Sbjct  28    KWVGGNRDSDELSVEQIVQELKNLVVEGRDGNVTFEDFPYYLSERTQVLLTSAAYVHLKH  87

Query  2659  ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS  2480
               F+KHTRNL PASR ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q+K+G 
Sbjct  88    LHFSKHTRNLPPASRAILLSGPAEPYQQMLAKALAHYFESKLLLLDITDFSVKLQNKFGC  147

Query  2479  SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPT  2300
             SR E SFKRSISE TL RMS   GSFS+L    E +G LR+QS        G   SSNP 
Sbjct  148   SRKEPSFKRSISEATLERMSGLFGSFSMLSSTGETRGILRQQS--------GASVSSNPP  199

Query  2299  TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLY  2120
              LRRN+SAS ++++ +S    + P PL  TSSL FDEKL +Q+LYK+LV +++T  I+LY
Sbjct  200   KLRRNASASYDISSTSSQCGPTFPAPLKHTSSLCFDEKLFVQSLYKLLVSITETGSIILY  259

Query  2119  LRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEI  1940
             +RD EKL+ +S ++Y LLQKM+++LSGSVLILGS+I+D  DD +E+DERL+ +FPYNIEI
Sbjct  260   IRDVEKLILQSPRLYNLLQKMIKKLSGSVLILGSQILDSEDDCKEVDERLTVLFPYNIEI  319

Query  1939  KPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNY  1760
             K PE+ETHL  WK QLE+DMK +Q+QDN+NHI EVLAANDI+CDDL SIC ADT+ LSNY
Sbjct  320   KAPEDETHLGCWKGQLEKDMKDIQFQDNRNHIAEVLAANDIDCDDLNSICHADTILLSNY  379

Query  1759  IEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAEL  1580
             IEE+VVSA+SYHLMNTKDPEYRN KLVIS+ SLSHG+++F+E K++   ++   ES  E 
Sbjct  380   IEEIVVSALSYHLMNTKDPEYRNGKLVISANSLSHGLSLFQEGKSSG--NLKTNESNKEN  437

Query  1579  SKETQSGEKG-----SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             S E  +G K      ++ PE K+E+  +     + G                   + A  
Sbjct  438   SGEDITGAKNEMKCDNQAPENKSETEKSIPITKKDGE----------------NPIPAKA  481

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
               PDNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  482   EVPDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPC  541

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAI+ EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+P
Sbjct  542   RGILLFGPPGTGKTMLAKAISNEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAP  601

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT P E+ILVLAATNRPFDLDE
Sbjct  602   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTGPNEQILVLAATNRPFDLDE  661

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRI+VGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC T
Sbjct  662   AIIRRFERRILVGLPSVENREMILKTLLAKEK-HENLDFKELATMTEGYTGSDLKNLCIT  720

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AAYRPVRELI+QER+KD+EKK+   E  +  DA + N+DK E+ IT+ P NM+D   AK+
Sbjct  721   AAYRPVRELIQQERMKDMEKKKREAEGQSSEDA-SNNKDKEEQEITLTPSNMEDMRRAKS  779

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+MNELK WN+LYGEGGSRKK+QL+YFL
Sbjct  780   QVAASFASEGSVMNELKHWNDLYGEGGSRKKQQLSYFL  817



>ref|XP_002454901.1| hypothetical protein SORBIDRAFT_03g001130 [Sorghum bicolor]
 gb|EES00021.1| hypothetical protein SORBIDRAFT_03g001130 [Sorghum bicolor]
Length=847

 Score =  1073 bits (2776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/819 (68%), Positives = 649/819 (79%), Gaps = 28/819 (3%)
 Frame = -1

Query  2806  VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLS  2627
             VTV+ +EQ++   +VDG +SKVTFDEFPYYLSEQTRV+LTSAA+VHLK A+ +K+TRNL+
Sbjct  40    VTVERVEQDLRRLLVDGSNSKVTFDEFPYYLSEQTRVVLTSAAYVHLKQAEISKYTRNLA  99

Query  2626  PASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSS-RNESSFKRS  2450
             PASR ILLSGPAELYQQMLA+ALAHYF AKLLLLD TDF +K+ SKYG+    E +FKRS
Sbjct  100   PASRAILLSGPAELYQQMLARALAHYFQAKLLLLDPTDFLIKIHSKYGTGGSTEKTFKRS  159

Query  2449  ISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasa  2270
             ISETTL R+S  LGS SI+  KE+ KGT+RRQSS  D+  +  E  +N   LRRN+S S+
Sbjct  160   ISETTLERVSGLLGSLSIISQKEQPKGTIRRQSSMTDVKLRSSESMTNLPKLRRNASTSS  219

Query  2269  nmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCR  2090
             +M+++ S   ++N  PL RTSS +FDEK+L+QALYKVL  VSK  P+VLY+RD EK L +
Sbjct  220   DMSSMASQGPSTNTAPLRRTSSWNFDEKILVQALYKVLHSVSKKYPVVLYIRDVEKFLHK  279

Query  2089  SEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLV  1910
             S K+Y+L +K+L +L G VL+LGSRIVD   D  ELD+RL+ +FPYNIEIKPPE E HLV
Sbjct  280   SPKMYLLFEKLLDKLEGPVLVLGSRIVDMDSD-EELDDRLTVLFPYNIEIKPPENENHLV  338

Query  1909  SWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAIS  1730
             SW SQLEEDMKM+Q+QDN+NHIMEVLA ND+ECDDLGSIC++DTM LS YIEE+VVSA+S
Sbjct  339   SWNSQLEEDMKMIQFQDNRNHIMEVLAENDLECDDLGSICLSDTMCLSKYIEEIVVSAVS  398

Query  1729  YHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG  1550
             YHLMN +DPEYRN KLV+S+KSLSH + IF+  K    KD +KLE    ++       + 
Sbjct  399   YHLMNNRDPEYRNGKLVLSTKSLSHALEIFQGNKMG-DKDSMKLE----VTDGALKAAEK  453

Query  1549  SKGPETKAESSTAPGS---------------KPETGsaapapapttkdatsSGTAVKAPE  1415
             +  P T A+S T P +                    +         +   +     KA E
Sbjct  454   AIAPAT-AKSETKPATLLPPVRPPAGAAAAAPSSAPAPRVESKTEPEKKDNPPPVAKALE  512

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGV+F DIGALD+IKESLHELVMLPLRRPDLFKGGLLKPC
Sbjct  513   VPPDNEFEKRIRPEVIPANEIGVSFDDIGALDDIKESLHELVMLPLRRPDLFKGGLLKPC  572

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  573   RGILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  632

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P +RILVLAATNRPFDLDE
Sbjct  633   TIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQRILVLAATNRPFDLDE  692

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RELI++ LL+KE V + LD K+LATMTEGY+GSDLKNLCTT
Sbjct  693   AIIRRFERRIMVGLPSMESRELIMRRLLSKEKVDEGLDYKELATMTEGYSGSDLKNLCTT  752

Query  694   AAYRPVRELIKQERLKDVEK-KRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAK  518
             AAYRPVRELI++ER K++EK KR   + P+  D P   E   E  I +RPLNM D  EAK
Sbjct  753   AAYRPVRELIQRERKKELEKMKREKGKTPS--DLPEKKEK--EETIILRPLNMTDLKEAK  808

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFAAEG+IM+EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  809   NQVAASFAAEGAIMSELRQWNELYGEGGSRKKQQLTYFL  847



>ref|XP_002865936.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42195.1| ATP binding protein [Arabidopsis lyrata subsp. lyrata]
Length=830

 Score =  1073 bits (2774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/825 (66%), Positives = 666/825 (81%), Gaps = 29/825 (4%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE++  IVDGR+S VTFDEFPY+LS++TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQIEQELMRQIVDGRESTVTFDEFPYFLSKRTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL++MS  +GSFS+L  +E E +GTLRR +SG D+ S+ IE
Sbjct  145   SKYGCTKREPFHKRSISELTLDKMSSLMGSFSMLSQREVEPRGTLRRHTSGNDLKSRSIE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+ P   +RN+SA++++++++S +++S      R+++L FDEKL +Q+LYKVLV VS+T
Sbjct  205   SSNRPPRHKRNASAASDISSMSSRSSSSVSASSRRSTNLCFDEKLFLQSLYKVLVSVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+ E +S++F
Sbjct  265   TPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVGEGISALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ LVSWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLVSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLASICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAI+YHL++TK+PEYRN KLVISS+SLSHG+ IF+E    + +D LKL
Sbjct  384   MCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLVISSRSLSHGLGIFQEGGNRSFEDSLKL  443

Query  1597  ESKAELSK---ETQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  +   E  S  +   GPE K ES  + P +K +                     
Sbjct  444   DTNTDSKRKEGEVCSKSESKSGPENKNESEISLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL KE   + LD  +L  MTEGY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLLKEKT-ENLDFHELGQMTEGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRL--AQECPNCGDAPTANEDKGERVITIRPLNMD  536
             NLC TAAYRPVRELI+QERLKD E+K+   A +           E   ERVIT+RPLNM+
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERKKREEAGKGTEEPKEKEEAEASEERVITLRPLNME  785

Query  535   DFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             D  +AKNQVAASFA+EG+ +NELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  786   DMRKAKNQVAASFASEGAGLNELKQWNDLYGEGGSRKKEQLTYFL  830



>ref|XP_006374291.1| AAA-type ATPase family protein [Populus trichocarpa]
 gb|ERP52088.1| AAA-type ATPase family protein [Populus trichocarpa]
Length=793

 Score =  1072 bits (2773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 568/819 (69%), Positives = 653/819 (80%), Gaps = 56/819 (7%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VS+W G   S + VT + +EQE++  +VDGRDSKVTF++      E+TR+LLTSAAFV
Sbjct  27    QKVSRWAGGCGSIDGVTAEQIEQELMRQVVDGRDSKVTFED------EKTRMLLTSAAFV  80

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+KHTRNLSPASR ILLSGPAE Y QMLAKALAH F +KLLLLDV+DFS+K   
Sbjct  81    HLKHADFSKHTRNLSPASRAILLSGPAEFYHQMLAKALAHNFESKLLLLDVSDFSMK---  137

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
                      SFKRSIS  TL RMS   GSFSIL PKEE               ++G EGS
Sbjct  138   ---------SFKRSISGVTLERMSSLFGSFSILSPKEE---------------TRGKEGS  173

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN   LRRN+S +++M+++TS +++ NP PL  TSS  FDE L +Q+LY+VLV VS+   
Sbjct  174   SNSPKLRRNTSTASDMSSMTSQSSSMNPAPLKHTSSWCFDENLFLQSLYQVLVSVSERSS  233

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LYLRDAEKLL +S+++Y LL K+L++LSG+VLILGSR++D  DD +E+DERL+ +FPY
Sbjct  234   IILYLRDAEKLLLQSQRMYNLLDKLLKKLSGNVLILGSRMLDQEDDCKEVDERLAMLFPY  293

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWK+QLEEDMK +Q+QDNKNHI EVLAANDIECD L SIC  DTM 
Sbjct  294   NIEIKPPEDETHLVSWKAQLEEDMKKIQFQDNKNHIAEVLAANDIECDGLSSICHGDTMV  353

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E K+  GKD LKLE+
Sbjct  354   LSNYIEEIVVSAISYHLMNNKDPEYRNGKLLISSKSLSHGLSIFQEGKSD-GKDTLKLET  412

Query  1591  KAELSKETQSGEK-GSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
              AE  KE +  E  G+K      +  +  G+K ++                     KAPE
Sbjct  413   NAEAGKEAEGEEAVGAKNNSKTEKEKSVTGAKKDSE-----------------NQPKAPE  455

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  456   VPPDNEFEKRIRPEVIPANEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPC  515

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  516   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  575

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDE
Sbjct  576   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDE  635

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE ILKTL++KE   + LD K+LATMTEGYTGSDLKNLC T
Sbjct  636   AIIRRFERRIMVGLPSIESRERILKTLMSKEKT-EDLDFKELATMTEGYTGSDLKNLCVT  694

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEAK  518
             AAYRPVREL++QER+KD EKK+ A+E  +  DA  + E+ K E VI +RPLNMDD  +AK
Sbjct  695   AAYRPVRELLQQERVKDKEKKQKAEEGTSSEDAADSKEEGKEESVIILRPLNMDDMRQAK  754

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVA+SFA EG++MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  755   NQVASSFATEGTVMNELKQWNELYGEGGSRKKQQLTYFL  793



>ref|XP_010671575.1| PREDICTED: uncharacterized protein LOC104888335 [Beta vulgaris 
subsp. vulgaris]
Length=830

 Score =  1071 bits (2771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/829 (65%), Positives = 660/829 (80%), Gaps = 39/829 (5%)
 Frame = -1

Query  2845  QTVSKWTGSSS--NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV KW GS++  ++++ D +E E+L  IVDG+++KVTFDEFPY+LSEQTR+LLTSAA+V
Sbjct  27    QTVGKWIGSNATLDSISADQIENELLRLIVDGKETKVTFDEFPYFLSEQTRMLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK A+ +K TRNLSP SR ILLSGPAELYQQ+LAKALAHYF AKLLLLDV DFS+K+Q+
Sbjct  87    HLKHAEVSKFTRNLSPGSRAILLSGPAELYQQLLAKALAHYFDAKLLLLDVVDFSMKMQN  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG ++ E+   RSISE TL RMS  LGSFS+L P+E  KGTLRRQ+S  DI S+  + +
Sbjct  147   KYGCNKKETRMTRSISEATLGRMSSLLGSFSVLPPREVPKGTLRRQASTTDINSRAGDAA  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S P   RRN+S S +++++ S + T++  P  RT++ SFDEKL +QALYKVLV  S+  P
Sbjct  207   SCPPKHRRNASTSTDLSSIASQSATTSFPP-KRTNNWSFDEKLFLQALYKVLVTASEKNP  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD E+LL +SE++Y L  K+L++++GSVL+LGSR++D   +Y ++D+RL+ +FPY
Sbjct  266   IILYVRDIERLLLQSERLYNLFDKLLKKMTGSVLVLGSRMLDANSEYEQVDDRLTLLFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NI+I+PP++E++LV+W SQLEEDMKM+Q+QD +NHI E+LAAND+ CDDLGSIC +DT+ 
Sbjct  326   NIDIRPPDDESNLVNWNSQLEEDMKMIQFQDTRNHIAEILAANDLVCDDLGSICHSDTIT  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LS++I+EVV+SAISYHLMN K+P+YRN KLVISS SL+HG++IF+E K      + K+E+
Sbjct  386   LSDHIDEVVMSAISYHLMNNKEPDYRNGKLVISSTSLAHGLSIFQEGKKMG---VAKMET  442

Query  1591  KAELSKETQS-------GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
               E  K T         G+  S G + K +  + P +K                  ++  
Sbjct  443   NGETGKATDDAGAVKSDGKSESSGADNKGDDKSLPPTK------------------NAEN  484

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
                  EV PDNEFEKRIRPEVIPA EIGVTF DIG+L+E KESL ELVMLPLRRPDLFKG
Sbjct  485   PAPVKEVAPDNEFEKRIRPEVIPANEIGVTFNDIGSLEETKESLQELVMLPLRRPDLFKG  544

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRG+LLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  545   GLLKPCRGVLLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTL  604

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             AAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGE+ILVLAATNR
Sbjct  605   AAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGEQILVLAATNR  664

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP+ E RE ILKTLL+KE    V D ++LATMTEGYTGSDL
Sbjct  665   PFDLDEAIIRRFERRIMVGLPSTENREKILKTLLSKEKAENV-DFRELATMTEGYTGSDL  723

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANE-----DKGERVITIRP  548
             KNLC TAAYRPVRELI++ER KD+ +K+ AQE  N  D+  A+      +K E  I +R 
Sbjct  724   KNLCITAAYRPVRELIQRERKKDLARKKKAQE--NNNDSTDASSETKEPEKEEEPIVLRA  781

Query  547   LNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             LNM+D  +AKNQVAASFA+EG++MNELKQWN LYGEGGSRKKEQLTYFL
Sbjct  782   LNMEDLRQAKNQVAASFASEGAVMNELKQWNELYGEGGSRKKEQLTYFL  830



>ref|XP_010442834.1| PREDICTED: uncharacterized protein LOC104725802 [Camelina sativa]
Length=832

 Score =  1070 bits (2767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/827 (66%), Positives = 670/827 (81%), Gaps = 31/827 (4%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE+L  IVDGR+S VTFDEFPY+LS++TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQIEQELLRQIVDGRESTVTFDEFPYFLSKRTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL++MS F+GSFS+L  +E E +GTLRR  SG D+ S+ +E
Sbjct  145   SKYGCTKREPFHKRSISEFTLDKMSSFMGSFSMLSQREVEPRGTLRRPISGNDLNSRSME  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+     +RN+SA++++++++S +++S      R ++L FDEKL +Q+LYKVLV VS+T
Sbjct  205   SSNRLPRHKRNASATSDISSISSRSSSSVSASSKRNTNLCFDEKLFLQSLYKVLVTVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VL+LGSR+++P DD++E+DE +S++F
Sbjct  265   SPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLLLGSRVLEPEDDFQEVDEGVSALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLASICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E  +   +D LKL
Sbjct  384   MCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGSRLLEDSLKL  443

Query  1597  ESKAELSKE---TQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  ++     S  +   GP+ K ES  + P +K +                     
Sbjct  444   DTNTDSKRKEGEVSSKSESKSGPDNKNESEKSLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  ++A MTEGY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHEIAQMTEGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG----ERVITIRPLN  542
             NLC TAAYRPVRELI+QERLKD E+K   +   +  ++      K     ERVIT+RPLN
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERKNKEEAGKSTEESKEEEAGKTSESEERVITLRPLN  785

Query  541   MDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             M+D  +AKNQVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  786   MEDMRKAKNQVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  832



>gb|AAF24564.1|AC007764_6 F22C12.12 [Arabidopsis thaliana]
Length=825

 Score =  1069 bits (2765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/848 (68%), Positives = 649/848 (77%), Gaps = 82/848 (10%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SS+NAVT D ME+E+L  +VDGR+SK+TFD+      EQTRVLLTSAA+
Sbjct  27    QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDD------EQTRVLLTSAAY  80

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  81    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  140

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYGS   ESS                              GTLRRQSSGVDI S  +EG
Sbjct  141   SKYGSGNTESSVIAG--------------------------GTLRRQSSGVDIKSSSMEG  174

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVK-----  2150
             SSNP  LRRNSSA+AN++NL    ++SN  PL R+SS SFDEKLL+Q+LYKV+ K     
Sbjct  175   SSNPPKLRRNSSAAANISNLA---SSSNQAPLKRSSSWSFDEKLLVQSLYKVMCKTIKSI  231

Query  2149  -----VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYR  1988
                  VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +
Sbjct  232   KVLAYVSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQ  291

Query  1987  ELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECD  1808
             E+DE+LS+VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CD
Sbjct  292   EIDEKLSAVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICD  351

Query  1807  DLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEK  1628
             DL SI   DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K
Sbjct  352   DLESISFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGK  411

Query  1627  TAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkda  1448
              A G++ LK ++K E SKE ++    S  PETK ES T   SK E            K+A
Sbjct  412   -AGGREKLKQKTKEESSKEVKA---ESIKPETKTESVTTVSSKEEP----------EKEA  457

Query  1447  tsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRP  1268
              +     KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALDEIKESL ELVMLPLRRP
Sbjct  458   KAEKVTPKAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRP  517

Query  1267  DLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
             DLF GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR
Sbjct  518   DLFTGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  577

Query  1087  ALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVL  908
             ALFTLA+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVL
Sbjct  578   ALFTLASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVL  637

Query  907   AATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGY  728
             AATNRPFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGY
Sbjct  638   AATNRPFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGY  697

Query  727   TGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLA--------------QECPNCGD-AP  593
             TGSDLKNLCTTAAYRPVRELI+QER+KD  +  ++               +C       P
Sbjct  698   TGSDLKNLCTTAAYRPVRELIQQERIKDTVRNNISLRLFLYTSIFILVLTDCEKKKQREP  757

Query  592   T--ANEDKG--ERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRK  425
             T    ED+G  ERVIT+RPLN  DF EAKNQVAASFAAEG+ M ELKQWN LYGEGGSRK
Sbjct  758   TKAGEEDEGKEERVITLRPLNRQDFKEAKNQVAASFAAEGAGMGELKQWNELYGEGGSRK  817

Query  424   KEQLTYFL  401
             KEQLTYFL
Sbjct  818   KEQLTYFL  825



>ref|XP_010917029.1| PREDICTED: uncharacterized protein LOC105041713 isoform X2 [Elaeis 
guineensis]
Length=836

 Score =  1068 bits (2763),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/784 (70%), Positives = 642/784 (82%), Gaps = 9/784 (1%)
 Frame = -1

Query  2845  QTVSKWTG--SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTVSKW    SSS  VT + +E+E++  +VDGR+ KVTFDEFPYYLSEQTR LLTSAA+V
Sbjct  27    QTVSKWAAPASSSAGVTAENIEKELMRMVVDGREGKVTFDEFPYYLSEQTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK AD +K TRNLSPAS+ ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QS
Sbjct  87    HLKQADLSKFTRNLSPASQAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK---GTLRRQSSGVDIPSKGI  2321
             KYGSS  +S F+RS+SE TL RMS  LGSFSIL  +EE +   G+L RQ+S V++  +G 
Sbjct  147   KYGSSNKDSFFRRSVSEATLERMSSLLGSFSILAQREEPRVIAGSLHRQNSCVELRPRGS  206

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             + +S  T L +N+S SA+M+ LTS     NP PL R+SS SFDEK+L+Q+LYKVLV VSK
Sbjct  207   DSNSYMTKLHKNASVSADMHGLTSQCAPINPVPLKRSSSWSFDEKILLQSLYKVLVSVSK  266

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
             + P+VLY+RD E LL RS+++Y L QKML++L G VLILGSR+++   DYR++D R+ ++
Sbjct  267   SNPVVLYIRDVENLLYRSQRIYSLFQKMLKKLPGPVLILGSRLLESDGDYRDMDGRVGNL  326

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPYNIEIKPPE+ETHLVSWKSQLEEDM+M+Q QDN+NHI  VLA ND+ECDDLGSIC+ D
Sbjct  327   FPYNIEIKPPEDETHLVSWKSQLEEDMRMIQIQDNRNHITGVLAENDLECDDLGSICLVD  386

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             T+ LSNYIEE+VVSA+SYHLMN K+PEYRN KL+ISSKSLSHG++IF+E + + G+D LK
Sbjct  387   TVVLSNYIEEIVVSAVSYHLMNNKEPEYRNGKLIISSKSLSHGLSIFQESRRS-GEDTLK  445

Query  1600  LESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             LE+  E  KET   E G+     K E S A  S PE  S A  PA   KDA  S    K 
Sbjct  446   LEANVESGKETVD-EDGAAAAVAKPEVS-AEASPPEKKSEAEKPASAVKDADGSSLPPKT  503

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIR EVIPA EIGVTF DIGALDE+KESL ELVMLPLRRPDLF GGLLK
Sbjct  504   PEVAPDNEFEKRIRQEVIPASEIGVTFNDIGALDEVKESLQELVMLPLRRPDLFTGGLLK  563

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMST+TSKWFGEDEKNVRALFTLAAKV
Sbjct  564   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTVTSKWFGEDEKNVRALFTLAAKV  623

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             +PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM HWDGLLTK GERILVLAATNRPFDL
Sbjct  624   APTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMMHWDGLLTKSGERILVLAATNRPFDL  683

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RELIL+ LL+KE V + LD +++AT TEGY+GSDLKNLC
Sbjct  684   DEAIIRRFERRIMVGLPSVESRELILRKLLSKEKVEE-LDYREIATTTEGYSGSDLKNLC  742

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
              TAAYRPVRELI++ERLK++EKK+ A+E  +  ++    E+ GE+ +T+RPLNM+D  +A
Sbjct  743   VTAAYRPVRELIQRERLKELEKKQKAEEGDSSAESSENREEDGEQTVTLRPLNMEDLRQA  802

Query  520   KNQV  509
             KNQ+
Sbjct  803   KNQI  806



>gb|EPS71448.1| hypothetical protein M569_03307 [Genlisea aurea]
Length=807

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/824 (65%), Positives = 634/824 (77%), Gaps = 53/824 (6%)
 Frame = -1

Query  2845  QTVSKWTGSSSNA-VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             Q V KW  S   A VT +I+EQEMLN + DGRDS V+FD FPYY+SEQTRVLLTSAA V+
Sbjct  28    QAVGKWAASKDYAGVTPEIVEQEMLNLVCDGRDSNVSFDRFPYYISEQTRVLLTSAALVY  87

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             L   DF KHTRNLSPASRTILLSGPAELY QM++KALAHYF AKLL+LDVTDFSLK+Q K
Sbjct  88    LNKFDFTKHTRNLSPASRTILLSGPAELYHQMISKALAHYFEAKLLILDVTDFSLKIQRK  147

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YG S +E+SFKRS+SE+TL RMSE LGSFS+++ KEE KG            ++ + GS 
Sbjct  148   YGGSIDEASFKRSVSESTLGRMSELLGSFSLIR-KEENKGD-----------NQSMSGSG  195

Query  2308  NPTTlrrnssasanmnnltSYNTTSNP---GPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
                        +A+  N+    T SN    G L R++S  FDEKL ++ LYK+L+KVSK 
Sbjct  196   RDDCRSAKLRRNASAANIYDMGTNSNSSASGSLKRSASWCFDEKLFVKTLYKILMKVSKL  255

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
             CP+VLYLRD EKLL RSE++YIL QKML+RLSGS+LILGSRIV P D+ R +DE +S+VF
Sbjct  256   CPVVLYLRDVEKLLFRSERLYILFQKMLKRLSGSILILGSRIVSPEDECRIVDENVSAVF  315

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYN+EI+PPE+E  L+SW+SQLEEDMKM+QYQDN+NHI+EVLAAND++CDDL SIC+ADT
Sbjct  316   PYNVEIRPPEDEVRLISWRSQLEEDMKMIQYQDNRNHILEVLAANDLDCDDLDSICLADT  375

Query  1777  MALSNYIEEVVVSAISYHLMNTKD--PEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDIL  1604
             + LSN+I+E+V+SAIS+HLM+ K+  P+YRN KLVISSKSLSHG+++F+E K  +   I 
Sbjct  376   INLSNFIDEIVISAISFHLMDAKEEPPQYRNGKLVISSKSLSHGLSVFQEGKNNSAGKI-  434

Query  1603  KLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
                   E  K T   +     P++ + S     +  E                      +
Sbjct  435   -----KESKKSTTESKNEKPTPKSPSVSCVCCLAFSELSLFDCLLFR------------E  477

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             + + PPDNEFEKRIRPEV+PA EIGVTF DIGALDEIKESL ELVMLPLRRPDLF+GGLL
Sbjct  478   SQDFPPDNEFEKRIRPEVVPASEIGVTFGDIGALDEIKESLQELVMLPLRRPDLFEGGLL  537

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIA E+GASFINVSMST+TSKWFGEDEKNVRALFT+AAK
Sbjct  538   KPCRGILLFGPPGTGKTMLAKAIANESGASFINVSMSTVTSKWFGEDEKNVRALFTVAAK  597

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSP+IIF+DEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGL+TKPGE+ILVLAATNRPFD
Sbjct  598   VSPSIIFIDEVDSMLGQRNRAGEHEAMRKIKNEFMAHWDGLMTKPGEKILVLAATNRPFD  657

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RE IL TLL+KE   + LD ++LA MTEGYTGSDLKNL
Sbjct  658   LDEAIIRRFERRIMVGLPSSENREKILNTLLSKEKAIEGLDFEELARMTEGYTGSDLKNL  717

Query  703   CTTAAYRPVRELIKQER---LKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDD  533
             C TAAYRPVRELI+ ER   L+D  K R  +E              GER I IRP+ MDD
Sbjct  718   CITAAYRPVRELIQNERRLLLQDQAKNRRTEE--------------GERKIAIRPITMDD  763

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
               +AK QVA SFA+EGSIMNELKQWN +YGEGGSRKKEQL+YF+
Sbjct  764   LHQAKKQVAPSFASEGSIMNELKQWNEIYGEGGSRKKEQLSYFM  807



>ref|NP_194529.4| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AEE85418.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=830

 Score =  1066 bits (2758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 541/826 (65%), Positives = 662/826 (80%), Gaps = 31/826 (4%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR+S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRESSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK +D +KHTRNL+P S+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQSDISKHTRNLAPGSKAILLSGPAEFYQQMLAKALAHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E S KRSISE T+++MS  +GS S+L  KE  +GTLRR +SG D+ S+G + 
Sbjct  145   SKYGCVKKEPSHKRSISELTMDKMSNLMGSISVLSQKEATRGTLRRHTSGNDLHSRGFDV  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +S P  L+RN+SA+++M++++S + TS      R+++L FDE+L +Q+LYKVLV +S+T 
Sbjct  205   TSQPPRLKRNASAASDMSSISSRSATSVSASSKRSANLCFDERLFLQSLYKVLVSISETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ Y L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKL-CQSERFYKLFQRLLTKLSGPVLVLGSRLLEPEDDCQEVGEGISALFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E  L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDENQLMSWKTRFEDDMKVIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLMN K+PEY+N +LVISS SLSHG+NI +E +    +D LKL+
Sbjct  384   FLSSHIEEIVVSAISYHLMNNKEPEYKNGRLVISSNSLSHGLNILQEGQ-GCFEDSLKLD  442

Query  1594  SKAELSKETQSGEKGSKG------PETKAESSTA-PGSKPETGsaapapapttkdatsSG  1436
             +  +   E   G   S+       PE K ES T+ P +K E                   
Sbjct  443   TNIDSKVEEGEGITKSESKSETTVPENKNESDTSIPAAKNECPL----------------  486

Query  1435  TAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK  1256
                KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFK
Sbjct  487   -PPKAPEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFK  545

Query  1255  GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFT  1076
             GGLLKPCRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFT
Sbjct  546   GGLLKPCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFT  605

Query  1075  LAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATN  896
             LAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATN
Sbjct  606   LAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNAGDRILVLAATN  665

Query  895   RPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSD  716
             RPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MT+GY+GSD
Sbjct  666   RPFDLDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSD  724

Query  715   LKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG-ERVITIRPLNM  539
             LKN CTTAAYRPVRELIKQE LKD E+++  +   N  +   A E+   ER IT+RPL+M
Sbjct  725   LKNFCTTAAYRPVRELIKQECLKDQERRKREEAEKNSEEGSEAKEEVSEERGITLRPLSM  784

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +D   AK+QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  785   EDMKVAKSQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  830



>ref|XP_010537130.1| PREDICTED: putative ribosome biogenesis ATPase nvl [Tarenaya 
hassleriana]
Length=831

 Score =  1066 bits (2757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/819 (67%), Positives = 664/819 (81%), Gaps = 16/819 (2%)
 Frame = -1

Query  2845  QTVSKWTGSSSNAV---TVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW   S   V    V+ +EQE++  +VDGR+SKVTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGKWANGSGYLVDGPAVEQIEQELVRQVVDGRESKVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGP+E YQQMLA+ALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQYDISKHTRNLAPASKAILLSGPSEFYQQMLARALAHYFESKLLLLDITDFSVKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG ++ E S KRSISE TL +MS  +GSFS+L P+EE +G LRR +SG D+ S+  E 
Sbjct  145   SKYGCTKKEPSHKRSISEMTLEKMSSLMGSFSMLNPREETRGALRRHTSGNDLCSRSFES  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SS P   +RN+S ++++++ +S ++ S  G   R ++L FDEKL +Q+LYKVLV VS++ 
Sbjct  205   SSKPPKHKRNASTASDISSKSSRSSVSVSGSSKRATNLCFDEKLFLQSLYKVLVSVSESN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              ++LYLRD EKLL  SE+ Y L Q++L ++SG VLILGSR+++P DD +E+ E +S +FP
Sbjct  265   SVILYLRDIEKLL-ESERFYKLFQRLLTKVSGPVLILGSRLLEPEDDCQEVSEEISDLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+ PEEE+ LVSWK++LEEDMKM+Q+QDNKNHI EVLAAND+ECDDL SIC ADTM
Sbjct  324   YNIEIRTPEEESQLVSWKTRLEEDMKMIQFQDNKNHIAEVLAANDLECDDLASICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSN+IEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG+++F+E      +D LKL+
Sbjct  384   VLSNHIEEIVVSAISYHLMNNKDPEYRNGKLIISSKSLSHGLSLFQEGYRGL-EDSLKLD  442

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +  +   + + GE G+ G +++++S T     PE+ +      P+TK    +    KAPE
Sbjct  443   TNTD--SKGKDGE-GTIGLKSESKSETVA---PESRTEMEKSLPSTKKDNENPLPPKAPE  496

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  497   VPPDNEFEKRIRPEVIPASEIGVTFADIGALDETKESLQELVMLPLRRPDLFKGGLLKPC  556

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  557   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  616

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDLDE
Sbjct  617   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDLDE  676

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MTEGY+GSDLK +C+ 
Sbjct  677   AIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFQELAQMTEGYSGSDLK-VCS-  733

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG-ERVITIRPLNMDDFMEAK  518
              A   +R+L +QERLKD E+K+  +      +A  + E+   ER IT+R LNM+D  +AK
Sbjct  734   -ALISIRKLCQQERLKDQERKKKQEAGKGTEEASDSKEETSEERAITLRSLNMEDMRQAK  792

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFAAEGS+MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  793   NQVAASFAAEGSVMNELKQWNDLYGEGGSRKKQQLTYFL  831



>ref|XP_010445330.1| PREDICTED: putative cell division cycle ATPase [Camelina sativa]
Length=855

 Score =  1066 bits (2756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 549/850 (65%), Positives = 671/850 (79%), Gaps = 54/850 (6%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE+L  IVDGR+S VTFDEFPY+LS++TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQIEQELLRQIVDGRESTVTFDEFPYFLSKRTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL++MS F+GSFS+L  +E E +GTLRR  SG D+ S+ +E
Sbjct  145   SKYGCAKREPFHKRSISEFTLDKMSSFMGSFSMLSQREVEPRGTLRRPISGNDLNSRSME  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+     +RN+SA++++++++S +++S      R+++L FDEKL +Q+LYKVLV VS+T
Sbjct  205   SSNRLPRHKRNASAASDISSISSRSSSSVSASSKRSTNLCFDEKLFLQSLYKVLVTVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VL+LGSR+++P DD++E+DE +S++F
Sbjct  265   SPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLLLGSRVLEPEDDFQEVDEGVSALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+ET L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDETQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLASICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAISYHL +TK+PEYRN KLVISSKSLSHG++IF+E    + +D L L
Sbjct  384   MCLSNHIEEIVVSAISYHLTHTKEPEYRNGKLVISSKSLSHGLSIFQEGGNKSFEDSLNL  443

Query  1597  ESKAELSKE---TQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  ++     S  +   GPE K ES  + P +K +                     
Sbjct  444   DTNTDSKRKEGEVSSKSESKSGPENKNESEKSLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  ++A MT+GY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHEIAQMTDGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQ----------ECPNCGDAPTANEDKG----  572
             NLC TAAYRPVRELI+QERLKD E+K+  +          E    G   +  E+ G    
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERKKKEEAGKSTEESKGEEAGKGTEESKEEEAGKSTK  785

Query  571   -------------ERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGS  431
                          ER IT+RPLNM+D  +AKNQVAASFA+EG+ MNELKQWN+LYGEGGS
Sbjct  786   ESKEEQAEASDSEERAITLRPLNMEDMRKAKNQVAASFASEGAGMNELKQWNDLYGEGGS  845

Query  430   RKKEQLTYFL  401
             RKKEQLTYFL
Sbjct  846   RKKEQLTYFL  855



>gb|KFK26889.1| hypothetical protein AALP_AA8G306800 [Arabis alpina]
Length=831

 Score =  1065 bits (2754),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/821 (67%), Positives = 660/821 (80%), Gaps = 20/821 (2%)
 Frame = -1

Query  2845  QTVSKWTGSSS---NAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   SS   + +T   +EQE+L  IVDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGSSSVEDGLTGLQIEQELLRQIVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E E +G LRR +SG D+ S+ +E
Sbjct  145   SKYGCTKREPFHKRSISELTLDKVSSLMGSFSMLSQREVEPRGILRRHTSGNDLKSRNLE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+ P   +RN+SA++++++L+S ++TS      R++ L FDEKL +Q+LYKVLV VS+T
Sbjct  205   SSNRPPRHKRNASAASDISSLSSRSSTSVSASSKRSAYLCFDEKLFLQSLYKVLVTVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q +L +LSG +LILGSR+++P DD +E+DE +S++F
Sbjct  265   NPLIIYLRDVEKLL-ESERFYKLFQTLLNKLSGPILILGSRVLEPEDDCQEVDEGISTLF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ LVSWKS+LE+DMKM+Q+QDNKNHI EVLAAND++CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLVSWKSRLEDDMKMIQFQDNKNHIAEVLAANDLQCDDLSSICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+I+E+VVSAISYHLM+ K+PEYRN KLVISSKSLSHG++IF+E    + KD LKL
Sbjct  384   MCLSNHIDEIVVSAISYHLMHNKEPEYRNGKLVISSKSLSHGLSIFQEGGNRSFKDSLKL  443

Query  1597  ESKAELSKETQSGEKGS-KGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
             ++       T S  KG  +        S+AP +K E             +   +    KA
Sbjct  444   DTN------TDSKRKGEVRSKSESKSESSAPENKNEL------EKSLPANKNDNPLPPKA  491

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLLK
Sbjct  492   PEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLLK  551

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  552   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  611

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDL
Sbjct  612   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDL  671

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  MTEGY+GSDLKNLC
Sbjct  672   DEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELGQMTEGYSGSDLKNLC  730

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNC-GDAPTANEDKGERVITIRPLNMDDFME  524
              TAAYRPVRELI+QERLKD E+K+  +   +         E   ER IT+RPLNM+D  +
Sbjct  731   ITAAYRPVRELIQQERLKDQERKKREEAGKSTEEPKEEKEEASEERDITLRPLNMEDMRK  790

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFA+EGS MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  791   AKNQVAASFASEGSGMNELKQWNDLYGEGGSRKKEQLTYFL  831



>dbj|BAH19655.1| AT5G52882 [Arabidopsis thaliana]
Length=829

 Score =  1065 bits (2753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/824 (66%), Positives = 661/824 (80%), Gaps = 28/824 (3%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE++  IVDGR+S VTF+EFPY+LS++TR LLTS A+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQIEQELIRQIVDGRESTVTFEEFPYFLSKRTRELLTSVAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E E +GTLRR +SG D+ S+  E
Sbjct  145   SKYGCTKREPFHKRSISELTLDKVSSLMGSFSMLSQREVEPRGTLRRHTSGNDLKSRSTE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+     +RN+SA+ ++++++S +++S      RT++L FDEKL +Q+LYKVL  VS+T
Sbjct  205   SSNRLPRHKRNASAAYDISSISSRSSSSVSASRKRTTNLCFDEKLFLQSLYKVLSSVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+DE +S++F
Sbjct  265   TPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVDESISALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ LVSWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLVSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLSSICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E    + +D LKL
Sbjct  384   MCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGNRSFEDSLKL  443

Query  1597  ESKAELSK---ETQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  +   E  S  +   GPE K ES  + P +K +                     
Sbjct  444   DTNTDSKRKGGEVCSKSESKSGPENKNESEISLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  +TEGY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELGQITEGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNC-GDAPTANEDKGERVITIRPLNMDD  533
             NLC TAAYRPVRELI+QERLKD E+K+  +             E   ERVIT+RPLNM+D
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERKKREEAGKGTEESKEEEAEASEERVITLRPLNMED  785

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
               +AK QVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  786   MRKAKTQVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  829



>ref|NP_001042464.1| Os01g0226400 [Oryza sativa Japonica Group]
 dbj|BAD81507.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD81550.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04378.1| Os01g0226400 [Oryza sativa Japonica Group]
 dbj|BAG95489.1| unnamed protein product [Oryza sativa Japonica Group]
Length=840

 Score =  1064 bits (2752),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/811 (68%), Positives = 645/811 (80%), Gaps = 21/811 (3%)
 Frame = -1

Query  2803  TVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSP  2624
             TV+ +EQE+   +VDG DS+VTFD FPYYLSEQTRVLLTSAA+VHLK AD +++TRNL+P
Sbjct  41    TVERVEQELRRLVVDGADSRVTFDGFPYYLSEQTRVLLTSAAYVHLKQADISQYTRNLAP  100

Query  2623  ASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS-SRNESSFKRSI  2447
             ASR ILLSGPAELYQQMLAKALAHYF AKLLLLD TDF +K+ SKYG  S  +SSFKRSI
Sbjct  101   ASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDPTDFLIKIHSKYGGGSSTDSSFKRSI  160

Query  2446  SETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasan  2267
             SETTL ++S  LGS SIL  KE+ KGT+RRQSS  D+  +  E +S+   L+RN+S S++
Sbjct  161   SETTLEKVSGLLGSLSILPQKEKPKGTIRRQSSMTDMKLRSSESTSSFPKLKRNASTSSD  220

Query  2266  mnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
             M++L S    +NP  L R SS +FDEK+L+QA+YKVL  VSK  PIVLY+RD EK L +S
Sbjct  221   MSSLASQGPPNNPASLRRASSWTFDEKILVQAVYKVLHSVSKKNPIVLYIRDVEKFLHKS  280

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
             +K+Y++ +K+L +L G VL+LGSRIVD   D  ELDERL+++FPYNIEIKPPE E HLVS
Sbjct  281   KKMYVMFEKLLNKLEGPVLVLGSRIVDMDFD-EELDERLTALFPYNIEIKPPENENHLVS  339

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             W SQLEEDMKM+Q+QDN+NHI EVLA ND+ECDDLGSIC++DTM L  YIEE+VVSA+SY
Sbjct  340   WNSQLEEDMKMIQFQDNRNHITEVLAENDLECDDLGSICLSDTMVLGRYIEEIVVSAVSY  399

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGS  1547
             HLMN KDPEYRN KL++S+KSLSH + IF+E K    KD +KLE+K + SK    G    
Sbjct  400   HLMNKKDPEYRNGKLLLSAKSLSHALEIFQENKMY-DKDSMKLEAKRDASKVADRG----  454

Query  1546  KGPETKAESSTAPGS---------KPETGsaapapapttkdatsSGTAVKAPEVPPDNEF  1394
               P   A+S T P +                + A     +   +   A KAPE+PPDNEF
Sbjct  455   IAP-FAAKSETKPATLLPPVPPTAAAAPPVESKAEPEKFEKKDNPSPAAKAPEMPPDNEF  513

Query  1393  EKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFG  1214
             EKRIRPEVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFG
Sbjct  514   EKRIRPEVIPANEIGVTFDDIGALSDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFG  573

Query  1213  PPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  1034
             PPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE
Sbjct  574   PPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  633

Query  1033  VDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFE  854
             VDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEAIIRRFE
Sbjct  634   VDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEAIIRRFE  693

Query  853   RRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVR  674
             RRIMVGLP+ E RELIL++LL+KE V   LD K+LATMTEGY+GSDLKNLCTTAAYRPVR
Sbjct  694   RRIMVGLPSLESRELILRSLLSKEKVDGGLDYKELATMTEGYSGSDLKNLCTTAAYRPVR  753

Query  673   ELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFA  494
             ELI++E  +  E ++  ++  N  DA    E   +  I +RPLNM D  EAKNQVAASFA
Sbjct  754   ELIQKE--RKKELEKKREQGGNASDASKMKEK--DETIILRPLNMKDLKEAKNQVAASFA  809

Query  493   AEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AEG+IM ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  810   AEGTIMGELKQWNELYGEGGSRKKQQLTYFL  840



>ref|XP_007152107.1| hypothetical protein PHAVU_004G102900g [Phaseolus vulgaris]
 gb|ESW24101.1| hypothetical protein PHAVU_004G102900g [Phaseolus vulgaris]
Length=816

 Score =  1064 bits (2751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/813 (67%), Positives = 650/813 (80%), Gaps = 26/813 (3%)
 Frame = -1

Query  2833  KWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKS  2660
             KW G +  S+ ++++ + QE+   +V+GRD K TF+EFPYYLSE+ R+LLTSAA++HLK 
Sbjct  28    KWVGGNRDSDEISMEQIVQELRRLVVEGRDGKCTFEEFPYYLSERIRILLTSAAYIHLKH  87

Query  2659  ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS  2480
               F+KHTRNLSP SR ILLSGPAE YQQ LA+ALAHYF +KLLLLD+TDFS+K+Q+K+G 
Sbjct  88    LHFSKHTRNLSPGSRAILLSGPAESYQQALARALAHYFESKLLLLDITDFSVKLQNKFGC  147

Query  2479  SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPT  2300
             SR E+  KRSISE TL  MS   GSFS+L    E +G +R+QSS  +        SSNP 
Sbjct  148   SRKETCLKRSISEATLETMSALFGSFSMLSSAGESRGIVRQQSSATE--------SSNPP  199

Query  2299  TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLY  2120
              L+RN+SA++++++  S    + P    RTSSL FDEKL +QALYK+LV  S+T  I+LY
Sbjct  200   KLKRNASAASDISSTASQCGPTFPARFKRTSSLCFDEKLFVQALYKLLVSFSETSSIILY  259

Query  2119  LRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEI  1940
             +RD EKLL +S ++Y LLQKM+ +LSGSVLILGS+I+D  DD +E+DERL+++FPYNIEI
Sbjct  260   IRDVEKLLLQS-RLYNLLQKMINKLSGSVLILGSQILDSDDDCKEVDERLTALFPYNIEI  318

Query  1939  KPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNY  1760
             K PE+ETH  +WK  LEEDMK +Q+QDN+NHI EVLAANDI+CDDL S+C +DT+ LSNY
Sbjct  319   KAPEDETHSGNWKGSLEEDMKAIQFQDNRNHIAEVLAANDIDCDDLNSVCFSDTILLSNY  378

Query  1759  IEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAEL  1580
             IEE+VVSAISYHLM TKDPEYRN KLVIS+ SLSHG+++F+E K++   ++   ES  E 
Sbjct  379   IEEIVVSAISYHLMKTKDPEYRNGKLVISANSLSHGLSLFQEGKSSG--NLKTNESNKEN  436

Query  1579  SKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDN  1400
             + E  SG K     E K+++  AP +K ET       +           A    EVP DN
Sbjct  437   AGEDISGAKN----EVKSDNQ-APENKNET-----EKSIPVTKKDGENPAPSKAEVP-DN  485

Query  1399  EFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILL  1220
             EFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPCRGILL
Sbjct  486   EFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPCRGILL  545

Query  1219  FGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFV  1040
             FGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFV
Sbjct  546   FGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFV  605

Query  1039  DEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRR  860
             DEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLT P E+ILVLAATNRPFDLDEAIIRR
Sbjct  606   DEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTGPNEQILVLAATNRPFDLDEAIIRR  665

Query  859   FERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRP  680
             FERR++VGLP+ E RE ILKTLLAKE   + LD K LATMTEGYTGSDLKNLC TAAYRP
Sbjct  666   FERRVLVGLPSAENREKILKTLLAKEK-HENLDFKDLATMTEGYTGSDLKNLCITAAYRP  724

Query  679   VRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAAS  500
             VRELI++ER+K++EKK+   E  N  DA + N+DK ++ IT+RPLNM+D  +AK+QVAAS
Sbjct  725   VRELIQRERMKEMEKKKREAEGQNSEDA-SNNKDKEDQEITLRPLNMEDMKQAKSQVAAS  783

Query  499   FAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             FA+EGS+MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  784   FASEGSVMNELKQWNDLYGEGGSRKKQQLTYFL  816



>ref|XP_008673493.1| PREDICTED: uncharacterized protein LOC103649551 [Zea mays]
 tpg|DAA52785.1| TPA: hypothetical protein ZEAMMB73_632926 [Zea mays]
Length=841

 Score =  1064 bits (2751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/811 (68%), Positives = 646/811 (80%), Gaps = 21/811 (3%)
 Frame = -1

Query  2806  VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLS  2627
             VTV+ +EQ++   + DG DSKVTFDEFPYYLSEQTRV+LTSAA+VHLK A+ +K+TRNL+
Sbjct  43    VTVERVEQDLRRLLADGADSKVTFDEFPYYLSEQTRVVLTSAAYVHLKQAEISKYTRNLA  102

Query  2626  PASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSR-NESSFKRS  2450
             PASR ILLSGPAELYQQMLA+ALAHYF AKLLLLD TDF +K+ +KYG+    E +FKRS
Sbjct  103   PASRAILLSGPAELYQQMLARALAHYFQAKLLLLDPTDFLIKIHNKYGTGGGTEKTFKRS  162

Query  2449  ISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasa  2270
             ISETTL R+S   GS SIL  KE+ KGT+RRQSS  D+  +  E +SN   LRRN+S+S+
Sbjct  163   ISETTLERVSGLFGSLSILPQKEQPKGTIRRQSSMTDVKLRSSESTSNLPKLRRNASSSS  222

Query  2269  nmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCR  2090
             +M+++ S   ++N  PL RTSS +FD+K+L+QALYKVL+ VSK+ PIVLY+RD EK L +
Sbjct  223   DMSSMASQGPSTNTAPLRRTSSWTFDDKILVQALYKVLLSVSKSYPIVLYIRDVEKFLHK  282

Query  2089  SEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLV  1910
             S K+Y+L +K+L +L G VL+LGSRIVD   D  ELD RL+ +FPYNIEIKPPE E HLV
Sbjct  283   SPKMYLLFEKLLNKLDGPVLVLGSRIVDMESD-EELDYRLTVLFPYNIEIKPPENENHLV  341

Query  1909  SWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAIS  1730
             SWKSQLEEDMKM+Q+QDN+NHIMEVLA ND+ECDDLGSIC++DTM LS YIEE+VVSA+S
Sbjct  342   SWKSQLEEDMKMIQFQDNRNHIMEVLAENDLECDDLGSICLSDTMCLSKYIEEIVVSAVS  401

Query  1729  YHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG  1550
             YHLMN KDP+YRN KLV+S+KSLSH   IF+  K    KD +KLE    ++  T    + 
Sbjct  402   YHLMNNKDPDYRNGKLVLSTKSLSHASEIFQGNKMT-DKDSMKLE----VTDGTLKASEK  456

Query  1549  SKGPETKAESSTAPGSK--------PETGsaapapapttkdatsSGTAVKAPEVPPDNEF  1394
             +  P T A+S T P S             +         +   +   + K PE   DNEF
Sbjct  457   AIAP-TTAKSETKPASSLPPVRPPAAGAPAPRVESKTELEKKDNPPPSAKVPEGTADNEF  515

Query  1393  EKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFG  1214
             EKRIRPEVIPA EIGV+F DIGALD+IKESLHELVMLPLRRPDLFKGGLLKPCRGILLFG
Sbjct  516   EKRIRPEVIPANEIGVSFDDIGALDDIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFG  575

Query  1213  PPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  1034
             PPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE
Sbjct  576   PPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  635

Query  1033  VDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFE  854
             VDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++  +RILVLAATNRPFDLDEAIIRRFE
Sbjct  636   VDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRSDQRILVLAATNRPFDLDEAIIRRFE  695

Query  853   RRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVR  674
             RRIMVGLP+ E RELI++ LL+KE V + L+ K+LATMTEGY+GSDLKNLCTTAAYRPVR
Sbjct  696   RRIMVGLPSMESRELIMRRLLSKEKVDERLNFKELATMTEGYSGSDLKNLCTTAAYRPVR  755

Query  673   ELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFA  494
             ELI++ER K++EK +  +     G+ P+    K E  IT+RPL+M D  EAKNQVAASFA
Sbjct  756   ELIQKERKKELEKLKREK-----GETPSDLPKKKEETITLRPLSMTDLKEAKNQVAASFA  810

Query  493   AEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +EG  M+EL+QWN LYGEGGSRKKEQLTYFL
Sbjct  811   SEGVCMSELRQWNELYGEGGSRKKEQLTYFL  841



>ref|XP_003611047.1| Spastin [Medicago truncatula]
Length=854

 Score =  1063 bits (2750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 555/830 (67%), Positives = 645/830 (78%), Gaps = 34/830 (4%)
 Frame = -1

Query  2821  SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKH  2642
             SSSNA+T D +E EML  +VDGR+S VTFD FPYYLSEQTRVLLTSAA+VHLK A+ +K+
Sbjct  36    SSSNALTPDKIENEMLRLVVDGRESNVTFDNFPYYLSEQTRVLLTSAAYVHLKHAEVSKY  95

Query  2641  TRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESS  2462
             TRNL+PASRTILLSGPAELYQQ+LAKAL HYF AKLLL DVTDFSLK+QS+YGSS  E+S
Sbjct  96    TRNLAPASRTILLSGPAELYQQVLAKALTHYFEAKLLLFDVTDFSLKIQSRYGSSNCETS  155

Query  2461  FKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrns  2282
             F RS SET L R+S+  GSF++   +EE +G + RQSSG D+     EGS +      ++
Sbjct  156   FTRSTSETALARLSDLFGSFALFPQREENQGKIHRQSSGSDLRQMEAEGSYSKLRRNASA  215

Query  2281  sasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVL------------------  2156
             SA+ +   L S  T S PG     +   FDEK+LIQ LYKVL                  
Sbjct  216   SANISSIGLQSNPTNSAPGK--HITGWPFDEKILIQTLYKVLSLLIVSQISASAHKCVLD  273

Query  2155  ----VKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYR  1988
                 + VSKT PIVLY+RDA+KLLCRS+++Y L Q ML +LSG +LI+GSRI+D G++ +
Sbjct  274   SKVLLYVSKTYPIVLYMRDADKLLCRSQRIYKLFQTMLTKLSGPILIIGSRILDSGNECK  333

Query  1987  ELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECD  1808
              +DE L+S+FPYNIEIKPPE+E+ LVSWKSQ E DMK +Q QDNKNHIMEVLAAND++C 
Sbjct  334   RVDEMLTSLFPYNIEIKPPEDESRLVSWKSQFEADMKKIQIQDNKNHIMEVLAANDLDCH  393

Query  1807  DLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEK  1628
             DL SIC+ADTM LSNYIEE++VSAISYH+M  K+PEYRN KL+I   SLSH + IF+  K
Sbjct  394   DLDSICVADTMVLSNYIEEIIVSAISYHIMKNKEPEYRNGKLIIPCNSLSHALGIFQAGK  453

Query  1627  TAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkda  1448
                 +D LKLE++A  S++ + G   +  PE K ES  AP  K E            +++
Sbjct  454   FG-DRDSLKLEAQAVTSEKKEEG--AAVKPEGKTESP-APAVKTEAEIPTSVRKTDGENS  509

Query  1447  tsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRP  1268
               +  A    EVP DNEFEKRIRPEVIPA EIGVTF+DIGALDE K+SL ELVMLPLRRP
Sbjct  510   VPASKA----EVP-DNEFEKRIRPEVIPANEIGVTFSDIGALDETKDSLQELVMLPLRRP  564

Query  1267  DLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
             DLF+GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVR
Sbjct  565   DLFEGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVR  624

Query  1087  ALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVL  908
             ALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMS+WDGL +K  +RILVL
Sbjct  625   ALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSNWDGLTSKSEDRILVL  684

Query  907   AATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGY  728
             AATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLLAKE V   LD K+LATMTEGY
Sbjct  685   AATNRPFDLDEAIIRRFERRIMVGLPSAENRENILRTLLAKEKVHGGLDFKELATMTEGY  744

Query  727   TGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIR  551
             +GSDLKNLCTTAAYRPVRELI+QE  KD +KK+   E  N  DA  A E+ + ERVIT+R
Sbjct  745   SGSDLKNLCTTAAYRPVRELIQQEIQKDSQKKKKDAEGQNSQDAQDAKEEVEQERVITLR  804

Query  550   PLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             PLNM DF  AK+QVAASFAAEG+ MNEL+QWN+LYGEGGSRKKEQL+YFL
Sbjct  805   PLNMQDFKMAKSQVAASFAAEGAGMNELRQWNDLYGEGGSRKKEQLSYFL  854



>ref|XP_010658531.1| PREDICTED: calmodulin-interacting protein 111 isoform X2 [Vitis 
vinifera]
Length=771

 Score =  1063 bits (2749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 561/749 (75%), Positives = 634/749 (85%), Gaps = 18/749 (2%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QTVS+WTGS   SS+A+T + MEQE+L  +V+GR+SKVTFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QTVSRWTGSGSGSSDALTAEKMEQELLRQVVEGRESKVTFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+F+K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+Q
Sbjct  87    VHLKQAEFSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDVTDFSLKIQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK--------GTLRRQSSGVD  2339
             +KYGS+  ESS KRSIS TTL R+S  LGS S++   EE K        GTLRRQSSG+D
Sbjct  147   NKYGSASKESSMKRSISTTTLERVSSLLGSLSLIPQMEESKALSKSSVGGTLRRQSSGMD  206

Query  2338  IPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKV  2159
             I S+G + S NP  +RRN+SASANMNN+ S      P PL RTSS SFDEKLLIQ+LYKV
Sbjct  207   IASRGRDCSCNPPKIRRNASASANMNNMAS-QFAPYPAPLKRTSSWSFDEKLLIQSLYKV  265

Query  2158  LVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELD  1979
             LV VSKT P+VLY+RD EKLL RS+++Y L QKML +LSGS+LILGS+I+DP DDY ++D
Sbjct  266   LVSVSKTSPLVLYIRDVEKLLSRSQRIYNLFQKMLNKLSGSILILGSQIIDPDDDYGDVD  325

Query  1978  ERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLG  1799
             +RL+++FPYNIEI+PPE+E H VSWK+QLEEDMKM+Q QDNKNHI+EVLAAND++C DL 
Sbjct  326   QRLTALFPYNIEIRPPEDENHFVSWKTQLEEDMKMIQLQDNKNHIIEVLAANDLDCRDLD  385

Query  1798  SICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
             SIC+ DTM LSNYIEE+VVSA+SYHLMN KD EY+N KLVISSKSL+HG+++F+E K+ +
Sbjct  386   SICLEDTMVLSNYIEEIVVSAVSYHLMNNKDHEYKNGKLVISSKSLAHGLSLFQEGKSGS  445

Query  1618  GKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsS  1439
              KD  KLE+ AE SKE    E     P  KAES TAP +K E GS   A           
Sbjct  446   -KDTSKLEAHAEPSKEAGGEEGAGVKPAAKAES-TAPENKNEAGSLIVAVKEGDNPI---  500

Query  1438  GTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF  1259
               A KAPEVPPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLF
Sbjct  501   -PASKAPEVPPDNEFEKRIRPEVIPASEIGVTFADIGAMDEIKESLQELVMLPLRRPDLF  559

Query  1258  KGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALF  1079
             +GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF
Sbjct  560   EGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALF  619

