BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7225_g1_i1 len=972 path=[1:0-279 281:280-320 281:321-361
322:362-971]

Length=972
                                                                      Score     E

ref|XP_009760183.1|  PREDICTED: uncharacterized protein LOC104212580    270   1e-86   
ref|XP_009602363.1|  PREDICTED: uncharacterized protein LOC104097500    268   6e-86   
ref|XP_004239899.1|  PREDICTED: uncharacterized protein LOC101245363    264   2e-84   
ref|XP_006355752.1|  PREDICTED: uncharacterized protein LOC102587407    262   1e-83   
ref|XP_009763237.1|  PREDICTED: uncharacterized protein LOC104215181    261   3e-83   
gb|EPS65086.1|  late embryogenesis abundant protein group 9 protein     254   8e-81   
ref|XP_009619887.1|  PREDICTED: uncharacterized protein LOC104111821    253   3e-80   
ref|XP_011073727.1|  PREDICTED: uncharacterized protein LOC105158615    253   4e-80   
gb|ADQ91848.1|  late embryogenesis abundant protein group 9 protein     247   1e-77   
gb|EYU32605.1|  hypothetical protein MIMGU_mgv1a026335mg                245   2e-77   
ref|XP_011091363.1|  PREDICTED: uncharacterized protein LOC105171820    245   4e-77   
ref|XP_010110670.1|  hypothetical protein L484_009698                   245   5e-77   
ref|XP_006420392.1|  hypothetical protein CICLE_v10006007mg             244   1e-76   
ref|XP_006480228.1|  PREDICTED: uncharacterized protein LOC102609870    244   1e-76   
ref|XP_006418116.1|  hypothetical protein EUTSA_v10009503mg             243   3e-76   
ref|XP_007143778.1|  hypothetical protein PHAVU_007G100700g             243   3e-76   
ref|XP_010556935.1|  PREDICTED: uncharacterized protein LOC104826101    243   6e-76   
ref|XP_006306448.1|  hypothetical protein CARUB_v10012389mg             241   1e-75   
emb|CDY18245.1|  BnaC05g02680D                                          241   2e-75   
emb|CDO99336.1|  unnamed protein product                                241   2e-75   
ref|XP_009341621.1|  PREDICTED: uncharacterized protein LOC103933654    241   3e-75   
ref|XP_007223551.1|  hypothetical protein PRUPE_ppa012188mg             240   4e-75   
emb|CDY59184.1|  BnaC08g50170D                                          240   5e-75   
emb|CDX89812.1|  BnaA10g02700D                                          240   8e-75   
emb|CDY53198.1|  BnaAnng12230D                                          239   9e-75   
ref|XP_009119280.1|  PREDICTED: uncharacterized protein LOC103844243    239   1e-74   
ref|XP_009118632.1|  PREDICTED: uncharacterized protein LOC103843642    239   1e-74   
gb|KHG09017.1|  Chaperone htpG                                          239   1e-74   
ref|XP_002314514.1|  AWPM-19-like membrane family protein               239   1e-74   Populus trichocarpa [western balsam poplar]
gb|KDP33343.1|  hypothetical protein JCGZ_12892                         238   2e-74   
ref|XP_003556252.1|  PREDICTED: uncharacterized protein LOC100782087    239   2e-74   
gb|KHN00885.1|  hypothetical protein glysoja_000553                     238   3e-74   
ref|XP_010457507.1|  PREDICTED: uncharacterized protein LOC104738979    238   4e-74   
ref|XP_010483949.1|  PREDICTED: uncharacterized protein LOC104762370    238   4e-74   
ref|XP_008224024.1|  PREDICTED: uncharacterized protein LOC103323789    238   4e-74   
gb|AFK34963.1|  unknown                                                 238   4e-74   
gb|KFK42796.1|  hypothetical protein AALP_AA1G040000                    237   8e-74   
ref|XP_010475117.1|  PREDICTED: uncharacterized protein LOC104754594    236   1e-73   
ref|NP_563710.1|  AWPM-19-like family protein                           236   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001238105.1|  maturation protein PM3                             235   5e-73   
ref|XP_002889515.1|  hypothetical protein ARALYDRAFT_470438             235   6e-73   
ref|XP_011041466.1|  PREDICTED: uncharacterized protein LOC105137431    234   8e-73   
ref|XP_004296544.1|  PREDICTED: uncharacterized protein LOC101311268    234   1e-72   
ref|XP_010918948.1|  PREDICTED: uncharacterized protein LOC105043...    233   3e-72   
gb|ACU13395.1|  unknown                                                 233   3e-72   Glycine max [soybeans]
ref|XP_002285517.1|  PREDICTED: uncharacterized protein LOC100240897    232   5e-72   Vitis vinifera
emb|CAN62925.1|  hypothetical protein VITISV_041433                     232   7e-72   Vitis vinifera
gb|KEH43462.1|  ABA induced plasma membrane protein                     229   7e-71   