Query  1078  TLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAAT  899
             TLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAAT
Sbjct  620   TLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAAT  679

Query  898   NRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGS  719
             NRPFDLDEAIIRRFERRIMVGLP+ E RE+I+KTLL+KE V + LD K+LATMTEGY+GS
Sbjct  680   NRPFDLDEAIIRRFERRIMVGLPSVENREMIMKTLLSKEKVAEGLDFKELATMTEGYSGS  739

Query  718   DLKNLCTTAAYRPVRELIKQERLKDVEKK  632
             DLKNLCTTAAYRPVRELI+QERLKD+ KK
Sbjct  740   DLKNLCTTAAYRPVRELIQQERLKDLVKK  768



>gb|EEC70216.1| hypothetical protein OsI_00975 [Oryza sativa Indica Group]
Length=841

 Score =  1061 bits (2745),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/811 (68%), Positives = 643/811 (79%), Gaps = 20/811 (2%)
 Frame = -1

Query  2803  TVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSP  2624
             TV+ +EQE+   +VDG DS+VTFD FPYYLSEQTRVLLTSAA+VHLK AD +++TRNL+P
Sbjct  41    TVERVEQELRRLVVDGADSRVTFDGFPYYLSEQTRVLLTSAAYVHLKQADISQYTRNLAP  100

Query  2623  ASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS-SRNESSFKRSI  2447
             ASR ILLSGPAELYQQMLAKALAHYF AKLLLLD TDF +K+ SKYG  S  +SSFKRSI
Sbjct  101   ASRAILLSGPAELYQQMLAKALAHYFEAKLLLLDPTDFLIKIHSKYGGGSSTDSSFKRSI  160

Query  2446  SETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasan  2267
             SETTL ++S  LGS SIL  KE+ KGT+RRQSS  D+  +  E +S+   L+RN+S S++
Sbjct  161   SETTLEKVSGLLGSLSILPQKEKPKGTIRRQSSMTDMKLRSSESTSSFPKLKRNASTSSD  220

Query  2266  mnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
             M++L S    +NP  L R SS +FDEK+L+QA+YKVL  VSK  PIVLY+RD EK L +S
Sbjct  221   MSSLASQGPPNNPASLRRASSWTFDEKILVQAVYKVLHSVSKKNPIVLYIRDVEKFLHKS  280

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
             +K+Y++ +K+L +L G VL+LGSRIVD   D  ELDERL+++FPYNIEIKPPE E HLVS
Sbjct  281   KKMYVMFEKLLNKLEGPVLVLGSRIVDMDFD-EELDERLTALFPYNIEIKPPENENHLVS  339

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             W SQLEEDMKM+Q+QDN+NHI EVLA ND+ECDDLGSIC++DTM L  YIEE+VVSA+SY
Sbjct  340   WNSQLEEDMKMIQFQDNRNHITEVLAENDLECDDLGSICLSDTMVLGRYIEEIVVSAVSY  399

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGS  1547
             HLMN KDPEYRN KL++S+KSLSH + IF+E K    KD +KLE+K + SK    G    
Sbjct  400   HLMNKKDPEYRNGKLLLSAKSLSHALEIFQENKMY-DKDSMKLEAKRDASKVADRG----  454

Query  1546  KGPETKAESSTAPGS---------KPETGsaapapapttkdatsSGTAVKAPEVPPDNEF  1394
               P   A+S T P +                + A     +   +   A KAPE+ PDNEF
Sbjct  455   IAP-FAAKSETKPATLLPPVPPTAAAAPPVESKAEPEKFEKKDNPSPAAKAPEMLPDNEF  513

Query  1393  EKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFG  1214
             EKRIRPEVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFG
Sbjct  514   EKRIRPEVIPANEIGVTFDDIGALSDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFG  573

Query  1213  PPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  1034
             PPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE
Sbjct  574   PPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  633

Query  1033  VDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFE  854
             VDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEAIIRRFE
Sbjct  634   VDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEAIIRRFE  693

Query  853   RRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVR  674
             RRIMVGLP+ E RELIL++LL+KE V   LD K+LATMTEGY+GSDLKNLCTTAAYRPVR
Sbjct  694   RRIMVGLPSLESRELILRSLLSKEKVDGGLDYKELATMTEGYSGSDLKNLCTTAAYRPVR  753

Query  673   ELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFA  494
             ELI Q+  K   +K+  ++  N  DA    E   +  I +RPLNM D  EAKNQVAASFA
Sbjct  754   ELI-QKERKKELEKKKREQGGNASDASKMKEK--DETIILRPLNMKDLKEAKNQVAASFA  810

Query  493   AEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AEG+IM ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  811   AEGTIMGELKQWNELYGEGGSRKKQQLTYFL  841



>ref|NP_001078747.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
 gb|AED96272.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein [Arabidopsis thaliana]
Length=829

 Score =  1061 bits (2743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/824 (66%), Positives = 662/824 (80%), Gaps = 28/824 (3%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE++  IVDGR+S VTF+EFPY+LS++TR LLTS A+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQIEQELIRQIVDGRESTVTFEEFPYFLSKRTRELLTSVAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E E +GTLRR +SG D+ S+  E
Sbjct  145   SKYGCTKREPFHKRSISELTLDKVSSLMGSFSMLSQREVEPRGTLRRHTSGNDLKSRSTE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+     +RN+SA++++++++S +++S      RT++L FDEKL +Q+LYKVL  VS+T
Sbjct  205   SSNRLPRHKRNASAASDISSISSRSSSSVSASRKRTTNLCFDEKLFLQSLYKVLSSVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+DE +S++F
Sbjct  265   TPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVDESISALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ LVSWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLVSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLSSICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E    + +D LKL
Sbjct  384   MCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGNRSFEDSLKL  443

Query  1597  ESKAELSK---ETQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  +   E  S  +   GPE K ES  + P +K +                     
Sbjct  444   DTNTDSKRKGGEVCSKSESKSGPENKNESEISLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  +TEGY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELGQITEGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNC-GDAPTANEDKGERVITIRPLNMDD  533
             NLC TAAYRPVRELI+QERLKD E+K+  +             E   ERVIT+RPLNM+D
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERKKREEAGKGTEESKEEEAEASEERVITLRPLNMED  785

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
               +AK QVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  786   MRKAKTQVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  829



>ref|XP_006413006.1| hypothetical protein EUTSA_v10024407mg [Eutrema salsugineum]
 gb|ESQ54459.1| hypothetical protein EUTSA_v10024407mg [Eutrema salsugineum]
Length=831

 Score =  1060 bits (2742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 547/819 (67%), Positives = 665/819 (81%), Gaps = 16/819 (2%)
 Frame = -1

Query  2845  QTVSKWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q + KW   S +A   +T + +EQE++  IVDGR+S VTFDEFPY+LSE+TR+LLTSAA+
Sbjct  25    QGLGKWANGSVSAEDGLTGEKIEQELVRQIVDGRESGVTFDEFPYFLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E S KRSISE TL++MS  +GSFS+L  KEE++GTLRR +SG D+ S+G EG
Sbjct  145   SKYGCIKKEPSHKRSISEMTLDKMSNLMGSFSMLSQKEERRGTLRRHTSGNDLSSRGFEG  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SS+P  L+RN+SA++++++++S + TS      R+++L FDEKL +Q+LYKVLV VS+T 
Sbjct  205   SSHPPRLKRNASAASDISSISSRSATSVSASSKRSTNLCFDEKLFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKLL +SE+ Y L Q++L +LSG VL+LGSR+++P DD +E+ E +S+VFP
Sbjct  265   PIIIYLRDVEKLL-QSERFYKLFQRLLTKLSGPVLLLGSRLLEPEDDCQEVGEGISAVFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAANDIECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDIECDDLGSICQADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS SLSHG+NIF+E           LE
Sbjct  384   FLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISSNSLSHGLNIFQEGNRY-------LE  436

Query  1594  SKAELSKETQS-GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
                +L + T S GE+G     ++++S TA    PE  +      P+ K+           
Sbjct  437   DSLKLDRNTDSKGEEGEGIIMSESKSETAV---PENKNELERSVPSAKNECPLPPKAPVN  493

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKP
Sbjct  494   EVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKP  553

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  554   CRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  613

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLD
Sbjct  614   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNAGDRILVLAATNRPFDLD  673

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA MT+GY+GSDLKN CT
Sbjct  674   EAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELAQMTDGYSGSDLKNFCT  732

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAK  518
             TAAYRPVRELIKQE LKD E+K+  +   +   + +  E   ERVIT+RPL+M+D   AK
Sbjct  733   TAAYRPVRELIKQECLKDQERKKREEAENSEERSESQEEVSEERVITLRPLSMEDMRVAK  792

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  793   SQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  831



>ref|XP_009132511.1| PREDICTED: uncharacterized protein LOC103857110 [Brassica rapa]
Length=823

 Score =  1060 bits (2741),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 545/828 (66%), Positives = 656/828 (79%), Gaps = 42/828 (5%)
 Frame = -1

Query  2845  QTVSKWT---GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W    GS  + +T + +EQE++  I+DGR+S VTFDEFPY+LSE+TRVLLTS+A+
Sbjct  25    QSLGRWANGPGSVEDDLTGEQIEQELVRQIIDGRESTVTFDEFPYFLSERTRVLLTSSAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK +D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKESDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E + +GTLRR +SG D+ S+ IE
Sbjct  145   SKYGCTKKEPFHKRSISELTLDKVSSLMGSFSMLSQREVDPRGTLRRHTSGNDLKSRSIE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+ P   +R +SA+ ++++  S  +  N     R+++L FDEKL +Q+LYKVLV VS T
Sbjct  205   TSNRPPKHKRYASAAPDISSSISSVSGCNK----RSTNLCFDEKLFLQSLYKVLVSVSAT  260

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+ ER SS+F
Sbjct  261   TPLIVYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVSERTSSLF  319

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEIKPPE+E+ L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDIECDDL SIC ADT
Sbjct  320   PYNIEIKPPEDESQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIECDDLASICHADT  379

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+I+EVVVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E     G   L+L
Sbjct  380   MCLSNHIDEVVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQE----GGSRSLEL  435

Query  1597  ESKAELSKETQSGE--------KGSKGPETKAE-SSTAPGSKPETGsaapapapttkdat  1445
             ++  +  +  + GE          S GPE K E   + P +K +                
Sbjct  436   DTNTDYKR--KGGEVCSKSESKPESSGPENKNELEKSLPSNKNDNP--------------  479

Query  1444  sSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPD  1265
                +  KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPD
Sbjct  480   ---SPPKAPEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPD  536

Query  1264  LFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRA  1085
             LFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRA
Sbjct  537   LFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRA  596

Query  1084  LFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLA  905
             LFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLA
Sbjct  597   LFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLA  656

Query  904   ATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYT  725
             ATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  MTEGY+
Sbjct  657   ATNRPFDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKTDE-LDFHELGQMTEGYS  715

Query  724   GSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPL  545
             GSDLKNLC TAAYRPVRELI+QERLKD E+K+  +      +     E   ER I +RPL
Sbjct  716   GSDLKNLCITAAYRPVRELIQQERLKDQERKKREEAGKGTEETKEEEEASEEREIVLRPL  775

Query  544   NMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NM+D  +AKNQV ASFA+EGS MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  776   NMEDMRKAKNQVGASFASEGSGMNELKQWNDLYGEGGSRKKEQLTYFL  823



>ref|XP_009416406.1| PREDICTED: ribosome biogenesis ATPase RIX7-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416407.1| PREDICTED: ribosome biogenesis ATPase RIX7-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=835

 Score =  1058 bits (2737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 531/822 (65%), Positives = 639/822 (78%), Gaps = 20/822 (2%)
 Frame = -1

Query  2845  QTVSKWT---GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW    GSSS+ VT + +E E+   +VDGR++KVTFDEFPYYLSEQTRV+LTSAA+
Sbjct  27    QAVGKWAAPAGSSSDGVTEEAVEAELRRRVVDGRETKVTFDEFPYYLSEQTRVILTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             V+LK  D  K+TRNL+PASR ILLSGP ELYQQMLAKALAHY+ AKLLLLDVT+FS+K+Q
Sbjct  87    VYLKQTDVLKYTRNLTPASRAILLSGPTELYQQMLAKALAHYYEAKLLLLDVTEFSIKIQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDI----PSK  2327
             +K G    +   KRS+SE TL R+S  LGS S +   EE +G  RRQSS +++    P  
Sbjct  147   NKCGGCNKDMFVKRSMSEATLGRLSGILGSLSTILRMEESEGMFRRQSSSMELRQRRPDY  206

Query  2326  GIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKV  2147
                 +  P T   ++      +   S N   NP    R+S  SFDEK+LI +LYKVL+ +
Sbjct  207   ANSTNELPKTASFSAEMGGLTSQHGSRNMV-NP---KRSSCWSFDEKILIHSLYKVLILI  262

Query  2146  SKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLS  1967
             SK+ PI+LY+RD E  +CRSE+VY L QKML +LSG V+ILGSR+ +P +  +++D RL+
Sbjct  263   SKSNPIILYIRDVEHFICRSERVYSLFQKMLTKLSGHVIILGSRLSEPDNCCKDVDARLT  322

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             ++FPYNIEIKPPE+E HLVSWKSQLE+D K +Q QDN+NHI EVLAAND+ECDDLG+IC+
Sbjct  323   TLFPYNIEIKPPEDENHLVSWKSQLEKDTKTIQIQDNRNHITEVLAANDLECDDLGTICL  382

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
             +D + LS YIEE+VVSA+SYHLMN KDP+YRN KLVI+SKSLSHG++IF++ +   GKD 
Sbjct  383   SDILVLSTYIEEIVVSAVSYHLMNNKDPQYRNGKLVITSKSLSHGLSIFQDSRLC-GKDT  441

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAV  1427
             LKLE+ AE  ++     + +  PE   E+   PG+K ET  +               T +
Sbjct  442   LKLEASAESEEDVNEDARTATKPENNGEA-LLPGNKSETEKSTTLVKDGETL-----TPI  495

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             K PEV PDNEFEKRIRPEVIPA EIGVTF DIGALDE KESL EL++LPL+RPDLFKG L
Sbjct  496   KVPEVAPDNEFEKRIRPEVIPANEIGVTFDDIGALDETKESLQELIILPLQRPDLFKG-L  554

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEK+VRALFTLAA
Sbjct  555   LKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKHVRALFTLAA  614

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KV+PTIIFVDEVD MLGQR+R GEHEAMRKIKNEFM+ WDGLLTKPGERILVLAATNRPF
Sbjct  615   KVAPTIIFVDEVDGMLGQRTRVGEHEAMRKIKNEFMTRWDGLLTKPGERILVLAATNRPF  674

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAIIRRFERRIMVGLP+ E RE IL+ LL+KE V + LD K+LATMTEGY+GSDLKN
Sbjct  675   DLDEAIIRRFERRIMVGLPSLESRESILRKLLSKEKV-EGLDYKELATMTEGYSGSDLKN  733

Query  706   LCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFM  527
             LC TAAYRP+RELI++ER K++ KK+  +E  +        ++  +  I +RPLNMDD  
Sbjct  734   LCITAAYRPLRELIQRERSKELGKKQKTEEGESSSAGSENRDEDDQPAIALRPLNMDDLR  793

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +AKNQVAASFAAEGS+MNELKQWN+LYG+GGSRK++QLTYFL
Sbjct  794   QAKNQVAASFAAEGSVMNELKQWNDLYGDGGSRKRQQLTYFL  835



>ref|XP_010482665.1| PREDICTED: lon protease homolog, mitochondrial-like isoform X1 
[Camelina sativa]
Length=843

 Score =  1058 bits (2736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/838 (65%), Positives = 668/838 (80%), Gaps = 42/838 (5%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE+L  I+DGR+S VTFDEFPY+LS++TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSIEDGLTGEQIEQELLRQIIDGRESSVTFDEFPYFLSKRTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKECDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL++MS F+GSFS+L  +E E +GTLRR  SG D+ S+ +E
Sbjct  145   SKYGCTKREPFHKRSISEFTLDKMSSFMGSFSMLSQREVEPRGTLRRPISGNDLNSRSME  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+     +RN+SA++++++++S +++S      R+++L FDEKL +Q+LYKVLV VS+T
Sbjct  205   SSNRLPRHKRNASAASDISSISSRSSSSVSASSKRSTNLCFDEKLFLQSLYKVLVTVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VL+LGSR+++P DD++E+ E +S++F
Sbjct  265   SPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLLLGSRVLEPEDDFQEVGEGVSALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLASICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E    + +D +KL
Sbjct  384   MCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGNKSFEDSMKL  443

Query  1597  ESKAELSK---ETQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  +   E  S  +   G E K ES  + P +K +                     
Sbjct  444   DTNTDSKRKEGEVSSKSESKSGSENKNESEKSLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  ++A MT+GY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHEIAQMTDGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKR---------------LAQECPNCGDAPTANEDK  575
             NLC TAAYRPVRELI+QERLKD E+K+                 +      +      + 
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERKKKEEAGKSTEESKEEEAGKSTEKSKEEAAGASES  785

Query  574   GERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              ERVIT+RPLNM+D  +AKNQVAASFA+EG+ MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  786   EERVITLRPLNMEDMRKAKNQVAASFASEGAGMNELKQWNDLYGEGGSRKKEQLTYFL  843



>ref|XP_006282839.1| hypothetical protein CARUB_v10006764mg [Capsella rubella]
 gb|EOA15737.1| hypothetical protein CARUB_v10006764mg [Capsella rubella]
Length=830

 Score =  1057 bits (2733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/826 (65%), Positives = 663/826 (80%), Gaps = 31/826 (4%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR+S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGPLSAEDGLTGEKIEQELVRQIVDGRESSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+P S+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPGSKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E+S KRSISE TL++MS  +GS S+L  +EE +GTLRR +SG D+ S+G + 
Sbjct  145   SKYGCVKKETSHKRSISEMTLDKMSNLMGSLSMLSQREETRGTLRRHTSGNDLHSRGFDV  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +S+P  L+RN+SA+++M++++S ++TS      R+++L FDE+L +Q+LYKVLV VS+T 
Sbjct  205   TSHPPRLKRNASAASDMSSISSRSSTSASASSKRSANLCFDERLFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ Y L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKL-CQSERFYKLFQRLLSKLSGPVLVLGSRLLEPEDDCQEVGEGISTLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKTRFEDDMKVIQIQDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS SLSHG++I  +E +   +D LKL+
Sbjct  384   FLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISSNSLSHGLSIL-QEGSRCFEDSLKLD  442

Query  1594  SKAELSKETQSG------EKGSKGPETKAESS-TAPGSKPETGsaapapapttkdatsSG  1436
             +  +L  E   G      +  +  PE K ES  + P +K E                   
Sbjct  443   ANTDLKGEEGEGIIKSESKSETAAPENKNESERSNPSAKNECP-----------------  485

Query  1435  TAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK  1256
                KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFK
Sbjct  486   LPPKAPEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFK  545

Query  1255  GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFT  1076
             GGLLKPCRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFT
Sbjct  546   GGLLKPCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFT  605

Query  1075  LAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATN  896
             LAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATN
Sbjct  606   LAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNSGDRILVLAATN  665

Query  895   RPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSD  716
             RPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA MT+GY+GSD
Sbjct  666   RPFDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELAQMTDGYSGSD  724

Query  715   LKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG-ERVITIRPLNM  539
             LKN CTTAAYRPVRELIKQE LKD E+K+      +  +   A E+   ERVIT+RPL+M
Sbjct  725   LKNFCTTAAYRPVRELIKQECLKDQERKKREDAEKSSEEGSEAKEEVSEERVITLRPLSM  784

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +D   AK+QVAASFAAEG+ MNELKQWN LYGEGGSRKKEQL+YFL
Sbjct  785   EDMKIAKSQVAASFAAEGAGMNELKQWNELYGEGGSRKKEQLSYFL  830



>emb|CDY19639.1| BnaC09g28950D [Brassica napus]
Length=803

 Score =  1056 bits (2730),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/821 (66%), Positives = 651/821 (79%), Gaps = 48/821 (6%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + MEQE++  +VDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQMEQELVRQVVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  + +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKELEISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL++MS  +GSFS L  +E E +G LRR +SG D+ S+ ++
Sbjct  145   SKYGCTKREPLHKRSISELTLDKMSSLMGSFSTLSRREVEPRGALRRDTSGNDLKSRSLD  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              SS P   +RN+SA+++    +S           R+++L FDEKL +Q+LYKV+V VSKT
Sbjct  205   SSSLPPRHKRNASATSSSVTASS----------KRSTNLCFDEKLFLQSLYKVVVSVSKT  254

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q +L ++SG VLILGSR+++P DD +E+ E +S++F
Sbjct  255   NPLIIYLRDVEKLL-ESERFYKLFQILLNKISGPVLILGSRVLEPEDDCQEVSEGVSALF  313

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ LVSWK++LE+DMKM+Q++D KNHI EVLAANDI+CDDL SIC ADT
Sbjct  314   PYNIEIRPPEDESQLVSWKNRLEDDMKMIQFRDKKNHIAEVLAANDIQCDDLASICHADT  373

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IE++VVSAISYHL+ TK+PEYRN KLVISSKSLSHG++IF+E  + + +D LKL
Sbjct  374   MCLSNHIEQIVVSAISYHLIQTKEPEYRNGKLVISSKSLSHGLSIFQEGGSRSSEDSLKL  433

Query  1597  ESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             ++  +           SKG E + E S  P +K +                      KAP
Sbjct  434   DTNTD-----------SKGKEGELEKSL-PSNKNDNPL-----------------PPKAP  464

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLLKP
Sbjct  465   EVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLLKP  524

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  525   CRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  584

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP+DLD
Sbjct  585   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPYDLD  644

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ E RE IL+TLL+KE     LD  +L  MTEGY+GSDLKNLC 
Sbjct  645   EAIIRRFERRIMVGLPSTESREKILRTLLSKEKTDD-LDFHELGQMTEGYSGSDLKNLCI  703

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG--ERVITIRPLNMDDFME  524
             TAAYRPVRELI+QERLKD E+K+  +E     +     ED+   E+ I +RPLNM+D  +
Sbjct  704   TAAYRPVRELIQQERLKDQERKK-REEAGKSAEESKDKEDEACEEKEIILRPLNMEDMRK  762

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFA+EGS MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  763   AKNQVAASFASEGSGMNELKQWNDLYGEGGSRKKEQLTYFL  803



>emb|CDY56163.1| BnaA03g12490D [Brassica napus]
Length=805

 Score =  1055 bits (2728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/820 (66%), Positives = 648/820 (79%), Gaps = 44/820 (5%)
 Frame = -1

Query  2845  QTVSKWT---GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W    GS  + +T + +EQE++  I+DGR+S VTFDEFPY+LSE+TRVLLTS+A+
Sbjct  25    QSLGRWANGPGSVEDDLTGEQIEQELVRQIIDGRESTVTFDEFPYFLSERTRVLLTSSAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK +D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKESDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E + +GTLRR +SG D+ S+ IE
Sbjct  145   SKYGCTKKEPFHKRSISELTLDKVSSLMGSFSMLSQREVDPRGTLRRHTSGNDLKSRSIE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+ P   +R +SA+ ++++  S  +  N     R+++L FDEKL +Q+LYKVLV VS T
Sbjct  205   SSNRPPKHKRYASAAPDISSSISSVSGCNK----RSTNLCFDEKLFLQSLYKVLVSVSAT  260

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+ ER SS+F
Sbjct  261   TPLIVYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVSERTSSLF  319

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEIKPPE+E+ L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDIECDDL SIC ADT
Sbjct  320   PYNIEIKPPEDESQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIECDDLASICHADT  379

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+I+EVVVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E +  +       
Sbjct  380   MCLSNHIDEVVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGEVCS-------  432

Query  1597  ESKAELSKETQSGEKGSKGPETKAE-SSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
                          +  S GPE K E   + P +K +                   +  KA
Sbjct  433   ---------KSESKPESSGPENKNELEKSLPSNKNDNP-----------------SPPKA  466

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLLK
Sbjct  467   PEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLLK  526

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  527   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  586

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDL
Sbjct  587   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDL  646

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  MTEGY+GSDLKNLC
Sbjct  647   DEAIIRRFERRIMVGLPSIESREKILRTLLSKEKTDE-LDFHELGQMTEGYSGSDLKNLC  705

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
              TAAYRPVRELI+QERLKD E+K+  +      +     E   ER I +RPLNM+D  +A
Sbjct  706   ITAAYRPVRELIQQERLKDQERKKREEAGKGTEETKEEEEASEEREIVLRPLNMEDMRKA  765

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQV ASFA+EGS MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  766   KNQVGASFASEGSGMNELKQWNDLYGEGGSRKKEQLTYFL  805



>ref|XP_006401767.1| hypothetical protein EUTSA_v10012687mg [Eutrema salsugineum]
 gb|ESQ43220.1| hypothetical protein EUTSA_v10012687mg [Eutrema salsugineum]
Length=833

 Score =  1055 bits (2727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/821 (66%), Positives = 657/821 (80%), Gaps = 18/821 (2%)
 Frame = -1

Query  2845  QTVSKWT---GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W    GS  + +T + +EQE++  IVDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGLGSVEDGLTGEQIEQELVRQIVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL++MS  +GSFS+L  +E E +GTLRR +SG D+ S+  +
Sbjct  145   SKYGCTKKEPFQKRSISELTLDKMSSLMGSFSMLSQREVEPRGTLRRHTSGNDLKSRSFD  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+ P   +RN+SA++++++++S +++S      R+++L FDEKL +Q+LYKVLV VS+T
Sbjct  205   SSNRPPRHKRNASAASDISSISSRSSSSVSASSKRSTNLCFDEKLFLQSLYKVLVSVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD  KLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+ E +S++F
Sbjct  265   NPLIIYLRDVGKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVGEDISALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ L+SWK++LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLMSWKNRLEDDMKMIQFQDNKNHITEVLAANDIQCDDLASICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAISYHL++TK+PEYRN KLVISSKSLSHG++IF+E  +   +D LKL
Sbjct  384   MCLSNHIEEIVVSAISYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGSRTFEDSLKL  443

Query  1597  ESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             ++  +  +         KG E     S +        +          +   +    KAP
Sbjct  444   DTNTDYKR---------KGGEV-CSKSESKSESSSLENKNDLEKSLPSNKNDNALPPKAP  493

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLLKP
Sbjct  494   EVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLLKP  553

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  554   CRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  613

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDLD
Sbjct  614   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDLD  673

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMV LP+ E RE IL+TLL+KE   + LD  +L  MTEGY+GSDLKNLC 
Sbjct  674   EAIIRRFERRIMVALPSIESREKILRTLLSKEKT-ENLDFHELGQMTEGYSGSDLKNLCI  732

Query  697   TAAYRPVRELIKQERLKDVEKKRL--AQECPNCGDAPTANEDKGERVITIRPLNMDDFME  524
             TAAYRPVRELI+QERLKD E K+   A +           E   ERVIT+RPLNM+D  +
Sbjct  733   TAAYRPVRELIQQERLKDQESKKREEAGKSTEEAKEEEKEEASEERVITLRPLNMEDMRQ  792

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFA+EGS MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  793   AKNQVAASFASEGSGMNELKQWNDLYGEGGSRKKEQLTYFL  833



>ref|XP_010448049.1| PREDICTED: uncharacterized protein LOC104730561 isoform X2 [Camelina 
sativa]
Length=828

 Score =  1054 bits (2725),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/820 (65%), Positives = 660/820 (80%), Gaps = 21/820 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRQSSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+P S+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPGSKAILLSGPAESYQQMLAKALAHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E+S KRSISE TL++MS  +GS S+L  +EE +GTLRR +SG D+ S+G + 
Sbjct  145   SKYGCVKKETSHKRSISEMTLDKMSSLMGSLSMLSQREETRGTLRRITSGNDLHSRGFDV  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +++P  L+RN+SA+++M++++S + TS      R ++L FDE+L +Q+LYKVLV VS+T 
Sbjct  205   TTHPPRLKRNASAASDMSSISSRSATSGSASSKRNANLCFDERLFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ + L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKL-CQSERFFKLFQRLLTKLSGPVLVLGSRLLEPEDDCQEVGESISTLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q+QDN+NHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKTRFEDDMKVIQFQDNRNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS SLSHG+ I  +E     ++ LKL+
Sbjct  384   FLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISSNSLSHGLGIL-QEGNRRFENSLKLD  442

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +  +   + +  E G    E+K+E++ AP +K E                      KAPE
Sbjct  443   ANTDTKVQGEESE-GIIKSESKSETA-APENKTEP-----------TPKNECPLPPKAPE  489

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             V PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  490   VAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPC  549

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  550   RGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  609

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLDE
Sbjct  610   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNSGDRILVLAATNRPFDLDE  669

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MT+GY+GSDLKN CTT
Sbjct  670   AIIRRFERRIMVGLPSTESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSDLKNFCTT  728

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGD--APTANEDKGERVITIRPLNMDDFMEA  521
             AAYRPVRELIKQE LKD E+K+  +E     +  +    E   ER+I +RPL+M+D   A
Sbjct  729   AAYRPVRELIKQECLKDQERKKRGEEAEKSNEEVSEAKEEVSEERIIKLRPLSMEDMKVA  788

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             K+QVAASFAAEG+ MNELKQWN LYGEGGSRKKEQL+YFL
Sbjct  789   KSQVAASFAAEGAGMNELKQWNELYGEGGSRKKEQLSYFL  828



>ref|XP_009796700.1| PREDICTED: transitional endoplasmic reticulum ATPase homolog 
2-like isoform X1 [Nicotiana sylvestris]
Length=685

 Score =  1053 bits (2724),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 565/693 (82%), Positives = 614/693 (89%), Gaps = 9/693 (1%)
 Frame = -1

Query  2923  MDQKNlflsalgvgvgvgvgfglasGQTVSKWTG-SSSNAVTVDIMEQEMLNTIVDGRDS  2747
             M+QKN+ LSALGVG+GVGVG GLASGQTVS+WTG S++N +T  IMEQEMLN I +G+DS
Sbjct  1     MEQKNMLLSALGVGIGVGVGIGLASGQTVSRWTGGSAANVITPLIMEQEMLNLIANGKDS  60

Query  2746  KVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLA  2567
             KVTFDEFPYYLSEQTRVLLTSA+FVHL +ADFAKHTRNLSPASRTILLSGPAELYQQMLA
Sbjct  61    KVTFDEFPYYLSEQTRVLLTSASFVHLTNADFAKHTRNLSPASRTILLSGPAELYQQMLA  120

Query  2566  KALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQP  2387
             KALAHYF AKLLLLDVTDFSLK+QSKYG +  E SFKRSISETTL RMS   GSFS+LQP
Sbjct  121   KALAHYFNAKLLLLDVTDFSLKMQSKYGGACKEYSFKRSISETTLGRMSGMFGSFSMLQP  180

Query  2386  KEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTS  2207
             KEE KGTLRRQSSGVDI SK  +G    T LRRN+SASAN++NLTSY T+ NP PL R S
Sbjct  181   KEENKGTLRRQSSGVDIGSK--DGLLKATNLRRNASASANLDNLTSYGTSGNPAPLTRNS  238

Query  2206  SLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLI  2027
             S SFDEKLLIQ LYKVLVKVSKT PIVLYLRD EK+LCRSEK+Y+L QKML++LSG+VLI
Sbjct  239   SWSFDEKLLIQTLYKVLVKVSKTSPIVLYLRDVEKVLCRSEKIYVLFQKMLKKLSGAVLI  298

Query  2026  LGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNH  1847
             LGSRIVDPG+DYRE+DERLSS+FPYN+EIKPPE+ETHLVSWKSQLEEDMKM+Q+QDN+NH
Sbjct  299   LGSRIVDPGNDYREIDERLSSIFPYNLEIKPPEDETHLVSWKSQLEEDMKMIQFQDNRNH  358

Query  1846  IMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSK  1667
             IMEVL+ANDIEC+DLGSICM+DTM LSNYIEE+VVSAISYHLMNTKDPEYRN KLVISS 
Sbjct  359   IMEVLSANDIECEDLGSICMSDTMVLSNYIEEIVVSAISYHLMNTKDPEYRNGKLVISSS  418

Query  1666  SLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETG  1487
             SLS G+ +F+E K++ GKD LKLE++AE SK+ Q  E     PE KAE     G  PE+ 
Sbjct  419   SLSRGLGVFQEGKSS-GKDTLKLEAQAETSKDAQGRETSITKPEAKAE-----GILPESK  472

Query  1486  saapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKE  1307
               A APA   KD   S +  KAPEVPPDNEFEKRIRPEVIPA EIGVTFADIGALDE+KE
Sbjct  473   GEAEAPALPVKDGNISTSTPKAPEVPPDNEFEKRIRPEVIPASEIGVTFADIGALDELKE  532

Query  1306  SLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTI  1127
             SL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTI
Sbjct  533   SLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIASEAGASFINVSMSTI  592

Query  1126  TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWD  947
             TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWD
Sbjct  593   TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWD  652

Query  946   GLLTKPGERILVLAATNRPFDLDEAIIRRFERR  848
             GLLTK GERILVLAATNRPFDLDEAIIRRFERR
Sbjct  653   GLLTKAGERILVLAATNRPFDLDEAIIRRFERR  685



>ref|XP_010433277.1| PREDICTED: uncharacterized protein LOC104717423 isoform X1 [Camelina 
sativa]
 ref|XP_010433278.1| PREDICTED: uncharacterized protein LOC104717423 isoform X2 [Camelina 
sativa]
Length=828

 Score =  1053 bits (2723),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/820 (65%), Positives = 664/820 (81%), Gaps = 21/820 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRQSSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+P S+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPGSKAILLSGPAESYQQMLAKALAHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E+S KRSISE TL++M   +GS S+L  +EE +GTLRR +SG D+ S+G + 
Sbjct  145   SKYGCVKKETSHKRSISEMTLDKMYNLVGSLSMLSQREETRGTLRRITSGNDLHSRGFDV  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +S+P  L+RN+SA+++M++++S + TS  G   R+++L FDE++ +Q+LYKVLV VS+T 
Sbjct  205   TSHPPRLKRNASAASDMSSISSRSATSASGSSKRSTNLCFDERVFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ + L Q++L +LSG VL+LGSR+++P +D +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKL-CQSERFFKLFQRLLTKLSGPVLVLGSRLLEPEEDCQEVGESISTLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKARFEDDMKVIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS SLSHG+ I  +E     +D LKL+
Sbjct  384   FLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISSNSLSHGLGIL-QEGNRCFEDSLKLD  442

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +  +   + +  E G    E+K+E++ AP +K E+                     KAPE
Sbjct  443   ANTDTKVQGEESE-GIIKSESKSETA-APENKNES-----------TPKNECPLPPKAPE  489

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             V PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  490   VAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPC  549

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  550   RGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  609

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLDE
Sbjct  610   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNSGDRILVLAATNRPFDLDE  669

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MT+GY+GSDLKN CTT
Sbjct  670   AIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSDLKNFCTT  728

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCG-DAPTANEDKG-ERVITIRPLNMDDFMEA  521
             AAYRPVRELIKQE LKD E+K+  +E      +   ANE+   ER+I +RPL+M+D   A
Sbjct  729   AAYRPVRELIKQECLKDQERKKRGEEAEKSNEEVSEANEEVSEERIIKLRPLSMEDMKVA  788

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             K+QVAASFAAEG+ MNELKQWN LYGEGGSRKKEQL+YFL
Sbjct  789   KSQVAASFAAEGAGMNELKQWNELYGEGGSRKKEQLSYFL  828



>ref|XP_010438518.1| PREDICTED: uncharacterized protein LOC104722110 [Camelina sativa]
Length=826

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/820 (65%), Positives = 660/820 (80%), Gaps = 23/820 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRQSSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+P S+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPGSKAILLSGPAESYQQMLAKALAHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E+S KRSISE TL++M   +GS S+L  +EE +GTLRR +SG D+ S+G + 
Sbjct  145   SKYGCVKKETSHKRSISEMTLDKMYNLMGSLSMLSQREETRGTLRRITSGNDLHSRGFDV  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +S+P  L+RN+SA+++M++++S + TS      R+++L FDE+L +Q+LYKVLV VS+T 
Sbjct  205   TSHPPRLKRNASAASDMSSISSRSATSASASGKRSANLCFDERLFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ + L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKL-CQSERFFKLFQRLLTKLSGPVLVLGSRLLEPEDDCQEVGESISTLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q+QDN+NHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKTRFEDDMKVIQFQDNRNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS SLSHG+ I  +E     ++ LKL+
Sbjct  384   FLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISSNSLSHGLGIL-QEGNRCFEESLKLD  442

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +  +   E   G   S   E+K+E++ AP +K E+                     KAPE
Sbjct  443   ANTDTKGEESEGIVKS---ESKSETA-APENKNES-----------TPKNECPMPPKAPE  487

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             V PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  488   VAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPC  547

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  548   RGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  607

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLDE
Sbjct  608   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSDSGDRILVLAATNRPFDLDE  667

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MT+GY+GSDLKN CTT
Sbjct  668   AIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSDLKNFCTT  726

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGD--APTANEDKGERVITIRPLNMDDFMEA  521
             AAYRPVRELIKQE LKD E+K+  +E     +  +    E   ER+I +RPL+M+D   A
Sbjct  727   AAYRPVRELIKQECLKDQERKKRGEEAEKSNEEVSEAKEEVSEERIIKLRPLSMEDMKVA  786

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             K+QVAASFAAEG+ MNELKQWN LYGEGGSRKKEQL+YFL
Sbjct  787   KSQVAASFAAEGAGMNELKQWNELYGEGGSRKKEQLSYFL  826



>ref|XP_009796701.1| PREDICTED: transitional endoplasmic reticulum ATPase homolog 
2-like isoform X2 [Nicotiana sylvestris]
Length=680

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 544/667 (82%), Positives = 590/667 (88%), Gaps = 9/667 (1%)
 Frame = -1

Query  2845  QTVSKWTG-SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVH  2669
             QTVS+WTG S++N +T  IMEQEMLN I +G+DSKVTFDEFPYYLSEQTRVLLTSA+FVH
Sbjct  22    QTVSRWTGGSAANVITPLIMEQEMLNLIANGKDSKVTFDEFPYYLSEQTRVLLTSASFVH  81

Query  2668  LKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSK  2489
             L +ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYF AKLLLLDVTDFSLK+QSK
Sbjct  82    LTNADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFNAKLLLLDVTDFSLKMQSK  141

Query  2488  YGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSS  2309
             YG +  E SFKRSISETTL RMS   GSFS+LQPKEE KGTLRRQSSGVDI SK  +G  
Sbjct  142   YGGACKEYSFKRSISETTLGRMSGMFGSFSMLQPKEENKGTLRRQSSGVDIGSK--DGLL  199

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
               T LRRN+SASAN++NLTSY T+ NP PL R SS SFDEKLLIQ LYKVLVKVSKT PI
Sbjct  200   KATNLRRNASASANLDNLTSYGTSGNPAPLTRNSSWSFDEKLLIQTLYKVLVKVSKTSPI  259

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             VLYLRD EK+LCRSEK+Y+L QKML++LSG+VLILGSRIVDPG+DYRE+DERLSS+FPYN
Sbjct  260   VLYLRDVEKVLCRSEKIYVLFQKMLKKLSGAVLILGSRIVDPGNDYREIDERLSSIFPYN  319

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             +EIKPPE+ETHLVSWKSQLEEDMKM+Q+QDN+NHIMEVL+ANDIEC+DLGSICM+DTM L
Sbjct  320   LEIKPPEDETHLVSWKSQLEEDMKMIQFQDNRNHIMEVLSANDIECEDLGSICMSDTMVL  379

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
             SNYIEE+VVSAISYHLMNTKDPEYRN KLVISS SLS G+ +F+E K++ GKD LKLE++
Sbjct  380   SNYIEEIVVSAISYHLMNTKDPEYRNGKLVISSSSLSRGLGVFQEGKSS-GKDTLKLEAQ  438

Query  1588  AELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             AE SK+ Q  E     PE KAE     G  PE+   A APA   KD   S +  KAPEVP
Sbjct  439   AETSKDAQGRETSITKPEAKAE-----GILPESKGEAEAPALPVKDGNISTSTPKAPEVP  493

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EIGVTFADIGALDE+KESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  494   PDNEFEKRIRPEVIPASEIGVTFADIGALDELKESLQELVMLPLRRPDLFKGGLLKPCRG  553

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  554   ILLFGPPGTGKTMLAKAIASEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  613

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLTK GERILVLAATNRPFDLDEAI
Sbjct  614   IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTKAGERILVLAATNRPFDLDEAI  673

Query  868   IRRFERR  848
             IRRFERR
Sbjct  674   IRRFERR  680



>ref|XP_004515406.1| PREDICTED: putative cell division cycle ATPase-like [Cicer arietinum]
Length=828

 Score =  1051 bits (2719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/823 (66%), Positives = 659/823 (80%), Gaps = 29/823 (4%)
 Frame = -1

Query  2845  QTVSKWTGSSSN--AVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G SS+   V  D + +E+   +VDG++SKVTFD+FPYYLSE+TRVLLTSAA+V
Sbjct  27    QAVQKWVGGSSDFDEVYGDQIVEELKKLLVDGKNSKVTFDDFPYYLSERTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  +++KHTRNLSPASR ILLSGPAELYQQMLAKALAHYF +KLLLLDVTDFS+K+QS
Sbjct  87    HLKHLNYSKHTRNLSPASRAILLSGPAELYQQMLAKALAHYFESKLLLLDVTDFSVKLQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             ++G  R E SF+RSISE T  RMS   GSFS+L    E +GT R  SS         + S
Sbjct  147   RFGCPRKEPSFRRSISEMTFERMSGLFGSFSMLPSTGETRGTTRGSSS--------FDSS  198

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +NP  LRRN+SA++++++ +S + ++N  PL RTSSL FDEKL +Q+LYKVLV +S T  
Sbjct  199   NNPPQLRRNASAASDLSSASSQSVSTNSAPLRRTSSLCFDEKLFVQSLYKVLVSISGTDS  258

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD EKL+ +S ++Y LLQKM++RLSGSVLILGS+I++  +  +E+ ER++ +FPY
Sbjct  259   IILYIRDVEKLVRKSPRLYNLLQKMIKRLSGSVLILGSQILELDEGCKEI-ERITMLFPY  317

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NI IKPPE+E HL SWK QLEEDMK++++QD +NHI EVL+ NDI+CDDL SIC ADTM 
Sbjct  318   NIVIKPPEDEIHLCSWKGQLEEDMKVIKFQDTRNHIAEVLSENDIDCDDLNSICYADTMI  377

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSN IEE+VVSAISYHLMNTK+PEYRN KLVIS+ SLSHG+++F+E K++   ++   +S
Sbjct  378   LSNCIEEIVVSAISYHLMNTKEPEYRNGKLVISANSLSHGLSLFQEGKSSG--NLNTNDS  435

Query  1591  KAELSKETQSGEKG-----SKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
               E   +  +G K      ++ PE K+E+  + P +K E  +   A            T 
Sbjct  436   NKENGGDDTAGAKNDVRSDNQAPENKSEAEISIPVTKKEGETPMLAKVDE--------TP  487

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
             + A E  PDNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGG
Sbjct  488   MPAIEEFPDNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGG  547

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAG SFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  548   LLKPCRGILLFGPPGTGKTMLAKAIANEAGTSFINVSMSTITSKWFGEDEKNVRALFTLA  607

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKV+PTIIFVDEVDSMLGQR++ GEHEAMRKIKNEFM+HWDGLL+ P E+ILVLAATNRP
Sbjct  608   AKVAPTIIFVDEVDSMLGQRTQFGEHEAMRKIKNEFMTHWDGLLSGPNEQILVLAATNRP  667

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ + RE+ILKTLLAKE   + LD K+LATMTEG++GSDLK
Sbjct  668   FDLDEAIIRRFERRIMVGLPSGDNREMILKTLLAKEK-HENLDFKELATMTEGFSGSDLK  726

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLC TAAYRPVRELI+QER+K++EKK+   E  +  DA + N+D  ER IT+RPL+M+D 
Sbjct  727   NLCITAAYRPVRELIQQERMKEMEKKKREAEGVSSEDA-SNNKDNEEREITLRPLSMEDI  785

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AKNQVAASFA+EGS+M ELKQWN+LYGEGG RKK+QLTYFL
Sbjct  786   KQAKNQVAASFASEGSVMAELKQWNDLYGEGGWRKKQQLTYFL  828



>emb|CDY51824.1| BnaC03g15360D [Brassica napus]
Length=806

 Score =  1050 bits (2714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/822 (66%), Positives = 649/822 (79%), Gaps = 47/822 (6%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE++  I+DGR+S VTFDEFPY+LSE+TRVLLTS+A+
Sbjct  25    QSLGRWANGSGSVEDDLTGEQIEQELVRQIIDGRESTVTFDEFPYFLSERTRVLLTSSAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK +D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKESDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E + +GTLRR +SG D+ S+ IE
Sbjct  145   SKYGCTKKEPFHKRSISELTLDKVSSLMGSFSMLSQREVDPRGTLRRHTSGNDLKSRSIE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+ P   +RN+SA+ +++     + +S  G   R+++L FDEKL +Q+LYKVLV VS T
Sbjct  205   TSNRPPKHKRNASAAPDIS-----SISSVSGCNKRSTNLCFDEKLFLQSLYKVLVSVSAT  259

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD E LL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+ ER SS+F
Sbjct  260   TPLIVYLRDVEMLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVSERTSSLF  318

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PY+IEIKPPE+E+ L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDIECDDL SIC ADT
Sbjct  319   PYSIEIKPPEDESQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIECDDLASICHADT  378

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+I+EVVVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E +  +       
Sbjct  379   MCLSNHIDEVVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGEVCS-------  431

Query  1597  ESKAELSKETQSGEKGSKGPETKAE-SSTAPGSKPETGsaapapapttkdatsSGTAVKA  1421
                          +  S GPE K E   + P +K +                   +  KA
Sbjct  432   ---------KSESKPESSGPENKNELEKSLPSNKNDNP-----------------SPPKA  465

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
             PEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLLK
Sbjct  466   PEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLLK  525

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  526   PCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  585

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDL
Sbjct  586   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDL  645

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  MTEGY+GSDLKNLC
Sbjct  646   DEAIIRRFERRIMVGLPSIESREKILRTLLSKEKTDE-LDFHELGQMTEGYSGSDLKNLC  704

Query  700   TTAAYRPVRELIKQERLKDVEKKRL--AQECPNCGDAPTANEDKGERVITIRPLNMDDFM  527
              TAAYRPVRELI+QERLKD E+K+   A +           E   ER I +RPLNM+D  
Sbjct  705   ITAAYRPVRELIQQERLKDQERKKREEAGKGTEETKEEEEEEASEEREIVLRPLNMEDMR  764

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +AKNQV ASFA+EGS MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  765   KAKNQVGASFASEGSGMNELKQWNDLYGEGGSRKKEQLTYFL  806



>ref|XP_009137753.1| PREDICTED: uncharacterized protein LOC103861800 [Brassica rapa]
Length=821

 Score =  1049 bits (2713),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 536/816 (66%), Positives = 657/816 (81%), Gaps = 28/816 (3%)
 Frame = -1

Query  2833  KWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             KW   S +A   +T + +EQE++  IVDGR+S VTFDEFPY+LSE+TR+LLT+AA+VHLK
Sbjct  29    KWANGSVSAEDGLTGEKIEQELVRQIVDGRESGVTFDEFPYFLSEKTRLLLTNAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLDVTDFS+K+QSKYG
Sbjct  89    QFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDVTDFSIKIQSKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNP  2303
               + E S KRSISE TL++MS  +GSFS+L  +E+ +GTLRR +SG D+ S+G EGSS+P
Sbjct  149   CVKKEPSHKRSISELTLDKMSNLVGSFSMLTQREQPRGTLRRLTSGNDLTSRGFEGSSHP  208

Query  2302  TTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVL  2123
               L+RN+SA++++++++S + TS      R+++L FDE+L +Q+LYKVLV VS+  PI++
Sbjct  209   PQLKRNASAASDISSISSRSGTSVSASSKRSTNLCFDERLFLQSLYKVLVSVSEANPIII  268

Query  2122  YLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIE  1943
             YLRD EKLL +SE+ Y L QK+L +LSG VL+LGSR+++P DD +++ E +S++FPYNIE
Sbjct  269   YLRDVEKLL-QSERFYKLFQKLLSKLSGPVLLLGSRLLEPEDDCQQVGEGISALFPYNIE  327

Query  1942  IKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSN  1763
             I+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGS+C ADTM LS+
Sbjct  328   IRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDLECDDLGSVCHADTMFLSS  387

Query  1762  YIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAE  1583
             +IEE+VV+AISYHLMN K+PEY+N +LVISS SLSHG++IF+E  +   ++ LK++  ++
Sbjct  388   HIEEIVVTAISYHLMNNKEPEYKNGRLVISSNSLSHGLSIFQEGHSCH-ENSLKMDRNSD  446

Query  1582  LSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPD  1403
                    GE+      ++ +S T P  K E                     V   EVPPD
Sbjct  447   -----SKGEESEGMINSELKSETTPSEKNECPLP---------------PKVPVNEVPPD  486

Query  1402  NEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGIL  1223
             NEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKPCRGIL
Sbjct  487   NEFEKRIRPEVIPADEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPCRGIL  546

Query  1222  LFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIF  1043
             LFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIF
Sbjct  547   LFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIF  606

Query  1042  VDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIR  863
             VDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLDEAIIR
Sbjct  607   VDEVDSMLGQRTRAGEHEAMRKIKNEFMTHWDGLMSSSGDRILVLAATNRPFDLDEAIIR  666

Query  862   RFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYR  683
             RFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA MT+GY+GSDLKN CTTAAYR
Sbjct  667   RFERRIMVGLPSMESREKILRTLLSKEKT-ENLDFHELAQMTDGYSGSDLKNFCTTAAYR  725

Query  682   PVRELIKQERLKDVE-KKRLAQECPNCGDAPTANEDKG-ERVITIRPLNMDDFMEAKNQV  509
             PVRELIK E LKD E KKR   E  +  +   A E+   ERVIT+R L+M+D   AK+QV
Sbjct  726   PVRELIKHECLKDQERKKREEAEKSSSEEGTEAKEEASEERVITLRGLSMEDMRVAKSQV  785

Query  508   AASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AASFAAEG+ MNELKQWN LYGEGGSRK+EQL+YFL
Sbjct  786   AASFAAEGAGMNELKQWNELYGEGGSRKQEQLSYFL  821



>emb|CDJ26560.1| unnamed protein product [Triticum aestivum]
Length=840

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/804 (68%), Positives = 639/804 (79%), Gaps = 6/804 (1%)
 Frame = -1

Query  2806  VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLS  2627
             VT++ +E E+   +VDGRDSKVTFDEFPYYLSEQTRV+LTSAA+VHLK A+ +K+TRNL+
Sbjct  41    VTLERVEHELRRLVVDGRDSKVTFDEFPYYLSEQTRVVLTSAAYVHLKQAEISKYTRNLA  100

Query  2626  PASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSI  2447
             PASR ILLSGPAELYQQMLAKALAHYF AK+LLLD TDF +K+  KYG+  +E S  RSI
Sbjct  101   PASRAILLSGPAELYQQMLAKALAHYFEAKILLLDPTDFLIKLHGKYGTGGSEQSVTRSI  160

Query  2446  SETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasan  2267
             SETTL RMS  L SF++   KE+ +G +RRQSS  D+  +  E +++   LRRN+S S++
Sbjct  161   SETTLERMSGLLQSFTMTPQKEQSRGGIRRQSSMTDMKLRSSESTNSMPKLRRNASTSSD  220

Query  2266  mnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
             M++L S    SN  PL R SS +FDEK+L+QALYK+L KVSK  PIVLY+RD EK L +S
Sbjct  221   MSSLASQGAPSNSAPLRRASSWNFDEKMLVQALYKILHKVSKKSPIVLYIRDVEKFLHKS  280

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
              K+Y+L +K+L +L G VL+LGSRIVD   D  ELD+RLS++FPYNI+IKPPE E  LVS
Sbjct  281   PKMYLLFEKLLTKLEGPVLLLGSRIVDMDFDDDELDDRLSALFPYNIDIKPPENENCLVS  340

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             W SQLEEDMK++Q+QDN+NHI EVLA ND+EC DLGSIC++DTM LS YIEE+VVSA+SY
Sbjct  341   WNSQLEEDMKIIQFQDNRNHITEVLAENDLECLDLGSICLSDTMGLSKYIEEIVVSAVSY  400

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSK--ETQSGEK  1553
             HLMN KDPEYRN KL++S+KSL+H + IF+E K +  KD +KLE   +  K  E +    
Sbjct  401   HLMNHKDPEYRNGKLILSAKSLAHALEIFQENKMS-DKDTMKLERHTDARKISEKRIAPT  459

Query  1552  GSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPE  1373
              +K     A           T +  P      K   +     K PEVPPDNEFEKRIRPE
Sbjct  460   AAKLETKPATLLPPAAPAAATPAPPPESKTEPKKPENPPPPAKLPEVPPDNEFEKRIRPE  519

Query  1372  VIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKT  1193
             VIPA EIGV+F DIGAL++IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKT
Sbjct  520   VIPANEIGVSFDDIGALEDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKT  579

Query  1192  MLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQ  1013
             MLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQ
Sbjct  580   MLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQ  639

Query  1012  RSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGL  833
             R+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEAIIRRFERRIMVGL
Sbjct  640   RNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEAIIRRFERRIMVGL  699

Query  832   PTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQER  653
             P+ + RE+I+K LL+KE V + LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI++ER
Sbjct  700   PSVQNREMIMKRLLSKEKVDESLDYKELATMTEGYSGSDLKNLCTTAAYRPVRELIQKER  759

Query  652   LKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMN  473
              K++EK +L +       +    +DK    I +RPLNM D  EAKNQVAASFAAEGSIM 
Sbjct  760   KKELEKMKLEKGGTPLDPSKMKEKDKE---IILRPLNMADLKEAKNQVAASFAAEGSIMG  816

Query  472   ELKQWNNLYGEGGSRKKEQLTYFL  401
             ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  817   ELKQWNDLYGEGGSRKKEQLTYFL  840



>ref|XP_003565841.1| PREDICTED: uncharacterized protein LOC100831422 [Brachypodium 
distachyon]
Length=839

 Score =  1049 bits (2712),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 543/803 (68%), Positives = 644/803 (80%), Gaps = 4/803 (0%)
 Frame = -1

Query  2809  AVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNL  2630
              VT++ +EQE+   +VDG+DSKV FDEFPYYLSEQTRV+LTSAA+VHLK A+ +K+TRNL
Sbjct  41    GVTLERVEQELRRLVVDGKDSKVNFDEFPYYLSEQTRVVLTSAAYVHLKQAEISKYTRNL  100

Query  2629  SPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRS  2450
             +PASR ILLSGPAELYQQMLAKALAH+F AKLLLLD TDF +K+  KYG+  ++ S KRS
Sbjct  101   APASRAILLSGPAELYQQMLAKALAHFFEAKLLLLDPTDFLIKLHGKYGTGGSDQSVKRS  160

Query  2449  ISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasa  2270
             ISETTL +MS  L SF+ +  KE+ +G++RRQ+S  D+  +  E +++   LRRN+S S+
Sbjct  161   ISETTLEKMSGLLQSFTKVPQKEQPRGSMRRQNSMTDMKLRSSESTNSLPKLRRNASTSS  220

Query  2269  nmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCR  2090
             +M++L S    +N  PL R SS +FDEK+L+QALYKVLV VSK  PIVLY+RD EK   +
Sbjct  221   DMSSLASQGPPTNSAPLRRASSWNFDEKILVQALYKVLVSVSKKSPIVLYIRDVEKFFHK  280

Query  2089  SEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLV  1910
             S K+Y+L +K+L +L G VL+LGSRI D   D  ELD+RL+++FPYNIEIKPPE E HLV
Sbjct  281   SPKMYLLFEKLLSKLEGPVLLLGSRIFDIDFDDEELDDRLTALFPYNIEIKPPENENHLV  340

Query  1909  SWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAIS  1730
             SW SQLEEDMK++Q+QDN+NHI EVLA ND+EC DLGSIC++DTM LS YIEE+VVSA+S
Sbjct  341   SWNSQLEEDMKIIQFQDNRNHITEVLAENDLECLDLGSICLSDTMGLSKYIEEIVVSAVS  400

Query  1729  YHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG  1550
             YHLMN KDPEYRN KL++S+KSLSH + IF+E K    KD +KLE+ A+ SK    G   
Sbjct  401   YHLMNNKDPEYRNGKLILSAKSLSHALEIFQENKMC-DKDTMKLEAHADASKIAAKGIVP  459

Query  1549  SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEV  1370
                      ++  P + P   + AP      K   +   A KAPEVPPDNEFEKRIRPEV
Sbjct  460   IAAKSETKPATLLPPAAPAAAAPAPESKIEPKKPENPPPAAKAPEVPPDNEFEKRIRPEV  519

Query  1369  IPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTM  1190
             IPA EIGV+F DIGAL++ KESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTM
Sbjct  520   IPANEIGVSFEDIGALEDTKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTM  579

Query  1189  LAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR  1010
             LAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR
Sbjct  580   LAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR  639

Query  1009  SRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLP  830
             +RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEAIIRRFERRIMVGLP
Sbjct  640   NRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEAIIRRFERRIMVGLP  699

Query  829   TPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERL  650
             + + RELI++ LL+KE V + +D K+LA MTEGY+GSDLKNLCTTAAYRPVRELI++ER 
Sbjct  700   SVQNRELIMRRLLSKEKVDEGIDYKELAIMTEGYSGSDLKNLCTTAAYRPVRELIQKERK  759

Query  649   KDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNE  470
             K++EKK+L Q       +    +DKG   I +RPLNM D  EAKNQVAASFAAEGS+M E
Sbjct  760   KELEKKKLEQGGTPLDPSKIKEKDKG---IILRPLNMKDLKEAKNQVAASFAAEGSVMGE  816

Query  469   LKQWNNLYGEGGSRKKEQLTYFL  401
             LKQWN LYGEGGSRKKEQLTYFL
Sbjct  817   LKQWNELYGEGGSRKKEQLTYFL  839



>ref|XP_010448047.1| PREDICTED: uncharacterized protein LOC104730561 isoform X1 [Camelina 
sativa]
 ref|XP_010448048.1| PREDICTED: uncharacterized protein LOC104730561 isoform X1 [Camelina 
sativa]
Length=830