ref|XP_004247780.1|  PREDICTED: uncharacterized protein LOC101267061    227   7e-70   
ref|XP_006340959.1|  PREDICTED: uncharacterized protein LOC102579369    227   8e-70   
ref|XP_007035309.1|  AWPM-19-like family protein                        226   2e-69   
ref|XP_010693963.1|  PREDICTED: uncharacterized protein LOC104906834    220   2e-67   
ref|XP_009411381.1|  PREDICTED: uncharacterized protein LOC103993147    220   3e-67   
ref|XP_009357953.1|  PREDICTED: uncharacterized protein LOC103948641    217   4e-66   
gb|KHG12423.1|  3-phosphoshikimate 1-carboxyvinyltransferase            216   2e-65   
ref|XP_010069093.1|  PREDICTED: uncharacterized protein LOC104456070    216   2e-65   
ref|XP_010262475.1|  PREDICTED: uncharacterized protein LOC104600988    215   3e-65   
ref|XP_002518211.1|  conserved hypothetical protein                     212   2e-64   Ricinus communis
ref|XP_004147191.1|  PREDICTED: uncharacterized protein LOC101215543    213   2e-64   
ref|XP_008460698.1|  PREDICTED: uncharacterized protein LOC103499466    213   3e-64   
ref|XP_006854370.1|  hypothetical protein AMTR_s00039p00166770          211   6e-64   
ref|XP_008340681.1|  PREDICTED: uncharacterized protein LOC103403609    209   4e-63   
ref|XP_004496216.1|  PREDICTED: uncharacterized protein LOC101497725    209   4e-63   
ref|XP_010026780.1|  PREDICTED: uncharacterized protein LOC104417162    205   2e-61   
gb|ACG24926.1|  plasma membrane associated protein                      194   3e-57   Zea mays [maize]
ref|XP_002459766.1|  hypothetical protein SORBIDRAFT_02g010080          193   7e-57   Sorghum bicolor [broomcorn]
ref|XP_004956054.1|  PREDICTED: uncharacterized protein LOC101761416    190   9e-56   
ref|NP_001059485.1|  Os07g0422100                                       188   5e-55   Oryza sativa Japonica Group [Japonica rice]
gb|EMT28140.1|  hypothetical protein F775_28015                         188   8e-55   
ref|XP_010111145.1|  hypothetical protein L484_000734                   187   9e-55   
dbj|BAJ87360.1|  predicted protein                                      183   5e-53   
gb|AAB38504.1|  ABA induced plasma membrane protein PM 19               182   2e-52   Triticum aestivum [Canadian hard winter wheat]
gb|EMT26307.1|  hypothetical protein F775_29428                         182   2e-52   
gb|AFI25008.1|  plama membrane protein                                  182   3e-52   
gb|EMT26308.1|  hypothetical protein F775_29429                         180   1e-51   
gb|EAZ03646.1|  hypothetical protein OsI_25781                          179   1e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_006654338.1|  PREDICTED: uncharacterized protein LOC102710696    178   4e-51   
ref|XP_006658505.1|  PREDICTED: uncharacterized protein LOC102721097    177   8e-51   
ref|XP_004980953.1|  PREDICTED: uncharacterized protein LOC101784294    177   9e-51   
gb|AAF29532.1|AF218627_1  plasma membrane associated protein            176   2e-50   Hordeum vulgare [barley]
ref|NP_001055398.1|  Os05g0381400                                       174   2e-49   Oryza sativa Japonica Group [Japonica rice]
gb|ADE76757.1|  unknown                                                 173   3e-49   
ref|XP_010918949.1|  PREDICTED: uncharacterized protein LOC105043...    166   1e-46   
ref|XP_003557592.1|  PREDICTED: uncharacterized protein LOC100842584    161   2e-44   
gb|KDP32936.1|  hypothetical protein JCGZ_12967                         153   2e-41   
ref|XP_011021218.1|  PREDICTED: uncharacterized protein LOC105123357    151   8e-41   
ref|XP_010932736.1|  PREDICTED: uncharacterized protein LOC105053338    148   1e-39   
ref|XP_010909782.1|  PREDICTED: uncharacterized protein LOC105035782    143   1e-37   
ref|XP_006363128.1|  PREDICTED: uncharacterized protein LOC102578503    143   1e-37   
ref|XP_011099568.1|  PREDICTED: uncharacterized protein LOC105177...    142   3e-37   
ref|XP_002283463.2|  PREDICTED: uncharacterized protein LOC100242900    141   3e-37   Vitis vinifera
ref|XP_009793588.1|  PREDICTED: uncharacterized protein LOC104240443    141   5e-37   
emb|CBI33674.3|  unnamed protein product                                142   7e-37   
ref|XP_009601672.1|  PREDICTED: uncharacterized protein LOC104096921    138   6e-36   
emb|CAN66509.1|  hypothetical protein VITISV_003619                     144   3e-35   Vitis vinifera
gb|EYU43779.1|  hypothetical protein MIMGU_mgv1a023451mg                134   5e-35   
ref|XP_011099567.1|  PREDICTED: uncharacterized protein LOC105177...    135   6e-35   
ref|XP_008230390.1|  PREDICTED: uncharacterized protein LOC103329670    135   1e-34   
gb|ACH58418.1|  unknown                                                 131   2e-34   Prunus dulcis [sweet almond]
ref|XP_010103810.1|  hypothetical protein L484_008662                   134   3e-34   
ref|XP_008800777.1|  PREDICTED: uncharacterized protein LOC103715048    134   5e-34   
ref|XP_002516743.1|  conserved hypothetical protein                     133   1e-33   Ricinus communis
gb|EEE63546.1|  hypothetical protein OsJ_18362                          123   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010692699.1|  PREDICTED: uncharacterized protein LOC104905764    123   5e-30   
emb|CDP02791.1|  unnamed protein product                                120   3e-29   
ref|XP_006430802.1|  hypothetical protein CICLE_v10013040mg             115   1e-27   
ref|WP_033581559.1|  hypothetical protein                               114   1e-27   
ref|XP_006482274.1|  PREDICTED: uncharacterized protein LOC102618...    113   8e-27   
ref|XP_002983355.1|  hypothetical protein SELMODRAFT_180070             113   3e-26   
ref|XP_002984669.1|  hypothetical protein SELMODRAFT_423735             112   4e-26   
ref|XP_002960681.1|  hypothetical protein SELMODRAFT_437726             112   4e-26   
ref|XP_002982433.1|  hypothetical protein SELMODRAFT_421806             108   4e-25   
gb|EEC73942.1|  hypothetical protein OsI_08811                          109   6e-25   Oryza sativa Indica Group [Indian rice]
gb|EYU43780.1|  hypothetical protein MIMGU_mgv11b016991mg               105   1e-24   
ref|XP_002966597.1|  hypothetical protein SELMODRAFT_439591             105   6e-24   
dbj|BAD15935.1|  putative ABA-induced plasma membrane protein           106   7e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004304141.1|  PREDICTED: uncharacterized protein LOC101293215    105   2e-23   
ref|XP_006430801.1|  hypothetical protein CICLE_v10013040mg             103   3e-23   
ref|XP_001767555.1|  predicted protein                                  104   4e-23   
gb|ABK23186.1|  unknown                                                 104   5e-23   Picea sitchensis
ref|XP_006482275.1|  PREDICTED: uncharacterized protein LOC102618...    101   2e-22   
gb|ADE77639.1|  unknown                                                 102   3e-22   
ref|XP_006647844.1|  PREDICTED: uncharacterized protein LOC102711043    101   6e-22   
gb|EYU44649.1|  hypothetical protein MIMGU_mgv1a0155012mg             99.0    6e-22   
dbj|BAK06029.1|  predicted protein                                      100   7e-22   
dbj|BAJ89281.1|  predicted protein                                    99.8    2e-21   
gb|KHG10022.1|  Major envelope                                        98.6    3e-21   
ref|XP_002519754.1|  conserved hypothetical protein                   98.6    3e-21   Ricinus communis
ref|XP_001783630.1|  predicted protein                                98.2    5e-21   
ref|XP_002978756.1|  hypothetical protein SELMODRAFT_37585            97.1    7e-21   
ref|XP_007212182.1|  hypothetical protein PRUPE_ppa012671mg           97.1    1e-20   
gb|KHG04455.1|  hypothetical protein F383_29509                       96.7    1e-20   
ref|XP_008225379.1|  PREDICTED: uncharacterized protein LOC103325034  96.7    1e-20   
gb|EMT01942.1|  hypothetical protein F775_09898                       97.8    1e-20   
ref|XP_006449606.1|  hypothetical protein CICLE_v10017020mg           96.7    1e-20   
ref|XP_006467552.1|  PREDICTED: uncharacterized protein LOC102611422  95.9    2e-20   
emb|CDP20500.1|  unnamed protein product                              95.5    3e-20   
ref|XP_002316743.1|  AWPM-19-like membrane family protein             95.5    4e-20   Populus trichocarpa [western balsam poplar]
ref|XP_009390003.1|  PREDICTED: uncharacterized protein LOC103976504  95.1    5e-20   
ref|XP_003533836.1|  PREDICTED: uncharacterized protein LOC100780911  95.1    5e-20   
ref|XP_008383523.1|  PREDICTED: uncharacterized protein LOC103446220  94.7    7e-20   
ref|XP_008443837.1|  PREDICTED: uncharacterized protein LOC103487332  94.7    7e-20   
ref|XP_004293658.1|  PREDICTED: uncharacterized protein LOC101308262  94.7    8e-20   
gb|ACU19489.1|  unknown                                               94.4    8e-20   Glycine max [soybeans]
ref|XP_007025202.1|  AWPM-19-like family protein                      94.4    8e-20   
ref|XP_009352163.1|  PREDICTED: uncharacterized protein LOC103943576  94.4    1e-19   
ref|XP_011005830.1|  PREDICTED: uncharacterized protein LOC105111993  94.4    1e-19   