 Score =  1048 bits (2711),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/822 (65%), Positives = 660/822 (80%), Gaps = 23/822 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRQSSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+P S+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPGSKAILLSGPAESYQQMLAKALAHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E+S KRSISE TL++MS  +GS S+L  +EE +GTLRR +SG D+ S+G + 
Sbjct  145   SKYGCVKKETSHKRSISEMTLDKMSSLMGSLSMLSQREETRGTLRRITSGNDLHSRGFDV  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +++P  L+RN+SA+++M++++S + TS      R ++L FDE+L +Q+LYKVLV VS+T 
Sbjct  205   TTHPPRLKRNASAASDMSSISSRSATSGSASSKRNANLCFDERLFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ + L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKL-CQSERFFKLFQRLLTKLSGPVLVLGSRLLEPEDDCQEVGESISTLFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q+QDN+NHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKTRFEDDMKVIQFQDNRNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS SLSHG+ I  +E     ++ LKL+
Sbjct  384   FLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISSNSLSHGLGIL-QEGNRRFENSLKLD  442

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP-  1418
             +  +   + +  E G    E+K+E++ AP +K E                      KAP 
Sbjct  443   ANTDTKVQGEESE-GIIKSESKSETA-APENKTEP-----------TPKNECPLPPKAPV  489

Query  1417  -EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
              EV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLK
Sbjct  490   NEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLK  549

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV
Sbjct  550   PCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  609

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             SPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDL
Sbjct  610   SPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNSGDRILVLAATNRPFDL  669

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MT+GY+GSDLKN C
Sbjct  670   DEAIIRRFERRIMVGLPSTESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSDLKNFC  728

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGD--APTANEDKGERVITIRPLNMDDFM  527
             TTAAYRPVRELIKQE LKD E+K+  +E     +  +    E   ER+I +RPL+M+D  
Sbjct  729   TTAAYRPVRELIKQECLKDQERKKRGEEAEKSNEEVSEAKEEVSEERIIKLRPLSMEDMK  788

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              AK+QVAASFAAEG+ MNELKQWN LYGEGGSRKKEQL+YFL
Sbjct  789   VAKSQVAASFAAEGAGMNELKQWNELYGEGGSRKKEQLSYFL  830



>ref|XP_011047746.1| PREDICTED: nuclear valosin-containing protein-like isoform X2 
[Populus euphratica]
Length=774

 Score =  1046 bits (2706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 546/772 (71%), Positives = 622/772 (81%), Gaps = 36/772 (5%)
 Frame = -1

Query  2713  SEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKL  2534
             SE+T++LLTSAAFVHLK ADF+KHTRNLSPASR ILLSGPAE Y QMLAKALAH F +KL
Sbjct  38    SEKTQMLLTSAAFVHLKHADFSKHTRNLSPASRAILLSGPAEFYLQMLAKALAHNFESKL  97

Query  2533  LLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQ  2354
             LLLDV+DFS+K+QSKYG S+ ESSFKRSIS  TL RMS   GSFSIL PKEE        
Sbjct  98    LLLDVSDFSMKMQSKYGCSKKESSFKRSISGVTLERMSSLFGSFSILSPKEE--------  149

Query  2353  SSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQ  2174
                    ++G EGSSN   LRRN+S +++M+++TS +++ NP PL   SS  FDE L ++
Sbjct  150   -------TRGKEGSSNSPKLRRNTSTASDMSSMTSQSSSMNPAPLKHPSSWCFDENLFLR  202

Query  2173  ALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDD  1994
             +LY+VLV VS+   I+LYLRD EKLL +S+++Y LL K+L++LSG+VLILGSR++D  DD
Sbjct  203   SLYQVLVSVSERSSIILYLRDVEKLLLQSQRMYNLLDKLLKKLSGNVLILGSRMLDQEDD  262

Query  1993  YRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIE  1814
              +E D RL+ +FPYNIEIKPPE+ETHLVSWK+QLEEDMK +Q+QDNKNHI EVLAANDIE
Sbjct  263   CKEADGRLAMLFPYNIEIKPPEDETHLVSWKAQLEEDMKKIQFQDNKNHIAEVLAANDIE  322

Query  1813  CDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE  1634
             CDDL SIC ADTM LSNYIEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E
Sbjct  323   CDDLSSICHADTMVLSNYIEEIVVSAISYHLMNNKDPEYRNGKLLISSKSLSHGLSIFQE  382

Query  1633  EKTAAGKDILKLE-SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapaptt  1457
              K+  GKD LKLE +     +       G+K      +  +  G+K              
Sbjct  383   GKSD-GKDTLKLEINAEAGKEAEGEEPDGAKNDSKTEKEKSVTGAKDSENQP--------  433

Query  1456  kdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPL  1277
                       KAPEVPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPL
Sbjct  434   ----------KAPEVPPDNEFEKRIRPEVIPANEIGVTFADIGALDETKESLQELVMLPL  483

Query  1276  RRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK  1097
             RRPDLF GGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK
Sbjct  484   RRPDLFNGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEK  543

Query  1096  NVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERI  917
             NVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERI
Sbjct  544   NVRALFTLAAKVSPTIIFVDEVDSMLGQRTRFGEHEAMRKIKNEFMTHWDGLLTKPGERI  603

Query  916   LVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMT  737
             LVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE ILKTL++KE   + LD K+LATMT
Sbjct  604   LVLAATNRPFDLDEAIIRRFERRIMVGLPSIESRERILKTLMSKEKT-EDLDFKELATMT  662

Query  736   EGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVIT  557
             EGYTGSDLKNLC TAAYRPVREL++QER+KD EKK+ A+   +   A T  E K E +I 
Sbjct  663   EGYTGSDLKNLCVTAAYRPVRELLQQERVKDKEKKQKAEGTSSEDAADTKEEGKEESMII  722

Query  556   IRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +RPLNMDD  +AKNQVA+SFA EG++MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  723   LRPLNMDDMRQAKNQVASSFATEGAVMNELKQWNELYGEGGSRKKQQLTYFL  774



>dbj|BAH19462.1| AT1G64110 [Arabidopsis thaliana]
Length=769

 Score =  1046 bits (2705),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/748 (74%), Positives = 615/748 (82%), Gaps = 26/748 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF+LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFALKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSN--PGPLMRTSSLSFDEKLLIQALYKVLVK  2150
             +EGSSNP  LRRNSSA+AN++NL    ++SN    PL R+SS SFDEKLL+Q+LYKVL  
Sbjct  207   MEGSSNPPKLRRNSSAAANISNLA---SSSNQVSAPLKRSSSWSFDEKLLVQSLYKVLAY  263

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDER  1973
             VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+
Sbjct  264   VSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEK  323

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             LS+VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI
Sbjct  324   LSAVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESI  383

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G+
Sbjct  384   SFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGK-AGGR  442

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             + LK ++K E SKE ++    S  PETK ES T   SK              K+A +   
Sbjct  443   EKLKQKTKEESSKEVKAE---SIKPETKTESVTTVSSK----------EEPEKEAKAEKV  489

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
               KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALDEIKESL ELVMLPLRRPDLF G
Sbjct  490   TPKAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRPDLFTG  549

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  550   GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  609

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  610   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  669

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGYTGSDL
Sbjct  670   PFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGYTGSDL  729

Query  712   KNLCTTAAYRPVRELIKQERLKDVEKKR  629
             KNLCTTAAYRPVRELI+QER+KD EKK+
Sbjct  730   KNLCTTAAYRPVRELIQQERIKDTEKKK  757



>gb|KEH25715.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=813

 Score =  1044 bits (2700),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 551/818 (67%), Positives = 652/818 (80%), Gaps = 34/818 (4%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G     + V+ + + +E+   +VDG+DSKVTFDEFPYYLSE+TRVLLTSAA+V
Sbjct  27    QAVQKWVGGIRDIDEVSGEQIVEELKRLVVDGKDSKVTFDEFPYYLSEKTRVLLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  +F+KHTRNLSPASR ILLSGPAELYQQMLAKALAHYF +KLLLLDVTDFS+K+QS
Sbjct  87    HLKHLNFSKHTRNLSPASRAILLSGPAELYQQMLAKALAHYFDSKLLLLDVTDFSVKLQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             ++G  R E+ F+RSISE TL RMS   GSFS++    E +GTLR+Q+         +E S
Sbjct  147   RFGIPRKEAYFRRSISEMTLERMSGLFGSFSMMPSTGETRGTLRQQN---------VESS  197

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             +NP  LRRN+SA++++++ +S + ++NP  L RTSSL FDEKL +Q+LYKVLV +S T  
Sbjct  198   NNPPRLRRNASAASDLSSTSSQSGSTNPASLRRTSSLCFDEKLFVQSLYKVLVSISGTDS  257

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY+RD EKL+ +S +++ LLQ+M+ +LSGSVLILGS+I D   D +ELDER++ +FPY
Sbjct  258   IILYIRDVEKLVLKSPRLFNLLQRMINKLSGSVLILGSQISDLEYDCKELDERVARLFPY  317

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIK PE+ETHL SWK QLEEDMK++Q+QD +NHI EVLA NDI+CDDL SIC ADTM 
Sbjct  318   NIEIKVPEDETHLGSWKGQLEEDMKIIQFQDTRNHIAEVLAENDIDCDDLNSICHADTMI  377

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYIEE+VVSAISYHLM TK+PEYRN KLVISS SLS G+++F+E K++     LK   
Sbjct  378   LSNYIEEIVVSAISYHLMITKEPEYRNGKLVISSNSLSQGLSLFEEGKSSGN---LKTND  434

Query  1591  KAELSKETQSGEKGSKGPETKAESS-TAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
               + + +  +G K     E K+E   + P +K E                     VKA E
Sbjct  435   SNKENVDDIAGVKNDVRNENKSEGEKSIPVTKKEG---------------EIPVPVKA-E  478

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VP DNEFEKRIRPEVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  479   VP-DNEFEKRIRPEVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPC  537

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+P
Sbjct  538   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAP  597

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLL+ P E+ILVLAATNRPFDLDE
Sbjct  598   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLSGPNEQILVLAATNRPFDLDE  657

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE+ILKTL++KE   + LD K+LATMTEG++GSDLKNLC T
Sbjct  658   AIIRRFERRIMVGLPSAENREMILKTLMSKEK-HENLDFKELATMTEGFSGSDLKNLCIT  716

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AAYRPVRELI+QER K++EKK+   E  N  DA  +N D  E  I +RPL+M+D  +AKN
Sbjct  717   AAYRPVRELIQQERKKEMEKKKKEAESVNSEDASNSN-DNDEPEIILRPLSMEDMKQAKN  775

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             QVAASFA+EGS+M ELKQWN LYGEGGSRKK+QLTYFL
Sbjct  776   QVAASFASEGSVMAELKQWNELYGEGGSRKKQQLTYFL  813



>ref|XP_009119823.1| PREDICTED: calmodulin-interacting protein 111 isoform X3 [Brassica 
rapa]
Length=818

 Score =  1043 bits (2697),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/823 (66%), Positives = 650/823 (79%), Gaps = 37/823 (4%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + MEQE++  IVDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQMEQELVRQIVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  + +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKELEISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ +   KRSISE TL++MS  +GSFS+L   E E +G LRR +SG  + S    
Sbjct  145   SKYGCTKRKPLHKRSISELTLDKMSSLMGSFSMLSQFEVEPRGALRRDTSGNVLKS----  200

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNP--GPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
              SS P   +RN+             +TSN       R+++L FDEKL +Q+LYKV+V VS
Sbjct  201   SSSLPPRHKRNAI------------STSNSVTASSKRSTNLCFDEKLFLQSLYKVVVFVS  248

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSS  1964
             KT P+++YLRD EKLL  SE+ Y L Q +L ++SG VLILGS +++P DD +E+ E +++
Sbjct  249   KTNPLIIYLRDVEKLL-ESERFYKLFQILLNKISGPVLILGSMVLEPEDDCQEVSEGVTA  307

Query  1963  VFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMA  1784
             +FPYNIEI+PPE+E+ LVSWK++LE+DMKM+Q++DNKNHI EVLAANDI+CDDL SIC A
Sbjct  308   LFPYNIEIRPPEDESQLVSWKNRLEDDMKMIQFRDNKNHIAEVLAANDIQCDDLASICHA  367

Query  1783  DTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDIL  1604
             DTM LSN+IE++VVSAISYHL++TK+PEYRN KLVISSKSLSHG++IF+E  + + +D L
Sbjct  368   DTMCLSNHIEQIVVSAISYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGSRSSEDSL  427

Query  1603  KLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
             KL++  +  +  + GE  SK  E+K ES  +P +K E             +   +    K
Sbjct  428   KLDTNTDSKR--KGGEVCSKS-ESKPES-YSPENKNE------LEKSLPSNKNDNPLPPK  477

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             APEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLL
Sbjct  478   APEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLL  537

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK
Sbjct  538   KPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  597

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFD
Sbjct  598   VSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFD  657

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE     LD  +L  MTEGY+GSDLKNL
Sbjct  658   LDEAIIRRFERRIMVGLPSTESREKILRTLLSKEKTDD-LDFNELGQMTEGYSGSDLKNL  716

Query  703   CTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG--ERVITIRPLNMDDF  530
             C TAAYRPVRELI+QERLKD EKK+  +E     +     ED+   E+ I +RPLNM+D 
Sbjct  717   CITAAYRPVRELIQQERLKDQEKKK-REEAGKSAEESKEKEDEACEEKEIILRPLNMEDM  775

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AK QVAASFA+EGS MNELKQWN+LYGEGGSRKKE LTYFL
Sbjct  776   RKAKTQVAASFASEGSGMNELKQWNDLYGEGGSRKKEPLTYFL  818



>ref|XP_009119822.1| PREDICTED: calmodulin-interacting protein 111 isoform X2 [Brassica 
rapa]
Length=821

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 539/823 (65%), Positives = 652/823 (79%), Gaps = 34/823 (4%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + MEQE++  IVDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQMEQELVRQIVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  + +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKELEISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ +   KRSISE TL++MS  +GSFS+L   E E +G LRR +SG ++    ++
Sbjct  145   SKYGCTKRKPLHKRSISELTLDKMSSLMGSFSMLSQFEVEPRGALRRDTSG-NVLKSSLD  203

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNP--GPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
              SS P   +RN+             +TSN       R+++L FDEKL +Q+LYKV+V VS
Sbjct  204   SSSLPPRHKRNAI------------STSNSVTASSKRSTNLCFDEKLFLQSLYKVVVFVS  251

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSS  1964
             KT P+++YLRD EKLL  SE+ Y L Q +L ++SG VLILGS +++P DD +E+ E +++
Sbjct  252   KTNPLIIYLRDVEKLL-ESERFYKLFQILLNKISGPVLILGSMVLEPEDDCQEVSEGVTA  310

Query  1963  VFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMA  1784
             +FPYNIEI+PPE+E+ LVSWK++LE+DMKM+Q++DNKNHI EVLAANDI+CDDL SIC A
Sbjct  311   LFPYNIEIRPPEDESQLVSWKNRLEDDMKMIQFRDNKNHIAEVLAANDIQCDDLASICHA  370

Query  1783  DTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDIL  1604
             DTM LSN+IE++VVSAISYHL++TK+PEYRN KLVISSKSLSHG++IF+E  + + +D L
Sbjct  371   DTMCLSNHIEQIVVSAISYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGSRSSEDSL  430

Query  1603  KLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
             KL++  +  +  + GE  SK  E+K ES  +P +K E             +   +    K
Sbjct  431   KLDTNTDSKR--KGGEVCSKS-ESKPES-YSPENKNE------LEKSLPSNKNDNPLPPK  480

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             APEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLL
Sbjct  481   APEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLL  540

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK
Sbjct  541   KPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  600

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFD
Sbjct  601   VSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFD  660

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE     LD  +L  MTEGY+GSDLKNL
Sbjct  661   LDEAIIRRFERRIMVGLPSTESREKILRTLLSKEKTDD-LDFNELGQMTEGYSGSDLKNL  719

Query  703   CTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG--ERVITIRPLNMDDF  530
             C TAAYRPVRELI+QERLKD EKK+  +E     +     ED+   E+ I +RPLNM+D 
Sbjct  720   CITAAYRPVRELIQQERLKDQEKKK-REEAGKSAEESKEKEDEACEEKEIILRPLNMEDM  778

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AK QVAASFA+EGS MNELKQWN+LYGEGGSRKKE LTYFL
Sbjct  779   RKAKTQVAASFASEGSGMNELKQWNDLYGEGGSRKKEPLTYFL  821



>ref|XP_009119821.1| PREDICTED: calmodulin-interacting protein 111 isoform X1 [Brassica 
rapa]
Length=822

 Score =  1041 bits (2693),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 540/823 (66%), Positives = 652/823 (79%), Gaps = 33/823 (4%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + MEQE++  IVDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQMEQELVRQIVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  + +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKELEISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ +   KRSISE TL++MS  +GSFS+L   E E +G LRR +SG  + S  ++
Sbjct  145   SKYGCTKRKPLHKRSISELTLDKMSSLMGSFSMLSQFEVEPRGALRRDTSGNVLKSSSLD  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNP--GPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
              SS P   +RN+             +TSN       R+++L FDEKL +Q+LYKV+V VS
Sbjct  205   SSSLPPRHKRNAI------------STSNSVTASSKRSTNLCFDEKLFLQSLYKVVVFVS  252

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSS  1964
             KT P+++YLRD EKLL  SE+ Y L Q +L ++SG VLILGS +++P DD +E+ E +++
Sbjct  253   KTNPLIIYLRDVEKLL-ESERFYKLFQILLNKISGPVLILGSMVLEPEDDCQEVSEGVTA  311

Query  1963  VFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMA  1784
             +FPYNIEI+PPE+E+ LVSWK++LE+DMKM+Q++DNKNHI EVLAANDI+CDDL SIC A
Sbjct  312   LFPYNIEIRPPEDESQLVSWKNRLEDDMKMIQFRDNKNHIAEVLAANDIQCDDLASICHA  371

Query  1783  DTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDIL  1604
             DTM LSN+IE++VVSAISYHL++TK+PEYRN KLVISSKSLSHG++IF+E  + + +D L
Sbjct  372   DTMCLSNHIEQIVVSAISYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGSRSSEDSL  431

Query  1603  KLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
             KL++  +  +  + GE  SK  E+K ES  +P +K E             +   +    K
Sbjct  432   KLDTNTDSKR--KGGEVCSKS-ESKPES-YSPENKNE------LEKSLPSNKNDNPLPPK  481

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             APEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLL
Sbjct  482   APEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLL  541

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK
Sbjct  542   KPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  601

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFD
Sbjct  602   VSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFD  661

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE     LD  +L  MTEGY+GSDLKNL
Sbjct  662   LDEAIIRRFERRIMVGLPSTESREKILRTLLSKEKTDD-LDFNELGQMTEGYSGSDLKNL  720

Query  703   CTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG--ERVITIRPLNMDDF  530
             C TAAYRPVRELI+QERLKD EKK+  +E     +     ED+   E+ I +RPLNM+D 
Sbjct  721   CITAAYRPVRELIQQERLKDQEKKK-REEAGKSAEESKEKEDEACEEKEIILRPLNMEDM  779

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AK QVAASFA+EGS MNELKQWN+LYGEGGSRKKE LTYFL
Sbjct  780   RKAKTQVAASFASEGSGMNELKQWNDLYGEGGSRKKEPLTYFL  822



>ref|XP_009144116.1| PREDICTED: uncharacterized protein LOC103867777 [Brassica rapa]
Length=831

 Score =  1040 bits (2688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/822 (65%), Positives = 658/822 (80%), Gaps = 22/822 (3%)
 Frame = -1

Query  2845  QTVSKWTGSS---SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q + KW   S    + +T + +EQE+   IVDGR+S VTFDEFPY+LSE+TR+LLTSAA+
Sbjct  25    QGLGKWANGSVAADDGLTGEKIEQELARQIVDGRESSVTFDEFPYFLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLDVTDFS+K+Q
Sbjct  85    VHLKQFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDVTDFSIKMQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  + E   KRSISE TL++MS  + SFS+L  +EE +GTLRR +SG D+ S+G EG
Sbjct  145   SKYGCIKKEPCHKRSISEMTLDKMSNLMESFSMLTQREETRGTLRRLTSGNDLTSRGFEG  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SS+P  L+RN+SA++++++++S + +S      R+++L FDEKL +Q+LYKVLV VS+T 
Sbjct  205   SSHPNRLKRNASAASDISSISSRSASSVSASTKRSTNLCFDEKLFLQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL+ +SE+ Y L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  265   PIIIYLRDVEKLI-QSERFYKLFQRLLTKLSGPVLLLGSRLLEPEDDCQEVGEGISALFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  324   YNIEIRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLMN K+PEY+N +LVISS SLSHG++IF+E            E
Sbjct  384   FLSSHIEEIVVSAISYHLMNNKEPEYKNGRLVISSNSLSHGLSIFQEGSKYP-------E  436

Query  1594  SKAELSKETQS-GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             +  +L + T S GE+  +  +++++S T P +K +        +             KAP
Sbjct  437   NSLKLDRNTDSKGEESEEIVKSESKSETVPANKNDL------ESSIPAAKNECPLPPKAP  490

Query  1417  --EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
               EV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLL
Sbjct  491   VNEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLL  550

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA K
Sbjct  551   KPCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAGK  610

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTII V+EVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFD
Sbjct  611   VSPTIICVEEVDSMLGQRTRAGEHEAMRKIKNEFMTHWDGLMSNSGDRILVLAATNRPFD  670

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA MT+GY+GSDLKN 
Sbjct  671   LDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFHELAQMTDGYSGSDLKNF  729

Query  703   CTTAAYRPVRELIKQERLKDVE-KKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFM  527
             CTTAAYRPVRELIKQE LKD E KKR   E  +   +    E   ERVIT+R L+M+D  
Sbjct  730   CTTAAYRPVRELIKQECLKDQERKKREEPEKSSEEGSEEKEEASEERVITLRALSMEDMR  789

Query  526   EAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              AK+QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  790   VAKSQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  831



>gb|AAL32670.1| similar to homeobox protein [Arabidopsis thaliana]
Length=752

 Score =  1040 bits (2688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/743 (74%), Positives = 609/743 (82%), Gaps = 26/743 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q V KW G   SS+NAVT D ME+E+L  +VDGR+SK+TFDEFPYYLSEQTRVLLTSAA+
Sbjct  27    QAVGKWAGGNSSSNNAVTADKMEKEILRQVVDGRESKITFDEFPYYLSEQTRVLLTSAAY  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +K+TRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLDV DF LK+Q
Sbjct  87    VHLKHFDASKYTRNLSPASRAILLSGPAELYQQMLAKALAHFFDAKLLLLDVNDFGLKIQ  146

Query  2494  SKYGSSRNESS-FKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKG  2324
             SKYGS   ESS FKRS SE+ L ++S    SFSIL  +EE K  GTLRRQSSGVDI S  
Sbjct  147   SKYGSGNTESSSFKRSPSESALEQLSGLFSSFSILPQREESKAGGTLRRQSSGVDIKSSS  206

Query  2323  IEGSSNPTTlrrnssasanmnnltSYNTTSN--PGPLMRTSSLSFDEKLLIQALYKVLVK  2150
             +EGSSNP  LRRNSSA+AN++NL    ++SN    PL R+SS SFDEKLL+Q+LYKVL  
Sbjct  207   MEGSSNPPKLRRNSSAAANISNLA---SSSNQVSAPLKRSSSWSFDEKLLVQSLYKVLAY  263

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVD-PGDDYRELDER  1973
             VSK  PIVLYLRD E  L RS++ Y L QK+L++LSG VLILGSRIVD   +D +E+DE+
Sbjct  264   VSKANPIVLYLRDVENFLFRSQRTYNLFQKLLQKLSGPVLILGSRIVDLSSEDAQEIDEK  323

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             LS+VFPYNI+I+PPE+ETHLVSWKSQLE DM M+Q QDN+NHIMEVL+ ND+ CDDL SI
Sbjct  324   LSAVFPYNIDIRPPEDETHLVSWKSQLERDMNMIQTQDNRNHIMEVLSENDLICDDLESI  383

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                DT  LSNYIEE+VVSA+SYHLMN KDPEYRN KLVISS SLSHG ++F+E K A G+
Sbjct  384   SFEDTKVLSNYIEEIVVSALSYHLMNNKDPEYRNGKLVISSISLSHGFSLFREGK-AGGR  442

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             + LK ++K E SKE ++    S  PETK ES T   SK E    A A             
Sbjct  443   EKLKQKTKEESSKEVKAE---SIKPETKTESVTTVSSKEEPEKEAKAEK----------V  489

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
               KAPEV PDNEFEKRIRPEVIPA+EI VTF DIGALDEIKESL ELVMLPLRRPDLF G
Sbjct  490   TPKAPEVAPDNEFEKRIRPEVIPAEEINVTFKDIGALDEIKESLQELVMLPLRRPDLFTG  549

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL
Sbjct  550   GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  609

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A+KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL+TKPGERILVLAATNR
Sbjct  610   ASKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLMTKPGERILVLAATNR  669

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAIIRRFERRIMVGLP  E RE IL+TLLAKE V + LD K+LA MTEGYTGSDL
Sbjct  670   PFDLDEAIIRRFERRIMVGLPAVENREKILRTLLAKEKVDENLDYKELAMMTEGYTGSDL  729

Query  712   KNLCTTAAYRPVRELIKQERLKD  644
             KNLCTTAAYRPVRELI+QER+KD
Sbjct  730   KNLCTTAAYRPVRELIQQERIKD  752



>gb|EEE54150.1| hypothetical protein OsJ_00955 [Oryza sativa Japonica Group]
Length=883

 Score =  1039 bits (2687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 554/861 (64%), Positives = 645/861 (75%), Gaps = 71/861 (8%)
 Frame = -1

Query  2803  TVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSP  2624
             TV+ +EQE+   +VDG DS+VTFD FPYYLSEQTRVLLTSAA+VHLK AD +++TRNL+P
Sbjct  34    TVERVEQELRRLVVDGADSRVTFDGFPYYLSEQTRVLLTSAAYVHLKQADISQYTRNLAP  93

Query  2623  ASRTILLSGPA-------------------------------------------------  2591
             ASR ILLSGPA                                                 
Sbjct  94    ASRAILLSGPADFSSSQIHSKYGGGSSTDSSFKRSISETTLEKVSGLLGSLSILPQKEKP  153

Query  2590  -ELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS-SRNESSFKRSISETTLNRMSE  2417
              ELYQQMLAKALAHYF AKLLLLD TDF +K+ SKYG  S  +SSFKRSISETTL ++S 
Sbjct  154   KELYQQMLAKALAHYFEAKLLLLDPTDFLIKIHSKYGGGSSTDSSFKRSISETTLEKVSG  213

Query  2416  FLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTT  2237
              LGS SIL  KE+ KGT+RRQSS  D+  +  E +S+   L+RN+S S++M++L S    
Sbjct  214   LLGSLSILPQKEKPKGTIRRQSSMTDMKLRSSESTSSFPKLKRNASTSSDMSSLASQGPP  273

Query  2236  SNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKM  2057
             +NP  L R SS +FDEK+L+QA+YKVL  VSK  PIVLY+RD EK L +S+K+Y++ +K+
Sbjct  274   NNPASLRRASSWTFDEKILVQAVYKVLHSVSKKNPIVLYIRDVEKFLHKSKKMYVMFEKL  333

Query  2056  LRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMK  1877
             L +L G VL+LGSRIVD   D  ELDERL+++FPYNIEIKPPE E HLVSW SQLEEDMK
Sbjct  334   LNKLEGPVLVLGSRIVDMDFD-EELDERLTALFPYNIEIKPPENENHLVSWNSQLEEDMK  392

Query  1876  MMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEY  1697
             M+Q+QDN+NHI EVLA ND+ECDDLGSIC++DTM L  YIEE+VVSA+SYHLMN KDPEY
Sbjct  393   MIQFQDNRNHITEVLAENDLECDDLGSICLSDTMVLGRYIEEIVVSAVSYHLMNKKDPEY  452

Query  1696  RNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESS  1517
             RN KL++S+KSLSH + IF+E K    KD +KLE+K + SK    G      P   A+S 
Sbjct  453   RNGKLLLSAKSLSHALEIFQENKMY-DKDSMKLEAKRDASKVADRG----IAP-FAAKSE  506

Query  1516  TAPGS---------KPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIP  1364
             T P +                + A     +   +   A KAPE+PPDNEFEKRIRPEVIP
Sbjct  507   TKPATLLPPVPPTAAAAPPVESKAEPEKFEKKDNPSPAAKAPEMPPDNEFEKRIRPEVIP  566

Query  1363  AKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLA  1184
             A EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLA
Sbjct  567   ANEIGVTFDDIGALSDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLA  626

Query  1183  KAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSR  1004
             KAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R
Sbjct  627   KAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRNR  686

Query  1003  AGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTP  824
             AGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEAIIRRFERRIMVGLP+ 
Sbjct  687   AGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEAIIRRFERRIMVGLPSL  746

Query  823   EQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKD  644
             E RELIL++LL+KE V   LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI++E  + 
Sbjct  747   ESRELILRSLLSKEKVDGGLDYKELATMTEGYSGSDLKNLCTTAAYRPVRELIQKE--RK  804

Query  643   VEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELK  464
              E ++  ++  N  DA    E   +  I +RPLNM D  EAKNQVAASFAAEG+IM ELK
Sbjct  805   KELEKKREQGGNASDASKMKEK--DETIILRPLNMKDLKEAKNQVAASFAAEGTIMGELK  862

Query  463   QWNNLYGEGGSRKKEQLTYFL  401
             QWN LYGEGGSRKK+QLTYFL
Sbjct  863   QWNELYGEGGSRKKQQLTYFL  883



>ref|XP_010555700.1| PREDICTED: uncharacterized protein LOC104825121 [Tarenaya hassleriana]
Length=834

 Score =  1035 bits (2675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 542/820 (66%), Positives = 655/820 (80%), Gaps = 15/820 (2%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW   +GS  +  TV  +EQE++  IVDGR+S VTFDEFPY+LSE+TR LLT+AA+
Sbjct  25    QSLGKWANGSGSMVDGPTVGQIEQELVRQIVDGRESNVTFDEFPYFLSERTRGLLTNAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKQYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDITDFSVKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG ++ E S KRSISE TL++MS F+GS S+L   E  +G+LRR +SG D+ S+  E 
Sbjct  145   SKYGCTKKEPSLKRSISEMTLDKMSSFMGSLSVLTQPEGTRGSLRRHTSGNDLISRSFES  204

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SS P   ++N+S ++++++++S +  S        ++L FDEKL IQ+LYKVLV VS+T 
Sbjct  205   SSKPPKHKKNASTASDISSISSRSANSVSASRKHATNLCFDEKLFIQSLYKVLVSVSETN  264

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD EKLL +SE+ Y L Q++L +LSG VLILGSR+++P DD +E+++ +S++FP
Sbjct  265   SIILYLRDVEKLL-QSERFYKLFQRLLTKLSGPVLILGSRLLEPEDDCQEVNKEISALFP  323

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E+ L+SWK++LEEDMKM+Q +DNKNHI EVLAAND+EC DL  IC ADT+
Sbjct  324   YNIEIRPPEDESQLISWKTRLEEDMKMIQSKDNKNHIAEVLAANDLECGDLALICHADTI  383

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSN+IEE+VVSAISYHLM+ K+PEYRN KL+ISSKSLSHG++ F+E           LE
Sbjct  384   VLSNHIEEIVVSAISYHLMHNKEPEYRNGKLIISSKSLSHGLSFFQE-------GCRGLE  436

Query  1594  SKAELSKETQS-GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             +  +L   T S G+ G +    K+ES +   + PE  +      P TK  + +    K P
Sbjct  437   NSLKLDTNTDSKGKDGEEAIVLKSESKSETLA-PENRTEMEKSLPFTKKDSDNPLPPKVP  495

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             +V PDNEFEKRIRPEVIPA EIGVTFADIGALDE K+SL ELVMLPLRRPDLFKGGLLKP
Sbjct  496   DVIPDNEFEKRIRPEVIPASEIGVTFADIGALDETKDSLQELVMLPLRRPDLFKGGLLKP  555

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             C GILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALF+LAAKVS
Sbjct  556   CGGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVS  615

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRPFDLD
Sbjct  616   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRPFDLD  675

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MTEGY+GSDLKNLC 
Sbjct  676   EAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFQELAQMTEGYSGSDLKNLCI  734

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEA  521
             TAAYRPVRELI+QERLKD E+K+      +  +   + E   GERVIT+R LNM+D   A
Sbjct  735   TAAYRPVRELIQQERLKDQERKKKEGAGKSTEETMDSKEGTSGERVITLRHLNMEDMRRA  794

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAAS AAEGS M+ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  795   KNQVAASSAAEGSAMSELKQWNDLYGEGGSRKKEQLTYFL  834



>gb|EYU25172.1| hypothetical protein MIMGU_mgv1a001471mg [Erythranthe guttata]
Length=813

 Score =  1031 bits (2665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 538/823 (65%), Positives = 643/823 (78%), Gaps = 46/823 (6%)
 Frame = -1

Query  2842  TVSKWTG----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             TV +WTG    ++++A++ D +E E+L  +VDG++SKVTF++FPYYLSE+ RVLLTSAA+
Sbjct  28    TVGRWTGGATYATADAISGDQIELELLRLLVDGKESKVTFEDFPYYLSERARVLLTSAAY  87

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNLSPASR ILLSGPAELYQQMLAKALAH+F AKLLLLD+ DFSLK+Q
Sbjct  88    VHLKHLDVSKHTRNLSPASRAILLSGPAELYQQMLAKALAHHFEAKLLLLDINDFSLKMQ  147

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG ++ +SS  RSISE+T+ +MS   GSF  L  K++                +GI  
Sbjct  148   SKYGITKKDSSLNRSISESTIEKMSSLFGSF--LPYKDD---------------YRGINN  190

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             S  P   R +S +S   +++++ +++SNP P  R  S SFDEK  +Q+LYKVLV VS+T 
Sbjct  191   SLRP--RRTSSVSSDTSSSISAMSSSSNPAPSKRVCSWSFDEKDFLQSLYKVLVSVSRTS  248

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LY+RDAEKL  +S ++Y L  KML+RL+GSVL+LGSRI+D  +D  E++++LS +F 
Sbjct  249   GIILYIRDAEKLFLQSSRLYKLFDKMLKRLTGSVLVLGSRILDTDEDSVEVNDKLSLLFS  308

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E  L SWKSQLEED++ +Q+QDNKNHI EVLAAND+ECDDLGSIC AD++
Sbjct  309   YNIEIRPPEDEARLTSWKSQLEEDIRKIQFQDNKNHIAEVLAANDLECDDLGSICHADSL  368

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYI+E+VVSAISYHLMN KDPEYRN KLVISSKSLSHG+++F+E ++  GK  LK+E
Sbjct  369   FLSNYIDEIVVSAISYHLMNNKDPEYRNGKLVISSKSLSHGLSVFQEGRSG-GKYTLKME  427

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE  K+ +  E      E+K E       K E  S A     +TK    +   VK  E
Sbjct  428   TNAECFKDAEVKENAGAKTESKPEIP-----KSENKSEAEKSNSSTKTDGENALVVKPVE  482

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTF+DIGALDEIKESL ELVMLPLRRPDLF GGLLKPC
Sbjct  483   VPPDNEFEKRIRPEVIPANEIGVTFSDIGALDEIKESLQELVMLPLRRPDLFNGGLLKPC  542

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  543   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  602

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GE E MRKIKNEF++HWDGLLTKPGERILVLAATNRPFDLDE
Sbjct  603   TIIFVDEVDSMLGQRTRVGEQETMRKIKNEFVTHWDGLLTKPGERILVLAATNRPFDLDE  662

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFER           RE+IL+TL++KE V + LD K++A MTEGY+GSDLKNLC T
Sbjct  663   AIIRRFER-----------REMILRTLMSKEKV-EDLDFKEIAVMTEGYSGSDLKNLCIT  710

Query  694   AAYRPVRELIKQERLKDVEKK-RLAQECPNCGDAPT----ANEDKGERVITIRPLNMDDF  530
             AAYRPVRELI+QER KD +KK    +EC +  DA        E K E+VI++RPLNM+D 
Sbjct  711   AAYRPVRELIQQERQKDKQKKLSDEEECESSKDAAASSAEVEETKDEKVISLRPLNMEDI  770

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AKNQVAASFA+EGSIM ELKQWN LYGEGGSRKK+QL+YFL
Sbjct  771   RQAKNQVAASFASEGSIMGELKQWNELYGEGGSRKKQQLSYFL  813



>dbj|BAK00929.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=840

 Score =  1030 bits (2662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 550/823 (67%), Positives = 649/823 (79%), Gaps = 23/823 (3%)
 Frame = -1

Query  2830  WTGSSSNA-----VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             W G  S       VT++ +E E+   IVDGRDSKVTFDEFPYYLSEQTRV+LTSAA+VHL
Sbjct  28    WAGGGSGGPARAGVTLERVEHELRRLIVDGRDSKVTFDEFPYYLSEQTRVVLTSAAYVHL  87

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K A+ +K+TRNL+PASR ILLSGPAELYQQMLAKALAHYF AK+LLLD TDF +K+  KY
Sbjct  88    KQAEISKYTRNLAPASRAILLSGPAELYQQMLAKALAHYFEAKILLLDPTDFLIKLHGKY  147

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G+  +E S KRSISETTL +MS  L SF++   KE+ +G +RRQ+S  D+  +  E +S+
Sbjct  148   GTGGSEQSVKRSISETTLEKMSGLLQSFTMTPQKEQSRGGMRRQNSMTDMKLRSSESTSS  207

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
                LRRN+S S++M++L S  T SN  PL R SS +FDEK+L+QALYKVL KVSK  PIV
Sbjct  208   MPRLRRNASTSSDMSSLASQGTPSNSAPLRRASSWTFDEKMLVQALYKVLHKVSKKSPIV  267

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LY+RD +K L +S K+++L +K+L +L G VL+LGSRIVD   D  ELD+RLS++FPYNI
Sbjct  268   LYIRDVDKFLHKSPKMFLLFEKLLAKLEGPVLLLGSRIVDMDFDDDELDDRLSALFPYNI  327

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             +IKPPE E  LVSW SQLEEDMK++Q+QDN+NHI EVLA ND+EC DLGSIC++DTM LS
Sbjct  328   DIKPPENENCLVSWNSQLEEDMKIIQFQDNRNHITEVLAENDLECLDLGSICLSDTMGLS  387

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
              YIEE+VVSA+SYHLMN KDPEYRN KL++S+KSLSH + IF+E K    KD +KLE   
Sbjct  388   KYIEEIVVSAVSYHLMNNKDPEYRNGKLILSAKSLSHALEIFQENKVC-DKDTMKLE---  443

Query  1585  ELSKETQSGEKGSKG-PETKAESSTAPGS-------KPETGsaapapapttkdatsSGTA  1430
                K T + +   KG   T A+  T P +            + +P   P  K   +    
Sbjct  444   ---KHTDAPKIAEKGIAPTAAKLETKPATLLPPAVPAAAAPAPSPESKPEPKKPENPPPP  500

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              K PEVPPDNEFEKRIRPEVIPA EIGV+F DIGAL++IKESL ELVMLPLRRPDLFKGG
Sbjct  501   AKLPEVPPDNEFEKRIRPEVIPANEIGVSFDDIGALEDIKESLQELVMLPLRRPDLFKGG  560

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  561   LLKPCRGILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLA  620

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRP
Sbjct  621   AKVSPTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRP  680

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ + RE+I++ LL+KE V + LD K+L T+TEGY+GSDLK
Sbjct  681   FDLDEAIIRRFERRIMVGLPSVQNREMIMRRLLSKEKVDEGLDYKELGTITEGYSGSDLK  740

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDF  530
             NLCTTAAYRPVRELI++ER K++EKK+L +       +    +DK    I +RPLNM D 
Sbjct  741   NLCTTAAYRPVRELIQKERKKELEKKKLEKGGTPLDPSKMKEKDKE---IILRPLNMADL  797

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              EAKNQVAASFAAEGSIM ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  798   KEAKNQVAASFAAEGSIMGELKQWNDLYGEGGSRKKEQLTYFL  840



>dbj|BAJ91550.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=840

 Score =  1029 bits (2661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 548/817 (67%), Positives = 646/817 (79%), Gaps = 11/817 (1%)
 Frame = -1

Query  2830  WTGSSSNA-----VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             W G  S       VT++ +E E+   IVDGRDSKVTFDEFPYYLSEQTRV+LTSAA+VHL
Sbjct  28    WAGGGSGGPARAGVTLERVEHELRRLIVDGRDSKVTFDEFPYYLSEQTRVVLTSAAYVHL  87

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K A+ +K+TRNL+PASR ILLSGPAELYQQMLAKALAHYF AK+LLLD TDF +K+  KY
Sbjct  88    KQAEISKYTRNLAPASRAILLSGPAELYQQMLAKALAHYFEAKILLLDPTDFLIKLHGKY  147

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G+  +E S KRSISETTL +MS  L SF++   KE+ +G +RRQ+S  D+  +  E +S+
Sbjct  148   GTGGSEQSVKRSISETTLEKMSGLLQSFTMTPQKEQSRGGMRRQNSMTDMKLRSSESTSS  207

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
                LRRN+S S++M++L S  T SN  PL R SS +FDEK+L+QALYKVL KVSK  PIV
Sbjct  208   MPRLRRNASTSSDMSSLASQGTPSNSAPLRRASSWTFDEKMLVQALYKVLHKVSKKSPIV  267

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LY+RD +K L +S K+++L +K+L +L G VL+LGSRIVD   D  ELD+RLS++FPYNI
Sbjct  268   LYIRDVDKFLHKSPKMFLLFEKLLAKLEGPVLLLGSRIVDMDFDDDELDDRLSALFPYNI  327

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             +IKPPE E  LVSW SQLEEDMK++Q+QDN+NHI EVLA ND+EC DLGSIC++DTM LS
Sbjct  328   DIKPPENENCLVSWNSQLEEDMKIIQFQDNRNHITEVLAENDLECLDLGSICLSDTMGLS  387

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
              YIEE+VVSA+SYHLMN KDPEYRN KL++S+KSLSH + IF+E K    KD +KLE   
Sbjct  388   KYIEEIVVSAVSYHLMNNKDPEYRNGKLILSAKSLSHALEIFQENKVC-DKDTMKLEKHT  446

Query  1585  ELSKETQSGEKGSKGP-ETKAESSTAPGSKPETGsaapa-papttkdatsSGTAVKAPEV  1412
             +  K  + G   +    ETK  +   P +      A      P  K   +     K PEV
Sbjct  447   DAPKIAEKGIAPTAAKLETKPATLLPPAAPAAAAPAPSPESKPEPKKPENPPPPAKLPEV  506

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             PPDNEFEKRIRPEVIPA EIGV+F DIGAL++IKESL ELVMLPLRRPDLFKGGLLKPCR
Sbjct  507   PPDNEFEKRIRPEVIPANEIGVSFDDIGALEDIKESLQELVMLPLRRPDLFKGGLLKPCR  566

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT
Sbjct  567   GILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  626

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEA
Sbjct  627   IIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEA  686

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ + RE+I++ LL+KE V + LD K+L T+TEGY+GSDLKNLCTTA
Sbjct  687   IIRRFERRIMVGLPSVQNREMIMRRLLSKEKVDEGLDYKELGTITEGYSGSDLKNLCTTA  746

Query  691   AYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQ  512
             AYRPVRELI++ER K++EKK+L +       +    +DK    I +RPLNM D  EAKNQ
Sbjct  747   AYRPVRELIQKERKKELEKKKLEKGGTPLDPSKMKEKDKE---IILRPLNMADLKEAKNQ  803

Query  511   VAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             VAASFAAEGSIM ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  804   VAASFAAEGSIMGELKQWNDLYGEGGSRKKEQLTYFL  840



>ref|XP_004145904.1| PREDICTED: uncharacterized protein LOC101216426 [Cucumis sativus]
Length=883

 Score =  1023 bits (2645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 512/738 (69%), Positives = 598/738 (81%), Gaps = 15/738 (2%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G   SS+ +T   +EQE++  ++DG++S VTF EFPYYLSE+TRVLL SAA+V
Sbjct  27    QAVGKWVGGNGSSDEITGQNIEQELIRQLLDGKNSNVTFAEFPYYLSERTRVLLMSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +KHTRNLSPASR ILLSGP ELYQQMLAKALAH+F +KLLLLDV+DFSLK+QS
Sbjct  87    HLKHCDISKHTRNLSPASRAILLSGPTELYQQMLAKALAHHFESKLLLLDVSDFSLKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + +SSF+RSISE TL RMS   GSFSIL      +G LRRQSS  DI S+  + S
Sbjct  147   KYGCPKKDSSFRRSISEVTLERMSSVWGSFSILPTSGNTRGNLRRQSSTTDIQSRCSDSS  206

Query  2311  SN-PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SN P   R  S+AS   +  ++Y +T N     RT++  FDEKL +Q+LYKVLV VS+T 
Sbjct  207   SNLPKLRRNASAASDISSISSNYGST-NSASAKRTNTWCFDEKLFLQSLYKVLVSVSETT  265

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD E+LL +S+++Y L  + L +LSGS+L+LGSR+VD  +D  ++D+RL+++F 
Sbjct  266   SIILYLRDVERLLLKSQRIYNLFHRFLNKLSGSILVLGSRMVDVENDCGDVDDRLTNLFR  325

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             Y++EI+PPE+E HLVSWK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  326   YSVEIRPPEDENHLVSWKAQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  385

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSAISYHLMN +DPEYRN KL+ISSKSLSHG++IF+E+  + GKD LKLE
Sbjct  386   VLSNYIEEIVVSAISYHLMNNRDPEYRNGKLLISSKSLSHGLSIFQED-NSEGKDTLKLE  444

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE SKE Q  E      E+K+E+   P ++ E                      KAPE
Sbjct  445   TNAESSKEAQRDEAVGAKTESKSEN---PATEAEKSVPIVKKDVENVPPQ------KAPE  495

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             +PPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  496   IPPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFKGGLLKPC  555

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  556   RGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  615

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDS+LGQR+R GEHEAMRKIKNEFMSHWDGLLT+  ERILVLAATNRPFDLDE
Sbjct  616   TIIFVDEVDSILGQRTRVGEHEAMRKIKNEFMSHWDGLLTRNDERILVLAATNRPFDLDE  675

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RELIL+TLL+KE   + LD K+LATMTEGY+GSDLKNLC T
Sbjct  676   AIIRRFERRIMVGLPSVESRELILRTLLSKEK-AEDLDFKELATMTEGYSGSDLKNLCVT  734

Query  694   AAYRPVRELIKQERLKDV  641
             AAYRPVREL++QERLKD+
Sbjct  735   AAYRPVRELLQQERLKDL  752


 Score =   101 bits (252),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  592  TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQL  413
            T   ++ ++ I +R LNMDD  +AKNQVAASFA+EGS+MNELKQWN+LYGEGGSRKK+QL
Sbjct  820  TKETEQDKQAIILRHLNMDDMRQAKNQVAASFASEGSVMNELKQWNDLYGEGGSRKKQQL  879

Query  412  TYFL  401
            TYFL
Sbjct  880  TYFL  883



>ref|XP_007040380.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY24881.1| P-loop containing nucleoside triphosphate hydrolases superfamily 
protein isoform 2 [Theobroma cacao]
Length=731

 Score =  1017 bits (2630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 528/711 (74%), Positives = 604/711 (85%), Gaps = 16/711 (2%)
 Frame = -1

Query  2836  SKWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             SKWTGS S A   +T++ ME+E+L  IVDGR+SKVTFD+FPYYLSEQT+ LLTSAA+VHL
Sbjct  28    SKWTGSGSGASTGITLERMEKELLRQIVDGRESKVTFDQFPYYLSEQTQALLTSAAYVHL  87

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K AD +K+TRNLSPASR ILLSGPAELYQQMLAKALAHYF +KLLLLDVTDFSLK+QSKY
Sbjct  88    KHADVSKYTRNLSPASRAILLSGPAELYQQMLAKALAHYFESKLLLLDVTDFSLKIQSKY  147

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             GS + ESSFKRS SETTL R+S   GSFS+L  +EE KGTLRRQSSGVDI S+G+E   +
Sbjct  148   GSGK-ESSFKRSTSETTLERLSGIFGSFSLLS-QEEHKGTLRRQSSGVDIGSRGVE---D  202

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
             P  LRRN+SASAN+N+L S  T++NP PL  TSS SFD+KLLIQ+LYKVLV VSK  P+V
Sbjct  203   PPKLRRNASASANINSLASQCTSANPAPLRWTSSFSFDDKLLIQSLYKVLVYVSKATPLV  262

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNI  1946
             LYLRD +KLL RS+++Y L Q+ML +LSG+VLILGSR+VD G+D RE+DERL+++FPYNI
Sbjct  263   LYLRDVDKLLFRSQRIYNLFQRMLNKLSGNVLILGSRVVDLGNDDREVDERLTAIFPYNI  322

Query  1945  EIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALS  1766
             EI+PPE+E HLVSWKSQLE+DMKM+Q QDN+NHIMEVL+AND++CDDL SIC+ADTMALS
Sbjct  323   EIRPPEDEKHLVSWKSQLEKDMKMIQAQDNRNHIMEVLSANDLDCDDLDSICVADTMALS  382

Query  1765  NYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKA  1586
              YIEEVVVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E K+  GKD LK E++ 
Sbjct  383   KYIEEVVVSAISYHLMNNKDPEYRNGKLMISSKSLSHGLSIFQEGKST-GKDTLKFEAET  441

Query  1585  ELSKETQSGEKGSKGPETKAES-STAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
             + SKE  +GE  S G +T+++S ST P  K E          T  +  +   A K  EVP
Sbjct  442   KTSKE--AGEV-SVGAKTESKSGSTNPEKKSE---METTATATKTEGENPAPAPKVTEVP  495

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EI VTFADIGALDE KESL ELVMLPLRRPDLF+GGLLKPCRG
Sbjct  496   PDNEFEKRIRPEVIPANEIDVTFADIGALDETKESLQELVMLPLRRPDLFQGGLLKPCRG  555

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  1049
             ILLFGPPGTGKTMLAKAIA+EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI
Sbjct  556   ILLFGPPGTGKTMLAKAIAREAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTI  615

Query  1048  IFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAI  869
             IFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKP ERILVLAATNRPFDLDEAI
Sbjct  616   IFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLLTKPSERILVLAATNRPFDLDEAI  675

Query  868   IRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSD  716
             IRRFERRIMVGLP+ + RE I +TLL+KE V   L+  +L +MTEGYTGSD
Sbjct  676   IRRFERRIMVGLPSADNREKIFRTLLSKEKVVDGLNFSELVSMTEGYTGSD  726



>ref|XP_006282408.1| hypothetical protein CARUB_v100258811mg, partial [Capsella rubella]
 gb|EOA15306.1| hypothetical protein CARUB_v100258811mg, partial [Capsella rubella]
Length=764

 Score =  1011 bits (2613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/783 (67%), Positives = 632/783 (81%), Gaps = 32/783 (4%)
 Frame = -1

Query  2710  EQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLL  2531
             ++TRVLLTSAA+VHLK  D +KHTRNL+PAS+ +LLSGPAE YQQMLAKAL+HYF +KLL
Sbjct  1     KRTRVLLTSAAYVHLKEYDISKHTRNLAPASKALLLSGPAEFYQQMLAKALSHYFESKLL  60

Query  2530  LLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQ  2354
             LLD+TDFS+K+QSKYG ++ E   KRSISE TL++MS  +GSFS+L  +E E +G+LRR 
Sbjct  61    LLDITDFSIKIQSKYGCTKKEPFHKRSISEFTLDKMSSLMGSFSMLSQREVEPRGSLRRP  120

Query  2353  SSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQ  2174
              SG D+ S+ +E SS P   +RN+SA++++++++S +++S      R+++L FDEKL +Q
Sbjct  121   ISGNDLKSRSMESSSRPPRHKRNASAASDISSISSRSSSSVSASSRRSTNLCFDEKLFLQ  180

Query  2173  ALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDD  1994
             +LYKV+V VS+T P+V+YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++  DD
Sbjct  181   SLYKVVVSVSETSPLVIYLRDVEKLL-ESERFYNLFQRLLNKLSGPVLILGSRVLEAEDD  239

Query  1993  YRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIE  1814
              +E+ E +S++FPYNIEI+PPE+E+ L+SWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+
Sbjct  240   SQEVGEGVSALFPYNIEIRPPEDESQLMSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQ  299

Query  1813  CDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE  1634
             CDDL SIC ADTM LSN+IEE+VVSAISYHL++TK+PEYRN KLVISSKSLSHG++IF+E
Sbjct  300   CDDLASICHADTMCLSNHIEEIVVSAISYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQE  359

Query  1633  EKTAAGKDILKLESKAELSK---ETQSGEKGSKGPETKAESSTA-PGSKPETGsaapapa  1466
                 + +D LKL++  +  +   E  S  +   GPE K ES  + P +K +         
Sbjct  360   GGNRSFEDSLKLDTNTDSKRKEGEVCSKSESKSGPENKNESEKSLPSNKNDNP-------  412

Query  1465  pttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVM  1286
                          KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVM
Sbjct  413   ----------LPPKAPEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVM  462

Query  1285  LPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGE  1106
             LPLRRPDLF+GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGE
Sbjct  463   LPLRRPDLFQGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGE  522

Query  1105  DEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPG  926
             DEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPG
Sbjct  523   DEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPG  582

Query  925   ERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLA  746
             ERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L 
Sbjct  583   ERILVLAATNRPFDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELG  641

Query  745   TMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNC--------GDAPT  590
              MTEGY+GSDLKNLC TAAYRPVRELI+QERLKD E+K+  +   +          DA  
Sbjct  642   QMTEGYSGSDLKNLCITAAYRPVRELIQQERLKDQERKKKEEAGKSTEEPKEKEEEDAEA  701

Query  589   ANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLT  410
               E   ERVIT+RPLNM+D  +AKNQVAASF++EG+ MNELKQWN+LYGEGGSRKKEQLT
Sbjct  702   EAEASEERVITLRPLNMEDMRKAKNQVAASFSSEGAGMNELKQWNDLYGEGGSRKKEQLT  761

Query  409   YFL  401
             YFL
Sbjct  762   YFL  764



>gb|EMT19774.1| Spastin [Aegilops tauschii]
Length=878

 Score =  1008 bits (2607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 533/829 (64%), Positives = 634/829 (76%), Gaps = 43/829 (5%)
 Frame = -1

Query  2824  GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAK  2645
             G +   VT++ +E E+   +VDGRDSKVTFDEFPYYLSEQTRV+LTSAA+VHLK A+ +K
Sbjct  72    GPARAGVTLERVEHELRRLVVDGRDSKVTFDEFPYYLSEQTRVVLTSAAYVHLKQAEISK  131

Query  2644  HTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDF-----SLKVQSKYGS  2480
             +TRNL+PASR ILLSGPAELYQQMLAKALAHYF AK+LLLD TDF     SL++  KYG+
Sbjct  132   YTRNLAPASRAILLSGPAELYQQMLAKALAHYFEAKILLLDPTDFLIKWCSLQLHGKYGT  191

Query  2479  SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPT  2300
               +E S  RSISETTL +MS  L SF++   KE+ +G +RRQ+S  D+    +  S +  
Sbjct  192   GGSEQSVTRSISETTLEKMSGLLQSFTMTPQKEQSRGGMRRQNSMTDM---KLRSSESTN  248

Query  2299  TlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLY  2120
             ++ R    ++  ++++S  +   P PL R SS +FDEK+L+QALYK+L KVSK  PIVLY
Sbjct  249   SIPRLRRNASTSSDMSSLASQGPPTPLRRASSWTFDEKMLVQALYKILHKVSKKSPIVLY  308

Query  2119  LRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEI  1940
             +RD EK L +S K+Y+L +K+L +L G VL+LGSRIVD   D  ELD+RLS++FPY+I+I
Sbjct  309   IRDVEKFLHKSPKMYLLFEKLLTKLEGPVLLLGSRIVDMDFDDDELDDRLSALFPYSIDI  368

Query  1939  KPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNY  1760
             KPPE E  LVSW SQLEEDMK++Q+QDN+NHI EVLA ND+EC DLGSIC++DTM LS Y
Sbjct  369   KPPENENCLVSWNSQLEEDMKIIQFQDNRNHITEVLAENDLECLDLGSICLSDTMGLSKY  428

Query  1759  IEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAEL  1580
             IEE+VVSA+SYHLMN KDPEYRN KL++S+KSLSH + IF+E K +  KD +KLE   + 
Sbjct  429   IEEIVVSAVSYHLMNHKDPEYRNGKLILSAKSLSHALEIFQENKMS-DKDTMKLERHTDA  487

Query  1579  SK---------ETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAV  1427
              K         ET+            A  +    SK              K   +     
Sbjct  488   RKGIVPTAAKLETKPATLLPPAAPAAATPAPPLESK-----------TEPKKPENPPPPA  536

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             K PEVPPDNEFEKRIRPEVIPA EIGV+F DIGAL++IKESL ELVMLPLRRPDLFKGGL
Sbjct  537   KLPEVPPDNEFEKRIRPEVIPANEIGVSFDDIGALEDIKESLQELVMLPLRRPDLFKGGL  596

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAA
Sbjct  597   LKPCRGILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAA  656

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPF
Sbjct  657   KVSPTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPF  716

Query  886   DLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKN  707
             DLDEAII    RRIMVGLP+ + RE+I+K LL+KE V + LD K+LATMTEGY+GSDLKN
Sbjct  717   DLDEAII----RRIMVGLPSVQNREMIMKRLLSKEKVDEGLDYKELATMTEGYSGSDLKN  772

Query  706   LCTTAAYRPVRELIKQERLKDV-------EKKRLAQECPNCGDAPTANEDKGERVITIRP  548
             LCTTAAYRPVRELI++ER K++       EKK+L  E       P+  ++K + VI +RP
Sbjct  773   LCTTAAYRPVRELIQKERKKELLTLKYLQEKKKL--EKGGTPLDPSKMKEKDKEVI-LRP  829

Query  547   LNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             LNM D  EAK QVAASFAAEGSIM ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  830   LNMADLKEAKTQVAASFAAEGSIMGELKQWNDLYGEGGSRKKEQLTYFL  878



>gb|EYU19606.1| hypothetical protein MIMGU_mgv1a001750mg [Erythranthe guttata]
Length=765

 Score =  1000 bits (2586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 516/820 (63%), Positives = 612/820 (75%), Gaps = 86/820 (10%)
 Frame = -1

Query  2842  TVSKWTGSSSNA-----VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAA  2678
             T+ +WTG++++A     V+ D ++ E+L  + D   +K TF++FPYYLSE+TRVLLTSAA
Sbjct  26    TLGRWTGAATSAGVAGGVSADELQLELLRLVADANKNKATFEDFPYYLSERTRVLLTSAA  85

Query  2677  FVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKV  2498
             +VHLK  D +KHTRNLSPASR ILLSGP ELYQQMLAKALAH+F AKLL+LDV DFS K+
Sbjct  86    YVHLKHLDVSKHTRNLSPASRAILLSGPGELYQQMLAKALAHHFEAKLLILDVADFSFKM  145