ref|XP_011096475.1|  PREDICTED: uncharacterized protein LOC105175661  94.0    1e-19   
gb|KDP21192.1|  hypothetical protein JCGZ_21663                       93.6    2e-19   
ref|XP_006281194.1|  hypothetical protein CARUB_v10027229mg           93.6    2e-19   
ref|XP_011015863.1|  PREDICTED: uncharacterized protein LOC105119422  93.2    3e-19   
ref|XP_008371555.1|  PREDICTED: uncharacterized protein LOC103434952  92.8    3e-19   
gb|ABK26630.1|  unknown                                               93.2    4e-19   Picea sitchensis
ref|XP_007138501.1|  hypothetical protein PHAVU_009G214500g           92.4    4e-19   
ref|NP_001237651.1|  uncharacterized protein LOC100527291             92.4    4e-19   
ref|XP_010924094.1|  PREDICTED: uncharacterized protein LOC105047019  92.0    5e-19   
ref|XP_011045325.1|  PREDICTED: uncharacterized protein LOC105140263  92.0    5e-19   
gb|EPS68447.1|  hypothetical protein M569_06323                       92.0    6e-19   
ref|XP_010052117.1|  PREDICTED: uncharacterized protein LOC104440830  91.7    7e-19   
ref|XP_010926217.1|  PREDICTED: uncharacterized protein LOC105048572  91.7    9e-19   
ref|XP_002988427.1|  hypothetical protein SELMODRAFT_447317           92.0    1e-18   
gb|EPS60342.1|  hypothetical protein M569_14462                       90.9    1e-18   
ref|XP_004233016.1|  PREDICTED: uncharacterized protein LOC101265094  91.3    1e-18   
ref|XP_007033303.1|  AWPM-19-like family protein, putative            89.7    1e-18   
emb|CDX87708.1|  BnaC02g32410D                                        90.9    1e-18   
ref|XP_010538226.1|  PREDICTED: uncharacterized protein LOC104812652  90.5    2e-18   
ref|XP_010916116.1|  PREDICTED: uncharacterized protein LOC105041024  90.5    2e-18   
ref|XP_011085292.1|  PREDICTED: uncharacterized protein LOC105167323  90.5    2e-18   
ref|XP_002865183.1|  hypothetical protein ARALYDRAFT_330772           90.1    2e-18   
gb|ABK25437.1|  unknown                                               90.9    2e-18   Picea sitchensis
ref|XP_010494829.1|  PREDICTED: uncharacterized protein LOC104771910  90.1    3e-18   
ref|XP_010549440.1|  PREDICTED: uncharacterized protein LOC104820623  89.7    3e-18   
gb|ABR18054.1|  unknown                                               90.5    4e-18   Picea sitchensis
gb|ABK27087.1|  unknown                                               90.1    5e-18   Picea sitchensis
gb|KHN48046.1|  hypothetical protein glysoja_015516                   89.0    6e-18   
ref|XP_010441574.1|  PREDICTED: uncharacterized protein LOC104724727  89.0    6e-18   
gb|KFK31462.1|  hypothetical protein AALP_AA6G114800                  89.0    7e-18   
ref|NP_199465.4|  AWPM-19-like family protein                         89.0    7e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002272619.1|  PREDICTED: uncharacterized protein LOC100253821  88.6    9e-18   Vitis vinifera
ref|XP_009128866.1|  PREDICTED: uncharacterized protein LOC103853714  88.6    9e-18   
gb|ABK23412.1|  unknown                                               89.0    9e-18   Picea sitchensis
ref|XP_009360815.1|  PREDICTED: uncharacterized protein LOC103951228  88.6    1e-17   
ref|XP_002979858.1|  hypothetical protein SELMODRAFT_444324           89.4    1e-17   
ref|XP_010529132.1|  PREDICTED: uncharacterized protein LOC104806110  88.2    1e-17   
ref|XP_010481448.1|  PREDICTED: uncharacterized protein LOC104760250  88.2    1e-17   
ref|XP_006398347.1|  hypothetical protein EUTSA_v10001059mg           88.2    1e-17   
ref|XP_006369867.1|  AWPM-19-like membrane family protein             87.8    2e-17   
ref|XP_006355583.1|  PREDICTED: uncharacterized protein LOC102586633  87.4    2e-17   
gb|EYU43292.1|  hypothetical protein MIMGU_mgv1a015292mg              87.4    3e-17   
ref|NP_001149332.1|  LOC100282955                                     87.0    3e-17   Zea mays [maize]
ref|XP_010922603.1|  PREDICTED: uncharacterized protein LOC105045871  87.0    3e-17   
ref|XP_003569627.1|  PREDICTED: uncharacterized protein LOC100832331  86.7    4e-17   
ref|XP_009788391.1|  PREDICTED: uncharacterized protein LOC104236211  86.3    5e-17   
ref|XP_003531288.1|  PREDICTED: uncharacterized protein LOC100781...  86.3    6e-17   
ref|XP_008780296.1|  PREDICTED: uncharacterized protein LOC103700073  86.3    7e-17   
ref|XP_002890814.1|  hypothetical protein ARALYDRAFT_473160           85.9    8e-17   
ref|XP_009632029.1|  PREDICTED: uncharacterized protein LOC104121681  85.9    8e-17   
ref|XP_010273381.1|  PREDICTED: uncharacterized protein LOC104608952  85.9    9e-17   
ref|XP_004962154.1|  PREDICTED: uncharacterized protein LOC101769...  85.9    9e-17   
gb|AFK34750.1|  unknown                                               85.9    9e-17   
dbj|BAJ98607.1|  predicted protein                                    85.9    1e-16   
ref|XP_006655300.1|  PREDICTED: uncharacterized protein LOC102709744  85.5    1e-16   
ref|XP_001780831.1|  predicted protein                                85.5    1e-16   
gb|ADE77128.1|  unknown                                               85.9    1e-16   
ref|XP_009769804.1|  PREDICTED: uncharacterized protein LOC104220604  85.1    2e-16   
ref|XP_006304542.1|  hypothetical protein CARUB_v10011510mg           85.1    2e-16   
ref|XP_010499463.1|  PREDICTED: uncharacterized protein LOC104776981  85.1    2e-16   
ref|NP_174245.1|  AWPM19-like protein                                 85.1    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35167.1|  BnaA09g18040D                                        84.7    2e-16   
ref|XP_009109659.1|  PREDICTED: uncharacterized protein LOC103835268  84.7    2e-16   
emb|CDX94673.1|  BnaC07g09850D                                        84.7    2e-16   
ref|XP_003595559.1|  hypothetical protein MTR_2g049340                84.7    2e-16   
emb|CDX90196.1|  BnaA08g17880D                                        84.3    3e-16   
ref|XP_004488295.1|  PREDICTED: uncharacterized protein LOC101512...  84.3    3e-16   
ref|XP_009115232.1|  PREDICTED: uncharacterized protein LOC103840476  84.3    3e-16   
dbj|BAK03367.1|  predicted protein                                    84.3    3e-16   
emb|CDY35302.1|  BnaC03g59210D                                        84.3    3e-16   
ref|XP_001766667.1|  predicted protein                                84.3    3e-16   
gb|KHN06453.1|  hypothetical protein glysoja_010797                   84.3    3e-16   
ref|NP_001235518.1|  uncharacterized protein LOC100527398             84.3    3e-16   
ref|XP_009604262.1|  PREDICTED: uncharacterized protein LOC104099076  84.0    3e-16   
emb|CDY69073.1|  BnaCnng61750D                                        84.0    4e-16   
ref|XP_004161137.1|  PREDICTED: uncharacterized LOC101207031          83.6    5e-16   
ref|XP_009102850.1|  PREDICTED: uncharacterized protein LOC103828959  83.6    5e-16   
ref|XP_009114344.1|  PREDICTED: uncharacterized protein LOC103839594  83.6    5e-16   
ref|XP_001769881.1|  predicted protein                                83.6    6e-16   
ref|XP_001753907.1|  predicted protein                                84.0    6e-16   
ref|XP_004147399.1|  PREDICTED: uncharacterized protein LOC101207031  83.6    6e-16   
gb|EMT09286.1|  hypothetical protein F775_29954                       83.6    6e-16   
emb|CDY44311.1|  BnaA07g07950D                                        83.2    6e-16   
ref|XP_007159519.1|  hypothetical protein PHAVU_002G244300g           83.2    7e-16   
emb|CDM83710.1|  unnamed protein product                              83.2    7e-16   
emb|CDX99831.1|  BnaC05g22530D                                        82.8    9e-16   
ref|XP_004982944.1|  PREDICTED: uncharacterized protein LOC101755...  83.2    1e-15   
dbj|BAK08343.1|  predicted protein                                    80.5    1e-15   
ref|XP_009396324.1|  PREDICTED: uncharacterized protein LOC103981346  82.8    1e-15   
ref|XP_006415566.1|  hypothetical protein EUTSA_v10008973mg           82.8    1e-15   
ref|XP_002511445.1|  conserved hypothetical protein                   82.8    1e-15   Ricinus communis
gb|EMT03177.1|  hypothetical protein F775_14927                       82.4    1e-15   
gb|EMS45462.1|  hypothetical protein TRIUR3_17420                     82.8    1e-15   
ref|NP_001152675.1|  plasma membrane associated protein               83.6    1e-15   Zea mays [maize]
ref|XP_003619776.1|  hypothetical protein MTR_6g068860                82.4    2e-15   
ref|XP_010255851.1|  PREDICTED: uncharacterized protein LOC104596402  82.4    2e-15   
emb|CDY48343.1|  BnaA09g26780D                                        82.0    2e-15   
ref|XP_010667529.1|  PREDICTED: uncharacterized protein LOC104884553  81.6    2e-15   
ref|XP_002456208.1|  hypothetical protein SORBIDRAFT_03g032160        81.3    3e-15   Sorghum bicolor [broomcorn]
ref|NP_001048020.2|  Os02g0731500                                     80.5    3e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CDY43979.1|  BnaA02g24570D                                        80.9    4e-15   
ref|NP_001152147.1|  plasma membrane associated protein               80.5    7e-15   Zea mays [maize]