Query  2497  QSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIE  2318
             QSKYG S+ +SS +RS+SE TL RMS FLGS SIL  +E  K            PSK   
Sbjct  146   QSKYGGSKKDSSVERSVSEVTLERMSSFLGSLSILPSQENTKA-----------PSK---  191

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
                                               R SS SFDEK+ I+++Y+VLV +S+T
Sbjct  192   ----------------------------------RFSSWSFDEKIFIESVYRVLVSISQT  217

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
               I+LY+RD ++L   S ++Y L  KML++LSG VLILGSR+++  +D   L+ R++ +F
Sbjct  218   GSIILYIRDVDRLFLHSTRLYKLFDKMLKKLSGPVLILGSRVLELAEDSGGLNNRIALLF  277

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PY++EI+PPE+ETHL+SW++QLEED+K +Q+QDNKN I EVLAANDIECDDLG IC ADT
Sbjct  278   PYSVEIRPPEDETHLLSWRAQLEEDLKRIQFQDNKNRIAEVLAANDIECDDLGLICHADT  337

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             + L +YIEE+VVSAIS+HLMN  D EYRN KLVIS+ SLSHG++ F+E K+  GKD LK 
Sbjct  338   LVLCSYIEEIVVSAISFHLMNNNDLEYRNGKLVISANSLSHGLSAFQEGKSG-GKDTLK-  395

Query  1597  ESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
                     +T+  E     PE+  E+      K ET                  +  K P
Sbjct  396   --------DTEGRENAGLKPESNTEN------KSET-------------EKLISSISKPP  428

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             E  PDNEFEKRIRPEVIP  EIGVTF+DIGALDEIKESL ELVMLPLRRPDLF GGLLKP
Sbjct  429   EPTPDNEFEKRIRPEVIPPNEIGVTFSDIGALDEIKESLQELVMLPLRRPDLFTGGLLKP  488

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  489   CRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  548

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD
Sbjct  549   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  608

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMV LP+ E RE ILKTLL+KE   + LD K+LA +TEGY+GSDLKNLC 
Sbjct  609   EAIIRRFERRIMVDLPSVENRETILKTLLSKEK-AEDLDFKELAAITEGYSGSDLKNLCI  667

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANED-KGERVITIRPLNMDDFMEA  521
             TAAYRPVREL++QER +D ++K+   E     D+    E+ K E VIT+RPLNM+D  +A
Sbjct  668   TAAYRPVRELMQQERERDKKEKKQKDESSE--DSSVLKEEAKEETVITLRPLNMEDMRQA  725

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KNQVAASFA+EGSIM ELKQWN+LYGEGG+RKK+QL+YFL
Sbjct  726   KNQVAASFASEGSIMGELKQWNDLYGEGGTRKKQQLSYFL  765



>ref|XP_008792388.1| PREDICTED: protein SAP1-like isoform X3 [Phoenix dactylifera]
Length=707

 Score =   998 bits (2581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 511/726 (70%), Positives = 596/726 (82%), Gaps = 20/726 (3%)
 Frame = -1

Query  2575  MLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSI  2396
             MLAKALAHYF AKLLLLDVTDFSLK+QSKYGSS  +S F+RS+SE TL R+S  LGS SI
Sbjct  1     MLAKALAHYFEAKLLLLDVTDFSLKIQSKYGSSNKDSFFRRSVSEATLERISSLLGSVSI  60

Query  2395  LQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLM  2216
             L  +EE KG+LRRQSS +++  +  + +S+   LR+N+S SA+MN LTS     NP PL 
Sbjct  61    LLQREEPKGSLRRQSSSLELRPRASDSNSSMPGLRKNASVSADMNGLTSQCAPVNPAPLK  120

Query  2215  RTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGS  2036
             RTSS SF +K+L+Q+LYKVL  VSK+ PIVLY+RD E L+ RS+++Y L QKML+ LSG 
Sbjct  121   RTSSWSFGDKVLLQSLYKVLASVSKSNPIVLYVRDVENLVYRSQRIYSLFQKMLKNLSGP  180

Query  2035  VLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDN  1856
             VLILGSR+++   DYR++D R++S+FPYNIEIKPPE+ETHLVSWKSQLEEDMKM+Q QDN
Sbjct  181   VLILGSRLLESDSDYRDVDGRVNSLFPYNIEIKPPEDETHLVSWKSQLEEDMKMIQIQDN  240

Query  1855  KNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVI  1676
             +NHI EVLAAND+ CDDLG IC+ADTM LSNYIEE+VVSA+SYHLMN K+PEYRN KLVI
Sbjct  241   RNHITEVLAANDLACDDLGCICLADTMVLSNYIEEIVVSAVSYHLMNNKEPEYRNGKLVI  300

Query  1675  SSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKP  1496
             SSKSLSHG++IF+E + + G+D +KLE+  E  KE  + E G+     +     APG K 
Sbjct  301   SSKSLSHGLSIFQESRLS-GEDTIKLEANVESGKEAVN-EDGAAA-AVEKAEKMAPGVKD  357

Query  1495  ETGsaapapapttkdatsSGTAVKAP-EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALD  1319
               GS                   KAP EV PDNEFEKRIRPEVIPA EIGVTF DIGALD
Sbjct  358   SEGS---------------SLPPKAPQEVSPDNEFEKRIRPEVIPANEIGVTFNDIGALD  402

Query  1318  EIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVS  1139
             EIKESL ELVMLPLRRPDLF GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVS
Sbjct  403   EIKESLQELVMLPLRRPDLFNGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVS  462

Query  1138  MSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM  959
             MSTITSKWFGEDEKNVRALFTLAAKV+P IIFVDEVDSMLGQR+R GEHEAMRKIKNEFM
Sbjct  463   MSTITSKWFGEDEKNVRALFTLAAKVAPAIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFM  522

Query  958   SHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKET  779
             +HWDGLLTK GERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RELI++ LL+KE 
Sbjct  523   THWDGLLTKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESRELIVRKLLSKEK  582

Query  778   VGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGD  599
             V + LD K+LATMTEGY+GSDLKNLC TAAYRPVRELI++ERLK++EK++ A+E  +  +
Sbjct  583   VEEGLDYKELATMTEGYSGSDLKNLCVTAAYRPVRELIQRERLKELEKQK-AEEVESSAE  641

Query  598   APTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKE  419
                  E+ GE+ IT+RPLNM+D  +AKNQVAASFAAEGS+M+ELKQWN+L+GEGGSRKK+
Sbjct  642   RSENREEDGEQAITLRPLNMEDLRQAKNQVAASFAAEGSVMSELKQWNDLHGEGGSRKKQ  701

Query  418   QLTYFL  401
             QL+YFL
Sbjct  702   QLSYFL  707



>ref|XP_009409440.1| PREDICTED: spastin isoform X2 [Musa acuminata subsp. malaccensis]
Length=720

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 519/728 (71%), Positives = 595/728 (82%), Gaps = 11/728 (2%)
 Frame = -1

Query  2575  MLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSI  2396
             MLAKALAHYF AKLLLLD+TDFSLK+QSKYGS+  +S+FKRSISETTL RMS   GS SI
Sbjct  1     MLAKALAHYFEAKLLLLDITDFSLKIQSKYGSAPKDSTFKRSISETTLERMSGLFGSLSI  60

Query  2395  LQPKEEKKGT--LRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGP  2222
             +  +EE K T  L RQSSG +I ++  E +SN   LRRN+SASA+M+ L +     NP  
Sbjct  61    MPQREEPKVTRNLHRQSSGFEINARS-ESTSNAPKLRRNASASADMSCLGTQCPPLNPAL  119

Query  2221  LMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLS  2042
             L RT S SFDEKLL+Q+LYKVL  +SK  PIVLYLRD + LL  S+++Y L +K+L+R+S
Sbjct  120   LKRTISWSFDEKLLVQSLYKVLHSISKNSPIVLYLRDVDSLLFISKRMYSLFEKLLKRIS  179

Query  2041  GSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQ  1862
             G VLILGSR V+ G D+RE+DE+LS +FPYNIEIKPPE+ETHLVSWK+QLEEDMKM+Q+Q
Sbjct  180   GQVLILGSRKVEAGSDFREVDEKLSLLFPYNIEIKPPEDETHLVSWKAQLEEDMKMIQFQ  239

Query  1861  DNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKL  1682
             DN+NHI EVLA ND++CDDLGSIC+ DTM LS YIEE+VVSAISYHLMN  DPEYRN KL
Sbjct  240   DNRNHITEVLARNDLDCDDLGSICLTDTMVLSKYIEEIVVSAISYHLMNNTDPEYRNGKL  299

Query  1681  VISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKET-QSGEKGSKGPETKAESSTAPG  1505
             VISSKSLSH ++IF+E K  A K   +LE  A+  KE+ +     +K  ETK E+S  P 
Sbjct  300   VISSKSLSHALSIFQENKLNA-KGTAQLEGSADSMKESGKEDSTSAKKSETKTEAS-PPE  357

Query  1504  SKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGA  1325
             SK E   + P     +          KAPEV PDNEFEKRIRPEVIPA EIGVTF DIGA
Sbjct  358   SKTELDKSVPVVKKDSVVP---SQPPKAPEVAPDNEFEKRIRPEVIPASEIGVTFDDIGA  414

Query  1324  LDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFIN  1145
             LD+IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFIN
Sbjct  415   LDDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFIN  474

Query  1144  VSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNE  965
             VSMSTITSKWFGEDEKNVRALFTLAAKVSPTI+FVDEVDSMLGQRSR GEHEAMRKIKNE
Sbjct  475   VSMSTITSKWFGEDEKNVRALFTLAAKVSPTIVFVDEVDSMLGQRSRVGEHEAMRKIKNE  534

Query  964   FMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAK  785
             FM+HWDGLLTKP ERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RELIL+TLL+K
Sbjct  535   FMTHWDGLLTKPEERILVLAATNRPFDLDEAIIRRFERRIMVGLPSQESRELILRTLLSK  594

Query  784   ETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNC  605
             E V + LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI++ERLK++E+K+ A++  N 
Sbjct  595   EKVEEKLDFKELATMTEGYSGSDLKNLCTTAAYRPVRELIQKERLKELERKKKAED--NQ  652

Query  604   GDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRK  425
              +A     +  E  I +RPLNM+D  +AKNQVAASFAAEGSIM+ELKQWN LYG+GGSRK
Sbjct  653   AEASETKAEDREETIVLRPLNMEDMKQAKNQVAASFAAEGSIMSELKQWNELYGDGGSRK  712

Query  424   KEQLTYFL  401
             K+QLTYFL
Sbjct  713   KQQLTYFL  720



>ref|XP_004160357.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101224244 
[Cucumis sativus]
Length=884

 Score =   997 bits (2578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/743 (69%), Positives = 589/743 (79%), Gaps = 24/743 (3%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G   SS+ +T   +EQE++  ++DG++S VTF EFPYYLSE+TRVLL SAA+V
Sbjct  27    QAVGKWVGGNGSSDEITGQNIEQELIRQLLDGKNSNVTFAEFPYYLSERTRVLLMSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +KHTRNLSPASR ILLSGP ELYQQMLAKALAH+F +KLLLLDV+DFSLK+QS
Sbjct  87    HLKHCDISKHTRNLSPASRAILLSGPTELYQQMLAKALAHHFESKLLLLDVSDFSLKMQS  146

Query  2491  KYGSSRNESS----FKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKG  2324
             KYG  + +S      +RSISE TL RMS   GSFSIL      +G LRRQSS  DI S+ 
Sbjct  147   KYGCPKKDSVSSNFHQRSISEVTLERMSSVWGSFSILPTSGNTRGNLRRQSSTTDIQSRC  206

Query  2323  IEGSSN-PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKV  2147
              + SSN P   R  S+AS   +  ++Y +T N     RT++  FDEKL +Q+LYKVLV V
Sbjct  207   SDSSSNLPKLRRNASAASDISSISSNYGST-NSASAKRTNTWCFDEKLFLQSLYKVLVSV  265

Query  2146  SKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLS  1967
             S+T  I+LYLRD E+LL +S+++Y L  + L +LSGS+L+LGSR+VD  +D  ++D+RL+
Sbjct  266   SETTSIILYLRDVERLLLKSQRIYNLFHRFLNKLSGSILVLGSRMVDVENDCGDVDDRLT  325

Query  1966  SVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICM  1787
             ++F Y++EI+PPE+E HLVSWK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC 
Sbjct  326   NLFRYSVEIRPPEDENHLVSWKAQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICH  385

Query  1786  ADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDI  1607
             ADTM LSNYIEE+VVSAISYHLMN +DPEYRN KL+ISSKSLSHG+ IF +E  + GKD 
Sbjct  386   ADTMVLSNYIEEIVVSAISYHLMNNRDPEYRNGKLLISSKSLSHGLGIF-QEGNSEGKDT  444

Query  1606  LKLESKAELSKETQSGEKGSKGPETKAES-STAPGSKPETGsaapapapttkdatsSGTA  1430
             LKLE+ AE SK      K +       +S S    S  E       P             
Sbjct  445   LKLETNAESSKVXFIFRKFASKSTCHCKSLSIEICSHSEKDVENVPPQ------------  492

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPE+PPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLFKGG
Sbjct  493   -KAPEIPPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFKGG  551

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  552   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  611

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLT+  ERILVLAATNRP
Sbjct  612   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTRNDERILVLAATNRP  671

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RELIL+TLL+KE   + LD K+LATMTEGY+GSDLK
Sbjct  672   FDLDEAIIRRFERRIMVGLPSVESRELILRTLLSKEK-AEDLDFKELATMTEGYSGSDLK  730

Query  709   NLCTTAAYRPVRELIKQERLKDV  641
             NLC TAAYRPVREL++QERLKD+
Sbjct  731   NLCVTAAYRPVRELLQQERLKDL  753


 Score =   101 bits (252),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/64 (70%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = -1

Query  592  TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQL  413
            T   ++ ++ I +R LNMDD  +AKNQVAASFA+EGS+MNELKQWN+LYGEGGSRKK+QL
Sbjct  821  TKETEQDKQAIILRHLNMDDMRQAKNQVAASFASEGSVMNELKQWNDLYGEGGSRKKQQL  880

Query  412  TYFL  401
            TYFL
Sbjct  881  TYFL  884



>ref|XP_008655280.1| PREDICTED: uncharacterized protein LOC100383493 isoform X1 [Zea 
mays]
 ref|XP_008656077.1| PREDICTED: peroxisome biosynthesis protein PAS1-like isoform 
X1 [Zea mays]
 gb|AFW81261.1| hypothetical protein ZEAMMB73_521633 [Zea mays]
 gb|AFW81264.1| hypothetical protein ZEAMMB73_340386 [Zea mays]
Length=843

 Score =   992 bits (2564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/835 (61%), Positives = 628/835 (75%), Gaps = 74/835 (9%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   ++DG +S VTFDEFPYYLS+QTR +L SAAFVHLK+A+  KH RNLS AS  
Sbjct  45    LEAELRRLVLDGPESDVTFDEFPYYLSDQTREVLISAAFVHLKNAELLKHVRNLSAASHA  104

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGP E Y Q LAKAL+HYF A+LL+LD TDFSL++QSKYG S   ++  +S++ETT 
Sbjct  105   ILLSGPTEAYLQSLAKALSHYFKARLLILDATDFSLRIQSKYGGSTKATARNQSVAETTF  164

Query  2431  NRMSEFLGSFSILQPKEEK--KGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnn  2258
              RMS+ +GSF +  PK++   + +LRRQ+S  D+ ++G +GSS+  +L++N+S S++M++
Sbjct  165   GRMSDLIGSF-MAYPKKDGPIEKSLRRQTSSTDLRTRGSDGSSSTPSLKKNASVSSDMSD  223

Query  2257  ltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKV  2078
             L S  + +   P+ RT S  FDEK+LIQ+LYKV+V VS+  PI+LY+RD +  L +S+++
Sbjct  224   LASQGSGN---PVRRTGSWCFDEKVLIQSLYKVMVSVSENGPIILYIRDVDHFLWKSQRI  280

Query  2077  YILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKS  1898
             + + QKML +LSG VLILGSR+++P  D R+ DER+S++FPY+++IK PEEETHL  WKS
Sbjct  281   HSMFQKMLAKLSGQVLILGSRLLNPDADNRDADERISTLFPYHVDIKAPEEETHLDCWKS  340

Query  1897  QLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLM  1718
             Q+EED + +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYHL+
Sbjct  341   QIEEDKRKIQMQDNRNHIIEVLSANDLDCDDLSSICEADTMVLSNYIEEIIVSAVSYHLI  400

Query  1717  NTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGP  1538
             + KDPEYRN KL++SSKSLSHG++IF  + +  GKD LKLE       ET+ G KG+ G 
Sbjct  401   HNKDPEYRNGKLMLSSKSLSHGLSIF--QGSHGGKDTLKLE-------ETKDGLKGALGS  451

Query  1537  ETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAK  1358
             +         G  P                      +  PEVP DNEFEKRIRPEVIPA 
Sbjct  452   KKTETLPVGEGPVP----------------------LPKPEVP-DNEFEKRIRPEVIPAS  488

Query  1357  EIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKA  1178
             EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKA
Sbjct  489   EIGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKA  548

Query  1177  IAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAG  998
             IA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R G
Sbjct  549   IANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARYG  608

Query  997   EHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQ  818
             EHEAMRKIKNEFMSHWDGLL+K GE+ILVLAATNRPFDLDEAIIRRFERRIMVGLPT E 
Sbjct  609   EHEAMRKIKNEFMSHWDGLLSKTGEKILVLAATNRPFDLDEAIIRRFERRIMVGLPTTES  668

Query  817   RELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK--------  662
             RELIL+TLL+KE V + +D K+LA MTEGY+GSDLKNLC TAAYRPVREL+K        
Sbjct  669   RELILRTLLSKEKVDEDIDFKELAAMTEGYSGSDLKNLCVTAAYRPVRELLKIERERELE  728

Query  661   -------------------------QERLKDVEKKRLAQECPNCGDAPTANEDKGER---  566
                                          K+  K   + E    GD    ++ +GE+   
Sbjct  729   RREKESKDKAAAAENSEAPESEKKESSETKEARKSTQSPEGGGKGDEGPDSKAEGEKEAA  788

Query  565   VITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             V+ +RPL M+D  +AKNQVAASFAAEG++MNEL+QWN+LYGEGGSRKK+QLTYFL
Sbjct  789   VVDLRPLTMEDLRQAKNQVAASFAAEGAVMNELRQWNDLYGEGGSRKKQQLTYFL  843



>ref|XP_006842930.1| hypothetical protein AMTR_s00075p00158590 [Amborella trichopoda]
 gb|ERN04605.1| hypothetical protein AMTR_s00075p00158590 [Amborella trichopoda]
Length=759

 Score =   989 bits (2558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 520/738 (70%), Positives = 595/738 (81%), Gaps = 21/738 (3%)
 Frame = -1

Query  2701  RVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLD  2522
             RV+LTSAA+VHLK AD +KH RNLSPASR ILLSGPAELYQQMLAKALAHYF +KLLLLD
Sbjct  8     RVILTSAAYVHLKQADLSKHIRNLSPASRAILLSGPAELYQQMLAKALAHYFESKLLLLD  67

Query  2521  VTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSS  2348
             VTDFSLK+QSKYGS  + SSFKRSISETTL RMS  LGSFSIL  +EE K  GTLRR SS
Sbjct  68    VTDFSLKMQSKYGSG-SVSSFKRSISETTLERMSSLLGSFSILPQREEPKAAGTLRRISS  126

Query  2347  GVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQAL  2168
             G ++  + +E  +    +RRNSSA+AN+++L      +NP PL RT+S +FDEKLLIQ+L
Sbjct  127   GSEMQLRALEAVNTAPKIRRNSSAAANISSLAYQRFPANPAPLKRTTSWAFDEKLLIQSL  186

Query  2167  YKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYR  1988
             YKV+V VS++ PIVLY+RD E+LL RS+++Y L QKML++LSG VLILGSR++D   DY 
Sbjct  187   YKVIVYVSRSTPIVLYIRDVERLLFRSQRIYTLFQKMLKKLSGPVLILGSRMLDSETDYN  246

Query  1987  ELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECD  1808
             E+DE LS +FPYNIEIKPPE+ETHLVSWK+QLEEDMKM+Q QDN+NHI EVLAANDI+CD
Sbjct  247   EVDEELSLLFPYNIEIKPPEDETHLVSWKTQLEEDMKMIQVQDNRNHITEVLAANDIDCD  306

Query  1807  DLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEK  1628
             DLGSIC+ADT++LS YIEE+VVSA+SYHLMN KDPEYRN +LVISSKSLS G++IF+E K
Sbjct  307   DLGSICLADTISLSRYIEEIVVSAVSYHLMNNKDPEYRNGRLVISSKSLSCGLSIFQEAK  366

Query  1627  TAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkda  1448
                GKD LKLE+  + SKE Q          T AES     +KPETG + P         
Sbjct  367   LD-GKDTLKLEANPDASKERQE-------EVTTAESK----NKPETGKSIPVEKKEGGSM  414

Query  1447  tsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRP  1268
                 T  KAPE+ PD EFEKRIRPEVIPA EIGV+FADIGAL EIKESL ELVMLPLRRP
Sbjct  415   P---TPSKAPEIAPDTEFEKRIRPEVIPASEIGVSFADIGALGEIKESLQELVMLPLRRP  471

Query  1267  DLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
             DLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVR
Sbjct  472   DLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVR  531

Query  1087  ALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVL  908
             ALFTLA KVS TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM+HWDGLLTKPGERILVL
Sbjct  532   ALFTLAGKVSLTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMTHWDGLLTKPGERILVL  591

Query  907   AATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGY  728
             AATNRPFDLDEAIIRRFERRIMVGLP+ E RELIL+TLL++E V + LD K+LA+MTEGY
Sbjct  592   AATNRPFDLDEAIIRRFERRIMVGLPSAENRELILRTLLSREKVEEGLDYKELASMTEGY  651

Query  727   TGSDLKNLCTTAAYRPVRELIKQ---ERLKDVEKKRLAQECPNCGDAPTANEDKGERVIT  557
             +GSDLKNLCT A+YRPVREL+++   +      K +  ++ P            GE  IT
Sbjct  652   SGSDLKNLCTIASYRPVRELLQREREKEKDKKNKIKEGEKSPLKYSKIVEGHRNGEPEIT  711

Query  556   IRPLNMDDFMEAKNQVAA  503
             +RPLNM+D  +AKNQ  A
Sbjct  712   LRPLNMEDMRQAKNQAHA  729



>ref|NP_001056452.1| Os05g0584600 [Oryza sativa Japonica Group]
 gb|AAT47060.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18366.1| Os05g0584600 [Oryza sativa Japonica Group]
Length=855

 Score =   989 bits (2556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/840 (61%), Positives = 630/840 (75%), Gaps = 72/840 (9%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDGR+  VTFDEF YYLSE+T+ +L SAAFVHLK AD +KH RNL  ASR 
Sbjct  45    LEAELRRLVVDGREGDVTFDEFRYYLSERTKEVLISAAFVHLKQADLSKHIRNLCAASRA  104

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGP E Y Q LA+AL+HY+ A+LL+LDVTDFSL++QSKYGSS    +  +SISETT 
Sbjct  105   ILLSGPTEPYLQSLARALSHYYKAQLLILDVTDFSLRIQSKYGSSSKGLAQSQSISETTF  164

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
              RMS+ +GSF+I     E + +L+RQ+S  D+ S+G E SSN   LR+N+S S+++++++
Sbjct  165   GRMSDLIGSFTIFPKSAEPRESLQRQTSSADVRSRGSEASSNAPPLRKNASMSSDISDVS  224

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
             S   +++     RTSS  FDEK+LIQ+LYKV+V V++  P++LY+RD ++LL RS++ Y 
Sbjct  225   S-QCSAHSVSARRTSSWCFDEKVLIQSLYKVMVSVAENNPVILYIRDVDQLLHRSQRTYS  283

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             L QKML +L+G VLILGSR++D   D+ ++DER+SS+FP++++IKPPEEETHL SWK+Q+
Sbjct  284   LFQKMLAKLTGQVLILGSRLLDSDSDHTDVDERVSSLFPFHVDIKPPEEETHLDSWKTQM  343

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNT  1712
             EED K +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYH+++ 
Sbjct  344   EEDTKKIQIQDNRNHIIEVLSANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSYHMIHN  403

Query  1711  KDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPET  1532
             KDPEY+N KLV+SSKSLSHG++IF +E    GK+ LKLE   +       G  G K  ET
Sbjct  404   KDPEYKNGKLVLSSKSLSHGLSIF-QESGFGGKETLKLEDDLK-------GATGPKKSET  455

Query  1531  KAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEI  1352
             + +S+T P                       G         PDNEFEKRIRPEVIPA EI
Sbjct  456   E-KSATVP------------------LKDGDGPLPPPKPEIPDNEFEKRIRPEVIPASEI  496

Query  1351  GVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  1172
             GVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA
Sbjct  497   GVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  556

Query  1171  KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEH  992
              +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEH
Sbjct  557   NDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARCGEH  616

Query  991   EAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRE  812
             EAMRKIKNEFMSHWDGLL+K GERILVLAATNRPFDLDEAIIRRFERRIMVGLPT + RE
Sbjct  617   EAMRKIKNEFMSHWDGLLSKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTLDSRE  676

Query  811   LILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV---  641
             LIL+TLL+KE V + +D K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+ER K++   
Sbjct  677   LILRTLLSKEKVAEDIDYKELATMTEGYSGSDLKNLCVTAAYRPVRELLKREREKEMERR  736

Query  640   --EKKRLAQECPNCGDAPTANEDK------------------------------------  575
               E K  A    N  ++P + ++K                                    
Sbjct  737   ANEAKEKAATAEN-SESPESKKEKENSENPESKEKEKERKENSENKEEKTENKQDNSKAE  795

Query  574   --GERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
                E  I +RPL M+D  +AKNQVAASFA EG++MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  796   GGTEGTIDLRPLTMEDLRQAKNQVAASFATEGAVMNELKQWNDLYGEGGSRKKQQLTYFL  855



>ref|XP_008656078.1| PREDICTED: peroxisome biosynthesis protein PAS1-like isoform 
X2 [Zea mays]
Length=838

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/835 (60%), Positives = 621/835 (74%), Gaps = 79/835 (9%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   ++DG +S VTFDEFPYYLS+QTR +L SAAFVHLK+A+  KH RNLS AS  
Sbjct  45    LEAELRRLVLDGPESDVTFDEFPYYLSDQTREVLISAAFVHLKNAELLKHVRNLSAASHA  104

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGP E Y Q LAKAL+HYF A+LL+LD TDFSL++QSKYG S   ++  +S++ETT 
Sbjct  105   ILLSGPTEAYLQSLAKALSHYFKARLLILDATDFSLRIQSKYGGSTKATARNQSVAETTF  164

Query  2431  NRMSEFLGSFSILQPKEEK--KGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnn  2258
              RMS+ +GSF +  PK++   + +LRRQ+S  D+ ++G +GSS+  +L++N+S S+    
Sbjct  165   GRMSDLIGSF-MAYPKKDGPIEKSLRRQTSSTDLRTRGSDGSSSTPSLKKNASVSS----  219

Query  2257  ltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKV  2078
                 + +     + RT S  FDEK+LIQ+LYKV+V VS+  PI+LY+RD +  L +S+++
Sbjct  220   ----DMSDLASQVRRTGSWCFDEKVLIQSLYKVMVSVSENGPIILYIRDVDHFLWKSQRI  275

Query  2077  YILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKS  1898
             + + QKML +LSG VLILGSR+++P  D R+ DER+S++FPY+++IK PEEETHL  WKS
Sbjct  276   HSMFQKMLAKLSGQVLILGSRLLNPDADNRDADERISTLFPYHVDIKAPEEETHLDCWKS  335

Query  1897  QLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLM  1718
             Q+EED + +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYHL+
Sbjct  336   QIEEDKRKIQMQDNRNHIIEVLSANDLDCDDLSSICEADTMVLSNYIEEIIVSAVSYHLI  395

Query  1717  NTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGP  1538
             + KDPEYRN KL++SSKSLSHG++IF  + +  GKD LKLE       ET+ G KG+ G 
Sbjct  396   HNKDPEYRNGKLMLSSKSLSHGLSIF--QGSHGGKDTLKLE-------ETKDGLKGALGS  446

Query  1537  ETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAK  1358
             +         G  P                      +  PEVP DNEFEKRIRPEVIPA 
Sbjct  447   KKTETLPVGEGPVP----------------------LPKPEVP-DNEFEKRIRPEVIPAS  483

Query  1357  EIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKA  1178
             EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKA
Sbjct  484   EIGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKA  543

Query  1177  IAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAG  998
             IA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R G
Sbjct  544   IANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARYG  603

Query  997   EHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQ  818
             EHEAMRKIKNEFMSHWDGLL+K GE+ILVLAATNRPFDLDEAIIRRFERRIMVGLPT E 
Sbjct  604   EHEAMRKIKNEFMSHWDGLLSKTGEKILVLAATNRPFDLDEAIIRRFERRIMVGLPTTES  663

Query  817   RELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK--------  662
             RELIL+TLL+KE V + +D K+LA MTEGY+GSDLKNLC TAAYRPVREL+K        
Sbjct  664   RELILRTLLSKEKVDEDIDFKELAAMTEGYSGSDLKNLCVTAAYRPVRELLKIERERELE  723

Query  661   -------------------------QERLKDVEKKRLAQECPNCGDAPTANEDKGER---  566
                                          K+  K   + E    GD    ++ +GE+   
Sbjct  724   RREKESKDKAAAAENSEAPESEKKESSETKEARKSTQSPEGGGKGDEGPDSKAEGEKEAA  783

Query  565   VITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             V+ +RPL M+D  +AKNQVAASFAAEG++MNEL+QWN+LYGEGGSRKK+QLTYFL
Sbjct  784   VVDLRPLTMEDLRQAKNQVAASFAAEGAVMNELRQWNDLYGEGGSRKKQQLTYFL  838



>gb|EEE64846.1| hypothetical protein OsJ_19703 [Oryza sativa Japonica Group]
Length=855

 Score =   988 bits (2555),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 514/840 (61%), Positives = 630/840 (75%), Gaps = 72/840 (9%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDGR+  VTFDEF YYLSE+T+ +L SAAFVHLK AD +KH RNL  ASR 
Sbjct  45    LEAELRRLVVDGREGDVTFDEFRYYLSERTKEVLISAAFVHLKQADLSKHIRNLCAASRA  104

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGP E Y Q LA+AL+HY+ A+LL+LDVTDFSL++QSKYGSS    +  +SISETT 
Sbjct  105   ILLSGPTEPYLQSLARALSHYYKAQLLILDVTDFSLRIQSKYGSSSKGLAQSQSISETTF  164

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
              RMS+ +GSF+I     E + +L+RQ+S  D+ S+G E SSN   LR+N+S S+++++++
Sbjct  165   GRMSDLIGSFTIFPKSAEPRESLQRQTSSADVRSRGSEASSNAPPLRKNASMSSDISDVS  224

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
             S   +++     RTSS  FDEK+LIQ+LYKV+V V++  P++LY+RD ++LL RS++ Y 
Sbjct  225   S-QCSAHSVSARRTSSWCFDEKVLIQSLYKVMVSVAENNPVILYIRDVDQLLHRSQRTYS  283

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             L QKML +L+G VLILGSR++D   D+ ++DER+SS+FP++++IKPPEEETHL SWK+Q+
Sbjct  284   LFQKMLAKLTGQVLILGSRLLDSDSDHTDVDERVSSLFPFHVDIKPPEEETHLDSWKTQM  343

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNT  1712
             EED K +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYH+++ 
Sbjct  344   EEDTKKIQIQDNRNHIIEVLSANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSYHMIHN  403

Query  1711  KDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPET  1532
             KDPEY+N KLV+SSKSLSHG++IF +E    GK+ LKLE   +       G  G K  ET
Sbjct  404   KDPEYKNGKLVLSSKSLSHGLSIF-QESGFGGKETLKLEDDLK-------GATGPKKSET  455

Query  1531  KAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEI  1352
             + +S+T P                       G         PDNEFEKRIRPEVIPA EI
Sbjct  456   E-KSATVP------------------LKDGDGPLPPPKPEIPDNEFEKRIRPEVIPASEI  496

Query  1351  GVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  1172
             GVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA
Sbjct  497   GVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  556

Query  1171  KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEH  992
              +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEH
Sbjct  557   NDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARCGEH  616

Query  991   EAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRE  812
             EAMRKIKNEFMSHWDGLL+K GERILVLAATNRPFDLDEAIIRRFERRIMVGLPT + RE
Sbjct  617   EAMRKIKNEFMSHWDGLLSKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTLDSRE  676

Query  811   LILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV---  641
             LIL+TLL+KE V + +D K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+ER K++   
Sbjct  677   LILRTLLSKEKVAEDIDYKELATMTEGYSGSDLKNLCVTAAYRPVRELLKREREKEMERR  736

Query  640   --EKKRLAQECPNCGDAPTANEDK------------------------------------  575
               E K  A    N  ++P + ++K                                    
Sbjct  737   ANEAKEKAATAENS-ESPESKKEKENSENPESKEKEKERKENSENKEEKTGNKQDNSKAE  795

Query  574   --GERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
                E  I +RPL M+D  +AKNQVAASFA EG++MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  796   GGTEGTIDLRPLTMEDLRQAKNQVAASFATEGAVMNELKQWNDLYGEGGSRKKQQLTYFL  855



>ref|NP_001169612.1| uncharacterized protein LOC100383493 [Zea mays]
 gb|ACN34266.1| unknown [Zea mays]
 gb|AFW81262.1| hypothetical protein ZEAMMB73_521633 [Zea mays]
 gb|AFW81263.1| hypothetical protein ZEAMMB73_340386 [Zea mays]
Length=849

 Score =   985 bits (2546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/841 (61%), Positives = 628/841 (75%), Gaps = 80/841 (10%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLS------EQTRVLLTSAAFVHLKSADFAKHTRNL  2630
             +E E+   ++DG +S VTFDEFPYYLS      +QTR +L SAAFVHLK+A+  KH RNL
Sbjct  45    LEAELRRLVLDGPESDVTFDEFPYYLSGVIACSDQTREVLISAAFVHLKNAELLKHVRNL  104

Query  2629  SPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRS  2450
             S AS  ILLSGP E Y Q LAKAL+HYF A+LL+LD TDFSL++QSKYG S   ++  +S
Sbjct  105   SAASHAILLSGPTEAYLQSLAKALSHYFKARLLILDATDFSLRIQSKYGGSTKATARNQS  164

Query  2449  ISETTLNRMSEFLGSFSILQPKEEK--KGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssa  2276
             ++ETT  RMS+ +GSF +  PK++   + +LRRQ+S  D+ ++G +GSS+  +L++N+S 
Sbjct  165   VAETTFGRMSDLIGSF-MAYPKKDGPIEKSLRRQTSSTDLRTRGSDGSSSTPSLKKNASV  223

Query  2275  sanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLL  2096
             S++M++L S  + +   P+ RT S  FDEK+LIQ+LYKV+V VS+  PI+LY+RD +  L
Sbjct  224   SSDMSDLASQGSGN---PVRRTGSWCFDEKVLIQSLYKVMVSVSENGPIILYIRDVDHFL  280

Query  2095  CRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETH  1916
              +S++++ + QKML +LSG VLILGSR+++P  D R+ DER+S++FPY+++IK PEEETH
Sbjct  281   WKSQRIHSMFQKMLAKLSGQVLILGSRLLNPDADNRDADERISTLFPYHVDIKAPEEETH  340

Query  1915  LVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSA  1736
             L  WKSQ+EED + +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA
Sbjct  341   LDCWKSQIEEDKRKIQMQDNRNHIIEVLSANDLDCDDLSSICEADTMVLSNYIEEIIVSA  400

Query  1735  ISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGE  1556
             +SYHL++ KDPEYRN KL++SSKSLSHG++IF  + +  GKD LKLE       ET+ G 
Sbjct  401   VSYHLIHNKDPEYRNGKLMLSSKSLSHGLSIF--QGSHGGKDTLKLE-------ETKDGL  451

Query  1555  KGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRP  1376
             KG+ G +         G  P                      +  PEVP DNEFEKRIRP
Sbjct  452   KGALGSKKTETLPVGEGPVP----------------------LPKPEVP-DNEFEKRIRP  488

Query  1375  EVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK  1196
             EVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK
Sbjct  489   EVIPASEIGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK  548

Query  1195  TMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLG  1016
             TMLAKAIA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLG
Sbjct  549   TMLAKAIANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLG  608

Query  1015  QRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVG  836
             QR+R GEHEAMRKIKNEFMSHWDGLL+K GE+ILVLAATNRPFDLDEAIIRRFERRIMVG
Sbjct  609   QRARYGEHEAMRKIKNEFMSHWDGLLSKTGEKILVLAATNRPFDLDEAIIRRFERRIMVG  668

Query  835   LPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK--  662
             LPT E RELIL+TLL+KE V + +D K+LA MTEGY+GSDLKNLC TAAYRPVREL+K  
Sbjct  669   LPTTESRELILRTLLSKEKVDEDIDFKELAAMTEGYSGSDLKNLCVTAAYRPVRELLKIE  728

Query  661   -------------------------------QERLKDVEKKRLAQECPNCGDAPTANEDK  575
                                                K+  K   + E    GD    ++ +
Sbjct  729   RERELERREKESKDKAAAAENSEAPESEKKESSETKEARKSTQSPEGGGKGDEGPDSKAE  788

Query  574   GER---VITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYF  404
             GE+   V+ +RPL M+D  +AKNQVAASFAAEG++MNEL+QWN+LYGEGGSRKK+QLTYF
Sbjct  789   GEKEAAVVDLRPLTMEDLRQAKNQVAASFAAEGAVMNELRQWNDLYGEGGSRKKQQLTYF  848

Query  403   L  401
             L
Sbjct  849   L  849



>gb|EAY99206.1| hypothetical protein OsI_21164 [Oryza sativa Indica Group]
Length=855

 Score =   983 bits (2542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 513/840 (61%), Positives = 630/840 (75%), Gaps = 72/840 (9%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDGR+  VTFDEF YYLSE+T+ +L SAAFVHLK AD +KH RNL  ASR 
Sbjct  45    LEAELRRLVVDGREGDVTFDEFRYYLSERTKEVLISAAFVHLKQADLSKHIRNLCAASRA  104

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGP E Y Q LA+AL+HY+ A+LL+LDVTDFSL++QSKYGSS    +  +SISETT 
Sbjct  105   ILLSGPTEPYLQSLARALSHYYKAQLLILDVTDFSLRIQSKYGSSSKGLAQSQSISETTF  164

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
              RMS+ +GSF+I     E + +L+RQ+S  D+ S+G E SSN   LR+N+S S++M++++
Sbjct  165   GRMSDLIGSFTIFPKSAEPRESLQRQTSSADVRSRGSEASSNAPPLRKNASMSSDMSDVS  224

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
             S   +++     RTSS  FDEK+LIQ+LYKV+V V++   ++LY+RD ++LL RS++ Y 
Sbjct  225   S-QCSAHSVSARRTSSWCFDEKVLIQSLYKVMVSVAENNSVILYIRDVDQLLHRSQRTYS  283

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             L QKML +L+G VLILGSR++D   D+ ++DER+SS+FP++++IKPPEEETHL SWK+Q+
Sbjct  284   LFQKMLAKLTGQVLILGSRLLDSDSDHTDVDERVSSLFPFHVDIKPPEEETHLDSWKTQM  343

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNT  1712
             EED K +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYH+++ 
Sbjct  344   EEDTKKIQIQDNRNHIIEVLSANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSYHMIHN  403

Query  1711  KDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPET  1532
             KDPEY+N KLV+SSKSLSHG++IF +E    GK+ LKLE   +       G  G K  ET
Sbjct  404   KDPEYKNGKLVLSSKSLSHGLSIF-QESGFGGKETLKLEDDLK-------GATGPKKSET  455

Query  1531  KAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEI  1352
             + +S+T P    +                  G         PDNEFEKRIRPEVIPA EI
Sbjct  456   E-KSATVPLKDGD------------------GPLPPPKPEIPDNEFEKRIRPEVIPASEI  496

Query  1351  GVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  1172
             GVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA
Sbjct  497   GVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  556

Query  1171  KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEH  992
              +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTI+FVDEVDSMLGQR+R GEH
Sbjct  557   NDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIVFVDEVDSMLGQRARCGEH  616

Query  991   EAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRE  812
             EAMRKIKNEFMSHWDGLL+K GERILVLAATNRPFDLDEAIIRRFERRIMVGLPT + RE
Sbjct  617   EAMRKIKNEFMSHWDGLLSKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTLDSRE  676

Query  811   LILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV---  641
             LIL+TLL+KE V + +D K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+ER K++   
Sbjct  677   LILRTLLSKEKVAEDIDYKELATMTEGYSGSDLKNLCVTAAYRPVRELLKREREKEMERR  736

Query  640   --EKKRLAQECPNCGDAPTANEDK------------------------------------  575
               E K  A    N  ++P + ++K                                    
Sbjct  737   ANEAKEKAATAEN-SESPESKKEKENSENPESKEKEKERKENSENKEEKKENKQDNSKAE  795

Query  574   --GERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
                E  I +RPL M+D  +AKNQVAASFA EG++MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  796   GGTEGTIDLRPLTMEDLRQAKNQVAASFATEGAVMNELKQWNDLYGEGGSRKKQQLTYFL  855



>dbj|BAE98739.1| hypothetical protein [Arabidopsis thaliana]
Length=751

 Score =   977 bits (2525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/746 (66%), Positives = 606/746 (81%), Gaps = 27/746 (4%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + +EQE++  IVDGR+S VTF+EFPY+LS++TR LLTS A+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQIEQELIRQIVDGRESTVTFEEFPYFLSKRTRELLTSVAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  D +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HYF +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKEYDISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYFESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ E   KRSISE TL+++S  +GSFS+L  +E E +GTLRR +SG D+ S+  E
Sbjct  145   SKYGCTKREPFHKRSISELTLDKVSSLMGSFSMLSQREVEPRGTLRRHTSGNDLKSRSTE  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              S+     +RN+SA++++++++S +++S      RT++L FDEKL +Q+LYKVL  VS+T
Sbjct  205   SSNRLPRHKRNASAASDISSISSRSSSSVSASRKRTTNLCFDEKLFLQSLYKVLSSVSET  264

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
              P+++YLRD EKLL  SE+ Y L Q++L +LSG VLILGSR+++P DD +E+DE +S++F
Sbjct  265   TPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSGPVLILGSRVLEPEDDCQEVDESISALF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEI+PPE+E+ LVSWKS+LE+DMKM+Q+QDNKNHI EVLAANDI+CDDL SIC ADT
Sbjct  324   PYNIEIRPPEDESQLVSWKSRLEDDMKMIQFQDNKNHIAEVLAANDIQCDDLSSICHADT  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LSN+IEE+VVSAI+YHL++TK+PEYRN KLVISSKSLSHG++IF+E    + +D LKL
Sbjct  384   MCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLVISSKSLSHGLSIFQEGGNRSFEDSLKL  443

Query  1597  ESKAELSK---ETQSGEKGSKGPETKAESSTA-PGSKPETGsaapapapttkdatsSGTA  1430
             ++  +  +   E  S  +   GPE K ES  + P +K +                     
Sbjct  444   DTNTDSKRKGGEVCSKSESKSGPENKNESEISLPSNKNDNPL-----------------P  486

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
              KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLF+GG
Sbjct  487   PKAPEVVPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFQGG  546

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLA
Sbjct  547   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  606

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL+TKPGERILVLAATNRP
Sbjct  607   AKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMTKPGERILVLAATNRP  666

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +L  +TEGY+GSDLK
Sbjct  667   FDLDEAIIRRFERRIMVGLPSIESREKILRTLLSKEKT-ENLDFHELGQITEGYSGSDLK  725

Query  709   NLCTTAAYRPVRELIKQERLKDVEKK  632
             NLC TAAYRPVRELI+QERLKD E+K
Sbjct  726   NLCITAAYRPVRELIQQERLKDQERK  751



>gb|EPS65718.1| hypothetical protein M569_09059 [Genlisea aurea]
Length=880

 Score =   976 bits (2524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 530/819 (65%), Positives = 639/819 (78%), Gaps = 31/819 (4%)
 Frame = -1

Query  2839  VSKWTGSSSNA----VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             V +W G  ++A    V+V+ +E E+L  ++DG+DS+VTFD FP YLSE+TRVLLTSAA++
Sbjct  87    VGRWAGGKNSAAAESVSVEQIEAELLKLVLDGKDSEVTFDSFPNYLSERTRVLLTSAAYI  146

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  D +KH RNLSPASR ILLSGPAE YQQMLA+ALAH F AKLLLLDV DFSLKVQ 
Sbjct  147   HLKHLDVSKHIRNLSPASRAILLSGPAESYQQMLARALAHRFEAKLLLLDVNDFSLKVQC  206

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTL--RRQSSGVDIPSKGIE  2318
             KYG  +     KRSISE TL+ +S  L SFS+L  + + KGT   +R   G+    +  E
Sbjct  207   KYGIMKKNPPLKRSISEATLDSVSSLLESFSLLPYRNDGKGTTLAQRGGGGLGTAVRDTE  266

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
              SSNP   RR SS S++M+ +TS ++TS+ G     SS SFDEK+L+QA+YKVL+ +S+ 
Sbjct  267   ASSNPLRHRRTSSVSSDMSGITSISSTSSSGSSRCVSSWSFDEKVLLQAIYKVLLSISQH  326

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
               I+LY+RD ++   +S ++Y L  KML++L+G VL+LGSR +D  +D  ++DERLSS+ 
Sbjct  327   SCIILYIRDVDRSFLQSSRMYRLFDKMLKKLTGPVLVLGSRTLDSVEDPVKVDERLSSLL  386

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PY+IE++PPE+ET L+SWKSQLEEDMK +Q++DNKNHI +VLAANDIECDDL SIC  DT
Sbjct  387   PYSIEVRPPEDETRLLSWKSQLEEDMKKIQHRDNKNHIADVLAANDIECDDLASICDVDT  446

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             + LSN+I+E+VVSAI YHLMN ++PEYRN +L+ISS+SLS G++IF+E K+  GKD LK+
Sbjct  447   VILSNHIDEIVVSAILYHLMNNQNPEYRNGRLIISSESLSKGLSIFQEGKSG-GKDTLKI  505

Query  1597  ESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             +   +  K++++ E  +   E+K E+    GS                   SS  +   P
Sbjct  506   D---DCFKDSEAKESTAAKAESKPEAENVSGSG------------NVDVVESSVISKPPP  550

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIP  EIGV F+DIGALDEIKESL ELVMLPLRRPDLF GGLLKP
Sbjct  551   EVPPDNEFEKRIRPEVIPPNEIGVMFSDIGALDEIKESLQELVMLPLRRPDLFNGGLLKP  610

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  611   CRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  670

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLTK GERILVLAATNRPFDLD
Sbjct  671   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTKTGERILVLAATNRPFDLD  730

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMV LP+ E RE ILKTLL+KETV + LD K+LA+MTEGY+GSDLKNLC 
Sbjct  731   EAIIRRFERRIMVELPSVESREKILKTLLSKETV-EDLDFKELASMTEGYSGSDLKNLCV  789

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAK  518
             TAAYRPVRELI+QE +KD EKK+  +E         A E   E+VI++R L M+D  +AK
Sbjct  790   TAAYRPVRELIQQESIKDKEKKQKLKEG-----EEIATE---EKVISLRALTMEDLRQAK  841

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFA+EGSIM+ELKQWN  +GEGGSRKK+QL+YFL
Sbjct  842   NQVAASFASEGSIMSELKQWNEQFGEGGSRKKQQLSYFL  880



>emb|CBI22605.3| unnamed protein product [Vitis vinifera]
Length=782

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 523/821 (64%), Positives = 628/821 (76%), Gaps = 71/821 (9%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV +WTG     +A+T + +E E+   ++DGR+SK+TFD+FPY+LS+QTRVLLTSAA  
Sbjct  27    QTVCRWTGLKLWPDAITEEQIEHELRRQVMDGRESKITFDKFPYFLSKQTRVLLTSAAHF  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HL+ +DF+KHTRNL+PASR ILLSGPAELYQQ LAKALAH+F AKLLLLD+ DFSLK+QS
Sbjct  87    HLRQSDFSKHTRNLTPASRAILLSGPAELYQQTLAKALAHFFQAKLLLLDLNDFSLKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSIL--QPKEEKKGTLRRQSSGVDIPSKGIE  2318
             KYGS + ESS K+SISE TL  MS FLGSFSIL    +EE KGTL RQSSG  I S+ + 
Sbjct  147   KYGSPKRESSSKKSISEVTLGPMSGFLGSFSILLQSEEEETKGTLSRQSSGAHIKSRCM-  205

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
               + P      S+ S   N + S   T++     RTS+ +FDEK L+Q+LYKVL  VS+T
Sbjct  206   --NPPKHGSNASTPSNTKNTVASQRVTTSSAHFKRTSNWAFDEKQLLQSLYKVLDSVSET  263

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
             CPI+LYLRD EKLL +SE++Y L QKML RLSGSVLILGSR++DP D+  E+DER+S +F
Sbjct  264   CPIILYLRDVEKLLLQSERLYKLFQKMLGRLSGSVLILGSRMLDPDDEDEEMDERVSLLF  323

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             PYNIEIK PE+ET L  W++QLE++ +M+Q+Q+NKNHI EVLAANDI CD+LGSIC AD+
Sbjct  324   PYNIEIKEPEDETCLDIWEAQLEKEREMIQFQENKNHIAEVLAANDIGCDNLGSICHADS  383

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
             M LS++IEE+V+SA+SYHLM+ K+PEYRN KLVISSKSLSHG++            I K 
Sbjct  384   MILSDHIEEIVISALSYHLMHNKNPEYRNGKLVISSKSLSHGLS------------IFKE  431

Query  1597  ESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
             +++                 +T AESS                                 
Sbjct  432   DTR-----------------KTNAESSKL-------------------------------  443

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
              VPP NEFE+RIRPEVIPA +IGV F DIGALD+IKESL ELVMLPL+RPDLFKGGLLKP
Sbjct  444   -VPPYNEFERRIRPEVIPANQIGVAFEDIGALDDIKESLQELVMLPLQRPDLFKGGLLKP  502

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPG GKTMLAKAIA EAGA FINVSMST+TSKWFGE EKNVRALFTLAAK+S
Sbjct  503   CRGILLFGPPGNGKTMLAKAIANEAGARFINVSMSTVTSKWFGEVEKNVRALFTLAAKIS  562

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDE DS+LGQR+  GEH AMR+IKNEFM+HWDGLLTK GER+LVLAATNRPFDLD
Sbjct  563   PTIIFVDEADSLLGQRTEVGEHYAMRQIKNEFMTHWDGLLTKAGERVLVLAATNRPFDLD  622

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFE RIMVGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC 
Sbjct  623   EAIIRRFEHRIMVGLPSVESREMILKTLLAKEK-AEDLDFKELATMTEGYTGSDLKNLCM  681

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGD--APTANEDKGERVITIRPLNMDDFME  524
             TAAYRPV+EL++QERLK+ +KK+   +     +  + T  E KGE+VI +RPLNM+D  +
Sbjct  682   TAAYRPVKELLQQERLKEDKKKKQKADEGKSSEDASDTKEEAKGEKVIVLRPLNMEDMRQ  741

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFA++ ++MN+LKQWN LYG+GGSR+K+QLTYFL
Sbjct  742   AKNQVAASFASDEAVMNKLKQWNELYGDGGSRRKKQLTYFL  782



>ref|XP_002441590.1| hypothetical protein SORBIDRAFT_09g029900 [Sorghum bicolor]
 gb|EES20020.1| hypothetical protein SORBIDRAFT_09g029900 [Sorghum bicolor]
Length=842

 Score =   974 bits (2519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 504/834 (60%), Positives = 618/834 (74%), Gaps = 72/834 (9%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   ++DGR+  VTFDEFPYYLS+QTR +L SAAFVHLK+A+ +KH RNLS ASR 
Sbjct  44    LEAELRRLVLDGRECDVTFDEFPYYLSDQTREVLISAAFVHLKNAELSKHIRNLSAASRA  103

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILLSGP E Y Q LAKAL+HYF A+LL++D TDFSL++QSKYG S   ++  +S++ETT 
Sbjct  104   ILLSGPTEPYLQSLAKALSHYFKARLLIVDATDFSLRIQSKYGGSTKATARNQSVTETTF  163

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
              RMS+ +GSF     K+E + + RRQ+S  D+ ++G +GSS+  +LR+N+S S++M +  
Sbjct  164   GRMSDLIGSFMAYPKKDEPRESQRRQTSNTDLRARGSDGSSSTPSLRKNASVSSDMGD--  221

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
              + +      + RT S  F+EK+LIQ+LYKV+V VS+  PI+LY+RD +  L +S++ Y 
Sbjct  222   -HASQCAGNSVRRTGSWCFEEKVLIQSLYKVMVSVSENGPIILYIRDVDHFLWKSQRTYS  280

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             + QKML +LSG VLILGSR++ P  D R+ DER+S++FPY+++IK PEEETHL  WKSQ+
Sbjct  281   MFQKMLAKLSGQVLILGSRLLSPDADNRDADERISTLFPYHVDIKAPEEETHLNCWKSQI  340

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNT  1712
             EED + +Q QDN+NHI+EVL+AND++CDDL SI  ADTM LSNYIEE++VSA+SYHL++ 
Sbjct  341   EEDTRKIQMQDNRNHIIEVLSANDLDCDDLSSISEADTMVLSNYIEEIIVSAVSYHLIHN  400

Query  1711  KDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPET  1532
             KDPEYRN KL++SSKSLSHG++IF  +    GKD LKLE        T+ G KG+ G + 
Sbjct  401   KDPEYRNGKLMLSSKSLSHGLSIF--QGGHGGKDTLKLEG-------TKDGLKGAPGSKK  451

Query  1531  KAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEI  1352
                     G  P                       + PEVP DNEFEKRIRPEVI A EI
Sbjct  452   TDTVPVGEGPLPP----------------------QKPEVP-DNEFEKRIRPEVILASEI  488

Query  1351  GVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  1172
             GVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA
Sbjct  489   GVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  548

Query  1171  KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEH  992
              +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEH
Sbjct  549   NDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARYGEH  608

Query  991   EAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRE  812
             EAMRKIKNEFMSHWDGLL+K GERILVLAATNRPFDLDEAIIRRFERRIMVGLPT E RE
Sbjct  609   EAMRKIKNEFMSHWDGLLSKTGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTQESRE  668

Query  811   LILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELI-----------  665
             LIL+TLL+KE + + +D K+LATMTEGY+GSDLKNLC TAAYRPVREL+           
Sbjct  669   LILRTLLSKEKIEENIDFKELATMTEGYSGSDLKNLCVTAAYRPVRELLKKEREKELERR  728

Query  664   ----KQERLKDVEKKRLAQECPNCGDAPTAN----------------------EDKGERV  563
                 K + +++ E     +E     DAP +                       E + E  
Sbjct  729   EKESKDKAVENSEAPEAKKESSESKDAPKSKEGSESSEDESSDSKSDSSEAKAEGEKEAA  788

Query  562   ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             I +RPL M+D  +AKNQVAASFA+EG++MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  789   IDLRPLTMEDLRQAKNQVAASFASEGAVMNELKQWNDLYGEGGSRKKQQLTYFL  842



>ref|XP_010662650.1| PREDICTED: cell division control protein 48-like [Vitis vinifera]
Length=790

 Score =   971 bits (2509),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 522/829 (63%), Positives = 628/829 (76%), Gaps = 79/829 (10%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QTV +WTG     +A+T + +E E+   ++DGR+SK+TFD+FPY+LS+QTRVLLTSAA  
Sbjct  27    QTVCRWTGLKLWPDAITEEQIEHELRRQVMDGRESKITFDKFPYFLSKQTRVLLTSAAHF  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HL+ +DF+KHTRNL+PASR ILLSGPAELYQQ LAKALAH+F AKLLLLD+ DFSLK+QS
Sbjct  87    HLRQSDFSKHTRNLTPASRAILLSGPAELYQQTLAKALAHFFQAKLLLLDLNDFSLKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK----------GTLRRQSSGV  2342
             KYGS + ESS K+SISE TL  MS FLGSFSIL   EE++          GTL RQSSG 
Sbjct  147   KYGSPKRESSSKKSISEVTLGPMSGFLGSFSILLQSEEEETKARVRTSNAGTLSRQSSGA  206

Query  2341  DIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYK  2162
              I S+ +   + P      S+ S   N + S   T++     RTS+ +FDEK L+Q+LYK
Sbjct  207   HIKSRCM---NPPKHGSNASTPSNTKNTVASQRVTTSSAHFKRTSNWAFDEKQLLQSLYK  263

Query  2161  VLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYREL  1982
             VL  VS+TCPI+LYLRD EKLL +SE++Y L QKML RLSGSVLILGSR++DP D+  E+
Sbjct  264   VLDSVSETCPIILYLRDVEKLLLQSERLYKLFQKMLGRLSGSVLILGSRMLDPDDEDEEM  323

Query  1981  DERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDL  1802
             DER+S +FPYNIEIK PE+ET L  W++QLE++ +M+Q+Q+NKNHI EVLAANDI CD+L
Sbjct  324   DERVSLLFPYNIEIKEPEDETCLDIWEAQLEKEREMIQFQENKNHIAEVLAANDIGCDNL  383

Query  1801  GSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTA  1622
             GSIC AD+M LS++IEE+V+SA+SYHLM+ K+PEYRN KLVISSKSLSHG++        
Sbjct  384   GSICHADSMILSDHIEEIVISALSYHLMHNKNPEYRNGKLVISSKSLSHGLS--------  435

Query  1621  AGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdats  1442
                 I K +++                 +T AESS                         
Sbjct  436   ----IFKEDTR-----------------KTNAESSKL-----------------------  451

Query  1441  SGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDL  1262
                      VPP NEFE+RIRPEVIPA +IGV F DIGALD+IKESL ELVMLPL+RPDL
Sbjct  452   ---------VPPYNEFERRIRPEVIPANQIGVAFEDIGALDDIKESLQELVMLPLQRPDL  502

Query  1261  FKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRAL  1082
             FKGGLLKPCRGILLFGPPG GKTMLAKAIA EAGA FINVSMST+TSKWFGE EKNVRAL
Sbjct  503   FKGGLLKPCRGILLFGPPGNGKTMLAKAIANEAGARFINVSMSTVTSKWFGEVEKNVRAL  562

Query  1081  FTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAA  902
             FTLAAK+SPTIIFVDE DS+LGQR+  GEH AMR+IKNEFM+HWDGLLTK GER+LVLAA
Sbjct  563   FTLAAKISPTIIFVDEADSLLGQRTEVGEHYAMRQIKNEFMTHWDGLLTKAGERVLVLAA  622