ref|XP_010687918.1|  PREDICTED: uncharacterized protein LOC104901978  79.7    1e-14   
gb|EAY97972.1|  hypothetical protein OsI_19891                        80.1    1e-14   Oryza sativa Indica Group [Indian rice]
gb|AAT85140.1|  unknown protein                                       80.1    1e-14   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009412172.1|  PREDICTED: uncharacterized protein LOC103993725  79.7    1e-14   
gb|KFK44784.1|  hypothetical protein AALP_AA1G302800                  79.3    2e-14   
ref|XP_008812791.1|  PREDICTED: uncharacterized protein LOC103723608  79.7    2e-14   
gb|AFK35331.1|  unknown                                               79.3    2e-14   
ref|XP_010938794.1|  PREDICTED: uncharacterized protein LOC105057794  79.0    3e-14   
ref|XP_008798859.1|  PREDICTED: uncharacterized protein LOC103713635  78.2    6e-14   
ref|XP_004982943.1|  PREDICTED: uncharacterized protein LOC101755...  78.2    8e-14   
ref|XP_003568494.1|  PREDICTED: uncharacterized protein LOC100821603  77.0    2e-13   
ref|NP_001151699.1|  LOC100285335                                     76.6    2e-13   Zea mays [maize]
gb|EMT06868.1|  hypothetical protein F775_10987                       76.3    2e-13   
ref|XP_008390804.1|  PREDICTED: uncharacterized protein LOC103453049  75.9    4e-13   
ref|XP_001752246.1|  predicted protein                                76.3    5e-13   
ref|XP_002439765.1|  hypothetical protein SORBIDRAFT_09g019680        75.5    5e-13   Sorghum bicolor [broomcorn]
ref|XP_009352137.1|  PREDICTED: uncharacterized protein LOC103943556  75.5    5e-13   
ref|XP_010272654.1|  PREDICTED: uncharacterized protein LOC104608385  75.1    5e-13   
ref|XP_007224440.1|  hypothetical protein PRUPE_ppa022222mg           75.5    6e-13   
ref|XP_009339933.1|  PREDICTED: uncharacterized protein LOC103932106  75.1    7e-13   
ref|NP_001152600.1|  plasma membrane associated protein               75.1    7e-13   Zea mays [maize]
ref|XP_002454858.1|  hypothetical protein SORBIDRAFT_03g000210        75.1    8e-13   Sorghum bicolor [broomcorn]
ref|XP_003528667.1|  PREDICTED: uncharacterized protein LOC100779785  74.7    9e-13   
ref|XP_008223034.1|  PREDICTED: uncharacterized protein LOC103322867  74.7    1e-12   
ref|XP_010942410.1|  PREDICTED: uncharacterized protein LOC105060425  74.7    1e-12   
emb|CDM80955.1|  unnamed protein product                              74.7    1e-12   
ref|NP_001042580.1|  Os01g0247900                                     74.3    2e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006643990.1|  PREDICTED: uncharacterized protein LOC102715246  73.6    3e-12   
tpg|DAA55723.1|  TPA: hypothetical protein ZEAMMB73_278557            73.6    3e-12   
ref|XP_002873921.1|  hypothetical protein ARALYDRAFT_488781           73.2    4e-12   
ref|XP_006850817.1|  hypothetical protein AMTR_s00025p00122690        72.8    4e-12   
ref|XP_007154293.1|  hypothetical protein PHAVU_003G106300g           72.8    5e-12   
ref|XP_008775452.1|  PREDICTED: uncharacterized protein LOC103695815  72.4    6e-12   
ref|NP_001043981.1|  Os01g0699900                                     72.0    7e-12   
ref|XP_006400451.1|  hypothetical protein EUTSA_v10014847mg           72.0    8e-12   
ref|XP_006644569.1|  PREDICTED: uncharacterized protein LOC102722160  72.0    9e-12   
gb|KDP40082.1|  hypothetical protein JCGZ_02080                       72.0    9e-12   
gb|EAY73285.1|  hypothetical protein OsI_01159                        72.0    9e-12   
ref|XP_008353243.1|  PREDICTED: uncharacterized protein LOC103416799  72.0    1e-11   
gb|KHG04590.1|  GDP-mannose transporter                               72.0    1e-11   
ref|XP_003550080.1|  PREDICTED: uncharacterized protein LOC100808359  71.2    1e-11   
ref|NP_197398.1|  AWPM-19-like protein                                71.2    2e-11   
ref|XP_001753906.1|  predicted protein                                71.2    2e-11   
ref|XP_010546820.1|  PREDICTED: uncharacterized protein LOC104818786  70.1    5e-11   
ref|XP_006288788.1|  hypothetical protein CARUB_v10002111mg           69.7    6e-11   
ref|XP_004512705.1|  PREDICTED: UDP-galactose transporter 2-like      69.7    6e-11   
ref|XP_004967316.1|  PREDICTED: uncharacterized protein LOC101769358  69.7    7e-11   
ref|XP_006419779.1|  hypothetical protein CICLE_v10006056mg           69.3    9e-11   
ref|XP_004488294.1|  PREDICTED: uncharacterized protein LOC101512...  69.3    1e-10   
ref|XP_002994447.1|  hypothetical protein SELMODRAFT_432371           68.9    1e-10   
ref|XP_008792822.1|  PREDICTED: uncharacterized protein LOC103709309  68.6    1e-10   
gb|KDO58956.1|  hypothetical protein CISIN_1g0107601mg                68.6    2e-10   
gb|KDO74870.1|  hypothetical protein CISIN_1g030875mg                 68.6    2e-10   
ref|XP_004969656.1|  PREDICTED: uncharacterized protein LOC101757725  68.2    2e-10   
ref|XP_009773610.1|  PREDICTED: uncharacterized protein LOC104223805  68.2    2e-10   
ref|XP_010445789.1|  PREDICTED: uncharacterized protein LOC104728521  67.8    3e-10   
gb|KFK26135.1|  hypothetical protein AALP_AA8G208100                  67.0    5e-10   
ref|XP_010105701.1|  hypothetical protein L484_011313                 67.0    5e-10   
ref|XP_004229462.1|  PREDICTED: uncharacterized protein LOC101263460  67.0    6e-10   
gb|ACA30296.1|  putative hydrophobic LEA-like protein                 65.5    1e-09   
gb|AAD38289.1|AC007789_15  putative ABA induced plasma membrane p...  66.2    1e-09   
emb|CDO98974.1|  unnamed protein product                              66.2    1e-09   
ref|XP_001768373.1|  predicted protein                                65.9    1e-09   
ref|XP_003565579.1|  PREDICTED: uncharacterized protein LOC100829474  65.9    1e-09   
ref|XP_002277418.1|  PREDICTED: uncharacterized protein LOC100263132  65.9    2e-09   
ref|XP_011090828.1|  PREDICTED: uncharacterized protein LOC105171413  65.5    2e-09   
ref|XP_006339422.1|  PREDICTED: uncharacterized protein LOC102603997  65.5    2e-09   
gb|ACI87781.1|  putative hydrophobic LEA-like protein                 63.5    3e-09   
ref|NP_001145966.1|  uncharacterized protein LOC100279493             65.5    3e-09   
ref|XP_009131714.1|  PREDICTED: uncharacterized protein LOC103856357  64.7    4e-09   
ref|XP_007034565.1|  AWPM-19-like family protein                      64.3    5e-09   
dbj|BAB10821.1|  unnamed protein product                              63.5    7e-09   
emb|CDX88904.1|  BnaA03g07450D                                        63.5    1e-08   
ref|XP_004508351.1|  PREDICTED: uncharacterized protein LOC101492128  62.8    2e-08   
emb|CAC83360.1|  putative hydrophobic LEA-like protein                60.8    3e-08   
emb|CDX92569.1|  BnaA10g16080D                                        62.0    3e-08   
emb|CDY13934.1|  BnaC09g38920D                                        62.0    3e-08   
ref|XP_010496742.1|  PREDICTED: uncharacterized protein LOC104773788  62.0    3e-08   
ref|XP_010454154.1|  PREDICTED: uncharacterized protein LOC104735954  62.0    3e-08   
ref|XP_010420678.1|  PREDICTED: uncharacterized protein LOC104706210  62.0    4e-08   
ref|XP_001784926.1|  predicted protein                                63.9    4e-08   
emb|CDX70859.1|  BnaC03g09430D                                        61.6    4e-08   
ref|XP_009120930.1|  PREDICTED: uncharacterized protein LOC103845795  61.6    5e-08   
ref|XP_010095137.1|  hypothetical protein L484_015637                 60.5    5e-08   
gb|AFK44110.1|  unknown                                               60.5    9e-08   
gb|EAY78832.1|  hypothetical protein OsI_33937                        60.8    1e-07   
ref|XP_002516802.1|  conserved hypothetical protein                   60.5    1e-07   
ref|XP_010679395.1|  PREDICTED: uncharacterized protein LOC104894777  60.1    1e-07   
gb|AGT38451.1|  hypothetical protein                                  60.1    2e-07   
gb|KCW60895.1|  hypothetical protein EUGRSUZ_H03634                   60.5    2e-07   
ref|XP_004962153.1|  PREDICTED: uncharacterized protein LOC101769...  60.5    2e-07   
gb|KHG04492.1|  hypothetical protein F383_29914                       59.3    2e-07   
ref|XP_004298180.1|  PREDICTED: uncharacterized protein LOC101314176  59.3    3e-07   
ref|XP_002312732.1|  AWPM-19-like membrane family protein             57.4    1e-06   
ref|XP_006845109.1|  hypothetical protein AMTR_s00005p00176760        57.4    1e-06   
gb|KDO58958.1|  hypothetical protein CISIN_1g0107601mg                56.6    2e-06   
ref|XP_010024446.1|  PREDICTED: uncharacterized protein LOC104414929  56.6    2e-06   
ref|XP_009629914.1|  PREDICTED: uncharacterized protein LOC104119979  56.6    2e-06   
ref|NP_001064793.1|  Os10g0464300                                     56.6    3e-06   
ref|XP_001780832.1|  predicted protein                                58.5    3e-06   
ref|XP_006379915.1|  hypothetical protein POPTR_0008s17330g           53.5    5e-06   
ref|XP_002311821.1|  AWPM-19-like membrane family protein             54.3    9e-06   