Query  901   TNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTG  722
             TNRPFDLDEAIIRRFE RIMVGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTG
Sbjct  623   TNRPFDLDEAIIRRFEHRIMVGLPSVESREMILKTLLAKEK-AEDLDFKELATMTEGYTG  681

Query  721   SDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGD--APTANEDKGERVITIRP  548
             SDLKNLC TAAYRPV+EL++QERLK+ +KK+   +     +  + T  E KGE+VI +RP
Sbjct  682   SDLKNLCMTAAYRPVKELLQQERLKEDKKKKQKADEGKSSEDASDTKEEAKGEKVIVLRP  741

Query  547   LNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             LNM+D  +AKNQVAASFA++ ++MN+LKQWN LYG+GGSR+K+QLTYFL
Sbjct  742   LNMEDMRQAKNQVAASFASDEAVMNKLKQWNELYGDGGSRRKKQLTYFL  790



>ref|XP_010230989.1| PREDICTED: spermatogenesis-associated protein 5-like isoform 
X1 [Brachypodium distachyon]
Length=845

 Score =   969 bits (2505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 506/831 (61%), Positives = 622/831 (75%), Gaps = 64/831 (8%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPY---YLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPA  2621
             +E E+   +VDG +S + F EF +   YLSEQT+ +L SAAFVHLK AD +KH RNLS A
Sbjct  45    VEAELRRLVVDGSESGINFKEFHHLHCYLSEQTKEVLISAAFVHLKQADLSKHIRNLSAA  104

Query  2620  SRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISE  2441
             SR ILLSGP E Y Q LA+AL+HY+  +LL+LD+TDFSL++QSKYGSS       +S+SE
Sbjct  105   SRAILLSGPTEPYLQSLARALSHYYKTRLLILDITDFSLRIQSKYGSSTKTLVQNQSMSE  164

Query  2440  TTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKG--IEGSSNPTTlrrnssasan  2267
             TT  R+S+F+GSF++   K+E + +LRRQ+S  D  ++G  +  SS+P+  +  S  S  
Sbjct  165   TTFGRVSDFIGSFAMFPKKDEPRESLRRQTSSADFRARGSDVIASSDPSIRKNVSMPSDT  224

Query  2266  mnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
              +  +  +  S      R +S  FDEK+LIQ+LYKV++ V+++ PI+LY+RD +  L RS
Sbjct  225   SDLASQCSGHS----ARRANSWCFDEKVLIQSLYKVMISVAESDPIILYIRDVDHFLHRS  280

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
             ++ Y + QKML +LSG VLILGSR+++ G +Y ++DER+S +FPY+++IKPPE+E HL  
Sbjct  281   QRTYSIFQKMLSKLSGQVLILGSRLLNSGAEYNDVDERVSGMFPYHVDIKPPEDEIHLNG  340

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             WK Q++ED K +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SY
Sbjct  341   WKIQMDEDAKKIQIQDNRNHIVEVLSANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSY  400

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGS  1547
             HL++ KDPEY+N KL++SSKSLSHG++IF +E    GKD LK+E+  E SK+   G  GS
Sbjct  401   HLIHNKDPEYKNGKLLLSSKSLSHGLSIF-QESGHGGKDTLKMEANDE-SKDGLKGAAGS  458

Query  1546  KGPETKAESSTAP---GSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRP  1376
             K  ET  +S T P   G  P                         PE+P DNEFEKRIRP
Sbjct  459   KNSETD-KSGTMPVKDGDAPPP----------------------KPEIP-DNEFEKRIRP  494

Query  1375  EVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK  1196
             EVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK
Sbjct  495   EVIPANEIGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK  554

Query  1195  TMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLG  1016
             TMLAKAIA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLG
Sbjct  555   TMLAKAIANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLG  614

Query  1015  QRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVG  836
             QR+R GEHEAMRKIKNEFMSHWDG+L+K GERILVLAATNRPFDLDEAIIRRFERRIMVG
Sbjct  615   QRARCGEHEAMRKIKNEFMSHWDGILSKSGERILVLAATNRPFDLDEAIIRRFERRIMVG  674

Query  835   LPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQE  656
             LPT E RELIL+TLL+KE V K ++ K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+E
Sbjct  675   LPTQESRELILRTLLSKEKVDKDIEFKELATMTEGYSGSDLKNLCVTAAYRPVRELLKKE  734

Query  655   RLKDVEKKRL----------AQECPNC----------------GDAPTANEDKGERVITI  554
             RLK++E++            A + P                  G++    E   E  I +
Sbjct  735   RLKELERREKEAKQKTTAVDASDNPESKEENSDSKEDNPESKDGNSEAKAESDKEAGIDL  794

Query  553   RPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             RPL M+D  +AKNQVAASFAAEG++MNELKQWN LYGEGGSRKK+QLTYFL
Sbjct  795   RPLTMEDLKQAKNQVAASFAAEGAVMNELKQWNELYGEGGSRKKQQLTYFL  845



>gb|EMS62853.1| Spastin [Triticum urartu]
Length=864

 Score =   968 bits (2503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 534/856 (62%), Positives = 630/856 (74%), Gaps = 76/856 (9%)
 Frame = -1

Query  2824  GSSSNAVTVDIMEQE--MLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADF  2651
             G   +   V I+ Q    + T + GR + V   E+ ++ SEQTRV+LTSAA+VHLK A+ 
Sbjct  37    GQQGHLRRVPILPQNRYAVRTQITGRRNPV--GEY-FHESEQTRVVLTSAAYVHLKQAEI  93

Query  2650  AKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDF-----SLKVQSKY  2486
             +K+TRNL+PASR ILLSGPAELYQQMLAKALAHYF AK+LLLD TDF     SL++  KY
Sbjct  94    SKYTRNLAPASRAILLSGPAELYQQMLAKALAHYFEAKILLLDPTDFLIKWCSLQLHGKY  153

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK---------------GTLRRQS  2351
             G+  +E S  RSISETTL +MS  L SF++   KE+ +               G +RRQS
Sbjct  154   GTGSSEQSVTRSISETTLEKMSGLLQSFTMTPQKEQSRVVVTYFSFYLNMFNSGGMRRQS  213

Query  2350  SGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQA  2171
             S  D+  +  E +++   LRRN+S S++M++L S    SN  PL R+SS +FDEK+L+QA
Sbjct  214   SMTDMKLRSSESTNSMPRLRRNASTSSDMSSLASQGPPSNSAPLRRSSSWTFDEKMLVQA  273

Query  2170  LYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDY  1991
             LYKVL KVSK  PIVLY+RD EK L +S K+++L +K+L +L G VL+LGSRIVD   D 
Sbjct  274   LYKVLHKVSKKSPIVLYIRDVEKFLQKSPKMFLLFEKLLAKLEGPVLLLGSRIVDMDFDD  333

Query  1990  RELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIEC  1811
              ELD+RLS++FPYNI+IKPPE E  LVSW SQLEEDMK++Q+QDN+NHI EVLA ND+EC
Sbjct  334   DELDDRLSALFPYNIDIKPPENENCLVSWNSQLEEDMKIIQFQDNRNHITEVLAENDLEC  393

Query  1810  DDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEE  1631
              DLGSIC++DTM LS YIEE+VVSA+SYHLMN KDPEYRN KL++S+KSLSH + IF+E 
Sbjct  394   LDLGSICLSDTMGLSKYIEEIVVSAVSYHLMNHKDPEYRNGKLILSAKSLSHALEIFQEN  453

Query  1630  KTAAGKDILKLESKAELSKETQSGEKGSKGP-ETKA------------------ESSTAP  1508
             K    KD +KLE   +  K  + G   +    ETK                   ES T P
Sbjct  454   KVC-DKDTMKLERHTDARKIAEKGIAPTAAKLETKPATLLPPAAPAAATPAPPPESKTEP  512

Query  1507  GSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIG  1328
               KPE                      K PEVPPDNEFEKRIRPEVIPA EIGV+F DIG
Sbjct  513   -KKPENPL----------------PPAKLPEVPPDNEFEKRIRPEVIPANEIGVSFDDIG  555

Query  1327  ALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFI  1148
             AL++IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EA ASFI
Sbjct  556   ALEDIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAQASFI  615

Query  1147  NVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKN  968
             NVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+RAGEHEAMRKIKN
Sbjct  616   NVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRNRAGEHEAMRKIKN  675

Query  967   EFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLA  788
             EFM+HWDGLL++P ++ILVLAATNRPFDLDEAII    RRIMVGLP+ + RE+I+K LL+
Sbjct  676   EFMTHWDGLLSRPDQKILVLAATNRPFDLDEAII----RRIMVGLPSVQNREMIMKRLLS  731

Query  787   KETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV-------EKKR  629
             KE V + LD K+LATMTEGYTGSDLKNLCTTAAYRPVRELI++ER K++       EK +
Sbjct  732   KEKVDEGLDYKELATMTEGYTGSDLKNLCTTAAYRPVRELIQKERKKELLTLEYLQEKMK  791

Query  628   LAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNL  449
             L +       +    +DK    I +RPLNM D  EAKNQVAASFAAEGSIM ELKQWN+L
Sbjct  792   LEKGGSPLDPSKIKQKDKE---IILRPLNMADLKEAKNQVAASFAAEGSIMGELKQWNDL  848

Query  448   YGEGGSRKKEQLTYFL  401
             YGEGGSRKKEQLTYFL
Sbjct  849   YGEGGSRKKEQLTYFL  864



>ref|XP_004961073.1| PREDICTED: putative cell division cycle ATPase-like [Setaria 
italica]
Length=844

 Score =   966 bits (2498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 509/846 (60%), Positives = 618/846 (73%), Gaps = 73/846 (9%)
 Frame = -1

Query  2824  GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFP---YYLSEQTRVLLTSAAFVHLKSAD  2654
             GS + A  V   E E+   ++DGR+S+VTFDEF    YYLS+QT+ +L SAAFVHL+ A+
Sbjct  34    GSGAGAAEV---EAELRRLVLDGRESQVTFDEFHNFHYYLSDQTKEVLISAAFVHLRKAE  90

Query  2653  FAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSR  2474
              +KH RNLS ASR ILLSGP E Y Q LAKAL+ +F A+LL+LD  DFSL++QSKYG S 
Sbjct  91    LSKHIRNLSAASRAILLSGPTEPYLQSLAKALSQHFKARLLILDANDFSLRIQSKYGGSN  150

Query  2473  NESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS-SNPTT  2297
                   +S+ ETT  +MS  +GSF     K+E + +L RQ+S  D+ ++G +GS S P+ 
Sbjct  151   KVMVRNQSVPETTFGKMSGLIGSFMTYPKKDEPRESLHRQTSNTDLRARGSDGSTSTPSL  210

Query  2296  lrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYL  2117
              +  S +S   +  +  +  S    + RTSS  FDEK+LIQ+LYKVL+ VS+  PI+LY+
Sbjct  211   RKNASVSSDMSDLASQCSGHS----VRRTSSWCFDEKVLIQSLYKVLISVSENDPIILYI  266

Query  2116  RDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIK  1937
             RD +  L +S++ Y + QKM+ +LSG VLILGSR+++   D R++DER+S++FPY+++IK
Sbjct  267   RDVDHFLWKSQRTYTMFQKMMAKLSGQVLILGSRLLNFDADNRDVDERVSTLFPYHVDIK  326

Query  1936  PPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYI  1757
             PPEEETHL  WK+Q+EED K  Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYI
Sbjct  327   PPEEETHLDCWKNQMEEDTKKFQMQDNRNHIIEVLSANDLDCDDLSSICEADTMVLSNYI  386

Query  1756  EEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELS  1577
             EE++VSA+SYHL+N KDPEY+N KL++SSKSLSHG++IF  +    GKD LKLE      
Sbjct  387   EEIIVSAVSYHLINNKDPEYKNGKLILSSKSLSHGLSIF--QGGHGGKDTLKLE------  438

Query  1576  KETQSGEKGSKGPE-TKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDN  1400
              ET+ G KG+ G + T+A+ ST                         G         PDN
Sbjct  439   -ETKDGVKGALGSKKTEADKSTP-------------------VPVGDGPLPPPKPEIPDN  478

Query  1399  EFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILL  1220
             EFEKRIRPEVIPA EIGVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILL
Sbjct  479   EFEKRIRPEVIPASEIGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILL  538

Query  1219  FGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFV  1040
             FGPPGTGKTMLAKAIA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFV
Sbjct  539   FGPPGTGKTMLAKAIANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFV  598

Query  1039  DEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRR  860
             DEVDSMLGQR+R+GEHEAMRKIKNEFMSHWDGLL+K GER+LVLAATNRPFDLDEAIIRR
Sbjct  599   DEVDSMLGQRARSGEHEAMRKIKNEFMSHWDGLLSKSGERVLVLAATNRPFDLDEAIIRR  658

Query  859   FERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRP  680
             FERRIMVGLPT E RELIL+TLL+KE V + +D K+LATMTEGY+GSDLKNLC TAAYRP
Sbjct  659   FERRIMVGLPTQESRELILRTLLSKEKVDENIDFKELATMTEGYSGSDLKNLCVTAAYRP  718

Query  679   VRELIK---------------------QERLKDVEKKRLAQECPNCGDAPTANED-----  578
             VREL+K                      E  +  E K+   E     ++   N D     
Sbjct  719   VRELLKKEREKELERREKEAKEKAAATSENPEAPESKKENSESKENSESKKKNSDGKVDS  778

Query  577   -----KGERVITI--RPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKE  419
                  +GE+  TI  RPL M+D  EAKNQVAASFAAEG++MNELKQWN+LYGEGGSRKK+
Sbjct  779   SGAKAEGEKEATIDLRPLTMEDLKEAKNQVAASFAAEGAVMNELKQWNDLYGEGGSRKKQ  838

Query  418   QLTYFL  401
             QLTYFL
Sbjct  839   QLTYFL  844



>gb|EMT26638.1| Spastin [Aegilops tauschii]
Length=851

 Score =   964 bits (2491),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 505/843 (60%), Positives = 622/843 (74%), Gaps = 82/843 (10%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPY---YLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPA  2621
             +E E+   ++DGRDS+VTFDEF +   YLSEQT+ +L SAAFVHLK AD +KH RNLS A
Sbjct  45    VEAELRRLLLDGRDSEVTFDEFHHRHCYLSEQTKEVLISAAFVHLKQADLSKHIRNLSAA  104

Query  2620  SRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISE  2441
             SR ILLSGP E Y Q LAKAL+HY+ A+LLLLDVTDFSL++QSKYG S       +S+SE
Sbjct  105   SRAILLSGPTEAYLQSLAKALSHYYKARLLLLDVTDFSLRIQSKYGGSGKALVQNQSVSE  164

Query  2440  TTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN-PTTlrrnssasanm  2264
             TT  R+S+F+GSF++   K+E + +LRRQ+S  D  ++G + +SN P   +  S  S   
Sbjct  165   TTFGRVSDFIGSFAMFPKKDEPRESLRRQTSSADSRARGSDVASNDPLLRKNASMPSDMS  224

Query  2263  nnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSE  2084
             +  +  +  S      R  S  FDEK+LIQ+LYKV++ V+++ PI+LY+RD +  L RS+
Sbjct  225   DVASQCSVHS----ARRARSWCFDEKVLIQSLYKVMISVAESDPIILYIRDVDHFLHRSQ  280

Query  2083  KVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSW  1904
             + Y + QKML +LSG VLILGSR+ +   +Y  +++R+SS+FPY+++IKPP+EE HL  W
Sbjct  281   RTYTMFQKMLAKLSGQVLILGSRLHNSDAEYNGMEDRVSSLFPYHVDIKPPQEEIHLNGW  340

Query  1903  KSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYH  1724
             K+Q+EED + +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYH
Sbjct  341   KTQMEEDARKIQIQDNRNHIVEVLSANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSYH  400

Query  1723  LMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSK  1544
             L++TKDPEY+N KL++SSKSLSHG++IF +E    GKD LKLE+  +  K    G  GSK
Sbjct  401   LVHTKDPEYKNGKLLLSSKSLSHGLSIF-QETGLGGKDTLKLEANEDGLK----GAPGSK  455

Query  1543  GPETK---AESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPE  1373
              PE+     +   AP  KPE                            PDNEFEKRIRPE
Sbjct  456   KPESDKSPGKDGDAPPPKPEI---------------------------PDNEFEKRIRPE  488

Query  1372  VIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG-LLKPCRGILLFGPPGTGK  1196
             VIP  E+GVTF DIGAL +IKESL ELVMLPLRRPDLFKGG LLKPCRGILLFGPPGTGK
Sbjct  489   VIPPSELGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGGLLKPCRGILLFGPPGTGK  548

Query  1195  TMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLG  1016
             TMLAKAIA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLG
Sbjct  549   TMLAKAIANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLG  608

Query  1015  QRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVG  836
             QR+R GEHEAMRKIKNEFMSHWDG+L+K GERILVLAATNRPFDLDEAIIRRFERRIMVG
Sbjct  609   QRARCGEHEAMRKIKNEFMSHWDGILSKSGERILVLAATNRPFDLDEAIIRRFERRIMVG  668

Query  835   LPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQE  656
             LPT + RELIL+T+L+KE V K ++ K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+E
Sbjct  669   LPTQDSRELILRTVLSKEKVDKDIEYKELATMTEGYSGSDLKNLCVTAAYRPVRELLKKE  728

Query  655   RLKDVEKKRLAQECPNCGDA-----------PTANEDKGERV------------------  563
             RLK++E+++   +      A            + N+D  E+V                  
Sbjct  729   RLKEMERRKTEAKQKTAAAAEDSDKAESKKVSSENKDSSEKVDSDGKEGDSESRVDASEA  788

Query  562   ---------ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLT  410
                      + +RPL M+D  +AKNQVAASFAAEG++MNELKQWN+LYGEGGSRKKEQLT
Sbjct  789   KTEGDKEAAVDLRPLTMEDLRQAKNQVAASFAAEGAVMNELKQWNDLYGEGGSRKKEQLT  848

Query  409   YFL  401
             YFL
Sbjct  849   YFL  851



>dbj|BAK00787.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=854

 Score =   961 bits (2484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 508/845 (60%), Positives = 617/845 (73%), Gaps = 84/845 (10%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPY---YLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPA  2621
             +E E+   +VDGRDS VTFDEF +   YLSEQT+ +L SAAFVHLK A  +KH RNLS A
Sbjct  46    VEAELRRLVVDGRDSDVTFDEFHHLHCYLSEQTKEVLISAAFVHLKQAGLSKHIRNLSAA  105

Query  2620  SRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISE  2441
             SR ILLSGP E Y Q LAKAL+HY+ A+LLLLDVTDFSL++QSKYG S       +S+SE
Sbjct  106   SRAILLSGPTEAYLQSLAKALSHYYKARLLLLDVTDFSLRIQSKYGGSSRALVQNQSVSE  165

Query  2440  TTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN-PTTlrrnssasanm  2264
             TT  R+S+F+GSF++   K+E + +LRRQ+S  D  ++G + +SN P+  +  S  S   
Sbjct  166   TTFGRVSDFIGSFAMFPKKDEPRESLRRQTSSADSRARGSDVASNDPSLRKNASMPSDMS  225

Query  2263  nnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSE  2084
             +  +  +  S      R SS  FDEK+LIQ+LYKV++ V+++ PI+LY+RD +  L RS+
Sbjct  226   DVGSQCSVHS----ARRASSWCFDEKVLIQSLYKVMISVAESDPIILYIRDVDHFLHRSQ  281

Query  2083  KVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSW  1904
             + Y + QKML +LSG VLILGSR+++   ++ + D+R+SS+FPY+++IKPP EE HL  W
Sbjct  282   RTYSMFQKMLAKLSGQVLILGSRLLNSDAEHSDADDRVSSLFPYHVDIKPPHEEIHLNGW  341

Query  1903  KSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYH  1724
             K+Q+EED K +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYH
Sbjct  342   KTQMEEDAKKIQIQDNRNHIVEVLSANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSYH  401

Query  1723  LMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSK  1544
             L++ KDPEY+N KL++SSKSLSHG++IF +E    GKD LKLE+  +  K    G  GSK
Sbjct  402   LVHNKDPEYKNGKLLLSSKSLSHGLSIF-QETGLGGKDTLKLEANEDGLK----GAPGSK  456

Query  1543  GPE---TKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPE  1373
              PE   +  +   AP  KPE                            PDNEFEKRIRPE
Sbjct  457   KPENDKSPVKDGDAPPPKPEI---------------------------PDNEFEKRIRPE  489

Query  1372  VIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG-LLKPCRGILLFGPPGTGK  1196
             VIP  E+GVTF DIGAL +IKESL ELVMLPLRRPDLFKGG LLKPCRGILLFGPPGTGK
Sbjct  490   VIPPSELGVTFDDIGALADIKESLQELVMLPLRRPDLFKGGGLLKPCRGILLFGPPGTGK  549

Query  1195  TMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLG  1016
             TMLAKAIA +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLG
Sbjct  550   TMLAKAIANDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLG  609

Query  1015  QRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVG  836
             QR+R GEHEAMRKIKNEFMSHWDG+L+K GERILVLAATNRPFDLDEAIIRRFERRIMVG
Sbjct  610   QRARCGEHEAMRKIKNEFMSHWDGILSKSGERILVLAATNRPFDLDEAIIRRFERRIMVG  669

Query  835   LPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQE  656
             LPT E RELIL+T+L+KE V K ++ K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+E
Sbjct  670   LPTQESRELILRTVLSKEKVDKDIEYKELATMTEGYSGSDLKNLCVTAAYRPVRELLKKE  729

Query  655   RLKDVEKKRLAQECPNCG-----DAP----------------------------------  593
             RLK++E+++   E          D P                                  
Sbjct  730   RLKEMERRKTEAEQKTAAAAEDSDKPESKKVSSDNKENNPEKVDSSDRKEGSSESKEDSS  789

Query  592   -TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQ  416
              T  E   E  I +RPL M+D  +AKNQVAASFAAEG++MNELKQWN LYGEGGSRKK+Q
Sbjct  790   ETKAEGDKEAFIDLRPLTMEDLRQAKNQVAASFAAEGAVMNELKQWNELYGEGGSRKKQQ  849

Query  415   LTYFL  401
             LTYFL
Sbjct  850   LTYFL  854



>ref|XP_006655636.1| PREDICTED: putative cell division cycle ATPase-like [Oryza brachyantha]
Length=804

 Score =   953 bits (2464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 492/810 (61%), Positives = 603/810 (74%), Gaps = 69/810 (9%)
 Frame = -1

Query  2713  SEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKL  2534
             SE+T+ +L S AFVHLK AD +KH RNL  ASR ILL+GP E Y Q LA+AL+HY+   L
Sbjct  25    SERTKEVLISGAFVHLKQADLSKHIRNLCAASRAILLAGPTEPYLQSLARALSHYYKTHL  84

Query  2533  LLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQ  2354
             L+LDVTDFSL++QSKYGSS       +SIS+TT  RMS+ +GSF+I     E + +L+R 
Sbjct  85    LILDVTDFSLRIQSKYGSSSKGLVHNQSISDTTFGRMSDLIGSFTIFSKSAEPRESLQRH  144

Query  2353  SSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQ  2174
             +S  D+ ++G E +SN     R S++ ++  +  S   +++     RTSS  FDEK+L+Q
Sbjct  145   TSSADVKARGSEATSN-APPLRKSTSVSSDMSDVSSQCSAHSVSARRTSSWCFDEKVLVQ  203

Query  2173  ALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDD  1994
             +LYKV+V V++  P++LY+RD + LL RS++ Y L QKML +LSG VLILGSR++D   D
Sbjct  204   SLYKVMVSVAENHPVILYIRDVDHLLHRSQRTYSLFQKMLGKLSGQVLILGSRLLDSDSD  263

Query  1993  YRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIE  1814
             +R++DER+SS+FP++++IKPPEEE+HL SW++Q+EED+K +Q  DN+NHI+EVL+AND++
Sbjct  264   HRDVDERVSSLFPFHVDIKPPEEESHLDSWRTQMEEDIKKIQILDNRNHIIEVLSANDLD  323

Query  1813  CDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE  1634
             CDDL SIC ADTM LSNYIEE++VSA+SYHL + KDPEY+N KLV+SSKSLSHG++IF +
Sbjct  324   CDDLSSICQADTMILSNYIEEIIVSAVSYHLNHNKDPEYKNGKLVLSSKSLSHGLSIF-Q  382

Query  1633  EKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttk  1454
             E    GK+ LKLE       +   G  GSK P+T+ +S+T P                  
Sbjct  383   ESGFGGKETLKLE-------DDMKGANGSKKPDTE-KSTTLP------------------  416

Query  1453  datsSGTAVKAPEVP--PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLP  1280
                  G     P+ P  PDNEFEKRIRPEVIPA EIGVTF DIGAL +IKESL ELVMLP
Sbjct  417   --LKDGDGPLPPQKPEIPDNEFEKRIRPEVIPASEIGVTFDDIGALADIKESLQELVMLP  474

Query  1279  LRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDE  1100
             LRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA +AGASFINVSMSTITSKWFGEDE
Sbjct  475   LRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANDAGASFINVSMSTITSKWFGEDE  534

Query  1099  KNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGER  920
             KNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLL+K GER
Sbjct  535   KNVRALFSLAAKVAPTIIFVDEVDSMLGQRARCGEHEAMRKIKNEFMSHWDGLLSKSGER  594

Query  919   ILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATM  740
             ILVLAATNRPFDLD+AIIRRFERRIMVGLPT + RELIL+TLL+KE V + +D K+LATM
Sbjct  595   ILVLAATNRPFDLDQAIIRRFERRIMVGLPTLDSRELILRTLLSKEKVDEGIDFKELATM  654

Query  739   TEGYTGSDLKNLCTTAAYRPVRELIKQERLKDV-----EKKRLAQECPNCGDA-------  596
             TEGY+GSDLKNLC TAAYRPVREL+K+ER K++     E K       N G++       
Sbjct  655   TEGYSGSDLKNLCVTAAYRPVRELLKREREKEMERRANEAKEKGATAENSGNSTSKKENP  714

Query  595   ---------------------PTANEDKGER----VITIRPLNMDDFMEAKNQVAASFAA  491
                                  P  +E K E      I +RPL M+D  +AKNQVAASFAA
Sbjct  715   ENPESKEKESSENKEEKTESKPENSEAKAEGGDGVTIDLRPLTMEDLRQAKNQVAASFAA  774

Query  490   EGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             EG++MNELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  775   EGAVMNELKQWNDLYGEGGSRKKQQLTYFL  804



>ref|XP_006606152.1| PREDICTED: peroxisomal biogenesis factor 6-like [Glycine max]
Length=820

 Score =   951 bits (2459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 496/858 (58%), Positives = 611/858 (71%), Gaps = 107/858 (12%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW   S  S+ ++ + +  E+ N ++DG++SKVTFD+FPYYLSE+ R +LTS  +V
Sbjct  27    QAVQKWVVGSCESDEISGEQIVLELNNRVIDGKNSKVTFDDFPYYLSERIRFVLTSTGYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             +LK  DF+KH RNL PASR ILLSGPAE YQQ LA+ALAHYF +KLLLLD+TDFSL++Q 
Sbjct  87    YLKQ-DFSKHLRNLRPASRAILLSGPAEPYQQNLARALAHYFESKLLLLDITDFSLEMQR  145

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  R E SF+RSISE TL R+S   GS S+L      +GTL RQSSG       IE S
Sbjct  146   KYGCPRKEPSFQRSISEVTLERVSGLFGSLSVLPSTGRTRGTLHRQSSG-------IENS  198

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SNP  LRRN+S + +  +   Y   S+P PL  TS   FDEKL +Q+LYKVLV +S+T  
Sbjct  199   SNPPKLRRNASTACDTISTPQYGP-SDPAPLKCTSGFCFDEKLFVQSLYKVLVSLSETSS  257

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY++D EKL  RS +++ L QK++++LSGSVLILGS+I D  DD  E+DE+L+ +FPY
Sbjct  258   VILYIKDVEKLFVRSTRLHNLFQKLIKKLSGSVLILGSQIFDSEDDCAEIDEKLTMLFPY  317

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NI+IKPP++ETHL SW+++L++DM+   +QD++NHI EVLAAND++CDDL  +  ADTM 
Sbjct  318   NIDIKPPQDETHLASWRTKLKKDMETSLFQDSRNHIAEVLAANDVDCDDLEKVSNADTML  377

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSN IEE+V SAIS+HLM TK PEYRN KLVIS KSLSH +N+F+E ++           
Sbjct  378   LSNCIEEIVASAISHHLMETKHPEYRNRKLVISHKSLSHVLNLFQESES-----------  426

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
                              PE K  +     +  + G                         
Sbjct  427   ----------------NPENKDSNKEDALATKKDG-------------------------  445

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
               DNEFEK +R EV+PA EIGVTF DIGALD+IKE L ++VMLPLRRPDLFKGGLLKP +
Sbjct  446   --DNEFEKHMREEVVPANEIGVTFEDIGALDDIKELLQDVVMLPLRRPDLFKGGLLKPYK  503

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVS+S ITSKWFGEDEKNVRALF+LAAKV+PT
Sbjct  504   GILLFGPPGTGKTMLAKAIANEAGASFINVSISKITSKWFGEDEKNVRALFSLAAKVAPT  563

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIF+DEVDSMLG+R++ GEHEAMRKIKNEFM+HWDGLLT+P ERILVLAATNRPFDLDEA
Sbjct  564   IIFIDEVDSMLGKRTKYGEHEAMRKIKNEFMAHWDGLLTEPNERILVLAATNRPFDLDEA  623

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKT+LAKE    + D K+L+TMTEGYTGSDLKNLCT A
Sbjct  624   IIRRFERRIMVGLPSAENREMILKTILAKEKYENI-DFKELSTMTEGYTGSDLKNLCTAA  682

Query  691   AYRPVRELIKQERL------------------------------------KDV-----EK  635
             AYRPVRE+++Q+RL                                    +D+     EK
Sbjct  683   AYRPVREVLQQDRLKEKEKKKAEVEVQRSEDASDAKGDKDEVTTLRCLNVEDIRHCSQEK  742

Query  634   KRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWN  455
             K+   E  +  +A  A  DK ++V+T+RPLNM+D   AK+QVAASFAAEGSIM+ELK+WN
Sbjct  743   KKTEAEVQSSQNASDAKGDKDDQVMTLRPLNMEDMRLAKSQVAASFAAEGSIMSELKEWN  802

Query  454   NLYGEGGSRKKEQLTYFL  401
              L+GEGGSRKK+QLTYFL
Sbjct  803   ELFGEGGSRKKQQLTYFL  820



>gb|KHN12924.1| Fidgetin-like protein 1 [Glycine soja]
Length=820

 Score =   951 bits (2458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 495/858 (58%), Positives = 610/858 (71%), Gaps = 107/858 (12%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW   S  S+ ++ + +  E+ N ++DG++SKVTFD+FPYYLSE+ R +LTS  +V
Sbjct  27    QAVQKWVVGSCESDEISGEQIVLELNNRVIDGKNSKVTFDDFPYYLSERIRFVLTSTGYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             +LK  DF+KH RNL PASR ILLSGPAE YQQ LA+ALAHYF +KLLLLD+TDFSL++Q 
Sbjct  87    YLKQ-DFSKHLRNLRPASRAILLSGPAEPYQQNLARALAHYFESKLLLLDITDFSLEMQR  145

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  R E  F+RSISE TL R+S   GS S+L      +GTL RQSSG       IE S
Sbjct  146   KYGCPRKEPCFQRSISEVTLERVSGLFGSLSVLPSTGRTRGTLHRQSSG-------IENS  198

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SNP  LRRN+S + +  +   Y   S+P PL  TS   FDEKL +Q+LYKVLV +S+T  
Sbjct  199   SNPPKLRRNASTACDTISTPQYGP-SDPAPLKCTSGFCFDEKLFVQSLYKVLVSISETSS  257

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY++D EKL  RS +++ L QK++++LSGSVLILGS+I D  DD  E+DE+L+ +FPY
Sbjct  258   VILYIKDVEKLFVRSTRLHNLFQKLIKKLSGSVLILGSQIFDSEDDCAEIDEKLTMLFPY  317

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NI+IKPP++ETHL SW+++L++DM+   +QD++NHI EVLAAND++CDDL  +  ADTM 
Sbjct  318   NIDIKPPQDETHLASWRTKLKKDMETSLFQDSRNHIAEVLAANDVDCDDLEKVSNADTML  377

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSN IEE+V SAIS+HLM TK PEYRN KLVIS KSLSH +N+F+E ++           
Sbjct  378   LSNCIEEIVASAISHHLMETKHPEYRNRKLVISHKSLSHVLNLFQESES-----------  426

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
                              PE K  +     +  + G                         
Sbjct  427   ----------------NPENKDSNKEDALATKKDG-------------------------  445

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
               DNEFEK +R EV+PA EIGVTF DIGALD+IKE L ++VMLPLRRPDLFKGGLLKP +
Sbjct  446   --DNEFEKHMREEVVPANEIGVTFEDIGALDDIKELLQDVVMLPLRRPDLFKGGLLKPYK  503

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVS+S ITSKWFGEDEKNVRALF+LAAKV+PT
Sbjct  504   GILLFGPPGTGKTMLAKAIANEAGASFINVSISKITSKWFGEDEKNVRALFSLAAKVAPT  563

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIF+DEVDSMLG+R++ GEHEAMRKIKNEFM+HWDGLLT+P ERILVLAATNRPFDLDEA
Sbjct  564   IIFIDEVDSMLGKRTKYGEHEAMRKIKNEFMAHWDGLLTEPNERILVLAATNRPFDLDEA  623

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKT+LAKE    + D K+L+TMTEGYTGSDLKNLCT A
Sbjct  624   IIRRFERRIMVGLPSAENREMILKTILAKEKYENI-DFKELSTMTEGYTGSDLKNLCTAA  682

Query  691   AYRPVRELIKQERL------------------------------------KDV-----EK  635
             AYRPVRE+++Q+RL                                    +D+     EK
Sbjct  683   AYRPVREVLQQDRLKEKEKKKTEVEVQRSEDASDAKGDKDEVTTLRCLNVEDIRHCSQEK  742

Query  634   KRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWN  455
             K+   E  +  +A  A  DK ++V+T+RPLNM+D   AK+QVAASFAAEGSIM+ELK+WN
Sbjct  743   KKTEAEVQSSQNASDAKGDKDDQVMTLRPLNMEDMRLAKSQVAASFAAEGSIMSELKEWN  802

Query  454   NLYGEGGSRKKEQLTYFL  401
              L+GEGGSRKK+QLTYFL
Sbjct  803   ELFGEGGSRKKQQLTYFL  820



>ref|XP_010230990.1| PREDICTED: spermatogenesis-associated protein 5-like isoform 
X2 [Brachypodium distachyon]
Length=781

 Score =   947 bits (2449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 494/805 (61%), Positives = 606/805 (75%), Gaps = 61/805 (8%)
 Frame = -1

Query  2722  YYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFG  2543
             + + EQT+ +L SAAFVHLK AD +KH RNLS ASR ILLSGP E Y Q LA+AL+HY+ 
Sbjct  7     HRMLEQTKEVLISAAFVHLKQADLSKHIRNLSAASRAILLSGPTEPYLQSLARALSHYYK  66

Query  2542  AKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTL  2363
              +LL+LD+TDFSL++QSKYGSS       +S+SETT  R+S+F+GSF++   K+E + +L
Sbjct  67    TRLLILDITDFSLRIQSKYGSSTKTLVQNQSMSETTFGRVSDFIGSFAMFPKKDEPRESL  126

Query  2362  RRQSSGVDIPSKG--IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDE  2189
             RRQ+S  D  ++G  +  SS+P+  +  S  S   +  +  +  S      R +S  FDE
Sbjct  127   RRQTSSADFRARGSDVIASSDPSIRKNVSMPSDTSDLASQCSGHS----ARRANSWCFDE  182

Query  2188  KLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIV  2009
             K+LIQ+LYKV++ V+++ PI+LY+RD +  L RS++ Y + QKML +LSG VLILGSR++
Sbjct  183   KVLIQSLYKVMISVAESDPIILYIRDVDHFLHRSQRTYSIFQKMLSKLSGQVLILGSRLL  242

Query  2008  DPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLA  1829
             + G +Y ++DER+S +FPY+++IKPPE+E HL  WK Q++ED K +Q QDN+NHI+EVL+
Sbjct  243   NSGAEYNDVDERVSGMFPYHVDIKPPEDEIHLNGWKIQMDEDAKKIQIQDNRNHIVEVLS  302

Query  1828  ANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGM  1649
             AND++CDDL SIC ADTM LSNYIEE++VSA+SYHL++ KDPEY+N KL++SSKSLSHG+
Sbjct  303   ANDLDCDDLSSICQADTMVLSNYIEEIIVSAVSYHLIHNKDPEYKNGKLLLSSKSLSHGL  362

Query  1648  NIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAP---GSKPETGsaa  1478
             +IF +E    GKD LK+E+  E SK+   G  GSK  ET  +S T P   G  P      
Sbjct  363   SIF-QESGHGGKDTLKMEANDE-SKDGLKGAAGSKNSETD-KSGTMPVKDGDAPPP----  415

Query  1477  papapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLH  1298
                                PE+P DNEFEKRIRPEVIPA EIGVTF DIGAL +IKESL 
Sbjct  416   ------------------KPEIP-DNEFEKRIRPEVIPANEIGVTFDDIGALADIKESLQ  456

Query  1297  ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSK  1118
             ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA +AGASFINVSMSTITSK
Sbjct  457   ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANDAGASFINVSMSTITSK  516

Query  1117  WFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLL  938
             WFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDG+L
Sbjct  517   WFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARCGEHEAMRKIKNEFMSHWDGIL  576

Query  937   TKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDL  758
             +K GERILVLAATNRPFDLDEAIIRRFERRIMVGLPT E RELIL+TLL+KE V K ++ 
Sbjct  577   SKSGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTQESRELILRTLLSKEKVDKDIEF  636

Query  757   KQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRL----------AQECPN  608
             K+LATMTEGY+GSDLKNLC TAAYRPVREL+K+ERLK++E++            A + P 
Sbjct  637   KELATMTEGYSGSDLKNLCVTAAYRPVRELLKKERLKELERREKEAKQKTTAVDASDNPE  696

Query  607   C----------------GDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIM  476
                              G++    E   E  I +RPL M+D  +AKNQVAASFAAEG++M
Sbjct  697   SKEENSDSKEDNPESKDGNSEAKAESDKEAGIDLRPLTMEDLKQAKNQVAASFAAEGAVM  756

Query  475   NELKQWNNLYGEGGSRKKEQLTYFL  401
             NELKQWN LYGEGGSRKK+QLTYFL
Sbjct  757   NELKQWNELYGEGGSRKKQQLTYFL  781



>ref|XP_006645663.1| PREDICTED: uncharacterized protein LOC102720661 [Oryza brachyantha]
Length=725

 Score =   945 bits (2442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 498/735 (68%), Positives = 577/735 (79%), Gaps = 20/735 (3%)
 Frame = -1

Query  2575  MLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS-SRNESSFKRSISETTLNRMSEFLGSFS  2399
             MLAKALAHYF A+LLLLD TDF +K+ +KYG+ S  E+SFKRSISETTL R+S  LGS S
Sbjct  1     MLAKALAHYFEARLLLLDPTDFLIKIHNKYGTGSSTETSFKRSISETTLERVSGLLGSLS  60

Query  2398  ILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPL  2219
             IL  KE+ KGT+RRQSS  D+  +  E   +   L+RN+S+S++M++L S    +NPG L
Sbjct  61    ILPQKEKPKGTIRRQSSMTDMKLRSSESMGSLPKLKRNASSSSDMSSLASQGPPNNPGSL  120

Query  2218  MRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSG  2039
              R SS +FDEK+L+QALYKVL  VSK  PIVLY+RD EK L +S K+Y++ +K+L +L G
Sbjct  121   RRASSWTFDEKILVQALYKVLHSVSKKNPIVLYIRDVEKFLHKSTKMYVMFEKLLNKLEG  180

Query  2038  SVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQD  1859
              VL+LGSRIV+   D  ELDERL+ +FPYNIEIKPPE E+HLVSW SQLEEDMKM+Q+QD
Sbjct  181   PVLVLGSRIVEMDFD-EELDERLTDLFPYNIEIKPPENESHLVSWNSQLEEDMKMIQFQD  239

Query  1858  NKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLV  1679
             N+NHI EVLA ND+ECDDLGSIC++DTM L  YIEE+VVSA+SYHLMN KDPEYRN KL+
Sbjct  240   NRNHITEVLAENDLECDDLGSICLSDTMFLGRYIEEIVVSAVSYHLMNNKDPEYRNGKLI  299

Query  1678  ISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGS-  1502
             +S+KSLSH + IF+E K    KD +KLE+K + SK +  G      P   A+S T P + 
Sbjct  300   LSAKSLSHALEIFQENKMC-DKDSMKLEAKCDASKVSGKG----IAP-VAAKSETKPATL  353

Query  1501  --------KPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGV  1346
                                A   +   +   A KAPEVPPDNEFEKRIRPEVIPA EIGV
Sbjct  354   LPPVAPPAAAAAPPVESKTAEKFEKKDNPPPAAKAPEVPPDNEFEKRIRPEVIPANEIGV  413

Query  1345  TFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKE  1166
             TF DIGAL +IKESL ELVMLPL+RPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA E
Sbjct  414   TFDDIGALSDIKESLQELVMLPLKRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANE  473

Query  1165  AGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEA  986
             A ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+RAGEHEA
Sbjct  474   AQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRNRAGEHEA  533

Query  985   MRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELI  806
             MRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RELI
Sbjct  534   MRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLDEAIIRRFERRIMVGLPSLESRELI  593

Query  805   LKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRL  626
             L++LL+KE V  VLD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI Q+  K   +K+ 
Sbjct  594   LRSLLSKEKVDAVLDYKELATMTEGYSGSDLKNLCTTAAYRPVRELI-QKERKKELEKKK  652

Query  625   AQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLY  446
              +   N  DA    E   +  I +RPLNM D  EAKNQVAASFAAEG+IM ELKQWN LY
Sbjct  653   RESGGNASDASKMKEK--DETIILRPLNMKDLKEAKNQVAASFAAEGTIMGELKQWNELY  710

Query  445   GEGGSRKKEQLTYFL  401
             GEGGSRKK+QLTYFL
Sbjct  711   GEGGSRKKQQLTYFL  725



>emb|CDY49165.1| BnaA10g06290D [Brassica napus]
Length=781

 Score =   940 bits (2430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 502/823 (61%), Positives = 611/823 (74%), Gaps = 74/823 (9%)
 Frame = -1

Query  2845  QTVSKW---TGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ +W   +GS  + +T + MEQE++  IVDGR+S VTFDEFPY+LSE+TRVLLTSAA+
Sbjct  25    QSLGRWANGSGSVEDGLTGEQMEQELVRQIVDGRESTVTFDEFPYFLSERTRVLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK  + +KHTRNL+PAS+ ILLSGPAE YQQMLAKAL+HY  +KLLLLD+TDFS+K+Q
Sbjct  85    VHLKELEISKHTRNLAPASKAILLSGPAEFYQQMLAKALSHYCESKLLLLDITDFSIKIQ  144

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKE-EKKGTLRRQSSGVDIPSKGIE  2318
             SKYG ++ +   KRSISE TL++MS  +GSFS+L   E E +G LRR +SG  + S  ++
Sbjct  145   SKYGCTKRKPLHKRSISELTLDKMSSLMGSFSMLSQFEVEPRGALRRDTSGNVLKSSSLD  204

Query  2317  GSSNPTTlrrnssasanmnnltSYNTTSNP--GPLMRTSSLSFDEKLLIQALYKVLVKVS  2144
              SS P   +RN+             +TSN       R+++L FDEKL +Q+LYKV+V VS
Sbjct  205   SSSLPPRHKRNAI------------STSNSVTASSKRSTNLCFDEKLFLQSLYKVVVFVS  252

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSS  1964
             KT P+++YLRD EKLL  SE+ Y L Q +L ++SG VLILGS +++P +D +E+ E +++
Sbjct  253   KTNPLIIYLRDVEKLL-ESERFYKLFQILLNKISGPVLILGSMVLEPENDCQEVSEGVTA  311

Query  1963  VFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMA  1784
             +FPYNIEI+PPE+E+ LVSWK++LE+DMKM+Q++DNKNHI EVLAANDI+CDDL SIC A
Sbjct  312   LFPYNIEIRPPEDESQLVSWKNRLEDDMKMIQFRDNKNHIAEVLAANDIQCDDLASICHA  371

Query  1783  DTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDIL  1604
             DTM             +S H+           ++V+S+  +S+ +   KE +   GK ++
Sbjct  372   DTMC------------LSNHI----------EQIVVSA--ISYHLIHTKEPEYRNGKLVI  407

Query  1603  KLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVK  1424
               +S +      Q  EK  +G   +   +  P                           K
Sbjct  408   SSKSLSHGLSIFQE-EKRRRGMFKERNDNPLPP--------------------------K  440

Query  1423  APEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLL  1244
             APEV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE K+SL ELVMLPLRRPDLFKGGLL
Sbjct  441   APEVVPDNEFEKRIRPEVIPADEIGVTFADIGSLDETKDSLQELVMLPLRRPDLFKGGLL  500

Query  1243  KPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  1064
             KPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK
Sbjct  501   KPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK  560

Query  1063  VSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFD  884
             VSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDG++TKPGERILVLAATNRPFD
Sbjct  561   VSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGIMTKPGERILVLAATNRPFD  620

Query  883   LDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNL  704
             LDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE     LD  +L  MTEGY+GSDLKNL
Sbjct  621   LDEAIIRRFERRIMVGLPSTESREKILRTLLSKEKTDD-LDFNELGQMTEGYSGSDLKNL  679

Query  703   CTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG--ERVITIRPLNMDDF  530
             C TAAYRPVRELI+QERLKD EKK+  +E     +     ED+   E+ I +RPLNM+D 
Sbjct  680   CITAAYRPVRELIQQERLKDQEKKK-REEAGKSAEESKEKEDEACEEKEIILRPLNMEDM  738

Query  529   MEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +AK QVAASFA+EGS MNELKQWN+LYGEGGSRKKE LTYFL
Sbjct  739   RKAKTQVAASFASEGSGMNELKQWNDLYGEGGSRKKEPLTYFL  781



>gb|EMS51643.1| Spastin [Triticum urartu]
Length=805

 Score =   937 bits (2423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 493/813 (61%), Positives = 607/813 (75%), Gaps = 79/813 (10%)
 Frame = -1

Query  2710  EQTRVLLTSAAFVHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLL  2531
             EQT+ +L SAAFVHLK AD +KH RNLS ASR ILLSGP E Y Q LAKAL+HY+ A+LL
Sbjct  29    EQTKEVLISAAFVHLKQADLSKHIRNLSAASRAILLSGPTEAYLQSLAKALSHYYKARLL  88

Query  2530  LLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQS  2351
             LLDVTDFSL++QSKYG S       +S SETT  R+S+F+GSF++   K+E + +LRRQ+
Sbjct  89    LLDVTDFSLRIQSKYGGSSKALVQNQSASETTFGRVSDFIGSFAMFPKKDEPRESLRRQT  148

Query  2350  SGVDIPSKGIEGSSN-PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQ  2174
             S  D  ++G + +SN P   +  S  S   +  +  +  S      R SS SFDEK+LIQ
Sbjct  149   SSADSRARGSDVASNDPLLRKNASMPSDMSDVASQCSVHS----ARRASSWSFDEKVLIQ  204

Query  2173  ALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDD  1994
             +LYKV++ V+++ PI+LY+RD +  L RS++ Y + Q+ML +LSG VLILGSR+++   +
Sbjct  205   SLYKVMISVAESDPIILYIRDVDHFLHRSQRTYSMFQRMLAKLSGQVLILGSRLLNSDAE  264

Query  1993  YRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIE  1814
             Y ++D+R+S++FPY+++IKPP+EE HL  WK+Q+EED + +Q QDN+NHI+EVL+AND++
Sbjct  265   YSDVDDRVSTLFPYHVDIKPPQEEIHLNGWKTQMEEDARKIQIQDNRNHIVEVLSANDLD  324

Query  1813  CDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE  1634
             CDDL SIC ADTM LSNYIEE++VSA+SYHL++T DPEY+N KL++SSKSLSHG++IF +
Sbjct  325   CDDLSSICQADTMVLSNYIEEIIVSAVSYHLVHTNDPEYKNGKLLLSSKSLSHGLSIF-Q  383

Query  1633  EKTAAGKDILKLESKAELSKETQSGEKGSKGPE---TKAESSTAPGSKPETGsaapapap  1463
             E    GKD LKLE+  +  K    G  GSK PE   +  +   AP  KPE          
Sbjct  384   ETGLGGKDTLKLEANEDGLK----GAPGSKKPENDKSPGKDGDAPPQKPEI---------  430

Query  1462  ttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVML  1283
                               PDNEFEKRIRPEVIP  E+GVTF DIGAL +IKESL ELVML
Sbjct  431   ------------------PDNEFEKRIRPEVIPPSELGVTFDDIGALADIKESLQELVML  472

Query  1282  PLRRPDLFKGG-LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGE  1106
             PLRRPDLFKGG LLKPCRGILLFGPPGTGKTMLAKAIA +AGASFINVSMSTITSKWFGE
Sbjct  473   PLRRPDLFKGGGLLKPCRGILLFGPPGTGKTMLAKAIANDAGASFINVSMSTITSKWFGE  532

Query  1105  DEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPG  926
             DEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDG+L+K G
Sbjct  533   DEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARCGEHEAMRKIKNEFMSHWDGILSKSG  592

Query  925   ERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLA  746
             ERILVLAATNRPFDLDEAIIRRFERRIMVGLPT + RELIL+T+L+KE V K ++ K+LA
Sbjct  593   ERILVLAATNRPFDLDEAIIRRFERRIMVGLPTQDSRELILRTVLSKEKVDKDIEYKELA  652

Query  745   TMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEK---------------------KR  629
             TMTEGY+GSDLKNLC TAAYRPVREL+K+ERLK++E+                     K+
Sbjct  653   TMTEGYSGSDLKNLCVTAAYRPVRELLKKERLKEMERRKTEAKQKTAAAAEDSDKAESKK  712

Query  628   LAQECPNC----------GDAPT---ANEDKGE----RVITIRPLNMDDFMEAKNQVAAS  500
             ++ E  +           GD+ +   A+E K E     V+ +RPL M+D  +AKNQVAAS
Sbjct  713   VSSENKDSSEKVDSDGKEGDSESKVDASEAKAEGDKEAVVDLRPLTMEDLRQAKNQVAAS  772

Query  499   FAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             FAAEG++MNELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  773   FAAEGAVMNELKQWNDLYGEGGSRKKEQLTYFL  805



>gb|KEH21162.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=703

 Score =   934 bits (2415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/675 (71%), Positives = 555/675 (82%), Gaps = 9/675 (1%)
 Frame = -1

Query  2845  QTVSKWTGS---SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q VSKW  +   SSNAVT D +E EML  IVDGR+S VTFD+FPYYLSEQTRVLLTSAA+
Sbjct  30    QNVSKWGPNYSFSSNAVTADKIEHEMLRQIVDGRESNVTFDKFPYYLSEQTRVLLTSAAY  89

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK A+ +K+TRNL+PASRTILLSGPAELYQQ+LAKALAHYF AKLLLLD+TDFSLK+Q
Sbjct  90    VHLKHAEVSKYTRNLAPASRTILLSGPAELYQQVLAKALAHYFEAKLLLLDLTDFSLKIQ  149

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKK--GTLRRQSSGVDIPSKGI  2321
              KYG+   E SFKRS SE+TL ++S+  GSFSI   +EE K  G + RQSSG+D+ S G 
Sbjct  150   GKYGTGNKEFSFKRSTSESTLEKLSDIFGSFSIFSQREEPKVSGKMNRQSSGMDLQSMGD  209

Query  2320  EGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSK  2141
             E S NP  LRRN+S+++N++ LTS +  +NP PL RT+S SFDEKLLIQ+LYKVL+ VSK
Sbjct  210   EASCNPPKLRRNASSTSNISGLTSQSNPTNPAPLKRTASWSFDEKLLIQSLYKVLLSVSK  269

Query  2140  TCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSV  1961
             T PIVLYLRD ++LL RS+K+Y + QKML+RLSG +LILGSR++D G+++ ELDE+L+ +
Sbjct  270   TYPIVLYLRDVDRLLSRSQKIYNMFQKMLKRLSGPILILGSRVLDSGNEFEELDEKLTVL  329

Query  1960  FPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMAD  1781
             FPY+IEI+PPE+E+HLVSWKSQLEEDMKM+Q QDNKNHI EVLAAND++CDDL SIC+ D
Sbjct  330   FPYDIEIRPPEDESHLVSWKSQLEEDMKMIQVQDNKNHITEVLAANDLDCDDLDSICVED  389

Query  1780  TMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILK  1601
             TM LSNYIEE++VSAIS+HLM  KD EYRN KL+IS  SLSH + IF++ K + G+D  K
Sbjct  390   TMVLSNYIEEIIVSAISHHLMKNKDLEYRNGKLIISCNSLSHALGIFRKGKFS-GRDTSK  448

Query  1600  LESKAELSKETQSGEKGSKGPETKAESST-APGSKP-ETGsaapapapttkdatsSGTAV  1427
             LE +A L  E  S  +    P  KAES+  A G+ P +   A  + +     A     A 
Sbjct  449   LEDQA-LKSEIPSVVETVAKPAVKAESAAPADGAAPVKKAEAEISTSVAKAGAEKPVAAS  507

Query  1426  KAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGL  1247
             KA EVPPDNEFEKRIRPEVIPA EI VTF+DIGAL+E KESL ELVMLPLRRPDLF GGL
Sbjct  508   KASEVPPDNEFEKRIRPEVIPANEIDVTFSDIGALEETKESLQELVMLPLRRPDLFTGGL  567

Query  1246  LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAA  1067
             LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA+
Sbjct  568   LKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAS  627

Query  1066  KVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPF  887
             KVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGL TK GERILVLAATNRPF
Sbjct  628   KVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLTTKQGERILVLAATNRPF  687

Query  886   DLDEAIIRRFERRIM  842
             DLDEAIIRRFERR +
Sbjct  688   DLDEAIIRRFERRCV  702



>ref|XP_010482667.1| PREDICTED: suppressor protein of bem1/bed5 double mutants-like 
isoform X2 [Camelina sativa]
Length=726

 Score =   934 bits (2413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 484/745 (65%), Positives = 592/745 (79%), Gaps = 39/745 (5%)
 Frame = -1

Query  2575  MLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSI  2396
             MLAKAL+HYF +KLLLLD+TDFS+K+QSKYG ++ E   KRSISE TL++MS F+GSFS+
Sbjct  1     MLAKALSHYFESKLLLLDITDFSIKIQSKYGCTKREPFHKRSISEFTLDKMSSFMGSFSM  60

Query  2395  LQPKE-EKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPL  2219
             L  +E E +GTLRR  SG D+ S+ +E S+     +RN+SA++++++++S +++S     
Sbjct  61    LSQREVEPRGTLRRPISGNDLNSRSMESSNRLPRHKRNASAASDISSISSRSSSSVSASS  120

Query  2218  MRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSG  2039
              R+++L FDEKL +Q+LYKVLV VS+T P+++YLRD EKLL  SE+ Y L Q++L +LSG
Sbjct  121   KRSTNLCFDEKLFLQSLYKVLVTVSETSPLIIYLRDVEKLL-ESERFYKLFQRLLNKLSG  179

Query  2038  SVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQD  1859
              VL+LGSR+++P DD++E+ E +S++FPYNIEI+PPE+E+ L+SWKS+LE+DMKM+Q+QD
Sbjct  180   PVLLLGSRVLEPEDDFQEVGEGVSALFPYNIEIRPPEDESQLMSWKSRLEDDMKMIQFQD  239

Query  1858  NKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLV  1679
             NKNHI EVLAANDI+CDDL SIC ADTM LSN+IEE+VVSAI+YHL++TK+PEYRN KLV
Sbjct  240   NKNHIAEVLAANDIQCDDLASICHADTMCLSNHIEEIVVSAITYHLIHTKEPEYRNGKLV  299

Query  1678  ISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSK---ETQSGEKGSKGPETKAESSTA-  1511
             ISSKSLSHG++IF+E    + +D +KL++  +  +   E  S  +   G E K ES  + 
Sbjct  300   ISSKSLSHGLSIFQEGGNKSFEDSMKLDTNTDSKRKEGEVSSKSESKSGSENKNESEKSL  359

Query  1510  PGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADI  1331
             P +K +                      KAPEV PDNEFEKRIRPEVIPA EIGVTFADI
Sbjct  360   PSNKNDNP-----------------LPPKAPEVVPDNEFEKRIRPEVIPADEIGVTFADI  402

Query  1330  GALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASF  1151
             G+LDE K+SL ELVMLPLRRPDLF+GGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASF
Sbjct  403   GSLDETKDSLQELVMLPLRRPDLFQGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASF  462

Query  1150  INVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIK  971
             INVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIK
Sbjct  463   INVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIK  522

Query  970   NEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLL  791
             NEFM+HWDGL+TKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL
Sbjct  523   NEFMTHWDGLMTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSIESREKILRTLL  582

Query  790   AKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKR------  629
             +KE   + LD  ++A MT+GY+GSDLKNLC TAAYRPVRELI+QERLKD E+K+      
Sbjct  583   SKEKT-ENLDFHEIAQMTDGYSGSDLKNLCITAAYRPVRELIQQERLKDQERKKKEEAGK  641

Query  628   ---------LAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIM  476
                        +      +      +  ERVIT+RPLNM+D  +AKNQVAASFA+EG+ M
Sbjct  642   STEESKEEEAGKSTEKSKEEAAGASESEERVITLRPLNMEDMRKAKNQVAASFASEGAGM  701

Query  475   NELKQWNNLYGEGGSRKKEQLTYFL  401
             NELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  702   NELKQWNDLYGEGGSRKKEQLTYFL  726



>ref|XP_009416408.1| PREDICTED: ribosome biogenesis ATPase RIX7-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=716

 Score =   931 bits (2406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 469/729 (64%), Positives = 565/729 (78%), Gaps = 17/729 (2%)
 Frame = -1

Query  2575  MLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSI  2396
             MLAKALAHY+ AKLLLLDVT+FS+K+Q+K G    +   KRS+SE TL R+S  LGS S 
Sbjct  1     MLAKALAHYYEAKLLLLDVTEFSIKIQNKCGGCNKDMFVKRSMSEATLGRLSGILGSLST  60

Query  2395  LQPKEEKKGTLRRQSSGVDI----PSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNP  2228
             +   EE +G  RRQSS +++    P      +  P T   ++      +   S N   NP
Sbjct  61    ILRMEESEGMFRRQSSSMELRQRRPDYANSTNELPKTASFSAEMGGLTSQHGSRNMV-NP  119

Query  2227  GPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRR  2048
                 R+S  SFDEK+LI +LYKVL+ +SK+ PI+LY+RD E  +CRSE+VY L QKML +
Sbjct  120   K---RSSCWSFDEKILIHSLYKVLILISKSNPIILYIRDVEHFICRSERVYSLFQKMLTK  176

Query  2047  LSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQ  1868
             LSG V+ILGSR+ +P +  +++D RL+++FPYNIEIKPPE+E HLVSWKSQLE+D K +Q
Sbjct  177   LSGHVIILGSRLSEPDNCCKDVDARLTTLFPYNIEIKPPEDENHLVSWKSQLEKDTKTIQ  236

Query  1867  YQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNA  1688
              QDN+NHI EVLAAND+ECDDLG+IC++D + LS YIEE+VVSA+SYHLMN KDP+YRN 
Sbjct  237   IQDNRNHITEVLAANDLECDDLGTICLSDILVLSTYIEEIVVSAVSYHLMNNKDPQYRNG  296

Query  1687  KLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAP  1508
             KLVI+SKSLSHG++IF++ +   GKD LKLE+ AE  ++     + +  PE   E+   P
Sbjct  297   KLVITSKSLSHGLSIFQDSRLC-GKDTLKLEASAESEEDVNEDARTATKPENNGEA-LLP  354

Query  1507  GSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIG  1328
             G+K ET  +               T +K PEV PDNEFEKRIRPEVIPA EIGVTF DIG
Sbjct  355   GNKSETEKSTTLVKDGETL-----TPIKVPEVAPDNEFEKRIRPEVIPANEIGVTFDDIG  409

Query  1327  ALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFI  1148
             ALDE KESL EL++LPL+RPDLFKG LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFI
Sbjct  410   ALDETKESLQELIILPLQRPDLFKG-LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFI  468

Query  1147  NVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKN  968
             NVSMSTITSKWFGEDEK+VRALFTLAAKV+PTIIFVDEVD MLGQR+R GEHEAMRKIKN
Sbjct  469   NVSMSTITSKWFGEDEKHVRALFTLAAKVAPTIIFVDEVDGMLGQRTRVGEHEAMRKIKN  528

Query  967   EFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLA  788
             EFM+ WDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+ LL+
Sbjct  529   EFMTRWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSLESRESILRKLLS  588

Query  787   KETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPN  608
             KE V + LD K+LATMTEGY+GSDLKNLC TAAYRP+RELI++ER K++ KK+  +E  +
Sbjct  589   KEKV-EGLDYKELATMTEGYSGSDLKNLCITAAYRPLRELIQRERSKELGKKQKTEEGES  647

Query  607   CGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSR  428
                     ++  +  I +RPLNMDD  +AKNQVAASFAAEGS+MNELKQWN+LYG+GGSR
Sbjct  648   SSAGSENRDEDDQPAIALRPLNMDDLRQAKNQVAASFAAEGSVMNELKQWNDLYGDGGSR  707

Query  427   KKEQLTYFL  401
             K++QLTYFL
Sbjct  708   KRQQLTYFL  716



>ref|XP_009119824.1| PREDICTED: spastin isoform X4 [Brassica rapa]
Length=705

 Score =   916 bits (2368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 481/730 (66%), Positives = 576/730 (79%), Gaps = 30/730 (4%)
 Frame = -1

Query  2575  MLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSI  2396
             MLAKAL+HY  +KLLLLD+TDFS+K+QSKYG ++ +   KRSISE TL++MS  +GSFS+
Sbjct  1     MLAKALSHYCESKLLLLDITDFSIKIQSKYGCTKRKPLHKRSISELTLDKMSSLMGSFSM  60

Query  2395  LQPKE-EKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNP--G  2225
             L   E E +G LRR +SG  + S  ++ SS P   +RN+             +TSN    
Sbjct  61    LSQFEVEPRGALRRDTSGNVLKSSSLDSSSLPPRHKRNAI------------STSNSVTA  108

Query  2224  PLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRL  2045
                R+++L FDEKL +Q+LYKV+V VSKT P+++YLRD EKLL  SE+ Y L Q +L ++
Sbjct  109   SSKRSTNLCFDEKLFLQSLYKVVVFVSKTNPLIIYLRDVEKLL-ESERFYKLFQILLNKI  167

Query  2044  SGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQY  1865
             SG VLILGS +++P DD +E+ E ++++FPYNIEI+PPE+E+ LVSWK++LE+DMKM+Q+
Sbjct  168   SGPVLILGSMVLEPEDDCQEVSEGVTALFPYNIEIRPPEDESQLVSWKNRLEDDMKMIQF  227

Query  1864  QDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAK  1685
             +DNKNHI EVLAANDI+CDDL SIC ADTM LSN+IE++VVSAISYHL++TK+PEYRN K
Sbjct  228   RDNKNHIAEVLAANDIQCDDLASICHADTMCLSNHIEQIVVSAISYHLIHTKEPEYRNGK  287

Query  1684  LVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPG  1505
             LVISSKSLSHG++IF+E  + + +D LKL++  +  +  + GE  SK  E+K ES  +P 
Sbjct  288   LVISSKSLSHGLSIFQEGGSRSSEDSLKLDTNTDSKR--KGGEVCSKS-ESKPES-YSPE  343

Query  1504  SKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGA  1325
             +K E             +   +    KAPEV PDNEFEKRIRPEVIPA EIGVTFADIG+
Sbjct  344   NKNEL------EKSLPSNKNDNPLPPKAPEVVPDNEFEKRIRPEVIPADEIGVTFADIGS  397

Query  1324  LDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFIN  1145
             LDE K+SL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFIN
Sbjct  398   LDETKDSLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFIN  457

Query  1144  VSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNE  965
             VSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNE
Sbjct  458   VSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNE  517

Query  964   FMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAK  785
             FM+HWDGL+TKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+K
Sbjct  518   FMTHWDGLMTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPSTESREKILRTLLSK  577

Query  784   ETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNC  605
             E     LD  +L  MTEGY+GSDLKNLC TAAYRPVRELI+QERLKD EKK+  +E    
Sbjct  578   EKTDD-LDFNELGQMTEGYSGSDLKNLCITAAYRPVRELIQQERLKDQEKKK-REEAGKS  635

Query  604   GDAPTANEDKG--ERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGS  431
              +     ED+   E+ I +RPLNM+D  +AK QVAASFA+EGS MNELKQWN+LYGEGGS
Sbjct  636   AEESKEKEDEACEEKEIILRPLNMEDMRKAKTQVAASFASEGSGMNELKQWNDLYGEGGS  695

Query  430   RKKEQLTYFL  401
             RKKE LTYFL
Sbjct  696   RKKEPLTYFL  705



>emb|CAB36769.1| putative protein [Arabidopsis thaliana]
 emb|CAB79602.1| putative protein [Arabidopsis thaliana]
Length=726

 Score =   908 bits (2347),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 479/819 (58%), Positives = 591/819 (72%), Gaps = 121/819 (15%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR+S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRESSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHLK +D +KHTRNL+P                          G+K +LL          
Sbjct  85    VHLKQSDISKHTRNLAP--------------------------GSKAILLS---------  109

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
                G +  E  + R                       +E+  TLRR +SG D+ S+G + 
Sbjct  110   ---GPADTEQVWMR-----------------------QERTWTLRRHTSGNDLHSRGFDV  143

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             +S P  L+RN+SA+++M++++S + TS      R+++L FDE+L +Q+LYKVLV +S+T 
Sbjct  144   TSQPPRLKRNASAASDMSSISSRSATSVSASSKRSANLCFDERLFLQSLYKVLVSISETN  203

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             PI++YLRD EKL C+SE+ Y L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FP
Sbjct  204   PIIIYLRDVEKL-CQSERFYKLFQRLLTKLSGPVLVLGSRLLEPEDDCQEVGEGISALFP  262

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             YNIEI+PPE+E  L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  263   YNIEIRPPEDENQLMSWKTRFEDDMKVIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  322

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LS++IEE+VVSAISYHLMN K+PEY+N +LVISS SLSHG+NI +E +    +D LKL+
Sbjct  323   FLSSHIEEIVVSAISYHLMNNKEPEYKNGRLVISSNSLSHGLNILQEGQ-GCFEDSLKLD  381

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
                                                                  T + + E
Sbjct  382   -----------------------------------------------------TNIDSKE  388

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             V PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  389   VAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPC  448

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  449   RGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  508

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLDE
Sbjct  509   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNAGDRILVLAATNRPFDLDE  568

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD ++LA MT+GY+GSDLKN CTT
Sbjct  569   AIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFQELAQMTDGYSGSDLKNFCTT  627

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKG-ERVITIRPLNMDDFMEAK  518
             AAYRPVRELIKQE LKD E+++  +   N  +   A E+   ER IT+RPL+M+D   AK
Sbjct  628   AAYRPVRELIKQECLKDQERRKREEAEKNSEEGSEAKEEVSEERGITLRPLSMEDMKVAK  687

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  688   SQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  726



>ref|XP_006842611.1| hypothetical protein AMTR_s00077p00173880 [Amborella trichopoda]
 gb|ERN04286.1| hypothetical protein AMTR_s00077p00173880 [Amborella trichopoda]
Length=833

 Score =   905 bits (2340),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 491/852 (58%), Positives = 612/852 (72%), Gaps = 84/852 (10%)
 Frame = -1

Query  2836  SKWTGSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSA  2657
             ++W+ S+   +  ++ E E++  + +G+ + +TFDEFPYYLSEQT++LLT++A+VHLK  
Sbjct  26    TRWSSSNGPNLAENV-EIELMKLVSEGKHTGITFDEFPYYLSEQTKMLLTNSAYVHLKQT  84

Query  2656  DFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSS  2477
             + +K+TRNLS AS+ ILLSGPAE YQQMLAKALA +F AKLLL DVTDFSLK+QSKYGS+
Sbjct  85    ELSKYTRNLSSASKAILLSGPAEPYQQMLAKALAQHFEAKLLLFDVTDFSLKIQSKYGSN  144

Query  2476  RNESSFKRS--ISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNP  2303
              N +    S  +S  T +  S  L   SI   ++E             +  +G EG+   
Sbjct  145   NNGTEVTSSNLMSSKTFDCFSNLLERLSIPSLRDE-------------LGLRGAEGT---  188

Query  2302  TTlrrnssasanmnnltSYNTTSNPGP-------LMRTSSLSFDEKLLIQALYKVLVKVS  2144
                                N T N GP         R++  +FDEKLL+Q+LYKV+  VS
Sbjct  189   ----------------IKGNGTCNSGPSSSGAVTAKRSNQWAFDEKLLVQSLYKVISSVS  232

Query  2143  KTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPG---DDYRELDER  1973
             KT PI+LYLRD EKLL +S+++Y L QKM+ +LSG VLILGSRI D     D+   +DE+
Sbjct  233   KTTPIILYLRDIEKLLSKSQRMYSLSQKMISKLSGPVLILGSRIYDHSCDKDNSIVIDEK  292

Query  1972  LSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSI  1793
             +  +FPY IE+KPPE +  L  WK QLEEDMK++Q QDN+NHI EVL AN+++CDDL SI
Sbjct  293   VLQLFPYKIEVKPPENDAELAQWKIQLEEDMKVIQVQDNRNHITEVLTANNLDCDDLSSI  352

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
             C+ADT  LSNYIEE+V+SA S+HL N + PEYRN KLVIS+KSL+HG+++F+E+    G 
Sbjct  353   CVADTEVLSNYIEEIVMSAFSHHLKNNESPEYRNGKLVISAKSLAHGLSLFQEDDVN-GN  411

Query  1612  DILKLESKAELSKETQSGEKGSKGPET--KAESSTAPGSKPETGsaapapapttkdatsS  1439
             D L++ + +E  KETQ  E GS   +T  KAE+  AP +K E          +   A   
Sbjct  412   DSLQIGASSESVKETQD-ETGSSTEKTEPKAEAG-APENKTE-------GEKSGPAAKKE  462

Query  1438  GTAVKA-PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDL  1262
                VK   EV PDNEFEKR+R EVIPA +IGVTF+DIGAL++ K+ L ELVMLPLRRPDL
Sbjct  463   SDGVKPLKEVVPDNEFEKRVRQEVIPASDIGVTFSDIGALEDTKKVLEELVMLPLRRPDL  522

Query  1261  FKGG-LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRA  1085
             FKGG LL+PCRGILLFGPPGTGKTMLAKAIAKEAGASFIN+SMS++TSKWFGEDEK VRA
Sbjct  523   FKGGGLLRPCRGILLFGPPGTGKTMLAKAIAKEAGASFINMSMSSVTSKWFGEDEKTVRA  582

Query  1084  LFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLA  905
             +FTLAAK++PTIIF+DEVDSMLGQRSR GEHEAMRKIKNEFM+HWDGLLTK  ERILVLA
Sbjct  583   VFTLAAKLAPTIIFIDEVDSMLGQRSRTGEHEAMRKIKNEFMAHWDGLLTKSNERILVLA  642

Query  904   ATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYT  725
             ATNRPFDLDEAIIRRFERRIMVGLP+ E RE+IL+TLLAKE   + LD K+LA+MTEGY+
Sbjct  643   ATNRPFDLDEAIIRRFERRIMVGLPSVESREMILRTLLAKEATEE-LDFKELASMTEGYS  701

Query  724   GSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECP--NCGDAPTANEDKGE------  569
             GSDLKNLCTTAAYRPVREL+K+E  K+ EKK+ + E       +   ANE++ E      
Sbjct  702   GSDLKNLCTTAAYRPVRELLKKEIEKEKEKKQESDEISKEKSDNKSEANEERPESSNSSG  761

Query  568   ----------------RVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEG  437
                              VI +RPL MDD  +AKNQVA SFA+EG++M+EL++WN+LYGEG
Sbjct  762   KGDEEAKEQKKEEEAEAVIPLRPLTMDDLRQAKNQVAPSFASEGAVMSELQRWNDLYGEG  821

Query  436   GSRKKEQLTYFL  401
             GSRKK+ L+YFL
Sbjct  822   GSRKKQTLSYFL  833



>ref|XP_011047747.1| PREDICTED: peroxisomal biogenesis factor 6-like isoform X3 [Populus 
euphratica]
Length=687

 Score =   899 bits (2324),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 471/671 (70%), Positives = 537/671 (80%), Gaps = 37/671 (6%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q VS+W G   S + VT + +EQE++  +VDGRDSKVTFDEFPYYLSE+T++LLTSAAFV
Sbjct  27    QKVSRWAGGCGSIDGVTAEQIEQELMRQVVDGRDSKVTFDEFPYYLSEKTQMLLTSAAFV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK ADF+KHTRNLSPASR ILLSGPAE Y QMLAKALAH F +KLLLLDV+DFS+K+QS
Sbjct  87    HLKHADFSKHTRNLSPASRAILLSGPAEFYLQMLAKALAHNFESKLLLLDVSDFSMKMQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG S+ ESSFKRSIS  TL RMS   GSFSIL PKEE               ++G EGS
Sbjct  147   KYGCSKKESSFKRSISGVTLERMSSLFGSFSILSPKEE---------------TRGKEGS  191

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SN   LRRN+S +++M+++TS +++ NP PL   SS  FDE L +++LY+VLV VS+   
Sbjct  192   SNSPKLRRNTSTASDMSSMTSQSSSMNPAPLKHPSSWCFDENLFLRSLYQVLVSVSERSS  251

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LYLRD EKLL +S+++Y LL K+L++LSG+VLILGSR++D  DD +E D RL+ +FPY
Sbjct  252   IILYLRDVEKLLLQSQRMYNLLDKLLKKLSGNVLILGSRMLDQEDDCKEADGRLAMLFPY  311

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE+ETHLVSWK+QLEEDMK +Q+QDNKNHI EVLAANDIECDDL SIC ADTM 
Sbjct  312   NIEIKPPEDETHLVSWKAQLEEDMKKIQFQDNKNHIAEVLAANDIECDDLSSICHADTMV  371

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE-  1595
             LSNYIEE+VVSAISYHLMN KDPEYRN KL+ISSKSLSHG++IF+E K+  GKD LKLE 
Sbjct  372   LSNYIEEIVVSAISYHLMNNKDPEYRNGKLLISSKSLSHGLSIFQEGKSD-GKDTLKLEI  430

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             +     +       G+K      +  +  G+K                        KAPE
Sbjct  431   NAEAGKEAEGEEPDGAKNDSKTEKEKSVTGAKDSENQP------------------KAPE  472

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             VPPDNEFEKRIRPEVIPA EIGVTFADIGALDE KESL ELVMLPLRRPDLF GGLLKPC
Sbjct  473   VPPDNEFEKRIRPEVIPANEIGVTFADIGALDETKESLQELVMLPLRRPDLFNGGLLKPC  532

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP
Sbjct  533   RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  592

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGLLTKPGERILVLAATNRPFDLDE
Sbjct  593   TIIFVDEVDSMLGQRTRFGEHEAMRKIKNEFMTHWDGLLTKPGERILVLAATNRPFDLDE  652

Query  874   AIIRRFERRIM  842
             AIIRRFERR +
Sbjct  653   AIIRRFERRYV  663



>ref|XP_004971479.1| PREDICTED: spastin-like [Setaria italica]
Length=694

 Score =   899 bits (2322),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 472/701 (67%), Positives = 549/701 (78%), Gaps = 28/701 (4%)
 Frame = -1

Query  2449  ISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasa  2270
             ISET   R++  LGS SIL  KE+ K T+RRQSS  D+  +  E  SN   LRRN+S S+
Sbjct  4     ISETMFERVTGLLGSLSILPQKEQPKETIRRQSSMTDVKLRSSESMSNLPKLRRNASTSS  63

Query  2269  nmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCR  2090
             +M++L S   ++N  PL R SS +FDEK+L+QALYKVL  VSK  PIVLY+RD EK L +
Sbjct  64    DMSSLASQGPSTNTAPLRRASSWTFDEKILVQALYKVLHSVSKKYPIVLYIRDVEKFLHK  123

Query  2089  SEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLV  1910
             S K+Y+L +K+L +L G VL+LGSRIV+   D  ELD+RL+ +FPYNIEIKPPE E HLV
Sbjct  124   SPKMYLLFEKLLNKLEGPVLVLGSRIVEMDVD-EELDDRLTVLFPYNIEIKPPENENHLV  182

Query  1909  SWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAIS  1730
             SW SQLEEDMKM+Q+QDN+NHI+EVLA ND+ECDDLGSIC++DT+ LS YIEE+VVSA+S
Sbjct  183   SWNSQLEEDMKMIQFQDNRNHILEVLAENDLECDDLGSICLSDTIGLSKYIEEIVVSAVS  242

Query  1729  YHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG  1550
             YHLMN ++PEYRN KLVIS+KSLSH + IF+E K +  KD LKLE  A+  K   + EKG
Sbjct  243   YHLMNNREPEYRNGKLVISAKSLSHALEIFQENKMS-DKDSLKLEVTADALK---AAEKG  298

Query  1549  SKGPETKAESSTAPGSKP----------------ETGsaapapapttkdatsSGTAVKAP  1418
             +     K+E+  A    P                     A    P  +   S   A KAP
Sbjct  299   TAPTAAKSETKPATLLPPVRPPAAASAAPAAAAAAAAPPAVESKPAPEKKDSPPPAAKAP  358

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIPA EIGV+F DIGALD+IKESLHELVMLPLRRPDLFKGGLLKP
Sbjct  359   EVPPDNEFEKRIRPEVIPANEIGVSFDDIGALDDIKESLHELVMLPLRRPDLFKGGLLKP  418

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  419   CRGILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  478

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P +RILVLAATNRPFDLD
Sbjct  479   PTIIFVDEVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQRILVLAATNRPFDLD  538

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ E RELI++ LL+KE V + LD K+LATMTEGY+GSDLKNLCT
Sbjct  539   EAIIRRFERRIMVGLPSMESRELIMRRLLSKEKVDEGLDFKELATMTEGYSGSDLKNLCT  598

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGER--VITIRPLNMDDFME  524
             TAAYRPVRELI++ER K++EK +  +     G AP+ +  K E+   I +RPLNM D  E
Sbjct  599   TAAYRPVRELIQKERKKELEKLKREK-----GGAPSDSTKKKEKEEPIILRPLNMTDLKE  653

Query  523   AKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             AKNQVAASFAAEG+IM EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  654   AKNQVAASFAAEGAIMGELRQWNELYGEGGSRKKQQLTYFL  694



>ref|XP_002968827.1| hypothetical protein SELMODRAFT_440620 [Selaginella moellendorffii]
 gb|EFJ29943.1| hypothetical protein SELMODRAFT_440620 [Selaginella moellendorffii]
Length=837

 Score =   895 bits (2312),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 474/836 (57%), Positives = 584/836 (70%), Gaps = 78/836 (9%)
 Frame = -1

Query  2797  DIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPAS  2618
             D++E E+L+ I+DG+DS  TFDEFPYYL+EQTRVLLT+AA+VHLK  +F+K+TRNLSPAS
Sbjct  43    DVLELELLSQIIDGKDSGATFDEFPYYLNEQTRVLLTNAAYVHLKQREFSKYTRNLSPAS  102

Query  2617  RTILLSGPA--ELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSIS  2444
             RTILL+GPA  E YQQMLA+ALAHYF AKLLLLDV+DF  KVQ K+G  +  S     + 
Sbjct  103   RTILLTGPAGAEAYQQMLARALAHYFEAKLLLLDVSDFVSKVQKKHGDVKFSS---EPLP  159

Query  2443  ETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanm  2264
             E     +S+F  +           G+L  Q +    PSK  E  S               
Sbjct  160   EVLFRTVSQFASNV----------GSLATQITSNTSPSKSPENLSKSGKAPEAL------  203

Query  2263  nnltSYNTTSNPGPLMRTSSLS-FDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
                          PL R++SL  F+EK L  AL+KVL  VS + PIVLYLRD E+L+ R 
Sbjct  204   -------------PLRRSNSLGLFEEKSLFNALFKVLASVSGSSPIVLYLRDVERLVSRG  250

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
              K Y L  K L++LSG +L+LGSRI+   D    ++E+L  +F Y I IKPPE+   LVS
Sbjct  251   PKTYSLFLKRLKKLSGPILVLGSRIMQTKDS-ESVNEKLEHLFSYTINIKPPEDNAVLVS  309

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             W+SQLEEDMK +Q QDN+NHI+EVL +ND+ECDDLGSIC +DTM LSNYIEE++VSAIS+
Sbjct  310   WRSQLEEDMKTIQAQDNRNHILEVLGSNDVECDDLGSICFSDTMLLSNYIEEILVSAISH  369

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGS  1547
             HLMNT+ P+YR+ +LVISSKSL++G+ +F+  +  + +  L+ E+K E SK  ++ E  +
Sbjct  370   HLMNTEQPDYRSGRLVISSKSLAYGLELFQAGQLDSNEAKLQAETKVETSK-PEAQETVT  428

Query  1546  KG----------PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNE  1397
             +G           E K E S   G KP+           + D T         +VPPDNE
Sbjct  429   RGNADVKTDVPVAEAKTEVSKPEGPKPDN-------EKKSSDTTKPAPVTTKADVPPDNE  481

Query  1396  FEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF-KGGLLKPCRGILL  1220
             FEKRIRPEVIPA E+GV F DIGALD +KESL ELVMLPLRRP+LF KGGL+KPCRGILL
Sbjct  482   FEKRIRPEVIPAGEVGVNFQDIGALDNVKESLQELVMLPLRRPELFNKGGLIKPCRGILL  541

Query  1219  FGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFV  1040
             FGPPGTGKTMLAKA+A EAGASFINVSMS+ITSKWFGEDEKNVRALFTLAAKV+PTI+F+
Sbjct  542   FGPPGTGKTMLAKAVATEAGASFINVSMSSITSKWFGEDEKNVRALFTLAAKVAPTIVFI  601

Query  1039  DEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRR  860
             DEVDSMLGQRSR GEHEAMRKIKNEFM+HWDGLLTK  ER+LVLAATNRPFDLDEAIIRR
Sbjct  602   DEVDSMLGQRSRVGEHEAMRKIKNEFMAHWDGLLTKGAERVLVLAATNRPFDLDEAIIRR  661

Query  859   FERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRP  680
             FERRIMVGLP  + RE IL+ +L+KE +    D  +LA MT+GY+GSDLKNLC  AAYRP
Sbjct  662   FERRIMVGLPDVQNREKILRAILSKEHLSSDFDFPELANMTDGYSGSDLKNLCMAAAYRP  721

Query  679   VRELIKQERLKD----------------VEKKRLAQECPNCGDAPTANEDKGERVITIRP  548
             VR+L+K+E+ K                   K    +     G AP   + K    +++RP
Sbjct  722   VRDLLKKEKEKKEKAKKKKRSSKEESEATSKSDKEEAAAKGGPAPPPTDAKTADDLSLRP  781

Query  547   LNMDDFMEAK-------NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             LNMDD  EA+       +QV+ASF+AEG+ M+EL++WN LYGEGGSRKK+QL+YF+
Sbjct  782   LNMDDMKEARKQASPIFSQVSASFSAEGAGMSELQEWNELYGEGGSRKKQQLSYFM  837



>ref|XP_002974147.1| hypothetical protein SELMODRAFT_442341 [Selaginella moellendorffii]
 gb|EFJ25102.1| hypothetical protein SELMODRAFT_442341 [Selaginella moellendorffii]
Length=845

 Score =   890 bits (2299),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 470/836 (56%), Positives = 586/836 (70%), Gaps = 70/836 (8%)
 Frame = -1

Query  2797  DIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPAS  2618
             D++E E+L+ I+DG+DS  TFDEFPYYL+EQTRVLLT+AA+VHLK  +F+K+TRNLSPAS
Sbjct  43    DVLELELLSQIIDGKDSGATFDEFPYYLNEQTRVLLTNAAYVHLKQREFSKYTRNLSPAS  102

Query  2617  RTILLSGPA--ELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSIS  2444
             RTILL+GPA  E YQQMLA+ALAHYF AKLLLLDV+DF  KVQ K+G  +  S     + 
Sbjct  103   RTILLTGPAGAEAYQQMLARALAHYFEAKLLLLDVSDFVSKVQKKHGDVKFSSEPLPEVL  162

Query  2443  ETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanm  2264
               T+++ +  +GS +    +   +     QS+    P+K  E S                
Sbjct  163   FRTVSQFASNVGSLATQITRSSGENASDAQSNTS--PNKSPEKSGKAPEAL---------  211

Query  2263  nnltSYNTTSNPGPLMRTSSLS-FDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRS  2087
                          PL R++SL  F+EK L  AL+KVL  VS + PIVLYLRD E+L+ R 
Sbjct  212   -------------PLRRSNSLGLFEEKSLFNALFKVLASVSGSSPIVLYLRDVERLVSRG  258

Query  2086  EKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVS  1907
              K Y L  K L++LSG +L+LGSRI+   D    ++E+L  +F Y I IKPPE+   LVS
Sbjct  259   PKTYSLFLKRLKKLSGPILVLGSRIMQTKDS-ESVNEKLEHLFSYTINIKPPEDNAVLVS  317

Query  1906  WKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISY  1727
             W+SQLEEDMK +Q QDN+NHI+EVL +ND+ECDDLGSIC +DTM LSNYIEE++VSAIS+
Sbjct  318   WRSQLEEDMKTIQAQDNRNHILEVLGSNDVECDDLGSICFSDTMLLSNYIEEILVSAISH  377

Query  1726  HLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGS  1547
             HLMNT+ P+YR+ +LV+SSKSL++G+ +F+  +  + +  L+ E+K E  K  ++ E  +
Sbjct  378   HLMNTEQPDYRSGRLVLSSKSLAYGLELFQAGQLDSNEAKLQAETKVETLK-PEAQETVT  436

Query  1546  KG----------PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNE  1397
             +G           E K E S   G KP+           + D T         +VPPDNE
Sbjct  437   RGNADVKTDVPVAEAKTEVSKPEGPKPDN-------EKKSSDTTKPAPVTTKADVPPDNE  489

Query  1396  FEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLF-KGGLLKPCRGILL  1220
             FEKRIRPEVIPA E+GV F DIGALD +KESL ELVMLPLRRP+LF KGGL+KPCRGILL
Sbjct  490   FEKRIRPEVIPAGEVGVNFQDIGALDNVKESLQELVMLPLRRPELFNKGGLIKPCRGILL  549

Query  1219  FGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFV  1040
             FGPPGTGKTMLAKA+A EAGASFINVSMS+ITSKWFGEDEKNVRALFTLAAKV+PTI+F+
Sbjct  550   FGPPGTGKTMLAKAVATEAGASFINVSMSSITSKWFGEDEKNVRALFTLAAKVAPTIVFI  609

Query  1039  DEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRR  860
             DEVDSMLGQRSR GEHEAMRKIKNEFM+HWDGLLTK  ER+LVLAATNRPFDLDEAIIRR
Sbjct  610   DEVDSMLGQRSRVGEHEAMRKIKNEFMAHWDGLLTKGAERVLVLAATNRPFDLDEAIIRR  669

Query  859   FERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRP  680
             FERRIMVGLP  + RE IL+ +L+KE +    D  +LA MT+GY+GSDLKNLC  AAYRP
Sbjct  670   FERRIMVGLPDVQNREKILRAILSKEHLSSDFDFPELANMTDGYSGSDLKNLCMAAAYRP  729

Query  679   VRELIKQERLKD----------------VEKKRLAQECPNCGDAPTANEDKGERVITIRP  548
             VR+L+K+E+ K                   K    +     G AP   + K    +++RP
Sbjct  730   VRDLLKKEKEKKEKAKKKKRSSKEESEATSKSDKEEAAAKGGPAPPPTDAKTADDLSLRP  789

Query  547   LNMDDFMEAK-------NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             LNMDD  EA+       +QV+ASF+AEG+ M+EL++WN LYGEGGSRKK+QL+YF+
Sbjct  790   LNMDDMKEARKQASPIFSQVSASFSAEGAGMSELQEWNELYGEGGSRKKQQLSYFM  845



>ref|XP_004496507.1| PREDICTED: uncharacterized protein LOC101505986 [Cicer arietinum]
Length=796

 Score =   881 bits (2277),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/820 (56%), Positives = 585/820 (71%), Gaps = 55/820 (7%)
 Frame = -1

Query  2833  KWTG------SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             +W G       +SN ++ + + +E++N ++DG+DS++TFDEFPYYLS++  +LLTSA FV
Sbjct  23    RWVGVGGYPIPNSNEISEEQIVRELMNLVIDGKDSEITFDEFPYYLSDKIEILLTSAGFV  82

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HL+    + H + LSP SR ILLSGPAELYQQ LA+ALAH F +KLLLLD TDFSLK+Q+
Sbjct  83    HLRQFHLSMHAKKLSPISRAILLSGPAELYQQNLARALAHCFDSKLLLLDFTDFSLKMQN  142

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG    E   KRSISE TL ++S   GS SIL      +GT   QSS +        G+
Sbjct  143   KYGCPGKEPDLKRSISEVTLEKVSSLFGSLSILPLMGAIRGTQLEQSSAI--------GN  194

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             S      +  + +      TS +  S+P PL  T+   FDEKL + +LY+VLV +S++  
Sbjct  195   SINPPKLQKKAPTTPDMGPTSQSGPSHPAPLKCTNRFCFDEKLFLHSLYEVLVSISQSGS  254

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY++D +K+  +S ++Y L QK+L++LSGSVLILGS+I D  ++  E+DE+L+++FPY
Sbjct  255   VILYIKDVDKIFLQSPRMYTLFQKLLKKLSGSVLILGSQIYDSENNCMEVDEKLTTLFPY  314

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
              IEIKPP++E  L  WK ++EE M+  Q +DN+NHI EVLA+NDI+C+D  SI   D M 
Sbjct  315   YIEIKPPQDEALLKIWKDEVEEAMQETQLKDNRNHIAEVLASNDIDCNDWNSISDPDIML  374

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             LSNYI+E   SAI YHL++ + PEYRN KL+IS+                     ++L  
Sbjct  375   LSNYIDEFAASAIFYHLVDFEHPEYRNGKLIISA---------------------MRLCQ  413

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAP---GSKPETGsaapapapttkdatsSGTAVKA  1421
               +L +E++SGE+  K  +        P   G+K ++    P                K 
Sbjct  414   LVKLLQESESGERSEKDDKKDGAKKHIPIPKGTKKDSDIKDPE---------------KE  458

Query  1420  PEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLK  1241
              EVP  NEFEKRIR EVI A +IGVTF+DIGALD++KE+L E+VMLPLRRPD+FKG LLK
Sbjct  459   AEVPSYNEFEKRIRKEVIRANKIGVTFSDIGALDDVKETLQEVVMLPLRRPDIFKGSLLK  518

Query  1240  PCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV  1061
             PCRG+LLFGPPGTGKTMLAKAIA +AGASFINVSMST+TSK +GEDEKNVRALF+LAAKV
Sbjct  519   PCRGVLLFGPPGTGKTMLAKAIANDAGASFINVSMSTLTSKLYGEDEKNVRALFSLAAKV  578

Query  1060  SPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDL  881
             +PTIIF+DEVDSMLG+RS + EHEA R+IKNEFMSHWDGLL+K  ERILVLAATNRPFDL
Sbjct  579   APTIIFIDEVDSMLGKRSESYEHEATRRIKNEFMSHWDGLLSKHDERILVLAATNRPFDL  638

Query  880   DEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLC  701
             DEAIIRRF+RRIMVGLP+ E RE ILKT+LA E    + D K+L+TMT+GY+GSDLKNLC
Sbjct  639   DEAIIRRFQRRIMVGLPSAESRERILKTVLANENHENI-DFKELSTMTDGYSGSDLKNLC  697

Query  700   TTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEA  521
              TAAYRPV ELI+QE+ KD++ K+  +E     DA  A EDK ++VI +RPLNM+D   A
Sbjct  698   MTAAYRPVAELIQQEKEKDMKNKKRKEEAQTSEDASNATEDKEDQVIALRPLNMEDMRVA  757

Query  520   KNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             KN+V AS+ AEG++MN+LKQWN LYGEGGSRKKEQLTYFL
Sbjct  758   KNKVGASY-AEGALMNQLKQWNELYGEGGSRKKEQLTYFL  796



>ref|XP_010112603.1| Uncharacterized AAA domain-containing protein [Morus notabilis]
 gb|EXC34328.1| Uncharacterized AAA domain-containing protein [Morus notabilis]
Length=548

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 430/557 (77%), Positives = 480/557 (86%), Gaps = 13/557 (2%)
 Frame = -1

Query  2059  MLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDM  1880
             ML +LSGSVLILGS IVDP D+Y E+DE+L+++F Y IEI+PPE+E+H VSWKSQLEEDM
Sbjct  1     MLNKLSGSVLILGSEIVDPKDEYGEVDEKLAALFTYTIEIRPPEDESHHVSWKSQLEEDM  60

Query  1879  KMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPE  1700
             +M+Q +DN+NHIMEVL+AND++CDDL SIC+ADTM LSNYIEE+VVSAISYHLMN K+PE
Sbjct  61    RMIQVKDNRNHIMEVLSANDLDCDDLDSICIADTMVLSNYIEEIVVSAISYHLMNNKNPE  120

Query  1699  YRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAES  1520
             YRN KL+I SKSLSHG++IF+E     GKD LKL+++ + SKE +S E     PETK ES
Sbjct  121   YRNGKLIIPSKSLSHGLSIFQEH----GKDSLKLDAQVKTSKEAESKETVGTKPETKVES  176

Query  1519  STAPGSKPETGsaapapapttkdatsSGT-AVKAPEVPPDNEFEKRIRPEVIPAKEIGVT  1343
              T     PE  SA   PA  TK  T +   A KAPEVPPDNEFEKRIRPEVIPA EIGVT
Sbjct  177   GT-----PENKSAEETPASVTKTDTDNSVPAAKAPEVPPDNEFEKRIRPEVIPASEIGVT  231

Query  1342  FADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEA  1163
             FADIGALDEIKESL ELVMLPLRRPDLF GGLLKPCRGILLFGPPGTGKTM+AKAIAKEA
Sbjct  232   FADIGALDEIKESLQELVMLPLRRPDLFNGGLLKPCRGILLFGPPGTGKTMMAKAIAKEA  291

Query  1162  GASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAM  983
             GASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSR+GEHEAM
Sbjct  292   GASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRSGEHEAM  351

Query  982   RKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELIL  803
             RKIKNEFM+HWDGLLTK G+RILVLAATNRPFDLDEAIIRRFERRI+VGLP+ E RE+IL
Sbjct  352   RKIKNEFMTHWDGLLTKQGDRILVLAATNRPFDLDEAIIRRFERRILVGLPSVENREMIL  411

Query  802   KTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLA  623
             KT+LAKE V + LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI+QERLKD+EKKR A
Sbjct  412   KTILAKEKVEEGLDYKELATMTEGYSGSDLKNLCTTAAYRPVRELIQQERLKDLEKKRKA  471

Query  622   QECPNCGDAPTANED---KGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNN  452
              E PN  +A    E    K ERVI +RPLNM+DF +AKNQVAASFAAEGS+M ELKQWN+
Sbjct  472   AEAPNTKEAENTAETESGKEERVIKLRPLNMEDFRQAKNQVAASFAAEGSVMKELKQWND  531

Query  451   LYGEGGSRKKEQLTYFL  401
              YGEGGSRKK+QLTYFL
Sbjct  532   SYGEGGSRKKQQLTYFL  548



>ref|XP_007158542.1| hypothetical protein PHAVU_002G1610001g, partial [Phaseolus vulgaris]
 gb|ESW30536.1| hypothetical protein PHAVU_002G1610001g, partial [Phaseolus vulgaris]
Length=637

 Score =   861 bits (2224),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 432/621 (70%), Positives = 499/621 (80%), Gaps = 19/621 (3%)
 Frame = -1

Query  2236  SNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKM  2057
             +N  P    ++  FDEKLL+Q LYKVLV VSKT PIVLYLRD +KLL RS +VY L Q M
Sbjct  27    TNSAPQKNITNWPFDEKLLVQTLYKVLVYVSKTYPIVLYLRDVDKLLHRSRRVYNLFQIM  86

Query  2056  LRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMK  1877
             L +L G +LILGSR++  G DY+E+DERLSSVFPYNIE+ PPE+E+++VSWKSQ EEDMK
Sbjct  87    LNKLQGRILILGSRVLSSGSDYKEMDERLSSVFPYNIELSPPEDESYIVSWKSQFEEDMK  146

Query  1876  MMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEY  1697
              +Q QDN+NHIMEVLAAND+ CDDLGSIC+ADTMA SN IEE+VVSAISYHLMN KDPEY
Sbjct  147   TIQTQDNRNHIMEVLAANDLYCDDLGSICVADTMAFSNNIEEIVVSAISYHLMNNKDPEY  206

Query  1696  RNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESS  1517
             +N KLVI   SLSH + IF+E K +  +D LKLE++A  ++  + G      PET +E+ 
Sbjct  207   QNGKLVIPCSSLSHALGIFQEGKFST-RDTLKLEAQAVTTEPREEG--VVVKPETTSENP  263

Query  1516  TAPGSKPETGsaapapapttkdatsSGTAVKAP--EVPPDNEFEKRIRPEVIPAKEIGVT  1343
              AP  K E+  +        +          AP  EV PDNEFEKRIRPEVIPA EIGV 
Sbjct  264   -APEIKAESDISTLVGKTDGE------NTAPAPKVEVAPDNEFEKRIRPEVIPANEIGVK  316

Query  1342  FADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEA  1163
             F+D+GALDE KESL ELVMLPLRRPDLF+GGLLKPC+GILLFGPPGTGKTMLAKAIA EA
Sbjct  317   FSDVGALDETKESLQELVMLPLRRPDLFRGGLLKPCKGILLFGPPGTGKTMLAKAIANEA  376

Query  1162  GASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAM  983
             GASFINVSMST+TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAM
Sbjct  377   GASFINVSMSTVTSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAM  436

Query  982   RKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELIL  803
             RKIKNEFM+ WDGL+T PGERILVLAATNRPFDLDEAIIRRFERRIMVG+P PE RE IL
Sbjct  437   RKIKNEFMTLWDGLMTNPGERILVLAATNRPFDLDEAIIRRFERRIMVGMPCPENREKIL  496

Query  802   KTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLA  623
             +TLL KE V + LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI+QERLK +EK++  
Sbjct  497   RTLLGKEKVDEKLDFKELATMTEGYSGSDLKNLCTTAAYRPVRELIQQERLKMLEKRQKG  556

Query  622   QECPNCG------DAPTANED-KGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELK  464
              E  N        DA    E+ + ERVI++RPLN+ DF EA++QV+AS+AAEG+ M+ELK
Sbjct  557   VEEQNNNVQEATQDASEGKEEVQQERVISLRPLNIKDFKEARSQVSASYAAEGAGMSELK  616

Query  463   QWNNLYGEGGSRKKEQLTYFL  401
             QWN +YGEGGSRKKEQL+YFL
Sbjct  617   QWNEMYGEGGSRKKEQLSYFL  637



>ref|XP_006589516.1| PREDICTED: peroxisomal biogenesis factor 6-like [Glycine max]
Length=814

 Score =   864 bits (2233),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/852 (54%), Positives = 583/852 (68%), Gaps = 101/852 (12%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G S  S+ ++ D +  E+ N ++DG++S+VTFD+FPYYLSE+ R +LTS  +V
Sbjct  27    QAVQKWVGGSCESDEISGDQIVLELNNRVIDGKNSEVTFDKFPYYLSERIRFVLTSTGYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             +LK  DF+KH RNL PASR ILLSGPAE YQQ LA+ALAHYF +KLLLLD+TDF L++Q 
Sbjct  87    YLKQ-DFSKHLRNLHPASRAILLSGPAEPYQQNLARALAHYFKSKLLLLDITDFLLEMQR  145

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  R E  F+RSISE TL R+S   GS S+L      +GTL RQSS        IE S
Sbjct  146   KYGCPRKEPCFQRSISEVTLERVSGLFGSLSVLPSTGRTRGTLHRQSSE-------IENS  198

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SNP  LRRN+S + +  + + Y   S+  PL  TS   FDEKL +Q+LYKVLV +S+T  
Sbjct  199   SNPPKLRRNASTACDTISTSQYGP-SDSAPLKCTSGFCFDEKLFVQSLYKVLVSISETSS  257

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY++D EKL  RS +++ L QK++++LSGSVLILGS+I+D  DD  E+DE+LS +FPY
Sbjct  258   VILYIKDVEKLFVRSTRLHNLFQKLIKKLSGSVLILGSQIIDSEDDCTEIDEKLSMLFPY  317

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPP+E+ HL SW+++L +D +   +QD++NHI EVLAAND++C         D + 
Sbjct  318   NIEIKPPQEDAHLASWRTKLIKDKEKSLFQDSRNHIAEVLAANDVDC---------DDLE  368

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
               N+ + +++S               N    I + ++SH +   K  +    K ++  +S
Sbjct  369   KVNHADTMLLS---------------NCIEEIVASAISHHLMETKHPEYRNRKLVISHKS  413

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              + +    Q  E   +  ++  E + A                                 
Sbjct  414   LSHVLNIFQESESNLENKDSNKEDALATKKDG----------------------------  445

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
               DNEFEKR+R EV+PA EIGVTF DIGALD+IKE L ++VMLPLRRPDLFKGGLLKP +
Sbjct  446   --DNEFEKRMRAEVVPANEIGVTFEDIGALDDIKELLEDVVMLPLRRPDLFKGGLLKPYK  503

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVS+S ITSKWFGEDEKNVRALF+LAAKV+PT
Sbjct  504   GILLFGPPGTGKTMLAKAIANEAGASFINVSISNITSKWFGEDEKNVRALFSLAAKVAPT  563

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIF+DEVDSMLG+R++ GEHEAMRKIKNEFM+HWDG+LTKPGERILVLAATNRPFDLDEA
Sbjct  564   IIFIDEVDSMLGKRTKYGEHEAMRKIKNEFMAHWDGILTKPGERILVLAATNRPFDLDEA  623

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKTLLAKE    + D  +L+T+TEGYTGSDLKNLCT A
Sbjct  624   IIRRFERRIMVGLPSAENREMILKTLLAKEKYEHI-DFNELSTITEGYTGSDLKNLCTAA  682

Query  691   AYRPVRELIKQ---------------ERLKDV--------------------EKKRLAQE  617
             AYRPVRE+++Q               +R +D                     EKK+   E
Sbjct  683   AYRPVREVLQQERLKEKEKKKTEAEVQRSEDASDAKGDKEDGVITSRCLNIQEKKKTEAE  742

Query  616   CPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEG  437
               +  +A  A  DK  +VIT+RPLNM+D   AK+QVAASFAAEGSIM+ELK+WN L+GEG
Sbjct  743   VQSSENASDAKGDKDHQVITLRPLNMEDMRLAKSQVAASFAAEGSIMSELKEWNELFGEG  802

Query  436   GSRKKEQLTYFL  401
             GSRKK+QLTYFL
Sbjct  803   GSRKKQQLTYFL  814



>gb|KHN21801.1| Fidgetin-like protein 1 [Glycine soja]
Length=809

 Score =   863 bits (2229),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 463/852 (54%), Positives = 581/852 (68%), Gaps = 106/852 (12%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G S  S+ ++ D +  E+ N ++DG++S+VTFD+FPYYLSE+ R +LTS  +V
Sbjct  27    QAVQKWVGGSCESDEISGDQIVLELNNRVIDGKNSEVTFDKFPYYLSERIRFVLTSTGYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             +LK  DF+KH RNL PASR ILLSGPAE YQQ LA+ALAHYF +KLLLLD+TDF L++Q 
Sbjct  87    YLKQ-DFSKHLRNLRPASRAILLSGPAEPYQQNLARALAHYFKSKLLLLDITDFLLEMQR  145

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  R E  F+RSISE TL R+S   GS S+L      +GTL RQSS        IE S
Sbjct  146   KYGCPRKEPCFQRSISEVTLERVSGLFGSLSVLPSTGRTRGTLHRQSSE-------IENS  198

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
             SNP  LRRN+S + +        +TS   PL  TS   FDEKL +Q+LYKVLV +S+T  
Sbjct  199   SNPPKLRRNASTACDTI------STSQYAPLKCTSGFCFDEKLFVQSLYKVLVSISETSS  252

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             ++LY++D EKL  RS +++ L QK++++LSGSVLILGS+I+D  DD  E+DE+LS +FPY
Sbjct  253   VILYIKDVEKLFVRSTRLHNLFQKLIKKLSGSVLILGSQIIDSEDDCTEIDEKLSMLFPY  312

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPP+E+ HL SW+++L +D +   +QD++NHI EVLAAND++C         D + 
Sbjct  313   NIEIKPPQEDAHLASWRTKLIKDKEKSLFQDSRNHIAEVLAANDVDC---------DDLE  363

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
               N+ + +++S               N    I + ++SH +   K  +    K ++  +S
Sbjct  364   KVNHADTMLLS---------------NCIEEIVASAISHHLMETKHPEYRNRKLVISHKS  408

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
              + +    Q  E   +  ++  E + A                                 
Sbjct  409   LSHVLNIFQESESNLENKDSNKEDALATKKDG----------------------------  440

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
               DNEFEKR+R EV+PA EIGVTF DIGALD+IKE L ++VMLPLRRPDLFKGGLLKP +
Sbjct  441   --DNEFEKRMRAEVVPANEIGVTFEDIGALDDIKELLEDVVMLPLRRPDLFKGGLLKPYK  498

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKAIA EAGASFINVS+S ITSKWFGEDEKNVRALF+LAAKV+PT
Sbjct  499   GILLFGPPGTGKTMLAKAIANEAGASFINVSISNITSKWFGEDEKNVRALFSLAAKVAPT  558

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIF+DEVDSMLG+R++ GEHEAMRKIKNEFM+HWDG+LTKPGERILVLAATNRPFDLDEA
Sbjct  559   IIFIDEVDSMLGKRTKYGEHEAMRKIKNEFMAHWDGILTKPGERILVLAATNRPFDLDEA  618

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRFERRIMVGLP+ E RE+ILKTLLAKE    + D  +L+T+TEGYTGSDLKNLCT A
Sbjct  619   IIRRFERRIMVGLPSAENREMILKTLLAKEKYEHI-DFNELSTITEGYTGSDLKNLCTAA  677

Query  691   AYRPVRELIKQ---------------ERLKDV--------------------EKKRLAQE  617
             AYRPVRE+++Q               +R +D                     EKK+   E
Sbjct  678   AYRPVREVLQQERLKEKEKKKTEAEVQRSEDASDAKGDKEDGVITSRCLNIQEKKKTEAE  737

Query  616   CPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEG  437
               +  +A  A  DK  +VIT+RPLNM+D   AK+QVAASFAAEGSIM+ELK+WN L+GEG
Sbjct  738   VQSSENASDAKGDKDHQVITLRPLNMEDMRLAKSQVAASFAAEGSIMSELKEWNELFGEG  797

Query  436   GSRKKEQLTYFL  401
             GSRKK+QLTYFL
Sbjct  798   GSRKKQQLTYFL  809



>ref|XP_004967434.1| PREDICTED: spastin-like [Setaria italica]
Length=621

 Score =   853 bits (2204),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 435/629 (69%), Positives = 502/629 (80%), Gaps = 27/629 (4%)
 Frame = -1

Query  2236  SNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKM  2057
             +N  PL   SS +F EK+L+QALYKVL  VSK  PIVLY+RD EK   +S K+Y+L +K+
Sbjct  3     NNAAPLRCASSWTFVEKILVQALYKVLHSVSKKYPIVLYIRDVEKFFHKSPKMYLLFEKL  62

Query  2056  LRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMK  1877
             L +L G VL+LGSRIV+   D  ELD+RL+ +FPYNIEIKPPE E HLVSW SQLEEDMK
Sbjct  63    LNKLEGPVLVLGSRIVEMDVD-EELDDRLTVLFPYNIEIKPPENENHLVSWNSQLEEDMK  121

Query  1876  MMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEY  1697
             M+Q+QDN+NHI+EVLA ND+ECDDLGSIC++DT+ LS YIEE+VVSA+SYHLMN ++PEY
Sbjct  122   MIQFQDNRNHILEVLAENDLECDDLGSICLSDTIGLSKYIEEIVVSAVSYHLMNNREPEY  181

Query  1696  RNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESS  1517
             RN KLVIS+KSLSH + IF+E K +  KD LKLE  A+  K   + EKG+     K+E+ 
Sbjct  182   RNGKLVISAKSLSHALEIFQENKMS-DKDSLKLEVTADALK---AAEKGTAPTAAKSETK  237

Query  1516  TAPGSKP---------------ETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRI  1382
              A    P                  + A    P  +   S   A KAPEVPPDNEFEKRI
Sbjct  238   PATLLPPVRPPAAASAAPAAAAAAAAPAVESKPAPEKKDSPPPAAKAPEVPPDNEFEKRI  297

Query  1381  RPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGT  1202
             RPEVIPA EIGV+F DIGALD+IKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGT
Sbjct  298   RPEVIPANEIGVSFDDIGALDDIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGT  357

Query  1201  GKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSM  1022
             GKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDS+
Sbjct  358   GKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSI  417

Query  1021  LGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIM  842
             LGQR+RAGEHEAMRKIKNEFM+HWDGLL++P +RILVLAATNRPFDLDEAIIRRFERRIM
Sbjct  418   LGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQRILVLAATNRPFDLDEAIIRRFERRIM  477

Query  841   VGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK  662
             VGLP+ E RELI++ LL+KE V + LD K+LATMTEGY+GSDLKNLCTTAAYRPVRELI+
Sbjct  478   VGLPSMESRELIMRRLLSKEKVDEGLDFKELATMTEGYSGSDLKNLCTTAAYRPVRELIQ  537

Query  661   QERLKDVEKKRLAQECPNCGDAPTANEDKGER--VITIRPLNMDDFMEAKNQVAASFAAE  488
             +ER K++EK +  +     G AP+ +  K E+   I +RPLNM D  EAKNQVAASFAAE
Sbjct  538   KERKKELEKLKREK-----GGAPSDSTKKKEKEEPIILRPLNMTDLKEAKNQVAASFAAE  592

Query  487   GSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             G+IM EL+QWN LYGEGGSRKK+QLTYFL
Sbjct  593   GAIMGELRQWNELYGEGGSRKKQQLTYFL  621



>ref|XP_008655281.1| PREDICTED: uncharacterized protein LOC100383493 isoform X2 [Zea 
mays]
 ref|XP_008656079.1| PREDICTED: spastin-like isoform X3 [Zea mays]
Length=677

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 434/713 (61%), Positives = 534/713 (75%), Gaps = 74/713 (10%)
 Frame = -1

Query  2425  MSEFLGSFSILQPKEEK--KGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
             MS+ +GSF +  PK++   + +LRRQ+S  D+ ++G +GSS+  +L++N+S S++M++L 
Sbjct  1     MSDLIGSF-MAYPKKDGPIEKSLRRQTSSTDLRTRGSDGSSSTPSLKKNASVSSDMSDLA  59

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
             S  + +   P+ RT S  FDEK+LIQ+LYKV+V VS+  PI+LY+RD +  L +S++++ 
Sbjct  60    SQGSGN---PVRRTGSWCFDEKVLIQSLYKVMVSVSENGPIILYIRDVDHFLWKSQRIHS  116

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             + QKML +LSG VLILGSR+++P  D R+ DER+S++FPY+++IK PEEETHL  WKSQ+
Sbjct  117   MFQKMLAKLSGQVLILGSRLLNPDADNRDADERISTLFPYHVDIKAPEEETHLDCWKSQI  176

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNT  1712
             EED + +Q QDN+NHI+EVL+AND++CDDL SIC ADTM LSNYIEE++VSA+SYHL++ 
Sbjct  177   EEDKRKIQMQDNRNHIIEVLSANDLDCDDLSSICEADTMVLSNYIEEIIVSAVSYHLIHN  236

Query  1711  KDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPET  1532
             KDPEYRN KL++SSKSLSHG++IF  + +  GKD LKLE       ET+ G KG+ G + 
Sbjct  237   KDPEYRNGKLMLSSKSLSHGLSIF--QGSHGGKDTLKLE-------ETKDGLKGALGSKK  287

Query  1531  KAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEI  1352
                     G  P                      +  PEVP DNEFEKRIRPEVIPA EI
Sbjct  288   TETLPVGEGPVP----------------------LPKPEVP-DNEFEKRIRPEVIPASEI  324

Query  1351  GVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  1172
             GVTF DIGAL +IKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA
Sbjct  325   GVTFDDIGALADIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA  384

Query  1171  KEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEH  992
              +AGASFINVSMSTITSKWFGEDEKNVRALF+LAAKV+PTIIFVDEVDSMLGQR+R GEH
Sbjct  385   NDAGASFINVSMSTITSKWFGEDEKNVRALFSLAAKVAPTIIFVDEVDSMLGQRARYGEH  444

Query  991   EAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRE  812
             EAMRKIKNEFMSHWDGLL+K GE+ILVLAATNRPFDLDEAIIRRFERRIMVGLPT E RE
Sbjct  445   EAMRKIKNEFMSHWDGLLSKTGEKILVLAATNRPFDLDEAIIRRFERRIMVGLPTTESRE  504

Query  811   LILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK----------  662
             LIL+TLL+KE V + +D K+LA MTEGY+GSDLKNLC TAAYRPVREL+K          
Sbjct  505   LILRTLLSKEKVDEDIDFKELAAMTEGYSGSDLKNLCVTAAYRPVRELLKIERERELERR  564

Query  661   -----------------------QERLKDVEKKRLAQECPNCGDAPTANEDKGER---VI  560
                                        K+  K   + E    GD    ++ +GE+   V+
Sbjct  565   EKESKDKAAAAENSEAPESEKKESSETKEARKSTQSPEGGGKGDEGPDSKAEGEKEAAVV  624

Query  559   TIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              +RPL M+D  +AKNQVAASFAAEG++MNEL+QWN+LYGEGGSRKK+QLTYFL
Sbjct  625   DLRPLTMEDLRQAKNQVAASFAAEGAVMNELRQWNDLYGEGGSRKKQQLTYFL  677



>ref|XP_004496827.1| PREDICTED: uncharacterized protein LOC101497517 [Cicer arietinum]
Length=782

 Score =   836 bits (2159),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/813 (55%), Positives = 565/813 (69%), Gaps = 65/813 (8%)
 Frame = -1

Query  2815  SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTR  2636
             SN ++   +  E+ N  ++G+DS+VTFD FPYYLSE  ++ LT A +VHL+    +KH R
Sbjct  27    SNEISEKQIVMELTNLAINGKDSQVTFDHFPYYLSENVKLFLTCAGYVHLRPRHLSKHMR  86

Query  2635  NLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFK  2456
             NL PASR ILLSGPAELYQQ LA+ALAH+F +KLLLLD+TDFSLK+Q+KYG    E   K
Sbjct  87    NLPPASRAILLSGPAELYQQNLARALAHFFESKLLLLDITDFSLKMQNKYGCPTKEQYLK  146

Query  2455  RSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssa  2276
             +SISE TL + S      SIL      +GT   QSS        I  S NP         
Sbjct  147   KSISEVTLEKASALFRCLSILPSMSPIRGTQLEQSS-------AIGNSINPP--------  191

Query  2275  sanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLL  2096
                      +   S    +  TS   FDEKL +++L KVLV + KT  ++LY++D EK+ 
Sbjct  192   -------KLHKNASTVSDMKCTSRFCFDEKLFLRSLCKVLVSILKTGSVILYIKDVEKIF  244

Query  2095  CRSEKVYILLQKMLRRLSGSVLILGSRIVDP-GDDYRELDERLSSVFPYNIEIKPPEEET  1919
              RS ++Y L QK+L++LSGSVLILGS I D  G++  E+ ++L+ +FP NIEIKPP++ET
Sbjct  245   LRSPRMYSLFQKLLKKLSGSVLILGSGIYDSEGNNRIEVGKKLTMLFPCNIEIKPPQDET  304

Query  1918  HLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVS  1739
              L  WK QLE+ MK  +  DN+NH+ EVLAA++I+CDDL SI   D M L N IE +V S
Sbjct  305   LLKIWKDQLEKAMKETRLIDNRNHMEEVLAAHNIDCDDLNSIGDTDIMLLGNCIEVIVAS  364

Query  1738  AISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSG  1559
              I YHLM+ K PEY+N KL+IS+KSL H +N+F+E K+   KD  K       +K T+  
Sbjct  365   VICYHLMHNKHPEYKNGKLIISAKSLCHVLNLFQESKSNE-KDNTK-------TKNTKIP  416

Query  1558  EKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP----EVPPDNEFE  1391
             +KG    + + +   + G+K +T                    +KAP     VP D+ FE
Sbjct  417   KKG----DARKDKPISKGTKKDTD-------------------IKAPAKENNVPHDDVFE  453

Query  1390  KRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFK-GGLLKPCRGILLFG  1214
             + IR EVI A EI VTF+DIGA+D++KESL E VMLPLRRP+LFK GGLLKPC+G+LLFG
Sbjct  454   EHIRQEVISANEIRVTFSDIGAVDDVKESLQEAVMLPLRRPELFKGGGLLKPCKGVLLFG  513

Query  1213  PPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  1034
             PPGTGKTMLAKAIA EAGASFINVS STIT+ WFG  EKNVRALF+LAAKV+PTIIF+DE
Sbjct  514   PPGTGKTMLAKAIANEAGASFINVSPSTITAMWFGNGEKNVRALFSLAAKVAPTIIFIDE  573

Query  1033  VDSMLGQRSRAG-EHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRF  857
             VDS+LGQRS    EH +MR++KNEFMS WDGLL+ P E+ILVLAATN PFDLDEAIIRRF
Sbjct  574   VDSLLGQRSNGQREHNSMRRLKNEFMSRWDGLLSNPDEKILVLAATNMPFDLDEAIIRRF  633

Query  856   ERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPV  677
             +RRIMVGLP+ E RE ILKTLLAKE   + +D K+L+ MT+GY+GSDLKNLC TAAYRPV
Sbjct  634   QRRIMVGLPSAENRESILKTLLAKEK-HENIDFKELSIMTKGYSGSDLKNLCMTAAYRPV  692

Query  676   RELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASF  497
              ELI+QE+ KDV+K+   +      D   A EDK ++VI +RPLNM+D   AKN+VAASF
Sbjct  693   MELIQQEKAKDVKKEAKVEISE---DTSNAIEDKEDQVIVLRPLNMEDMRHAKNKVAASF  749

Query  496   AAEGSIMNELKQWNNLYGEGGSRKKEQ-LTYFL  401
             +  GS+MN LK+WN+LYGEGGS++KE+ L+YF+
Sbjct  750   SENGSMMNMLKKWNDLYGEGGSKQKEETLSYFI  782



>ref|XP_002869527.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45786.1| AAA-type ATPase family protein [Arabidopsis lyrata subsp. lyrata]
Length=726

 Score =   823 bits (2126),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/663 (64%), Positives = 517/663 (78%), Gaps = 57/663 (9%)
 Frame = -1

Query  2386  KEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTS  2207
             ++E+  TLRR +SG D+ S+G + +S+P  L+RN+SA+++M++++S + TS      R++
Sbjct  120   RQERTWTLRRHTSGNDLHSRGFDVTSHPPRLKRNASAASDMSSISSRSATSVSASSKRSA  179

Query  2206  SLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLI  2027
             +L FDE+L +Q+LYKVLV +S+T PI++YLRD EKL C+SE+ Y L Q++L +LSG VL+
Sbjct  180   NLCFDERLFLQSLYKVLVSISETNPIIIYLRDVEKL-CQSERFYKLFQRLLTKLSGPVLV  238

Query  2026  LGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNH  1847
             LGSR+++P DD +E+ E +S++FPYNIEI+PPE+E  L+SWK++ E+DMK++Q+QDNKNH
Sbjct  239   LGSRLLEPEDDCQEVGEGISALFPYNIEIRPPEDENQLMSWKTRFEDDMKVIQFQDNKNH  298

Query  1846  IMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSK  1667
             I EVLAAND+ECDDLGSIC ADTM LS++IEE+VVSAISYHLM+ K+PEY+N +LVISS 
Sbjct  299   IAEVLAANDLECDDLGSICHADTMFLSSHIEEIVVSAISYHLMHNKEPEYKNGRLVISST  358

Query  1666  SLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETG  1487
             SLSHG++I  +E     +D LKL+                                    
Sbjct  359   SLSHGLSIL-QEGNGCFEDSLKLD------------------------------------  381

Query  1486  saapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKE  1307
                              T + + EV PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KE
Sbjct  382   -----------------TNIDSKEVAPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKE  424

Query  1306  SLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTI  1127
             SL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTI
Sbjct  425   SLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTI  484

Query  1126  TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWD  947
             TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWD
Sbjct  485   TSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWD  544

Query  946   GLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKV  767
             GL++  G+RILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + 
Sbjct  545   GLMSNAGDRILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKT-EN  603

Query  766   LDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKD-VEKKRLAQECPNCGDAPT  590
             LD  +LA MT+GY+GSDLKN CTTAAYRPVRELIKQE LKD   KK+   +  +   + T
Sbjct  604   LDFHELAQMTDGYSGSDLKNFCTTAAYRPVRELIKQECLKDQERKKKEEAKKSSEEGSET  663

Query  589   ANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLT  410
               E   ERVIT+RPL+M+D   AK+QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+
Sbjct  664   KEEVSEERVITLRPLSMEDMKVAKSQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLS  723

Query  409   YFL  401
             YFL
Sbjct  724   YFL  726


 Score =   117 bits (294),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             Q++ KW     S+ + +T + +EQE++  IVDGR+S VTFDEFPYYLSE+TR+LLTSAA+
Sbjct  25    QSLGKWANGSISAEDGLTGEKIEQELVRQIVDGRESSVTFDEFPYYLSEKTRLLLTSAAY  84

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQ  2579
             VHLK  D +KHTRNL+P S+ ILLSGPA+  Q
Sbjct  85    VHLKQFDISKHTRNLAPGSKAILLSGPADTEQ  116



>gb|ADN33778.1| ATP binding protein [Cucumis melo subsp. melo]
Length=837

 Score =   818 bits (2112),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/827 (55%), Positives = 554/827 (67%), Gaps = 123/827 (15%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G   SS+ +T   +EQE++  ++DG++S VTF EFPYYL  Q          +
Sbjct  27    QAVGKWVGGNGSSDEITGQKIEQELIRQLLDGKNSNVTFAEFPYYLRYQP------VCII  80

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             H               +  ++LL G  +L  +++AK        +L+L DV+DFSLK+QS
Sbjct  81    H--------------QSIESLLLVGSKKL--EVMAKL-------RLILCDVSDFSLKMQS  117

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  + ES F+RSISE TL RMS   GSFSIL      +G LRRQSS  DI S+  + S
Sbjct  118   KYGCPKKESLFRRSISEVTLERMSSVWGSFSILPTSGNTRGNLRRQSSTTDIQSRCTDSS  177

Query  2311  SN-PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             SN P   R  S+AS   +  ++Y +T N     RT++  FDEKL +Q+LYKVLV VS+T 
Sbjct  178   SNLPKLRRNASAASDISSISSNYGST-NSASAKRTNTWCFDEKLFLQSLYKVLVSVSETS  236

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              I+LYLRD E+LL +S+++Y L  + L +LSGSVL+LGSR+VD  +D  ++D+RL+++F 
Sbjct  237   SIILYLRDVERLLLKSQRMYNLFHRFLNKLSGSVLVLGSRMVDVENDCGDVDDRLTNLFR  296

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
             Y++EI+PPE+E HLVSWK+QLEEDMKM+Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM
Sbjct  297   YSVEIRPPEDENHLVSWKAQLEEDMKMIQFQDNKNHIAEVLAANDLECDDLGSICHADTM  356

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLE  1595
              LSNYIEE+VVSAISYHLMN +DPEYRN KL+ISSKSLSHG++IF +E  + GKD LKLE
Sbjct  357   VLSNYIEEIVVSAISYHLMNNRDPEYRNGKLLISSKSLSHGLSIF-QEGNSEGKDTLKLE  415

Query  1594  SKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPE  1415
             + AE SKE Q  E      E+K+E+  A   K           P  K    +    KAPE
Sbjct  416   TNAESSKEAQRDEAVGVKTESKSENPAAEAEK---------SVPIVKKDVENVPPQKAPE  466

Query  1414  VPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPC  1235
             +PPDNEFEKRIRPEVIPA EIGVTFADIGA+DEIKESL ELVMLPLRRPDLFKGGLLKPC
Sbjct  467   IPPDNEFEKRIRPEVIPANEIGVTFADIGAMDEIKESLQELVMLPLRRPDLFKGGLLKPC  526

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             RGILLFGPPGT                                            AKVSP
Sbjct  527   RGILLFGPPGT--------------------------------------------AKVSP  542

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIFVDEVDSMLGQR+R GEHEAMRKIKNEFMSHWDGLLT+  ERILVLAATNRPFDLDE
Sbjct  543   TIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMSHWDGLLTRNDERILVLAATNRPFDLDE  602

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRFERRIMVGLP+ E RELIL+TLL+KE   + LD K+LATMTEGY+GSDLKNLC T
Sbjct  603   AIIRRFERRIMVGLPSVESRELILRTLLSKEK-AEDLDFKELATMTEGYSGSDLKNLCVT  661

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP--------------------------  593
             AAYRPVREL++QERLKD+EKK+  ++     +                            
Sbjct  662   AAYRPVRELLQQERLKDLEKKQRERKEKEKEEEMEKEKQKEEKETETKNETGNENEKKEK  721

Query  592   ---------TANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSI  479
                      T   ++ ++ I +R LNMDD  +AKNQVAASFA+EGS+
Sbjct  722   ENNSEEVTGTKETEQDKQAIILRHLNMDDMRQAKNQVAASFASEGSL  768



>gb|AES62422.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=785

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/820 (53%), Positives = 548/820 (67%), Gaps = 94/820 (11%)
 Frame = -1

Query  2830  WTG-----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             W G       SN ++ + + + +   ++DG+DSKVTFD+FPYYLSE+ ++LLTSA + HL
Sbjct  50    WFGFGGDSDESNHISENQIVKGLKKLVIDGKDSKVTFDDFPYYLSEKNKILLTSAGYFHL  109

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             +  D +KHTRNLSP  R ILLSG AE Y   LA ALAH F +KLL LD+  FSLK+Q KY
Sbjct  110   RQHDLSKHTRNLSPVRRAILLSGHAEHYHHKLAGALAHCFESKLLSLDIAHFSLKMQGKY  169

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKG-IEGSS  2309
             G  R E  FKRSI E T   +S    S SIL                   PSKG I   S
Sbjct  170   GCPRKEPYFKRSIFEATREFVSGLFVSLSIL-------------------PSKGAIRAPS  210

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             N T                              S   FDEKL + +LYKVLV +S+   +
Sbjct  211   NST------------------------------SCYFFDEKLFLHSLYKVLVSISEAGSV  240

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             +LY+++ EK+   S ++Y L QK L +LSGSVLILGSR  D   +  +++E+L+ +FPYN
Sbjct  241   ILYIKNVEKVFLGSPRMYRLFQKTLNKLSGSVLILGSRPYDLKYNCTKVNEKLTMLFPYN  300

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEI PP++ETHL  WKSQL++ MK    +D   HI EVLAAND+ CDDL ++   D   L
Sbjct  301   IEITPPQDETHLKIWKSQLKKAMKKTHLKDYTTHIAEVLAANDLYCDDLDTVDHNDMTIL  360

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE-EKTAAGKDILKLES  1592
             SN  EEVV SAI +HL + K+P+YRN  L+IS+KSL H +++F+E E +       K ES
Sbjct  361   SNQTEEVVASAIFHHLKDAKNPKYRNGILIISAKSLRHVLSLFQEGESSEKDNKKTKKES  420

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             K + S++        K  E+K +      +K ++                          
Sbjct  421   KRDDSRK-------EKPKESKKDGDIKASAKSDS--------------------------  447

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG-GLLKPC  1235
              PDN FE+ IR E+IPA EI VTF+DIGALD++KESL E VMLPLRRPDLFKG G+LKPC
Sbjct  448   -PDNAFEECIRQELIPANEIKVTFSDIGALDDVKESLQEAVMLPLRRPDLFKGDGVLKPC  506

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             +G+LLFGPPGTGKTMLAKAIA EAGASFINVS STITS W G+ EKNVRALF+LAAKV+P
Sbjct  507   KGVLLFGPPGTGKTMLAKAIANEAGASFINVSPSTITSMWQGQSEKNVRALFSLAAKVAP  566

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIF+DEVDSMLGQRS   EH +MR++KNEFMS WDGLL+KP E+I VLAATN PFDLDE
Sbjct  567   TIIFIDEVDSMLGQRSSTREHSSMRRVKNEFMSRWDGLLSKPDEKITVLAATNMPFDLDE  626

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRF+RRIMVGLP+ + RE ILKT+LAKE   + ++ ++L+TMTEGY+GSDLKNLC T
Sbjct  627   AIIRRFQRRIMVGLPSADNRETILKTILAKEK-SENMNFEELSTMTEGYSGSDLKNLCMT  685

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTAN-EDKGERVITIRPLNMDDFMEAK  518
             AAYRP++ELI+QE+ K++ KK+   E     +A  A  EDK ++VI +RPLNM+D  EAK
Sbjct  686   AAYRPLKELIQQEKEKEMTKKKKVTEVEILEEASIATEEDKEDQVIALRPLNMEDMREAK  745

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKK-EQLTYFL  401
             N+V ASFAAEGSIM  LK+WN+LYGEGGSRKK EQL+YF 
Sbjct  746   NKVTASFAAEGSIMTRLKEWNDLYGEGGSRKKEEQLSYFF  785



>ref|XP_004496508.1| PREDICTED: uncharacterized AAA domain-containing protein C16E9.10c-like 
[Cicer arietinum]
Length=727

 Score =   796 bits (2055),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 425/819 (52%), Positives = 545/819 (67%), Gaps = 118/819 (14%)
 Frame = -1

Query  2839  VSKWT--GSSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             + KW   G   N ++ + +  E++N ++DG+DS +TFDEFPYYLS   ++LL  A +V+ 
Sbjct  21    LGKWVSVGVDFNDISEEQIVMELMNLVIDGKDSGITFDEFPYYLSVNIQILLIRAGYVYF  80

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             K  +  +HTRNLSP SR ILLSGPAELYQQ +A+ALA YF +KLLLLD+TDFSLK+Q+KY
Sbjct  81    KQDNLLRHTRNLSPVSRAILLSGPAELYQQNIARALARYFESKLLLLDITDFSLKMQNKY  140

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSN  2306
             G  R E   KRSISE    ++S+  GS SIL                   PS G      
Sbjct  141   GCPRKEPDLKRSISE----KVSDLFGSLSIL-------------------PSTG------  171

Query  2305  PTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIV  2126
                                    +   PL  T+   FDE + + +LYKVLV +S+   ++
Sbjct  172   -----------------------AIRAPLKCTNRFCFDENIFLDSLYKVLVSISEVDSVI  208

Query  2125  LYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDD-YRELDERLSSVFPYN  1949
             LY++D EK+  RS ++Y L QK+L++LSGSVLILGSR  D  D+   E+DE+L+ +FP N
Sbjct  209   LYIKDVEKIFHRSPRMYSLFQKLLKKLSGSVLILGSRTYDSEDNNCIEVDEKLTMLFPCN  268

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEIKPP++ETHL  W +QL++ MK  +  D +NH+ EVLAA++I+CDDL SI   D + L
Sbjct  269   IEIKPPQDETHLKIWNAQLKKAMKETRLIDTRNHVEEVLAAHEIDCDDLNSIGDTDIVLL  328

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESK  1589
              NYIEE+  SAI YHLM+ K P+Y+N KL+I +KSL H +                    
Sbjct  329   GNYIEEIATSAICYHLMDNKHPKYKNGKLIILAKSLFHVLT-------------------  369

Query  1588  AELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVP  1409
               L +E++S EK +   +   +                                    VP
Sbjct  370   --LFQESKSNEKDNTKTKKPKKK-----------------------------------VP  392

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG-LLKPCR  1232
              ++ FE+ IR EVI A EIGVTF+DIGA+D++KESL E VMLPLRRP+LFKGG LLKPC+
Sbjct  393   HNDVFEEHIRQEVISANEIGVTFSDIGAVDDVKESLQEAVMLPLRRPELFKGGGLLKPCK  452

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             G+LLFGPPGTGKTMLAKAIA EAGASFINVS STIT+ WFG  EKNVRALF+LAAKV+PT
Sbjct  453   GVLLFGPPGTGKTMLAKAIANEAGASFINVSPSTITAMWFGNGEKNVRALFSLAAKVAPT  512

Query  1051  IIFVDEVDSMLGQRSRA-GEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             IIF+DEVDS+LGQRS    EH +MR++KNEFMS WDGLL+KP E+ILVLAATN PFDLDE
Sbjct  513   IIFIDEVDSLLGQRSNGQHEHNSMRRLKNEFMSRWDGLLSKPDEKILVLAATNMPFDLDE  572

Query  874   AIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTT  695
             AIIRRF+RRIMVGLP+ E RE ILKTLLAKE   + +D K+L+ MT+GY+GSDLKNLC T
Sbjct  573   AIIRRFQRRIMVGLPSAENRESILKTLLAKEK-HENIDFKELSIMTKGYSGSDLKNLCMT  631

Query  694   AAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKN  515
             AAY PV+ELI+QE+ KDV+K+   +      D   A EDK ++VI +RPLNM+D   AKN
Sbjct  632   AAYLPVKELIQQEKAKDVKKEAKVEISE---DTSNAIEDKEDQVIALRPLNMEDMRHAKN  688

Query  514   QVAASFAAEGSIMNELKQWNNLYGEGGSRKK-EQLTYFL  401
             +VAASF+  GS+MN L +WN+LYGEGGS++K E  +YF+
Sbjct  689   KVAASFSENGSMMNMLMKWNDLYGEGGSKEKVETPSYFI  727



>ref|XP_003592171.1| Katanin p60 ATPase-containing subunit A-like protein [Medicago 
truncatula]
Length=799

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 437/835 (52%), Positives = 548/835 (66%), Gaps = 109/835 (13%)
 Frame = -1

Query  2830  WTG-----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             W G       SN ++ + + + +   ++DG+DSKVTFD+FPYYLSE+ ++LLTSA + HL
Sbjct  49    WFGFGGDSDESNHISENQIVKGLKKLVIDGKDSKVTFDDFPYYLSEKNKILLTSAGYFHL  108

Query  2665  KSADFAKHTRNLSPASRTILLSGPA---------------ELYQQMLAKALAHYFGAKLL  2531
             +  D +KHTRNLSP  R ILLSG A               E Y   LA ALAH F +KLL
Sbjct  109   RQHDLSKHTRNLSPVRRAILLSGHAGIFRPNLVFSCENYFEHYHHKLAGALAHCFESKLL  168

Query  2530  LLDVTDFSLKVQSKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQS  2351
              LD+  FSLK+Q KYG  R E  FKRSI E T   +S    S SIL              
Sbjct  169   SLDIAHFSLKMQGKYGCPRKEPYFKRSIFEATREFVSGLFVSLSIL--------------  214

Query  2350  SGVDIPSKG-IEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQ  2174
                  PSKG I   SN T                              S   FDEKL + 
Sbjct  215   -----PSKGAIRAPSNST------------------------------SCYFFDEKLFLH  239

Query  2173  ALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDD  1994
             +LYKVLV +S+   ++LY+++ EK+   S ++Y L QK L +LSGSVLILGSR  D   +
Sbjct  240   SLYKVLVSISEAGSVILYIKNVEKVFLGSPRMYRLFQKTLNKLSGSVLILGSRPYDLKYN  299

Query  1993  YRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIE  1814
               +++E+L+ +FPYNIEI PP++ETHL  WKSQL++ MK    +D   HI EVLAAND+ 
Sbjct  300   CTKVNEKLTMLFPYNIEITPPQDETHLKIWKSQLKKAMKKTHLKDYTTHIAEVLAANDLY  359

Query  1813  CDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE  1634
             CDDL ++   D   LSN  EEVV SAI +HL + K+P+YRN  L+IS+KSL H +++F+E
Sbjct  360   CDDLDTVDHNDMTILSNQTEEVVASAIFHHLKDAKNPKYRNGILIISAKSLRHVLSLFQE  419

Query  1633  -EKTAAGKDILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapaptt  1457
              E +       K ESK + S++        K  E+K +      +K ++           
Sbjct  420   GESSEKDNKKTKKESKRDDSRK-------EKPKESKKDGDIKASAKSDS-----------  461

Query  1456  kdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPL  1277
                             PDN FE+ IR E+IPA EI VTF+DIGALD++KESL E VMLPL
Sbjct  462   ----------------PDNAFEECIRQELIPANEIKVTFSDIGALDDVKESLQEAVMLPL  505

Query  1276  RRPDLFKG-GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDE  1100
             RRPDLFKG G+LKPC+G+LLFGPPGTGKTMLAKAIA EAGASFINVS STITS W G+ E
Sbjct  506   RRPDLFKGDGVLKPCKGVLLFGPPGTGKTMLAKAIANEAGASFINVSPSTITSMWQGQSE  565

Query  1099  KNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGER  920
             KNVRALF+LAAKV+PTIIF+DEVDSMLGQRS   EH +MR++KNEFMS WDGLL+KP E+
Sbjct  566   KNVRALFSLAAKVAPTIIFIDEVDSMLGQRSSTREHSSMRRVKNEFMSRWDGLLSKPDEK  625

Query  919   ILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATM  740
             I VLAATN PFDLDEAIIRRF+RRIMVGLP+ + RE ILKT+LAKE   + ++ ++L+TM
Sbjct  626   ITVLAATNMPFDLDEAIIRRFQRRIMVGLPSADNRETILKTILAKEK-SENMNFEELSTM  684

Query  739   TEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTAN-EDKGERV  563
             TEGY+GSDLKNLC TAAYRP++ELI+QE+ K++ KK+   E     +A  A  EDK ++V
Sbjct  685   TEGYSGSDLKNLCMTAAYRPLKELIQQEKEKEMTKKKKVTEVEILEEASIATEEDKEDQV  744

Query  562   ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKK-EQLTYFL  401
             I +RPLNM+D  EAKN+V ASFAAEGSIM  LK+WN+LYGEGGSRKK EQL+YF 
Sbjct  745   IALRPLNMEDMREAKNKVTASFAAEGSIMTRLKEWNDLYGEGGSRKKEEQLSYFF  799



>ref|XP_003569389.1| PREDICTED: peroxisome biosynthesis protein PAS1-like [Brachypodium 
distachyon]
Length=801

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 421/826 (51%), Positives = 542/826 (66%), Gaps = 102/826 (12%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDGR++ VTFDEFPYYLSE+T++ LTSAA+ +L      KH R LS ASRT
Sbjct  49    VEAELRRLVVDGRETGVTFDEFPYYLSEETKLALTSAAYAYLSKMSLPKHIRVLSAASRT  108

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILL GP+E Y Q L+KALA++F A+LLLLDV  FS +++ KYGS+ +    KRS++E  L
Sbjct  109   ILLCGPSEPYLQSLSKALAYHFNARLLLLDVPQFSRRIEHKYGSASSSLVRKRSLTEAAL  168

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
             +++S  +GSF+  + K+E   +L    + +D+ +     S  P+                
Sbjct  169   DKVSGLVGSFNFFRKKDEPTESLNHGKNILDLRTGNCCASYTPSVR--------------  214

Query  2251  SYNTTSNPGPLMR-----------TSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAE  2105
               + +  PG L             T S + DEK+LIQ+LYK+++ VS+  P++LY+RD  
Sbjct  215   -VHVSLLPGALGHDSDSLEEFESVTESWNLDEKILIQSLYKIIISVSECNPVILYIRDVN  273

Query  2104  KLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEE  1925
              LL  S++ + + QKML +LSG VLI+GS+ ++  +D  ++DE +S++FPY +E KPP+E
Sbjct  274   ILLGISDRAHSMFQKMLSKLSGQVLIIGSQFLESDEDSYDVDEDVSALFPYILETKPPKE  333

Query  1924  ETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM-ALSNYIEEV  1748
             ETHL  WK+Q+EED K  + Q  KN I +VL+AN +ECDDL S    D + A+ +YI E+
Sbjct  334   ETHLAQWKTQMEEDTKKTEGQKAKNIIADVLSANSLECDDLNSFDPDDNLTAVGSYIGEI  393

Query  1747  VVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKET  1568
             +  A+SYHLMN KDPEYRN KL            I   E  + G  I +   ++ L K+T
Sbjct  394   MAPAVSYHLMNNKDPEYRNGKL------------IISSESLSHGLSIFQ---ESNLGKDT  438

Query  1567  QSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEK  1388
                +  +K                                          +  PDNEFEK
Sbjct  439   VEPKDDTK------------------------------------------KSAPDNEFEK  456

Query  1387  RIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG-LLKPCRGILLFGP  1211
              IRP VIPA +IGVTF DIGAL +IKESL ELVMLPL+RP+LF GG LLKPCRGILLFGP
Sbjct  457   LIRPTVIPANQIGVTFDDIGALADIKESLQELVMLPLQRPELFNGGGLLKPCRGILLFGP  516

Query  1210  PGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEV  1031
             PGTGKTMLAKAIA EAGASF+N+SMSTI SKWFGE EK  RALF+LAAK++P I+FVDEV
Sbjct  517   PGTGKTMLAKAIANEAGASFLNISMSTILSKWFGEAEKITRALFSLAAKIAPAIVFVDEV  576

Query  1030  DSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFER  851
             DSMLGQR    EHE  R++KNEFM+HWDGLL+K  ERILVLAATNRPFDLDEAIIRRFE 
Sbjct  577   DSMLGQRDNPNEHELPRRVKNEFMTHWDGLLSKSTERILVLAATNRPFDLDEAIIRRFEH  636

Query  850   RIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRE  671
             RIMVGLPT + RELILK LL+KE V + +D K+LAT+TEGY+GSDLKNLC TAAYRPVRE
Sbjct  637   RIMVGLPTLDSRELILKKLLSKEKV-ESIDFKELATLTEGYSGSDLKNLCVTAAYRPVRE  695

Query  670   LIKQERLKDVEKKRLAQECPNCGDAPTANED--------KGER--------VITIRPLNM  539
             LI++E+ K  +KK  A E      A   N++        +GE+         + +R L M
Sbjct  696   LIQEEQKKKGDKKGNALEVKGEPGANPKNQESVENSESKQGEKGMQGQTGETVALRSLTM  755

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             DD   AK+QV AS A+EG++MN +KQWN LYG+GGSRKKEQLTYFL
Sbjct  756   DDLRNAKDQVGASLASEGAVMNAIKQWNELYGKGGSRKKEQLTYFL  801



>ref|NP_001043616.1| Os01g0623500 [Oryza sativa Japonica Group]
 dbj|BAB21091.1| cell division cycle gene CDC48-like [Oryza sativa Japonica Group]
 dbj|BAF05530.1| Os01g0623500 [Oryza sativa Japonica Group]
 gb|EAZ12740.1| hypothetical protein OsJ_02657 [Oryza sativa Japonica Group]
Length=812

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 413/851 (49%), Positives = 553/851 (65%), Gaps = 103/851 (12%)
 Frame = -1

Query  2836  SKWTG-SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKS  2660
             S+ TG ++    T   +E E+   +VDGRD  V+FD+FPYYLSEQ+++ LTS AFVHL  
Sbjct  26    SRLTGLATGGGATAAEVEAELRCLVVDGRDVGVSFDDFPYYLSEQSKLALTSTAFVHLSP  85

Query  2659  ADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGS  2480
                  H R LS +SRTILL GP+E Y Q LAKALA+ F A+LLLLDV DF+ K+  KYG 
Sbjct  86    TILPNHIRVLSASSRTILLCGPSEAYLQSLAKALANQFSARLLLLDVIDFACKLHHKYGG  145

Query  2479  SRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGT--LRRQSSGVDIPSKGIEGSSN  2306
               N  + +RS++E   +R+S  +G+F++ + KEE  GT  L R++  +D+ +      + 
Sbjct  146   PSNTQTRERSMTEAAFDRVSSLVGAFNLFRKKEEPTGTGPLSRETGILDLRTSTCCPHNT  205

Query  2305  PTTlrrnssa---sanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
             P+   + S       +    + Y  +  P         S +EK+LIQ+LYK++V  S+  
Sbjct  206   PSVRVQLSLVPPEKDHDPESSKYLASVKP-------CWSLNEKVLIQSLYKIIVSASEIS  258

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
             P++LY+RD + LL  SEK Y + QKML++LSG V+++GS+ +D  +D  +++E + ++FP
Sbjct  259   PVILYIRDVDDLLGSSEKAYCMFQKMLKKLSGRVIVIGSQFLDDDEDREDIEESVCALFP  318

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
               +E KPP+++  L  WK+Q+EED      Q  +N+I EVLA N++EC+DL SI   D  
Sbjct  319   CILETKPPKDKVLLEKWKTQMEEDSNNNNNQVVQNYIAEVLAENNLECEDLSSINADDDC  378

Query  1774  AL-SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKL  1598
              +   Y+EE++  ++SYHLMN K+P+YRN  LVISS+SLSHG+ IF+E            
Sbjct  379   KIIVAYLEEIITPSVSYHLMNNKNPKYRNGNLVISSESLSHGLRIFQE------------  426

Query  1597  ESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP  1418
                        S + G    E K E+                                  
Sbjct  427   -----------SNDLGKDTVEAKDETEM--------------------------------  443

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
              V PDNE+EK+IRP VIPA EIGVTF DIGAL +IKE LHELVMLPL+RPD FKGGLLKP
Sbjct  444   -VVPDNEYEKKIRPTVIPANEIGVTFDDIGALADIKECLHELVMLPLQRPDFFKGGLLKP  502

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             C+G+LLFGPPGTGKTMLAKA+A  AGASF+N+SM+++TSKW+GE EK ++ALF+LAAK++
Sbjct  503   CKGVLLFGPPGTGKTMLAKALANAAGASFLNISMASMTSKWYGESEKCIQALFSLAAKLA  562

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             P IIF+DEVDSMLG+R    E+EA R++KNEFM+HWDGLL+K  ERILVLAATNRPFDLD
Sbjct  563   PAIIFIDEVDSMLGKRDNHSENEASRRVKNEFMAHWDGLLSKSNERILVLAATNRPFDLD  622

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             +A+IRRFE RIMVGLPT E RELILKTLL+KETV  + D K+LA MTEGYT SDLKN+C 
Sbjct  623   DAVIRRFEHRIMVGLPTLESRELILKTLLSKETVENI-DFKELAKMTEGYTSSDLKNICV  681

Query  697   TAAYRPVRELIKQERLK------------DVEKKRLAQECPNCGDAPTANE--DKGERV-  563
             TAAY PVREL+++E+ K              EK ++ +      D+ T  +  D  E   
Sbjct  682   TAAYHPVRELLQKEKNKVKKETAPETKQEPKEKTKIQENGTKSSDSKTEKDKLDNKEGKK  741

Query  562   -----------------ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGG  434
                               T+RPLNM+D  +AK++VAASFA+EG +MN++K+WN LYG+GG
Sbjct  742   DKPADKKDKSDKGDAGETTLRPLNMEDLRKAKDEVAASFASEGVVMNQIKEWNELYGKGG  801

Query  433   SRKKEQLTYFL  401
             SRK+EQLTYFL
Sbjct  802   SRKREQLTYFL  812



>gb|EAY75016.1| hypothetical protein OsI_02914 [Oryza sativa Indica Group]
Length=814

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/832 (49%), Positives = 544/832 (65%), Gaps = 97/832 (12%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDGRD  V+FD+FPYYLSEQ+++ LTS AFVHL       H R LS +SRT
Sbjct  45    VEAELRCLVVDGRDVGVSFDDFPYYLSEQSKLALTSTAFVHLSPTILPNHIRVLSASSRT  104

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILL GP+E Y Q LAKALA+ F A+LLLLDV DF+ K+  KYG   N  + +RS++E   
Sbjct  105   ILLCGPSEAYLQSLAKALANQFSARLLLLDVIDFACKLHHKYGGPSNTQTRERSMTEAAF  164

Query  2431  NRMSEFLGSFSILQPKEEKKGT--LRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnn  2258
              R+S  +G+F++ + KEE  GT  L R++  +D+ +     S+ P          + +  
Sbjct  165   YRVSSLVGAFNLFRKKEEPTGTGPLSRETGILDLRT-----STCPHNTPSVRVQLSLVPP  219

Query  2257  ltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKV  2078
                ++  S+          S +EK+LIQ+LYK++V  S+  P++LY+RD + LL  SEK 
Sbjct  220   EKDHDPESSKYLASVKPCWSLNEKVLIQSLYKIIVSASEISPVILYIRDVDDLLGSSEKA  279

Query  2077  YILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKS  1898
             Y + QKML++LSG V+++GS+ +D  +D  +++E + ++FP  +E KPP+++  L  WK+
Sbjct  280   YCMFQKMLKKLSGRVIVIGSQFLDDDEDREDIEESVCALFPCILETKPPKDKALLEKWKT  339

Query  1897  QLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL-SNYIEEVVVSAISYHL  1721
             Q+EED      Q  +N+I EVLA N++EC+DL SI   D   +   Y+EE++  A+SYHL
Sbjct  340   QMEEDSNNNNNQVVQNYIAEVLAENNLECEDLSSINADDDCKIIVAYLEEIITPAVSYHL  399

Query  1720  MNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKG  1541
             MN K+P+YRN  LVISS+SLSHG+ IF+E                       S + G   
Sbjct  400   MNNKNPKYRNGNLVISSESLSHGLRIFQE-----------------------SNDLGKDT  436

Query  1540  PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPA  1361
              E K E+                                   V PDNE+EK+IRP VIPA
Sbjct  437   VEAKDETEM---------------------------------VVPDNEYEKKIRPTVIPA  463

Query  1360  KEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAK  1181
              EIGVTF DIGAL +IKE LHELVMLPL+RPD FKGGLLKPC+G+LLFGPPGTGKTMLAK
Sbjct  464   NEIGVTFDDIGALADIKECLHELVMLPLQRPDFFKGGLLKPCKGVLLFGPPGTGKTMLAK  523

Query  1180  AIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRA  1001
             A+A  AGASF+N+SM+++TSKW+GE EK ++ALF+LAAK++P IIF+DEVDSMLG+R   
Sbjct  524   ALANAAGASFLNISMASMTSKWYGESEKCIQALFSLAAKLAPAIIFIDEVDSMLGKRDNH  583

Query  1000  GEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPE  821
              E+EA R++KNEFM+HWDGLL+K  ERILVLAATNRPFDLD+A+IRRFE RIMVGLPT E
Sbjct  584   SENEASRRVKNEFMAHWDGLLSKSNERILVLAATNRPFDLDDAVIRRFEHRIMVGLPTLE  643

Query  820   QRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLK--  647
              RELILKTLL+KETV  + D K+LA MTEGYT SDLKN+C TAAY PVREL+++E+ K  
Sbjct  644   SRELILKTLLSKETVENI-DFKELAKMTEGYTSSDLKNICVTAAYHPVRELLQKEKNKVK  702

Query  646   ----------DVEKKRLAQECPNCGDAPTANE--DKGERV------------------IT  557
                         EK ++ +      D+ T  +  D  E                     T
Sbjct  703   KETAPETMQEPKEKTKIQENGTKSSDSKTEKDKLDNKEGKKDKPADKKDKSDKGDAGETT  762

Query  556   IRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +RPLNM+D  +AK++VAASFA+EG +MN++K+WN LYG+GGSRK+EQLTYFL
Sbjct  763   LRPLNMEDLRKAKDEVAASFASEGVVMNQIKEWNELYGKGGSRKREQLTYFL  814



>ref|XP_004969211.1| PREDICTED: ribosome biogenesis ATPase RIX7-like [Setaria italica]
Length=814

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/824 (49%), Positives = 525/824 (64%), Gaps = 90/824 (11%)
 Frame = -1

Query  2794  IMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASR  2615
             ++E E+L  +VDGR++ VTF +FPYYLSE+TR+ LTSAAF +L  A   KH + L  +SR
Sbjct  55    VVEAELLRLVVDGRETGVTFADFPYYLSEETRLALTSAAFPYLTQAVLPKHIQVLDDSSR  114

Query  2614  TILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSF--KRSISE  2441
             TILL G +E     LAKA+AH F A+LL LD+ +FS  ++ KYG+  +        S++E
Sbjct  115   TILLGGQSETCLLSLAKAVAHQFNARLLPLDLFEFSRLMKHKYGAPSDAQVEIPNSSMTE  174

Query  2440  TTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmn  2261
             TT +R+  F+ S +I + K E   +L  +   +D+ +      + P          + + 
Sbjct  175   TTWDRVYGFVDSLNIFRKKAEPTESLDHRRDILDVKTSIHYKITQPV-----GLYISLLP  229

Query  2260  nltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEK  2081
                 ++T S+    +     S DE++L+Q+LYKV+V VS+  P++LY+R+   LL  S +
Sbjct  230   CAKKHDTESDEDNEIVVPVWSVDEEILMQSLYKVIVSVSECSPLILYIREVNVLLGSSPR  289

Query  2080  VYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWK  1901
              Y L +KML +LSG VL++GS  +   +D  ++DE ++ +FPY +E KPP+EE+HL  WK
Sbjct  290   AYDLFKKMLNKLSGRVLVIGSHFLTADEDSGDVDEEVTELFPYILETKPPKEESHLEKWK  349

Query  1900  SQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHL  1721
             +Q+E D+   Q +    H   VL+A ++EC DL SI   D   +  YIE ++  A+SYHL
Sbjct  350   TQMENDVAKAQEESFVTHTAGVLSAYNLECGDLSSIPRDDYFTIGKYIENIIAPAVSYHL  409

Query  1720  MNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKG  1541
             MN KDPEY+N +L++SS SLSHG+ IF+E     G                         
Sbjct  410   MNNKDPEYKNGRLILSSTSLSHGLKIFQESNLGKGT------------------------  445

Query  1540  PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIR-PEVIP  1364
              ETK +S  A                                   DNE+EKRIR   VIP
Sbjct  446   VETKVDSKVAK----------------------------------DNEYEKRIRESSVIP  471

Query  1363  AKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLA  1184
             A E GVTF DIGAL +IKES+ ELVMLPL+RPDLF GGLLKPCRGILLFGPPGTGKTMLA
Sbjct  472   ASETGVTFDDIGALADIKESIQELVMLPLQRPDLFNGGLLKPCRGILLFGPPGTGKTMLA  531

Query  1183  KAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSR  1004
             KA+A EAGASFIN+SMSTI SKW+GE EK++RALF+LA K++P IIFVDEVDSMLG R R
Sbjct  532   KAVANEAGASFINISMSTIVSKWYGEAEKSIRALFSLATKIAPAIIFVDEVDSMLGSRER  591

Query  1003  AGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTP  824
             + EHE  R+IKNEFM+HWDGLL+KP ERILVLAATNRPFDLDEAIIRRFE R+MVGLPT 
Sbjct  592   SNEHEVSRRIKNEFMTHWDGLLSKPNERILVLAATNRPFDLDEAIIRRFEHRVMVGLPTL  651

Query  823   EQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKD  644
             E RELILK LL+KE V  + D K+LA MTEGY+GSDLKNLC TAAYRPVREL+++E+   
Sbjct  652   ESRELILKKLLSKEKVEDI-DFKELAKMTEGYSGSDLKNLCVTAAYRPVRELLQKEKEMK  710

Query  643   VE--------KKRLAQECPNCGDAPTANED-------------KGE--RVITIRPLNMDD  533
              +        KK  A+E  N G      E              KGE      +RPL M+D
Sbjct  711   KDKKAKDEEGKKVQAEEPTNQGSGKEKPESSKAKKVESGEEGAKGETKETAALRPLTMED  770

Query  532   FMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
               +AK +VA SF++EG++MNE++QWN LYG+GGSRKK+ L+YF 
Sbjct  771   LKKAKEEVATSFSSEGAVMNEIRQWNELYGKGGSRKKQDLSYFF  814



>gb|AES62421.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=750

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 420/813 (52%), Positives = 543/813 (67%), Gaps = 99/813 (12%)
 Frame = -1

Query  2821  SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKH  2642
             + SN +  D + + ++  + +G+D  VTFD+FPYYL E+ ++LLTSA +VHL     +KH
Sbjct  31    NQSNQLHEDQIVKGLMKLVTNGKDYDVTFDKFPYYLREKVKILLTSAGYVHLTQHRLSKH  90

Query  2641  TRNLSPASRTILLSGPA---ELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRN  2471
             T+NLSP SR ILLSGPA   E YQ+ LAKALAHYF +KLL+LD+ +F+ K+Q K+G    
Sbjct  91    TKNLSPVSRAILLSGPAVFEEFYQENLAKALAHYFESKLLILDIYNFTWKMQLKHGCP--  148

Query  2470  ESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlr  2291
                   S S    +R   +L +            TL+RQSS         E S+NP    
Sbjct  149   ----CASASGLFGSRFGLYLSA------------TLQRQSSS-------FENSNNPPKRH  185

Query  2290  rnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRD  2111
             +N S ++NM      N+TS   P+  TS + FDEK L+ +LYKVL+ + +T  ++LY+++
Sbjct  186   KNVSTASNM------NSTSQ-SPMTCTSRVCFDEKRLLDSLYKVLLSILETDSVILYIKN  238

Query  2110  AEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPP  1931
              E    +  ++Y L  ++L +LSGSVLILGSRI D  D   E+DE+L+ +FP NIEIKPP
Sbjct  239   VENDFRQYPRMYNLFHELLNKLSGSVLILGSRIYDSEDKCVEVDEKLTMLFPCNIEIKPP  298

Query  1930  EEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEE  1751
             ++E+ L  WK QLEE M   Q +    HI +VLA N+I CDDL +I  +DTM LSN+I+E
Sbjct  299   QDESRLKIWKVQLEEAMTKTQLK----HISQVLAENNIGCDDLNTIGHSDTMLLSNHIKE  354

Query  1750  VVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKE  1571
             +  SA+ Y LM+ K+PEYRN                        GK ++  ES   +   
Sbjct  355   IAASAVFYQLMDNKNPEYRN------------------------GKLVISAESLCHVLSV  390

Query  1570  TQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFE  1391
              Q GE      +   + S                                 EVPPDN FE
Sbjct  391   FQKGESSDNDNKKTTKESKK-------------------------------EVPPDNAFE  419

Query  1390  KRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG-GLLKPCRGILLFG  1214
             K IR E+I A EIGVTF+DIGALD++KESL E VMLPLRRPD+FKG G+LKPC+G+LLFG
Sbjct  420   KNIRRELISANEIGVTFSDIGALDDVKESLQEAVMLPLRRPDIFKGDGVLKPCKGVLLFG  479

Query  1213  PPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  1034
             PPGTGKTMLAKAIA EAGASFINVS STI+S WFG  EKNVRALF+LAAKVSPTIIF+DE
Sbjct  480   PPGTGKTMLAKAIANEAGASFINVSASTISSCWFGNGEKNVRALFSLAAKVSPTIIFIDE  539

Query  1033  VDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFE  854
             VDS+LG+RS   + + MR+IKNEFMSHWDGLL+KP E++ VLAATN PF LDEAIIRRF+
Sbjct  540   VDSLLGKRSD-NDDKTMRRIKNEFMSHWDGLLSKPVEKVTVLAATNMPFGLDEAIIRRFQ  598

Query  853   RRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVR  674
             RRIMVGLP+ E+RE ILKTLLAKE   + +D K+L+TMTEGY+GSDLKNLCTTAAYRP++
Sbjct  599   RRIMVGLPSAEKRETILKTLLAKEK-HEDIDFKELSTMTEGYSGSDLKNLCTTAAYRPIK  657

Query  673   ELIKQERLKDVEKKRLAQECPNCGD-APTANEDKGERVITIRPLNMDDFMEAKNQVAASF  497
             EL++QE+ K+++KK+   E     D + T +E+K ++VI +RPLNM+D  +AK +VAAS+
Sbjct  658   ELMQQEKEKEMKKKKKEAEVEKSEDVSNTGDEEKSDQVIALRPLNMEDMRQAKEKVAASY  717

Query  496   AAEGSIMNELKQWNNLYGEGGSRKK-EQLTYFL  401
             A EGS M  L+QWNNLYGEGGSRKK EQL+YF+
Sbjct  718   ATEGSNMKMLEQWNNLYGEGGSRKKEEQLSYFI  750



>ref|XP_003592170.1| Spastin [Medicago truncatula]
Length=748

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/813 (52%), Positives = 543/813 (67%), Gaps = 101/813 (12%)
 Frame = -1

Query  2821  SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKH  2642
             + SN +  D + + ++  + +G+D  VTFD+FPYYL E+ ++LLTSA +VHL     +KH
Sbjct  31    NQSNQLHEDQIVKGLMKLVTNGKDYDVTFDKFPYYLREKVKILLTSAGYVHLTQHRLSKH  90

Query  2641  TRNLSPASRTILLSGPA---ELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRN  2471
             T+NLSP SR ILLSGPA   E YQ+ LAKALAHYF +KLL+LD+ +F+ K+Q K+G    
Sbjct  91    TKNLSPVSRAILLSGPAVFEEFYQENLAKALAHYFESKLLILDIYNFTWKMQLKHGCP--  148

Query  2470  ESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlr  2291
                   S S    +R   +L +            TL+RQSS         E S+NP    
Sbjct  149   ----CASASGLFGSRFGLYLSA------------TLQRQSSS-------FENSNNPPKRH  185

Query  2290  rnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRD  2111
             +N S ++NM      N+T+   P+  TS + FDEK L+ +LYKVL+ + +T  ++LY+++
Sbjct  186   KNVSTASNM------NSTT---PMTCTSRVCFDEKRLLDSLYKVLLSILETDSVILYIKN  236

Query  2110  AEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPP  1931
              E    +  ++Y L  ++L +LSGSVLILGSRI D  D   E+DE+L+ +FP NIEIKPP
Sbjct  237   VENDFRQYPRMYNLFHELLNKLSGSVLILGSRIYDSEDKCVEVDEKLTMLFPCNIEIKPP  296

Query  1930  EEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEE  1751
             ++E+ L  WK QLEE M   Q +    HI +VLA N+I CDDL +I  +DTM LSN+I+E
Sbjct  297   QDESRLKIWKVQLEEAMTKTQLK----HISQVLAENNIGCDDLNTIGHSDTMLLSNHIKE  352

Query  1750  VVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKE  1571
             +  SA+ Y LM+ K+PEYRN                        GK ++  ES   +   
Sbjct  353   IAASAVFYQLMDNKNPEYRN------------------------GKLVISAESLCHVLSV  388

Query  1570  TQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFE  1391
              Q GE      +   + S                                 EVPPDN FE
Sbjct  389   FQKGESSDNDNKKTTKESKK-------------------------------EVPPDNAFE  417

Query  1390  KRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG-GLLKPCRGILLFG  1214
             K IR E+I A EIGVTF+DIGALD++KESL E VMLPLRRPD+FKG G+LKPC+G+LLFG
Sbjct  418   KNIRRELISANEIGVTFSDIGALDDVKESLQEAVMLPLRRPDIFKGDGVLKPCKGVLLFG  477

Query  1213  PPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDE  1034
             PPGTGKTMLAKAIA EAGASFINVS STI+S WFG  EKNVRALF+LAAKVSPTIIF+DE
Sbjct  478   PPGTGKTMLAKAIANEAGASFINVSASTISSCWFGNGEKNVRALFSLAAKVSPTIIFIDE  537

Query  1033  VDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFE  854
             VDS+LG+RS   + + MR+IKNEFMSHWDGLL+KP E++ VLAATN PF LDEAIIRRF+
Sbjct  538   VDSLLGKRSD-NDDKTMRRIKNEFMSHWDGLLSKPVEKVTVLAATNMPFGLDEAIIRRFQ  596

Query  853   RRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVR  674
             RRIMVGLP+ E+RE ILKTLLAKE   + +D K+L+TMTEGY+GSDLKNLCTTAAYRP++
Sbjct  597   RRIMVGLPSAEKRETILKTLLAKEK-HEDIDFKELSTMTEGYSGSDLKNLCTTAAYRPIK  655

Query  673   ELIKQERLKDVEKKRLAQECPNCGD-APTANEDKGERVITIRPLNMDDFMEAKNQVAASF  497
             EL++QE+ K+++KK+   E     D + T +E+K ++VI +RPLNM+D  +AK +VAAS+
Sbjct  656   ELMQQEKEKEMKKKKKEAEVEKSEDVSNTGDEEKSDQVIALRPLNMEDMRQAKEKVAASY  715

Query  496   AAEGSIMNELKQWNNLYGEGGSRKK-EQLTYFL  401
             A EGS M  L+QWNNLYGEGGSRKK EQL+YF+
Sbjct  716   ATEGSNMKMLEQWNNLYGEGGSRKKEEQLSYFI  748



>gb|KDO76368.1| hypothetical protein CISIN_1g007208mg [Citrus sinensis]
Length=613

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/566 (67%), Positives = 450/566 (80%), Gaps = 11/566 (2%)
 Frame = -1

Query  2845  QTVSKWTGS--SSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             QT+SKW G+  S NAVT + ME+E+L  IVDGR+S +TFDEFPYYLS QTR LLTSAA+V
Sbjct  27    QTMSKWAGNNPSPNAVTPEKMEKELLRQIVDGRESNITFDEFPYYLSGQTRALLTSAAYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             HLK  + +K+TRNLSPAS+ ILLSGPAELYQQMLAKALAH+F AKLLLLDVTDFSLK+QS
Sbjct  87    HLKHTEVSKYTRNLSPASQAILLSGPAELYQQMLAKALAHFFEAKLLLLDVTDFSLKIQS  146

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG +  ES F+RS SE+ L R+S   GSFSIL  KEE +GTLRRQ SGVDI S+G EGS
Sbjct  147   KYGGTNKESHFQRSPSESALERLSGLFGSFSILSQKEETQGTLRRQGSGVDITSRGTEGS  206

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              N   LRRN+SASAN++NL S  + SN G L RTSS SFDEKLLIQ++Y+VL  VSKT P
Sbjct  207   FNHPALRRNASASANISNLAS-QSFSNTGNLKRTSSWSFDEKLLIQSIYRVLCYVSKTSP  265

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             IV+YLRD +KL+ +S++ Y L QKM+++L  SVLILGSRIVD  +D RE+D R++++FPY
Sbjct  266   IVVYLRDVDKLIFKSQRTYNLFQKMMKKLLASVLILGSRIVDLSNDQREVDGRVTALFPY  325

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEI+PPE+E HLVSWKSQLEEDMKMMQ +DN+NHIMEVL+AND++CDDL SI +ADTM 
Sbjct  326   NIEIRPPEDENHLVSWKSQLEEDMKMMQAKDNRNHIMEVLSANDLDCDDLDSINVADTMV  385

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLES  1592
             L NYIEE+VVSA+SYHLMN +D +YRN KL+ISSKSLSHG++IF+E K A+GKD LKLE+
Sbjct  386   LGNYIEEIVVSAVSYHLMNNEDTDYRNGKLIISSKSLSHGLSIFQEGK-ASGKDTLKLEA  444

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT--AVKAP  1418
             +AE  K  + G K +KGP+  A +      KPE+ S A   A        S    A KAP
Sbjct  445   QAE--KSNEGGRKEAKGPKPAAGTEIM---KPESTSEAEKSAAAPNKDGDSSVPAAAKAP  499

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIP+ EI VTFADIGAL+EIKESL ELVMLPLRRPDLFKGGLLKP
Sbjct  500   EVPPDNEFEKRIRPEVIPSNEISVTFADIGALEEIKESLQELVMLPLRRPDLFKGGLLKP  559

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAG  1160
             CRGILLFGPPG GK    + + K  G
Sbjct  560   CRGILLFGPPGLGKQCWPRPLPKRLG  585



>gb|EMS67284.1| Spastin [Triticum urartu]
Length=1541

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 409/826 (50%), Positives = 543/826 (66%), Gaps = 91/826 (11%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDG DS VTFD+FPYYLSE+T++ LTSA + +L   +   H R LS ASRT
Sbjct  778   VEAELRRLVVDGLDSGVTFDDFPYYLSEETKLALTSAGYAYLSKINLPSHIRVLSAASRT  837

Query  2611  ILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISETTL  2432
             ILL GP+E Y Q LAKALAH+F A+LLLLD+ +FS ++Q KYGS+ +    KRS++E+ L
Sbjct  838   ILLCGPSEPYLQSLAKALAHHFDARLLLLDIAEFSRQIQHKYGSASSALVRKRSLTESAL  897

Query  2431  NRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmnnlt  2252
             +++S  +GSF+  + K+E   +L+ + S +D+ +     +   T   R   +      L 
Sbjct  898   DKVSGLVGSFNFFRKKDEPADSLKYEKSLLDLRT----SNCTKTPSVRVHVSLLPAAFLP  953

Query  2251  SYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYI  2072
             +   + + GP+ +  S + DEK+LI++LYK++  VS+  P+++Y+RD   LL  S+    
Sbjct  954   ACEPSEDLGPIRQ--SWNLDEKILIKSLYKMITSVSECNPVIVYIRDVNLLLGASDAACS  1011

Query  2071  LLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQL  1892
             + +KML +LSG VLI+GS  ++   D  ++DE +S +FPY +E KPP+EET LV WK+Q+
Sbjct  1012  MFKKMLSKLSGRVLIIGSYFLESDADSDDVDEVVSDIFPYILETKPPKEETDLVKWKTQI  1071

Query  1891  EEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM-ALSNYIEEVVVSAISYHLMN  1715
             EED K  + Q   N I EVL+AN + CDDL S+   D +  +++Y+EE++  A+SYHLM+
Sbjct  1072  EEDTKKTKGQIFTNMIAEVLSANSLICDDLDSLDPDDDLHTIASYMEEIMAPAVSYHLMD  1131

Query  1714  TKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPE  1535
              K PEYRN KL+I ++SLSHG+ IF +E ++ GKD   +E K    K T         P+
Sbjct  1132  NKVPEYRNGKLIIPAESLSHGLRIF-QESSSLGKDT--VEPKDVGKKVT---------PD  1179

Query  1534  TKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKE  1355
              + E    P                        T V A ++                   
Sbjct  1180  NEFEKLIRP------------------------TVVPASQI-------------------  1196

Query  1354  IGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAI  1175
              GVTF DIGAL +IKESL ELVMLPL+RP+LF GGLLKPC+GILLFGPPGTGKTMLAKA+
Sbjct  1197  -GVTFDDIGALTDIKESLQELVMLPLKRPELFNGGLLKPCKGILLFGPPGTGKTMLAKAL  1255

Query  1174  AKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGE  995
             A E+GASF+N+S+STI SK++G+ EK +RALF+LA K++P IIFVDEVDS+LGQR R  E
Sbjct  1256  ANESGASFLNISLSTIMSKYYGDAEKTIRALFSLATKLAPAIIFVDEVDSLLGQRDRRNE  1315

Query  994   HEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQR  815
             +E  R+IKNEFM+HWDGLL+K  ERILVLAATNRPFDLDEAI+RRFE RIMVGLPT E R
Sbjct  1316  NELPRRIKNEFMTHWDGLLSKSNERILVLAATNRPFDLDEAIVRRFEHRIMVGLPTLESR  1375

Query  814   ELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEK  635
             ELILK LL+KE V + +D K+LAT TEGY+GSDLKNLC TAAYRPVRELI++E+ K  +K
Sbjct  1376  ELILKKLLSKEKVEEGIDFKELATSTEGYSGSDLKNLCVTAAYRPVRELIQKEQQKVKDK  1435

Query  634   KR--------LAQECPNCGDAPTANEDKGERV--------------------ITIRPLNM  539
             K          AQ     G A ++   KGE V                    +T+RPL M
Sbjct  1436  KENAVQVKEPEAQPKSQRGAAQSSESKKGENVMLETKQGVTEKGVKGATEETVTLRPLTM  1495

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +D   AK+QV AS A+EGSIM  LK+WN LYG+GGSRKKEQL+YFL
Sbjct  1496  EDLRLAKDQVGASLASEGSIMTALKEWNELYGKGGSRKKEQLSYFL  1541



>gb|EMT26441.1| Spastin [Aegilops tauschii]
Length=848

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/871 (46%), Positives = 532/871 (61%), Gaps = 138/871 (16%)
 Frame = -1

Query  2791  MEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASRT  2612
             +E E+   +VDG DS VTFD+FPYYLSE+T++ LTSA + +L   +   H R LS ASRT
Sbjct  42    VEAELRRLVVDGLDSGVTFDDFPYYLSEETKLALTSAGYAYLSKINLPSHIRVLSAASRT  101

Query  2611  ILLSGP------------AELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNE  2468
             ILL GP            AE YQQ LAKALAH+F A+LLLLD+ +FS ++Q KYGS+ + 
Sbjct  102   ILLCGPSGCLFSHGQLVLAEPYQQSLAKALAHHFDARLLLLDIAEFSRQIQHKYGSASSA  161

Query  2467  SSF--------------KRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPS  2330
               +              KRS++E+ L+++S  +GSF+    K+E   +L+ + S +D+  
Sbjct  162   LLYIEAPAPPPFCCQVRKRSLTESALDKVSGLVGSFNFFCKKDEPADSLKYEKSLLDL--  219

Query  2329  KGIEGSSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVK  2150
                  +SN T         + +     +  + + GP+ +  S + DEK+LI++LYK++  
Sbjct  220   ----RTSNCTKTPSIRVHVSLLPAAFLHEPSEDLGPIRQ--SWNLDEKILIKSLYKMITS  273

Query  2149  VSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERL  1970
             VS+  P+++Y+RD   LL  S+    + +KML +LSG +LI+GS  ++   D  ++DE +
Sbjct  274   VSECNPVIVYIRDVNLLLGASDAACSMFKKMLSKLSGRILIIGSYFLESDADGDDVDEVV  333

Query  1969  SSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIEC-DDLGSI  1793
             S +FPY +E KPP+EET LV WK+Q+EED K  + Q   N I EVL+AN + C D     
Sbjct  334   SDIFPYILETKPPKEETDLVKWKTQIEEDTKKTKGQIFTNMIAEVLSANSLICDDLDSLD  393

Query  1792  CMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGK  1613
                D   +++Y+EE++  A+SYHLM+ K PEYRN KL+I ++SLSHG+ IF +E ++ GK
Sbjct  394   PDDDLQTIASYVEEIMAPAVSYHLMDNKVPEYRNGKLIIPAESLSHGLRIF-QESSSLGK  452

Query  1612  DILKLESKAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGT  1433
             D   +E K    K T         P+ + E    P                        T
Sbjct  453   DT--VEPKDVGKKVT---------PDNEFEKLIRP------------------------T  477

Query  1432  AVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG  1253
              V A ++              +   +IG   ADI      KESL ELVMLPL+RP+LF G
Sbjct  478   VVPASQIG-------------VTFDDIG-ALADI------KESLQELVMLPLKRPELFNG  517

Query  1252  GLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTL  1073
             GLLKPC+GILLFGPPGTGKTMLAKA+A E+GASF+N+S+STI SK++G+ EK +RALF+L
Sbjct  518   GLLKPCKGILLFGPPGTGKTMLAKALANESGASFLNISLSTIMSKYYGDAEKTIRALFSL  577

Query  1072  AAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNR  893
             A K++P IIFVDEVDS+LGQR R  E+E  R+IKNEFM+HWDGLL+K  ERILVLAATNR
Sbjct  578   ATKLAPAIIFVDEVDSLLGQRDRRNENELPRRIKNEFMTHWDGLLSKSNERILVLAATNR  637

Query  892   PFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDL  713
             PFDLDEAI+RRFE RIMVGLP  E RELILK LL+KE V + +D K+LAT TEGY+GSDL
Sbjct  638   PFDLDEAIVRRFEHRIMVGLPALESRELILKKLLSKEKVEEGIDFKELATSTEGYSGSDL  697

Query  712   KNLCTTAAYRPVRELIKQERLK--------DVEKKRL-------------------AQEC  614
             KNLC TAAYRPVRELI++E+ K         +  +RL                   AQ  
Sbjct  698   KNLCVTAAYRPVRELIQKEQHKVKMCCTNHIIISRRLDNSMSQDKKENAVQVKEPEAQPK  757

Query  613   PNCGDAPTANEDKGERV--------------------ITIRPLNMDDFMEAKNQVAASFA  494
                G A ++   KGE                      + +RPL M+D   AK+QV AS A
Sbjct  758   SQGGAAQSSQSKKGENAMPETKQGETEKGVKGATEGTVALRPLTMEDLRLAKDQVGASLA  817

Query  493   AEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
              EGSIM  LK+WN LYG+GGSRKKEQL+YFL
Sbjct  818   GEGSIMTALKEWNELYGKGGSRKKEQLSYFL  848



>emb|CDX89214.1| BnaA01g16790D [Brassica napus]
Length=758

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/587 (59%), Positives = 455/587 (78%), Gaps = 16/587 (3%)
 Frame = -1

Query  2833  KWTGSS---SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             KW   S    + +T + +EQE+   IVDGR+S VTFDEFPY+LSE+TR+LLTSAA+VHLK
Sbjct  29    KWANGSVAAEDGLTGEKIEQELARQIVDGRESSVTFDEFPYFLSEKTRLLLTSAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLDVTDFS+K+QSKYG
Sbjct  89    QFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDVTDFSIKMQSKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNP  2303
               + E   KRSISE TL++MS  + SFS+L  +EE +GTLRR +SG D+ S+G EGSS+P
Sbjct  149   CIKKEPCHKRSISEMTLDKMSNLMESFSMLTQREETRGTLRRLTSGNDLTSRGFEGSSHP  208

Query  2302  TTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVL  2123
               L+RN+SA++++++++S + +S      R+++L FDEKL +Q+LYKVLV VS+T PI++
Sbjct  209   NRLKRNASAASDISSISSRSASSVSASSKRSTNLCFDEKLFLQSLYKVLVSVSETNPIII  268

Query  2122  YLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIE  1943
             YLRD EKL+ +SE+ Y L Q++L +LSG VL+LGSR+++P DD +E+ E +S++FPYNIE
Sbjct  269   YLRDVEKLI-QSERFYKLFQRLLTKLSGPVLLLGSRLLEPEDDCQEVGEGISALFPYNIE  327

Query  1942  IKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSN  1763
             I+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADTM LS+
Sbjct  328   IRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDLECDDLGSICHADTMFLSS  387

Query  1762  YIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAE  1583
             +IEE+VVSAISYHLMN K+PEY+N +LVISS SLSHG++IF +E +   ++ LKL+   +
Sbjct  388   HIEEIVVSAISYHLMNNKEPEYKNGRLVISSNSLSHGLSIF-QEGSKYPENSLKLDRNTD  446

Query  1582  LSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP--EVP  1409
                +  +GE+  +  +++++S T P +K +        +             KAP  EV 
Sbjct  447   --SKVFTGEESEEIVKSESKSETVPANKDDL------ESSIPAAKNECPLPPKAPVNEVA  498

Query  1408  PDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRG  1229
             PDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKPCRG
Sbjct  499   PDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKPCRG  558

Query  1228  ILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
             ILLFGPPGTGKTM+AKAIA EAGAS   + +   T++ F  DE  +R
Sbjct  559   ILLFGPPGTGKTMMAKAIANEAGAS-DRILVLAATNRPFDLDEAIIR  604


 Score =   233 bits (595),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -1

Query  925  ERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLA  746
            +RILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA
Sbjct  584  DRILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFHELA  642

Query  745  TMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVE-KKRLAQECPNCGDAPTANEDKGE  569
             MT+GY+GSDLKN CTTAAYRPVRELIKQE LKD E KKR   E  +   +    E   E
Sbjct  643  QMTDGYSGSDLKNFCTTAAYRPVRELIKQECLKDQERKKREEPEKSSEEGSEEKEEASEE  702

Query  568  RVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
            RVIT+R L+M+D   AK+QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  703  RVITLRALSMEDMRVAKSQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  758



>gb|KHN47439.1| Spastin [Glycine soja]
Length=425

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/445 (73%), Positives = 365/445 (82%), Gaps = 25/445 (6%)
 Frame = -1

Query  1720  MNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG---  1550
             MNTKDPEYRN KLVIS+ SLSHG+++F+E K++   ++   ES  E + E  +G K    
Sbjct  1     MNTKDPEYRNGKLVISANSLSHGLSLFQEGKSSG--NLKTNESNKENAGEDITGAKNEVK  58

Query  1549  --SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRP  1376
               ++ PE K+E+  +     + G                 T  KA EVP DNEFEKRIRP
Sbjct  59    CDNQAPENKSETEKSIPVTKKDGENP--------------TPAKA-EVP-DNEFEKRIRP  102

Query  1375  EVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK  1196
             EVIPA EIGVTFADIGALDEIKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK
Sbjct  103   EVIPANEIGVTFADIGALDEIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGK  162

Query  1195  TMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLG  1016
             TMLAKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKV+PTIIFVDEVDSMLG
Sbjct  163   TMLAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVAPTIIFVDEVDSMLG  222

Query  1015  QRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVG  836
             QR+R GEHEAMRKIKNEFM+HWDGLLT P E+ILVLAATNRPFDLDEAIIRRFERRI+VG
Sbjct  223   QRTRVGEHEAMRKIKNEFMTHWDGLLTGPNEQILVLAATNRPFDLDEAIIRRFERRILVG  282

Query  835   LPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQE  656
             LP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC TAAYRPVRELI+QE
Sbjct  283   LPSVENREMILKTLLAKEK-HENLDFKELATMTEGYTGSDLKNLCITAAYRPVRELIQQE  341

Query  655   RLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIM  476
             RLKD+EKK+   E  +  DA + N+DK E+ IT+RPLNM+D  +AK+QVAASFA+EGS+M
Sbjct  342   RLKDMEKKKREAEGQSSEDA-SNNKDKEEQEITLRPLNMEDMRQAKSQVAASFASEGSVM  400

Query  475   NELKQWNNLYGEGGSRKKEQLTYFL  401
             NELKQWN+LYGEGGSRKK+QLTYFL
Sbjct  401   NELKQWNDLYGEGGSRKKQQLTYFL  425



>gb|KEH43666.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=635

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/669 (51%), Positives = 429/669 (64%), Gaps = 91/669 (14%)
 Frame = -1

Query  2830  WTG-----SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHL  2666
             W G       SN ++ + + + +   ++DG+DSKVTFD+FPYYLSE+ ++LLTSA + HL
Sbjct  50    WFGFGGDSDESNHISENQIVKGLKKLVIDGKDSKVTFDDFPYYLSEKNKILLTSAGYFHL  109

Query  2665  KSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKY  2486
             +  D +KHTRNLSP  R ILLSG AE Y   LA ALAH F +KLL LD+  FSLK+Q KY
Sbjct  110   RQHDLSKHTRNLSPVRRAILLSGHAEHYHHKLAGALAHCFESKLLSLDIAHFSLKMQGKY  169

Query  2485  GSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKG-IEGSS  2309
             G  R E  FKRSI E T   +S    S SIL                   PSKG I   S
Sbjct  170   GCPRKEPYFKRSIFEATREFVSGLFVSLSIL-------------------PSKGAIRAPS  210

Query  2308  NPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPI  2129
             N T                              S   FDEKL + +LYKVLV +S+   +
Sbjct  211   NST------------------------------SCYFFDEKLFLHSLYKVLVSISEAGSV  240

Query  2128  VLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYN  1949
             +LY+++ EK+   S ++Y L QK L +LSGSVLILGSR  D   +  +++E+L+ +FPYN
Sbjct  241   ILYIKNVEKVFLGSPRMYRLFQKTLNKLSGSVLILGSRPYDLKYNCTKVNEKLTMLFPYN  300

Query  1948  IEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL  1769
             IEI PP++ETHL  WKSQL++ MK    +D   HI EVLAAND+ CDDL ++   D   L
Sbjct  301   IEITPPQDETHLKIWKSQLKKAMKKTHLKDYTTHIAEVLAANDLYCDDLDTVDHNDMTIL  360

Query  1768  SNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKE-EKTAAGKDILKLES  1592
             SN  EEVV SAI +HL + K+P+YRN  L+IS+KSL H +++F+E E +       K ES
Sbjct  361   SNQTEEVVASAIFHHLKDAKNPKYRNGILIISAKSLRHVLSLFQEGESSEKDNKKTKKES  420

Query  1591  KAELSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEV  1412
             K + S++        K  E+K +      +K ++                          
Sbjct  421   KRDDSRK-------EKPKESKKDGDIKASAKSDS--------------------------  447

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKG-GLLKPC  1235
              PDN FE+ IR E+IPA EI VTF+DIGALD++KESL E VMLPLRRPDLFKG G+LKPC
Sbjct  448   -PDNAFEECIRQELIPANEIKVTFSDIGALDDVKESLQEAVMLPLRRPDLFKGDGVLKPC  506

Query  1234  RGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSP  1055
             +G+LLFGPPGTGKTMLAKAIA EAGASFINVS STITS W G+ EKNVRALF+LAAKV+P
Sbjct  507   KGVLLFGPPGTGKTMLAKAIANEAGASFINVSPSTITSMWQGQSEKNVRALFSLAAKVAP  566

Query  1054  TIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDE  875
             TIIF+DEVDSMLGQRS   EH +MR++KNEFMS WDGLL+KP E+I VLAATN PFDLDE
Sbjct  567   TIIFIDEVDSMLGQRSSTREHSSMRRVKNEFMSRWDGLLSKPDEKITVLAATNMPFDLDE  626

Query  874   AIIRRFERR  848
             AIIRRF+RR
Sbjct  627   AIIRRFQRR  635



>ref|XP_006644385.1| PREDICTED: katanin p60 ATPase-containing subunit A1-like [Oryza 
brachyantha]
Length=662

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/721 (48%), Positives = 458/721 (64%), Gaps = 98/721 (14%)
 Frame = -1

Query  2458  KRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnss  2279
             +RSI+E   N++S  +G+F++ + KEE  G+L R+++ +D+ +      + P+   + S 
Sbjct  5     ERSITEGAFNKVSSLVGAFNLFRKKEEPTGSLNRETNLLDLRTSNCCSHNAPSVRLQLSL  64

Query  2278  asanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKL  2099
                  +    + + S+             EK+LIQ+LYK++V  S+  PI+LY+RD E L
Sbjct  65    IPVAKD----HGSESSRDFDSAKPYWGLSEKVLIQSLYKIIVSASEISPIILYIRDVEDL  120

Query  2098  LCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEET  1919
             L  SEK Y + QKML++LSG V+++GS+ ++   D  +++E + ++FP  +E KPP+E+ 
Sbjct  121   LGCSEKAYCMFQKMLKKLSGRVIVIGSQFLESDQDRDDIEESVCALFPCILETKPPKEKN  180

Query  1918  HLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMAL-SNYIEEVVV  1742
              L  WK Q+EED    + +  +N+I EVL+   +EC+DLGSI   D   +  NY+EE++ 
Sbjct  181   LLQKWKIQMEEDSNNDKNRMVQNYIAEVLSKKSLECEDLGSINADDDFKIIVNYLEEIIA  240

Query  1741  SAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQS  1562
              A+SYHLMN KDP+YRN  LVISS+SLSHG+ IF+                       +S
Sbjct  241   PAVSYHLMNNKDPKYRNGNLVISSESLSHGLRIFQ-----------------------ES  277

Query  1561  GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRI  1382
                G    E K E+                                   V PD+E+EK+I
Sbjct  278   NNLGKDTLEAKDETEM---------------------------------VVPDSEYEKKI  304

Query  1381  RPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGT  1202
             R  VIPA EIGVTF DIGAL +IKE L ELVMLPL+RPD FKGGLLKPC+GILLFGPPGT
Sbjct  305   RQTVIPANEIGVTFDDIGALADIKEWLRELVMLPLQRPDFFKGGLLKPCKGILLFGPPGT  364

Query  1201  GKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSM  1022
             GKTMLAKA+A  AGASF+N+SMS++TSKW+GE EK ++ALF+LAAK++P IIFVDEVDSM
Sbjct  365   GKTMLAKALANAAGASFLNISMSSMTSKWYGESEKCIQALFSLAAKIAPAIIFVDEVDSM  424

Query  1021  LGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIM  842
             LG R    E+EA R+IKNEFM+HWDGLL+K  ERILVLAATNRPFDLD+A+IRRFE RIM
Sbjct  425   LGLRDNPNENEASRRIKNEFMAHWDGLLSKSNERILVLAATNRPFDLDDAVIRRFEHRIM  484

Query  841   VGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIK  662
             VGLPT E RELILKTLL+KETV  + D K+LA MTEGYT SDLKNLC TAAYRPVREL++
Sbjct  485   VGLPTLESRELILKTLLSKETVENI-DFKELAKMTEGYTSSDLKNLCVTAAYRPVRELLQ  543

Query  661   QERLKDVEKKRLAQECPNCGDAPTANEDKGERV---------------------------  563
             +E+ +D  KK  A E        T  ++ G                              
Sbjct  544   KEKNED--KKETAPETNQEPKQKTEIQEIGATSSDSKKDKDKLDNKDSKKDKPDDKKDKS  601

Query  562   -------ITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYF  404
                      +RPLNM D   AK++VAASFA+EG++M+ +K+WN LYG+GGSRK EQLTYF
Sbjct  602   DKGDAGETALRPLNMQDLRNAKDEVAASFASEGAVMSRIKEWNELYGKGGSRKPEQLTYF  661

Query  403   L  401
             L
Sbjct  662   L  662



>ref|XP_002458124.1| hypothetical protein SORBIDRAFT_03g027270 [Sorghum bicolor]
 gb|EES03244.1| hypothetical protein SORBIDRAFT_03g027270 [Sorghum bicolor]
Length=696

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/826 (43%), Positives = 486/826 (59%), Gaps = 167/826 (20%)
 Frame = -1

Query  2809  AVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNL  2630
             A   DI E E+   +VDG+++ +TF +FPYYLSE+ R+ L  A+F +L      KH +  
Sbjct  15    ATAADI-ELELRRLLVDGQETNITFAKFPYYLSEEMRLALMCASFPYLSQTILPKHIKVF  73

Query  2629  SPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRS  2450
               +S TILL G +E   + LAKA+A+ F A+LL LD+ +F  +V              RS
Sbjct  74    KDSSHTILLCGQSETCLRSLAKAIANQFNARLLELDIFEFLHQVPI------------RS  121

Query  2449  ISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasa  2270
              +   L ++ +F+GS SI    +E K        G  +P                     
Sbjct  122   KTMLALEKVYDFVGSLSIFCKNDESK--------GFGVPF--------------------  153

Query  2269  nmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCR  2090
                                    + D K L+Q+LYK++V  S   P+VLY+RD + +L  
Sbjct  154   ----------------------WNLDVKTLLQSLYKIIVSASACSPVVLYIRDVDIILRS  191

Query  2089  SEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLV  1910
             S +V  + QKML +  G VLI+GS  +D   D  ++++ L+ +FPY +E +PP EE HL 
Sbjct  192   SPRVLCMFQKMLNKQFGKVLIIGSHFLDANQDIDDINKDLTDLFPYILETRPPNEEAHLQ  251

Query  1909  SWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAIS  1730
              W  Q+  DM              + A ++I    + S        +++Y+E+++  A++
Sbjct  252   RWTRQMRIDM--------------IKARDEILAHHVAS-------EIASYLEDILAPAVA  290

Query  1729  YHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG  1550
             YH MN +DP+YRN +L++SS SL +G+ IF+E               + L K++      
Sbjct  291   YHFMNNQDPKYRNGRLILSSTSLCYGLRIFQE---------------SNLEKDS------  329

Query  1549  SKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEV  1370
                 ETK +S                                  +V   NE+EKRIR  V
Sbjct  330   ---VETKDDS----------------------------------KVTKYNEYEKRIRELV  352

Query  1369  IPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTM  1190
             IPA E GVTF DIGAL +IKES+ ELVMLPL+RPDLF GGLLKPCRGILLFGPPGTGKTM
Sbjct  353   IPASETGVTFDDIGALADIKESIRELVMLPLQRPDLFNGGLLKPCRGILLFGPPGTGKTM  412

Query  1189  LAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQR  1010
             LAKAIA E GASF+N+SMSTI SKWFGE EK+++ALF+LA K++P+IIF+DEVDSMLG R
Sbjct  413   LAKAIANEVGASFMNISMSTIMSKWFGEAEKSIQALFSLATKIAPSIIFMDEVDSMLGTR  472

Query  1009  SRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLP  830
              R+ E+E  R+IK+EFM+HWDG+L+KP E+ILVL ATNRPFDLD+AIIRR+E RIMVGLP
Sbjct  473   ERSNENEVSRRIKSEFMTHWDGILSKPSEKILVLGATNRPFDLDDAIIRRYEHRIMVGLP  532

Query  829   TPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERL  650
             T E RELI   LL+KE +  + D K+L  MTEGY+GSDLK+LC  AAYRPVREL+++E+ 
Sbjct  533   TLESRELIFHKLLSKENIENI-DFKELGKMTEGYSGSDLKSLCVAAAYRPVRELLQKEKQ  591

Query  649   ------------KDVEKKRLAQECPNCGDAPTANED-----------KGERVITIRPLNM  539
                         K+V  +  +Q+  +  +    N+D           + + VIT+RPL M
Sbjct  592   MKKDKKEKEVQGKNVHVEN-SQKEKSKMEKSKINKDMKAISEEDDEDEIDEVITLRPLIM  650

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +D  +AK++V+ASFA +G++MNE+KQWN LYG GGSR +++LTYF+
Sbjct  651   EDLKQAKDEVSASFAIDGAVMNEIKQWNELYGRGGSRNRQKLTYFM  696



>emb|CDY29873.1| BnaA03g48940D [Brassica napus]
Length=701

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/567 (54%), Positives = 404/567 (71%), Gaps = 62/567 (11%)
 Frame = -1

Query  2833  KWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             KW   S +A   +T + +EQE++  IVDGR+S VTFDEFPY+LSE+TR+LLT+AA+VHLK
Sbjct  29    KWANGSVSAEDGLTGEKIEQELVRQIVDGRESGVTFDEFPYFLSEKTRLLLTNAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLDVTDFS+K+QSKYG
Sbjct  89    QFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDVTDFSIKIQSKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNP  2303
               + E S KRSISE TL++MS  +GSFS+L  +E+ +GTLRR +SG D+ S+G EGSS+P
Sbjct  149   CVKKEPSHKRSISELTLDKMSNLVGSFSMLTQREQPRGTLRRLTSGNDLTSRGFEGSSHP  208

Query  2302  TTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVL  2123
               L+RN+SA++++++++S + TS      R+++L FDE+L +Q+LYKVLV VS+  PI++
Sbjct  209   PQLKRNASAASDISSISSRSGTSVSASSKRSTNLCFDERLFLQSLYKVLVSVSEANPIII  268

Query  2122  YLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIE  1943
             YLRD EKLL +SE+ Y L QK+L +LSG VL+LGSR+++P DD +++ E +S++FPYNIE
Sbjct  269   YLRDVEKLL-QSERFYKLFQKLLSKLSGPVLLLGSRLLEPEDDCQQVGEGISALFPYNIE  327

Query  1942  IKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSN  1763
             I+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGS+C ADTM LS+
Sbjct  328   IRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDLECDDLGSVCHADTMFLSS  387

Query  1762  YIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAE  1583
             +IEE+VV+AISYHLMN K+PEY+N +LVISS SLSHG++IF+E  +  G   LK++  ++
Sbjct  388   HIEEIVVTAISYHLMNNKEPEYKNGRLVISSNSLSHGLSIFQEGHSCHGNS-LKMDRNSD  446

Query  1582  LSKETQSGEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPD  1403
                    GE+      ++ +S T P  K E                     V   EVPPD
Sbjct  447   -----SKGEESEGMINSELKSETTPSEKNEC---------------PLPPKVPVNEVPPD  486

Query  1402  NEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCRGIL  1223
             NEFEKRIRPE  P                  +SL                       GIL
Sbjct  487   NEFEKRIRPETKPKNHF--------------KSL-----------------------GIL  509

Query  1222  LFGPPGTGKTMLAKAIAKEAGASFINV  1142
             LFGPPGTGKTM+AKAIA EAGASFINV
Sbjct  510   LFGPPGTGKTMMAKAIANEAGASFINV  536


 Score =   217 bits (552),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 143/205 (70%), Gaps = 13/205 (6%)
 Frame = -1

Query  979  KIKNEFMSHWDGLLTKPGERILVLAAT----------NRPFDLDEAIIRRFERRIMVGLP  830
            K KN F S    L   PG    ++A            N PFDLDEAIIRRFERRIMVGLP
Sbjct  498  KPKNHFKSLGILLFGPPGTGKTMMAKAIANEAGASFINVPFDLDEAIIRRFERRIMVGLP  557

Query  829  TPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERL  650
            + E RE IL+TLL+KE   + LD  +LA MT+GY+GSDLKN CTTAAYRPVRELIK E L
Sbjct  558  SVESREKILRTLLSKEKT-ENLDFHELAQMTDGYSGSDLKNFCTTAAYRPVRELIKHECL  616

Query  649  KDVE-KKRLAQECPNCGDAPTANEDKGE-RVITIRPLNMDDFMEAKNQVAASFAAEGSIM  476
            KD E KKR   E  +  +   A E+  E RVIT+R L+M+D   AK+QVAASFAAEG+ M
Sbjct  617  KDQERKKREEAEKSSSEEGTEAKEEASEERVITLRALSMEDMRVAKSQVAASFAAEGAGM  676

Query  475  NELKQWNNLYGEGGSRKKEQLTYFL  401
            NELKQWN LYGEGGSRK+EQL+YFL
Sbjct  677  NELKQWNELYGEGGSRKQEQLSYFL  701



>gb|KHN28202.1| ATPase family AAA domain-containing protein 1-A [Glycine soja]
Length=405

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/426 (70%), Positives = 335/426 (79%), Gaps = 34/426 (8%)
 Frame = -1

Query  1663  LSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKG-----SKGPETKAESSTAPGSK  1499
             LSHG+++F+E K++   ++   E   E S E  +G K      S+ PE K+E+  +    
Sbjct  9     LSHGLSLFQEGKSSG--NLKTTEPNKENSGEDITGAKNEMKCDSQAPENKSETEKSIPVT  66

Query  1498  PETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALD  1319
              + G                 T  KA EVP DNEFEKRIRPEVIPA EIGVTFADIGALD
Sbjct  67    KKDGENP--------------TPAKA-EVP-DNEFEKRIRPEVIPANEIGVTFADIGALD  110

Query  1318  EIKESLHELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVS  1139
             EIKESL ELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVS
Sbjct  111   EIKESLQELVMLPLRRPDLFKGGLLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVS  170

Query  1138  MSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFM  959
             MSTITSKWFGEDEKNVR      AKV+PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM
Sbjct  171   MSTITSKWFGEDEKNVR------AKVAPTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFM  224

Query  958   SHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKET  779
             +HWDGLLT P E+ILVLAATNRPFDLDEAIIRRFERRI+VGLP+ E RE+ILKTLLAKE 
Sbjct  225   THWDGLLTGPNEQILVLAATNRPFDLDEAIIRRFERRILVGLPSVENREMILKTLLAKEK  284

Query  778   VGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGD  599
               + LD K+LATMTEGYTGSDLKNLC T AYRPVRELI+QER+KD+EKK+      +   
Sbjct  285   -HENLDFKELATMTEGYTGSDLKNLCITVAYRPVRELIQQERMKDMEKKKRK----DLSA  339

Query  598   APTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKE  419
               + N+DK E+ IT+RPLNM+D  EAK QVAASFA+EGS+MNELK WN+LYGEGGSRKK+
Sbjct  340   YFSNNKDKEEQEITLRPLNMEDMREAKTQVAASFASEGSVMNELKHWNDLYGEGGSRKKQ  399

Query  418   QLTYFL  401
             QLTYFL
Sbjct  400   QLTYFL  405



>gb|KFK23539.1| hypothetical protein AALP_AAs65553U000100, partial [Arabis alpina]
Length=330

 Score =   544 bits (1402),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 273/339 (81%), Positives = 301/339 (89%), Gaps = 9/339 (3%)
 Frame = -1

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIPA EIGVTFADIG+LDE KESL ELVMLPLRRPDLFKGGLLKP
Sbjct  1     EVPPDNEFEKRIRPEVIPANEIGVTFADIGSLDETKESLQELVMLPLRRPDLFKGGLLKP  60

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTM+AKAIA EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  61    CRGILLFGPPGTGKTMMAKAIANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  120

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVDEVDSMLGQR+R GEHEAMRKIKNEFM+HWDGL++  G+RILVLAATNRPFDLD
Sbjct  121   PTIIFVDEVDSMLGQRTRVGEHEAMRKIKNEFMTHWDGLMSNSGDRILVLAATNRPFDLD  180

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA MTEGY+GSDLKN CT
Sbjct  181   EAIIRRFERRIMVGLPSAESREKILRTLLSKEKT-ENLDFHELAQMTEGYSGSDLKNFCT  239

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAK  518
             TAAYRPVRELIKQE LKD+E+K+  ++        ++ E   ERV+T+R L+M+D   AK
Sbjct  240   TAAYRPVRELIKQECLKDLERKKAGEK--------SSEEVSEERVVTLRALSMEDMRMAK  291

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +QVAASFAAEG+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  292   SQVAASFAAEGAGMNELKQWNDLYGEGGSRKKEQLSYFL  330



>emb|CDX92857.1| BnaC07g41150D [Brassica napus]
Length=704

 Score =   557 bits (1436),  Expect = 4e-180, Method: Compositional matrix adjust.
 Identities = 311/590 (53%), Positives = 413/590 (70%), Gaps = 78/590 (13%)
 Frame = -1

Query  2833  KWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             KW   S +A   +T + +EQE++  IVDGR+S VTFDEFPY+LSE+TR+LLT+AA+VHLK
Sbjct  29    KWANGSVSAEDGLTGEKIEQELVRQIVDGRESGVTFDEFPYFLSEKTRLLLTNAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLDVTDFS+K+QSKYG
Sbjct  89    QFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDVTDFSIKIQSKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNP  2303
               + E S KRSISE TL++MS  +GS S+L  +E+ +GTLRR +SG D+ S+G EGSS+P
Sbjct  149   CVKKEPSHKRSISELTLDKMSNLVGSLSMLTQREQPRGTLRRLTSGNDLTSRGFEGSSHP  208

Query  2302  TTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVL  2123
               L+RN+SA++++++++S + TS      R+++L FDE+L +Q+LYKVLV VS+  PI++
Sbjct  209   PQLKRNASAASDISSISSRSGTSVSASSKRSTNLCFDERLFLQSLYKVLVSVSEASPIII  268

Query  2122  YLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIE  1943
             YLRD EKLL +SE+ Y L QK+L +LSG VL+LGSR+++P DD +++ E +S++FPYNIE
Sbjct  269   YLRDVEKLL-QSERFYKLFQKLLSKLSGPVLLLGSRLLEPEDDCQQVGEGISALFPYNIE  327

Query  1942  IKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSN  1763
             I+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGS+C ADTM LS+
Sbjct  328   IRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDLECDDLGSVCHADTMFLSS  387

Query  1762  YIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAE  1583
             +IEE+VV+AISYHLMN K+PEY+N +LVISS SLSHG++IF+E            E+  +
Sbjct  388   HIEEIVVTAISYHLMNNKEPEYKNGRLVISSNSLSHGLSIFQEGHRCH-------ENSLK  440

Query  1582  LSKETQSGEKGSKG---PETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP--  1418
             + + T S  + S+G    E K+ES+  P ++ E                      KAP  
Sbjct  441   MDRNTDSKGEESEGIINSELKSEST--PSAQNEC-----------------PLPPKAPVN  481

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEV                  +K   H            FK      
Sbjct  482   EVPPDNEFEKRIRPEV----------------HWMKPKNH------------FKN-----  508

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
               GILLFGPPGTGKTM+AKAIA EAGA+         T++ F  DE  +R
Sbjct  509   -LGILLFGPPGTGKTMMAKAIANEAGAT---------TNRPFDLDEAIIR  548


 Score =   217 bits (553),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 132/172 (77%), Gaps = 4/172 (2%)
 Frame = -1

Query  907  AATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGY  728
            A TNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA MT+GY
Sbjct  534  ATTNRPFDLDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFHELAQMTDGY  592

Query  727  TGSDLKNLCTTAAYRPVRELIKQERLKDVEKKR---LAQECPNCGDAPTANEDKGERVIT  557
            +GSDLKN CTTAAYRPVRELIK E LKD E+K+     +     G      E   ERVIT
Sbjct  593  SGSDLKNFCTTAAYRPVRELIKHECLKDQERKKREEAEKSSSEEGTEAKEEEVSEERVIT  652

Query  556  IRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
            +R L+M+D   AK+QVAASFAAEG+ MNELKQWN LYGEGGSRKKEQL+YFL
Sbjct  653  LRALSMEDMRVAKSQVAASFAAEGAGMNELKQWNELYGEGGSRKKEQLSYFL  704



>emb|CDY19014.1| BnaC01g20540D [Brassica napus]
Length=718

 Score =   553 bits (1426),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 310/588 (53%), Positives = 411/588 (70%), Gaps = 58/588 (10%)
 Frame = -1

Query  2833  KWTGSSSNA---VTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLK  2663
             KW   S  A   +T + +EQE++  IVDGR+S VTFDEFPY+LSE+TR+LLTSAA+VHLK
Sbjct  29    KWANGSVAAEDELTGEKIEQELVRQIVDGRESSVTFDEFPYFLSEKTRLLLTSAAYVHLK  88

Query  2662  SADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYG  2483
               D +KHTRNL+PAS+ ILLSGPAE YQQMLAKALAHYF +KLLLLDVTDFS+K+QSKYG
Sbjct  89    QFDISKHTRNLAPASKAILLSGPAEFYQQMLAKALAHYFESKLLLLDVTDFSIKMQSKYG  148

Query  2482  SSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNP  2303
               + E   KRSISE TL++MS  + SFS+L  +EE +GTLRR +SG D+ S+G EGSS+P
Sbjct  149   CIKKEPCHKRSISEMTLDKMSNLMESFSMLTQREETRGTLRRLTSGNDLTSRGFEGSSHP  208

Query  2302  TTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCPIVL  2123
               L+RN+SA++++++++S + +S      R+++L FDEKL +Q+LYKVLV VS+T PI++
Sbjct  209   NRLKRNASAASDISSISSRSASSVSASSKRSTNLCFDEKLFLQSLYKVLVSVSETNPIII  268

Query  2122  YLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPYNIE  1943
             YLRD EKL+ +SE+ Y L Q++L +LSG VL+L SR+++P DD +E+ E +S++FPYNIE
Sbjct  269   YLRDVEKLI-QSERFYTLFQRLLTKLSGPVLLLVSRLLEPEDDCQEVGEGISALFPYNIE  327

Query  1942  IKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSN  1763
             I+PPE+E+ L+SWK++ E+DMK++Q+QDNKNHI EVLAAND+ECDDLGSIC ADT+ LS+
Sbjct  328   IRPPEDESQLMSWKTRFEDDMKLIQFQDNKNHIAEVLAANDLECDDLGSICHADTIFLSS  387

Query  1762  YIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAE  1583
             +IEE+VVSAISYHLMN K+PEY+N +LVISS SLSHG++IF+E            E   +
Sbjct  388   HIEEIVVSAISYHLMNNKEPEYKNGRLVISSNSLSHGLSIFQEGSRYP-------EGSLK  440

Query  1582  LSKETQS-GEKGSKGPETKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAP--EV  1412
             L + T S GE+G +  +++++S T P +K +                      KAP  EV
Sbjct  441   LDRNTDSKGEEGEEIVKSESKSETVPENKNDL------ERSIPAAKNECPLPPKAPVNEV  494

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
              PDNEFEKRIRPE+ P                                  FK        
Sbjct  495   APDNEFEKRIRPEMKPKNH-------------------------------FKS------L  517

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVR  1088
             GILLFGPPGTGKTM+AKAIA EAGAS   + +   T++ F  DE  +R
Sbjct  518   GILLFGPPGTGKTMMAKAIANEAGAS-DKILVLAATNRPFDLDEAIIR  564


 Score =   229 bits (584),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 142/176 (81%), Gaps = 2/176 (1%)
 Frame = -1

Query  925  ERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLA  746
            ++ILVLAATNRPFDLDEAIIRRFERRIMVGLP+ E RE IL+TLL+KE   + LD  +LA
Sbjct  544  DKILVLAATNRPFDLDEAIIRRFERRIMVGLPSVESREKILRTLLSKEKT-ENLDFHELA  602

Query  745  TMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVE-KKRLAQECPNCGDAPTANEDKGE  569
             MT+GY+GSDLKN CTTAAYRPVRELIKQE LKD E KKR   E  +   +    E   E
Sbjct  603  QMTDGYSGSDLKNFCTTAAYRPVRELIKQECLKDQERKKRDEAEKSSEESSEEKEEASEE  662

Query  568  RVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
            RVIT+R L+M+D   AK+QVAASFAA+G+ MNELKQWN+LYGEGGSRKKEQL+YFL
Sbjct  663  RVITLRALSMEDMGVAKSQVAASFAAKGAGMNELKQWNDLYGEGGSRKKEQLSYFL  718



>dbj|BAJ99051.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=336

 Score =   537 bits (1383),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 273/339 (81%), Positives = 302/339 (89%), Gaps = 3/339 (1%)
 Frame = -1

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             EVPPDNEFEKRIRPEVIPA EIGV+F DIGAL++IKESL ELVMLPLRRPDLFKGGLLKP
Sbjct  1     EVPPDNEFEKRIRPEVIPANEIGVSFDDIGALEDIKESLQELVMLPLRRPDLFKGGLLKP  60

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
             CRGILLFGPPGTGKTMLAKAIA EA ASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS
Sbjct  61    CRGILLFGPPGTGKTMLAKAIANEAQASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  120

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIFVD VDSMLGQR+RAGEHEAMRKIKNEFM+HWDGLL++P ++ILVLAATNRPFDLD
Sbjct  121   PTIIFVDAVDSMLGQRNRAGEHEAMRKIKNEFMTHWDGLLSRPDQKILVLAATNRPFDLD  180

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVGLP+ + RE+I++ LL+KE V + LD K+L T+TEGY+GSDLKNLCT
Sbjct  181   EAIIRRFERRIMVGLPSVQNREMIMRRLLSKEKVDEGLDYKELGTITEGYSGSDLKNLCT  240

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAK  518
             TAAYRPVRELI++ER K++EKK+L +       +    +DK    I +RPLNM D  EAK
Sbjct  241   TAAYRPVRELIQKERKKELEKKKLEKGGTPLDPSKMKEKDKE---IILRPLNMADLKEAK  297

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFAAEGSIM ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  298   NQVAASFAAEGSIMGELKQWNDLYGEGGSRKKEQLTYFL  336



>ref|XP_010662651.1| PREDICTED: cell division control protein 48-like isoform X1 [Vitis 
vinifera]
Length=733

 Score =   534 bits (1375),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 268/339 (79%), Positives = 294/339 (87%), Gaps = 3/339 (1%)
 Frame = -1

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             P  NEFE RIRPEVIP   IGVTF DIGALD+IKESL ELVM PL+RP++FKGGLLKPCR
Sbjct  396   PRCNEFESRIRPEVIPPNRIGVTFDDIGALDDIKESLEELVMFPLQRPEIFKGGLLKPCR  455

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKA+A EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK+SPT
Sbjct  456   GILLFGPPGTGKTMLAKAMANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKISPT  515

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR   GE  +MRKIKNEFM+HWDGLLTK GER+LVLAATNRPFDLDEA
Sbjct  516   IIFVDEVDSMLGQRLEFGEDCSMRKIKNEFMTHWDGLLTKAGERVLVLAATNRPFDLDEA  575

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRF+ RIMVGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC  A
Sbjct  576   IIRRFDHRIMVGLPSVESREMILKTLLAKEQ-AEDLDFKELATMTEGYTGSDLKNLCMAA  634

Query  691   AYRPVRELIKQERL-KDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAK  518
             AYRPVREL +QER+ KD +KK+ A E  +  DA  T  E KGERVI +RPLNM+D  +AK
Sbjct  635   AYRPVRELAQQERMKKDKKKKQKADEGKSSEDASDTREEAKGERVIVLRPLNMEDMRQAK  694

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFA++G+ MN+LKQWN LYGEGGSRKKEQLTYFL
Sbjct  695   NQVAASFASDGAAMNKLKQWNELYGEGGSRKKEQLTYFL  733


 Score =   450 bits (1157),  Expect = 9e-139, Method: Compositional matrix adjust.
 Identities = 229/412 (56%), Positives = 296/412 (72%), Gaps = 51/412 (12%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QT+S+WTG    S+ A+T   +E E+   +VDG++SK+TF+EFPY LS+QTR LLTSAA 
Sbjct  27    QTMSRWTGLLNCSAGAITEAQLEHELRGQVVDGKESKITFEEFPYILSKQTRGLLTSAAH  86

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHL+ +DF+KHT+ L PA R ILLSGPAELYQ+ LAKALA +F AKLLLLDV DFSLK+Q
Sbjct  87    VHLRLSDFSKHTQKLMPAGRAILLSGPAELYQRALAKALAQFFEAKLLLLDVNDFSLKMQ  146

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  R E S K+SI ETTL ++S FLGSFSIL  +EE K  ++               
Sbjct  147   SKYGCPRKEYSSKKSIPETTLKQISGFLGSFSILPQREETKAHIKC--------------  192

Query  2314  SSNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTC  2135
                                               TSS +FDEK L+Q+LYKVLV VS+TC
Sbjct  193   ----------------------------------TSSWAFDEKHLLQSLYKVLVSVSETC  218

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFP  1955
              ++LY+RD +KLL +S++ Y L +KML +LSGSVLILGSR++DP D+  E+DER+S +FP
Sbjct  219   SMILYIRDVDKLLLQSDRFYKLFRKMLDKLSGSVLILGSRMLDPDDEDNEMDERVSLLFP  278

Query  1954  YNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTM  1775
              NIEI+ PE+ETHL  W++QL+E+ K++Q+QDNKN++ +VLAAND++CDDLGSIC AD  
Sbjct  279   CNIEIEKPEDETHLDRWEAQLKEETKVIQFQDNKNYMAKVLAANDLDCDDLGSICYADPE  338

Query  1774  ALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
              LS+Y EE+V+SAISYHL+N KDPEYRN KLVISSKSLSHG+++F+E+   A
Sbjct  339   ILSDYTEEIVISAISYHLLNNKDPEYRNGKLVISSKSLSHGLSLFQEDAPNA  390



>ref|XP_007143490.1| hypothetical protein PHAVU_007G076300g [Phaseolus vulgaris]
 gb|ESW15484.1| hypothetical protein PHAVU_007G076300g [Phaseolus vulgaris]
Length=765

 Score =   533 bits (1374),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 258/341 (76%), Positives = 296/341 (87%), Gaps = 5/341 (1%)
 Frame = -1

Query  1417  EVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKP  1238
             +VPPDNE+EKR+R +V+PAKEIGV F DIGALD+IKE L + V+LPLRRPDLF GGLLKP
Sbjct  428   DVPPDNEYEKRMRADVVPAKEIGVRFEDIGALDDIKEILQDEVLLPLRRPDLFNGGLLKP  487

Query  1237  CRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVS  1058
              +GILLFGPPGTGKTMLAKAIA EA ASFINVS+STITSKWFGEDEKNVRALF+LAAKV+
Sbjct  488   YKGILLFGPPGTGKTMLAKAIANEAEASFINVSISTITSKWFGEDEKNVRALFSLAAKVA  547

Query  1057  PTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLD  878
             PTIIF+DEVDSMLGQR++ GEHEA+RKIKNEFM HWDGLL+KP  RILVLAATNRP+DLD
Sbjct  548   PTIIFIDEVDSMLGQRTKCGEHEAIRKIKNEFMVHWDGLLSKPSNRILVLAATNRPYDLD  607

Query  877   EAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCT  698
             EAIIRRFERRIMVG+P+ E RE+ILKTLLAKE    V D K+L+ MT+GY+GSDLKNLCT
Sbjct  608   EAIIRRFERRIMVGIPSAENREMILKTLLAKEKYENV-DFKELSIMTKGYSGSDLKNLCT  666

Query  697   TAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAK  518
              AAYRPVREL++QER K  EKK+   E  +  +A  A EDK  RVI +RPLNMDD  +AK
Sbjct  667   AAAYRPVRELLRQERNK--EKKKTEAEVQSSENASDAKEDKEHRVIALRPLNMDDLRQAK  724

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKK--EQLTYFL  401
             +QV ASFAAEGSIM+EL++WN+L+GEGGSRKK  EQLTYFL
Sbjct  725   SQVTASFAAEGSIMSELEEWNDLFGEGGSRKKKQEQLTYFL  765


 Score =   427 bits (1098),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 223/399 (56%), Positives = 290/399 (73%), Gaps = 19/399 (5%)
 Frame = -1

Query  2845  QTVSKWTGSS--SNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFV  2672
             Q V KW G S  S+ ++ + +  E+ N ++DG++SK TF++FPYYLSE+ R  LTSA +V
Sbjct  27    QAVQKWMGGSCESDEISGEQIVLELNNKVIDGKNSKTTFNDFPYYLSERVRFSLTSAGYV  86

Query  2671  HLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQS  2492
             +LK  DF+KH RNL PASR ILLSGPAELYQQ L +ALAHYFG+KLLLLD+ DFSL++Q 
Sbjct  87    YLKQ-DFSKHMRNLCPASRAILLSGPAELYQQKLTQALAHYFGSKLLLLDIVDFSLEMQR  145

Query  2491  KYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGS  2312
             KYG  R E  FKRSIS+ TL R+S   GSF IL      +GTL RQSS        IE S
Sbjct  146   KYGFLRKEPYFKRSISDVTLERVSGLFGSFPILPSTCRTRGTLLRQSSE-------IENS  198

Query  2311  SNPTTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKTCP  2132
              NP  L RN+SA  +  + +  +  S+P PL  +S   FDEK+ +++LYKVLV +S+T  
Sbjct  199   RNPLKLCRNASAGCDTISSSECDQ-SDPAPLKCSSGFCFDEKVFVESLYKVLVSISETSS  257

Query  2131  IVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVFPY  1952
             I+LY++D EKL  RS ++  L QK++++LSG VLILGS+I D         ++L+ +FPY
Sbjct  258   IILYIKDVEKLFVRSPRLQNLFQKLIKKLSGPVLILGSQISD--------SDKLTMLFPY  309

Query  1951  NIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMA  1772
             NIEIKPPE ++HL SWK++L+EDMK + +QD++NHI EVLAA+DI+CDDL S+C ADTM 
Sbjct  310   NIEIKPPENDSHLASWKTKLKEDMKTILFQDSRNHIAEVLAASDIDCDDLNSVCHADTML  369

Query  1771  LSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSH  1655
             LSN IEE+V SA+S+HL  TKDPEYRN KLVIS+KSLSH
Sbjct  370   LSNSIEEIVASAVSHHLTETKDPEYRNGKLVISAKSLSH  408



>ref|XP_006347396.1| PREDICTED: uncharacterized protein LOC102604053 [Solanum tuberosum]
Length=937

 Score =   538 bits (1386),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 322/859 (37%), Positives = 475/859 (55%), Gaps = 143/859 (17%)
 Frame = -1

Query  2794  IMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAFVHLKSADFAKHTRNLSPASR  2615
             +  +++  TI+DG+D +V+FD+FPYYLSE T+ +L +  ++HLK  +  K+   L   + 
Sbjct  161   VFREQIQATIIDGKDIEVSFDDFPYYLSETTKAMLIADTYIHLKHREQLKYVSELPAVNS  220

Query  2614  TILLSGPA--ELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQSKYGSSRNESSFKRSISE  2441
              ILLSGPA  E+YQ+ML KALA Y+GAKLL+ D   F   +  K      E+    S  +
Sbjct  221   RILLSGPAGSEIYQEMLVKALARYYGAKLLIFDSDAFLGGISVKEAEPMKEAC---SAHK  277

Query  2440  TTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEGSSNPTTlrrnssasanmn  2261
             ++L+R+S    +   ++      G L         P  GI+  S    +   +       
Sbjct  278   SSLSRVSNVFRTGDRVKYIGSASGALHLS------PIWGIKVGSTGRVVLSFNDNLFAKV  331

Query  2260  nltSYN-----------TTSNPGPLMRTSSLSFD-------EKLLIQALYKVLVKVSKTC  2135
              +   N              + G   + S L  D       +KLL   L++V+   S+  
Sbjct  332   GVRFDNPFIYGIDLGGLCDDSHGYFCKVSELCLDATAVDAPDKLLANTLFEVVFNESRKS  391

Query  2134  PIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGS---------------------  2018
             P +L+++DA+K++  + ++Y   +  L +L  +V+ +GS                     
Sbjct  392   PFILFVKDADKVMGGNSELYSTFKSRLEKLPDNVITIGSHAHTDNHKEKSHPGGLLLSKF  451

Query  2017  -----------------RIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLE  1889
                              +  D G +  +  + L+ +FP  + I  P++E  L  WK QL+
Sbjct  452   DSSTAGLLDLAFLDSPEKTHDKGKEVAKNSKFLTELFPNIVAIHMPQDEALLSIWKQQLD  511

Query  1888  EDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLM-NT  1712
             +D   ++ ++N N +  VL+ N +EC+   ++C+ D        E+VV  A+S+HLM NT
Sbjct  512   KDADTLKMKENFNSLQTVLSRNGLECNGPETLCIKDRNFSVESAEKVVGWALSHHLMQNT  571

Query  1711  K-DPEYRNAKLVISSKSLSHGMNIFKEEKTAAGKDILKLESKAELSKETQSGEKGSKGPE  1535
             + DP   N  LV+S +S+ +G+ + + ++                  +T+S +K  K   
Sbjct  572   QVDP---NMTLVLSPESIQYGLEVLQAKQN-----------------DTKSLKKSLKDVA  611

Query  1534  TKAESSTAPGSKPETGsaapapapttkdatsSGTAVKAPEVPPDNEFEKRIRPEVIPAKE  1355
             T+ E                                          FE RI  +VI   +
Sbjct  612   TENE------------------------------------------FENRILDDVILPSD  629

Query  1354  IGVTFADIGALDEIKESLHELVMLPLRRPDLF-KGGLLKPCRGILLFGPPGTGKTMLAKA  1178
             IGVTF DIGAL+ +K++L ELVMLPL+RP+LF K  L KPC+GILLFGPPGTGKTMLAKA
Sbjct  630   IGVTFDDIGALENVKDTLKELVMLPLQRPELFCKSQLTKPCKGILLFGPPGTGKTMLAKA  689

Query  1177  IAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPTIIFVDEVDSMLGQRSRAG  998
             +A EAGA+FIN+SMS+ITSK FGE EK V+A+F+LA+K++P ++FVDEVDS+LG+R  +G
Sbjct  690   VATEAGANFINISMSSITSKLFGEGEKYVKAVFSLASKIAPCVVFVDEVDSLLGRRENSG  749

Query  997   EHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEAIIRRFERRIMVGLPTPEQ  818
             EHEAMRKIKNEFM +WDGL TK  ER+++LAATNRPFDLDEA+IRR  RR+MV LP    
Sbjct  750   EHEAMRKIKNEFMVNWDGLRTKDSERVMILAATNRPFDLDEAVIRRLPRRLMVNLPDAPN  809

Query  817   RELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTAAYRPVRELIKQERLKDVE  638
             R  ILK +LAKE + + +DL  +A+MT GY+GSDLKNLC TAAYRP+RE++++E+ +   
Sbjct  810   RAKILKVILAKEDLAQDVDLDSVASMTNGYSGSDLKNLCVTAAYRPIREIVEKEKKEHAA  869

Query  637   KKRLAQECPNCGDAPTANEDKGERVITIRPLNMDDFMEAKNQVAASFAAEGSIMNELKQW  458
                  +  P    AP ++ D       IRPLNMDD   +  QV  S ++E   M +L +W
Sbjct  870   ASADGRPPP----APYSSAD-------IRPLNMDDLRYSHQQVCTSVSSESDNMTKLLEW  918

Query  457   NNLYGEGGSRKKEQLTYFL  401
             N+L+GEGGSRKK+  +Y +
Sbjct  919   NDLHGEGGSRKKQSFSYIM  937



>emb|CBI22604.3| unnamed protein product [Vitis vinifera]
Length=827

 Score =   532 bits (1371),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 268/339 (79%), Positives = 294/339 (87%), Gaps = 3/339 (1%)
 Frame = -1

Query  1411  PPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGGLLKPCR  1232
             P  NEFE RIRPEVIP   IGVTF DIGALD+IKESL ELVM PL+RP++FKGGLLKPCR
Sbjct  490   PRCNEFESRIRPEVIPPNRIGVTFDDIGALDDIKESLEELVMFPLQRPEIFKGGLLKPCR  549

Query  1231  GILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKVSPT  1052
             GILLFGPPGTGKTMLAKA+A EAGASFINVSMSTITSKWFGEDEKNVRALFTLAAK+SPT
Sbjct  550   GILLFGPPGTGKTMLAKAMANEAGASFINVSMSTITSKWFGEDEKNVRALFTLAAKISPT  609

Query  1051  IIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRPFDLDEA  872
             IIFVDEVDSMLGQR   GE  +MRKIKNEFM+HWDGLLTK GER+LVLAATNRPFDLDEA
Sbjct  610   IIFVDEVDSMLGQRLEFGEDCSMRKIKNEFMTHWDGLLTKAGERVLVLAATNRPFDLDEA  669

Query  871   IIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLKNLCTTA  692
             IIRRF+ RIMVGLP+ E RE+ILKTLLAKE   + LD K+LATMTEGYTGSDLKNLC  A
Sbjct  670   IIRRFDHRIMVGLPSVESREMILKTLLAKEQ-AEDLDFKELATMTEGYTGSDLKNLCMAA  728

Query  691   AYRPVRELIKQERL-KDVEKKRLAQECPNCGDAP-TANEDKGERVITIRPLNMDDFMEAK  518
             AYRPVREL +QER+ KD +KK+ A E  +  DA  T  E KGERVI +RPLNM+D  +AK
Sbjct  729   AYRPVRELAQQERMKKDKKKKQKADEGKSSEDASDTREEAKGERVIVLRPLNMEDMRQAK  788

Query  517   NQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             NQVAASFA++G+ MN+LKQWN LYGEGGSRKKEQLTYFL
Sbjct  789   NQVAASFASDGAAMNKLKQWNELYGEGGSRKKEQLTYFL  827


 Score =   471 bits (1212),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 241/413 (58%), Positives = 318/413 (77%), Gaps = 4/413 (1%)
 Frame = -1

Query  2845  QTVSKWTG---SSSNAVTVDIMEQEMLNTIVDGRDSKVTFDEFPYYLSEQTRVLLTSAAF  2675
             QT+S+WTG    S+ A+T   +E E+   +VDG++SK+TF+EFPY LS+QTR LLTSAA 
Sbjct  72    QTMSRWTGLLNCSAGAITEAQLEHELRGQVVDGKESKITFEEFPYILSKQTRGLLTSAAH  131

Query  2674  VHLKSADFAKHTRNLSPASRTILLSGPAELYQQMLAKALAHYFGAKLLLLDVTDFSLKVQ  2495
             VHL+ +DF+KHT+ L PA R ILLSGPAELYQ+ LAKALA +F AKLLLLDV DFSLK+Q
Sbjct  132   VHLRLSDFSKHTQKLMPAGRAILLSGPAELYQRALAKALAQFFEAKLLLLDVNDFSLKMQ  191

Query  2494  SKYGSSRNESSFKRSISETTLNRMSEFLGSFSILQPKEEKKGTLRRQSSGVDIPSKGIEG  2315
             SKYG  R E S K+SI ETTL ++S FLGSFSIL  +EE K TL RQS+G +I SK ++ 
Sbjct  192   SKYGCPRKEYSSKKSIPETTLKQISGFLGSFSILPQREETKDTLSRQSTGANIKSKSMDP  251

Query  2314  SSNP-TTlrrnssasanmnnltSYNTTSNPGPLMRTSSLSFDEKLLIQALYKVLVKVSKT  2138
               +  +    +++++   N L      S    +  TSS +FDEK L+Q+LYKVLV VS+T
Sbjct  252   PQHCGSASTSSNASTIPPNMLVLLLLISFVAHIKCTSSWAFDEKHLLQSLYKVLVSVSET  311

Query  2137  CPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSVLILGSRIVDPGDDYRELDERLSSVF  1958
             C ++LY+RD +KLL +S++ Y L +KML +LSGSVLILGSR++DP D+  E+DER+S +F
Sbjct  312   CSMILYIRDVDKLLLQSDRFYKLFRKMLDKLSGSVLILGSRMLDPDDEDNEMDERVSLLF  371

Query  1957  PYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNKNHIMEVLAANDIECDDLGSICMADT  1778
             P NIEI+ PE+ETHL  W++QL+E+ K++Q+QDNKN++ +VLAAND++CDDLGSIC AD 
Sbjct  372   PCNIEIEKPEDETHLDRWEAQLKEETKVIQFQDNKNYMAKVLAANDLDCDDLGSICYADP  431

Query  1777  MALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVISSKSLSHGMNIFKEEKTAA  1619
               LS+Y EE+V+SAISYHL+N KDPEYRN KLVISSKSLSHG+++F+E+   A
Sbjct  432   EILSDYTEEIVISAISYHLLNNKDPEYRNGKLVISSKSLSHGLSLFQEDAPNA  484



>emb|CDX96166.1| BnaC02g14850D [Brassica napus]
Length=679

 Score =   520 bits (1339),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 261/346 (75%), Positives = 290/346 (84%), Gaps = 7/346 (2%)
 Frame = -1

Query  1429  VKAPEVPPDNEFEKRIRPEVIPAKEIGVTFADIGALDEIKESLHELVMLPLRRPDLFKGG  1250
             +KAPE  PDNEFE+RIR EVIPA EIGV FADIG+LDE K+ L ELV+LPLRRPDLFKG 
Sbjct  338   LKAPEAVPDNEFEERIRSEVIPANEIGVKFADIGSLDETKDLLQELVILPLRRPDLFKGN  397

Query  1249  LLKPCRGILLFGPPGTGKTMLAKAIAKEAGASFINVSMSTITSKWFGEDEKNVRALFTLA  1070
             LLKPCRGILLFGPPGTGKTMLAKAIA EAGASFINVSMSTITSK++GEDEKNVRALFTLA
Sbjct  398   LLKPCRGILLFGPPGTGKTMLAKAIANEAGASFINVSMSTITSKYYGEDEKNVRALFTLA  457

Query  1069  AKVSPTIIFVDEVDSMLGQRSRAGEHEAMRKIKNEFMSHWDGLLTKPGERILVLAATNRP  890
             AKVSPTIIFVDEVDS LGQR   GE E+ RKIKNEFM HWDGL+T+PGE ++VLAATNRP
Sbjct  458   AKVSPTIIFVDEVDSRLGQRKSVGETESTRKIKNEFMLHWDGLMTEPGEGVMVLAATNRP  517

Query  889   FDLDEAIIRRFERRIMVGLPTPEQRELILKTLLAKETVGKVLDLKQLATMTEGYTGSDLK  710
             FDLDEAIIRRFERRIMVGLP+ E RE+IL+TLL+KE     LD  ++   TEGYTGSDLK
Sbjct  518   FDLDEAIIRRFERRIMVGLPSIESREMILRTLLSKEKTDD-LDFHEIGQKTEGYTGSDLK  576

Query  709   NLCTTAAYRPVRELIKQERLKDVEKKRLAQECPNCGDAP---TANEDKGERVITIRPLNM  539
             N+C TAAYRPVRELI+QERLKD  K     + P     P   +A+ D   R IT+RPLNM
Sbjct  577   NMCITAAYRPVRELIQQERLKDKVK---GVKDPLLHSIPIEFSAHSDFFVRDITLRPLNM  633

Query  538   DDFMEAKNQVAASFAAEGSIMNELKQWNNLYGEGGSRKKEQLTYFL  401
             +D  +AKNQV+ASFA+EGS M ELKQWN+LYGEGGSRKKEQLTYFL
Sbjct  634   EDMRKAKNQVSASFASEGSGMEELKQWNDLYGEGGSRKKEQLTYFL  679


 Score =   269 bits (687),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 163/196 (83%), Gaps = 1/196 (1%)
 Frame = -1

Query  2212  TSSLSFDEKLLIQALYKVLVKVSKTCPIVLYLRDAEKLLCRSEKVYILLQKMLRRLSGSV  2033
             +++L FDEKL +Q+LYKVLV VS   P+++Y +D EKLL  SE+ Y L Q +L +L G V
Sbjct  138   STNLCFDEKLFMQSLYKVLVSVSDKNPLIIYFKDVEKLL-DSERFYKLFQNLLNKLPGPV  196

Query  2032  LILGSRIVDPGDDYRELDERLSSVFPYNIEIKPPEEETHLVSWKSQLEEDMKMMQYQDNK  1853
             LILGSR+++  DD +E+ E  S++FPYNI I+PPE+E+ L++WK++LEEDMKM++ QDNK
Sbjct  197   LILGSRVLESKDDCQEVTEGTSALFPYNIGIRPPEDESQLMTWKTRLEEDMKMIKIQDNK  256

Query  1852  NHIMEVLAANDIECDDLGSICMADTMALSNYIEEVVVSAISYHLMNTKDPEYRNAKLVIS  1673
             NHI EVLAANDI+CDDL SIC+ADTM LSN IEEVV+SAI+YHL++TK+PEYRN KLVIS
Sbjct  257   NHIAEVLAANDIQCDDLASICLADTMCLSNRIEEVVISAITYHLIHTKEPEYRNGKLVIS  316

Query  1672  SKSLSHGMNIFKEEKT  1625
             SKSLSHG++IF+E K 
Sbjct  317   SKSLSHGLSIFQENKN  332



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 11610461259123