ref|XP_002456993.1|  hypothetical protein SORBIDRAFT_03g046890        56.2    9e-06   
ref|XP_008362000.1|  PREDICTED: uncharacterized protein LOC103425690  53.9    1e-05   
ref|XP_004134640.1|  PREDICTED: uncharacterized protein LOC101209586  54.3    1e-05   
ref|XP_004134167.1|  PREDICTED: uncharacterized protein LOC101213723  54.3    1e-05   
gb|AAP74340.1|  maturation protein-like                               52.0    1e-05   
gb|EYU43847.1|  hypothetical protein MIMGU_mgv1a015153mg              53.9    2e-05   
ref|XP_011009033.1|  PREDICTED: uncharacterized protein LOC105114241  53.9    2e-05   
ref|XP_008438739.1|  PREDICTED: uncharacterized protein LOC103483760  53.5    2e-05   
gb|AAP74339.1|  maturation protein-like                               49.7    1e-04   
dbj|BAK04636.1|  predicted protein                                    47.8    2e-04   
ref|XP_011009028.1|  PREDICTED: uncharacterized protein LOC105114235  50.4    3e-04   
ref|XP_004980853.1|  PREDICTED: uncharacterized protein LOC101758635  49.3    8e-04   



>ref|XP_009760183.1| PREDICTED: uncharacterized protein LOC104212580 [Nicotiana sylvestris]
Length=179

 Score =   270 bits (690),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 160/169 (95%), Gaps = 2/169 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVAR++AAPLLFLNL+MY IVLGFASWCLN++INGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARTVARSVAAPLLFLNLVMYFIVLGFASWCLNRYINGQTNHPSFGGNGATMFFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGI+SKFMGGNHLRVWRNDSLAAAGSSA+VAWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIISKFMGGNHLRVWRNDSLAAAGSSAIVAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            VLE FVI+L FTQLLYVLMLHAGWFSSRYGPGYR+ +Y  G+GAP  EK
Sbjct  121  VLEGFVIVLGFTQLLYVLMLHAGWFSSRYGPGYRETEY--GVGAPPGEK  167



>ref|XP_009602363.1| PREDICTED: uncharacterized protein LOC104097500 [Nicotiana tomentosiformis]
Length=179

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 159/169 (94%), Gaps = 2/169 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVAR++AAPLLFLNL+MY IVLGFASWCLN++INGQT+HP+FGGNGAT+FFL F+IL
Sbjct  1    MARTVARSVAAPLLFLNLVMYFIVLGFASWCLNRYINGQTNHPSFGGNGATLFFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGI+SK MGGNHLRVWRNDSLAAAGSSA+VAWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIISKLMGGNHLRVWRNDSLAAAGSSAIVAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            VLE FVI+L FTQLLYVLMLHAGWFSSRYGPGYR+ +Y  G GAPA EK
Sbjct  121  VLEGFVIVLGFTQLLYVLMLHAGWFSSRYGPGYRETEY--GAGAPAGEK  167



>ref|XP_004239899.1| PREDICTED: uncharacterized protein LOC101245363 [Solanum lycopersicum]
Length=178

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVART+AAPLLFLNLIMY+I+LGFASWCLNK+INGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARTVARTVAAPLLFLNLIMYLIMLGFASWCLNKYINGQTNHPSFGGNGATMFFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A++LGI+SK +GGNHLRVWRNDSLAAAGSSA+VAWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   ASILGIISKVLGGNHLRVWRNDSLAAAGSSAIVAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            VLE F I+LAFTQL+YVLMLHAG FSSRYGPGYR+ +YG G   PA EK
Sbjct  121  VLEGFTIVLAFTQLIYVLMLHAGMFSSRYGPGYREPEYGSGGVPPAGEK  169



>ref|XP_006355752.1| PREDICTED: uncharacterized protein LOC102587407 [Solanum tuberosum]
Length=178

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVAR++A PLLFLNLIMY+IVLGFASWCLNK+INGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARTVARSVATPLLFLNLIMYLIVLGFASWCLNKYINGQTNHPSFGGNGATMFFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGI+SK +GGNHLR WRNDSLAAAGSSA+VAWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIISKVLGGNHLRAWRNDSLAAAGSSAIVAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            VLE F I+LAFTQLLYVLMLHAG FSSRYGPGYR+ +YG G   P  EK
Sbjct  121  VLEGFTIVLAFTQLLYVLMLHAGMFSSRYGPGYREPEYGSGGVPPVGEK  169



>ref|XP_009763237.1| PREDICTED: uncharacterized protein LOC104215181 [Nicotiana sylvestris]
Length=179

 Score =   261 bits (667),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 147/179 (82%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVARTLAAPLLF+NL+MY+IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARTVARTLAAPLLFINLVMYLIVLGFASWCLNRFINGQTNHPSFGGNGATMFFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGI+SK +G  HLR WRNDSLAAAGSSA++AWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIISKLIGAKHLRAWRNDSLAAAGSSAVIAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEKgttgvtgTRV  354
            VLE FVI+L  TQLLYVLMLHAGWFSS YGPGYRD +YG+G      EKGTTGVTG RV
Sbjct  121  VLEGFVIVLGVTQLLYVLMLHAGWFSSTYGPGYRDTEYGVGAPGGVGEKGTTGVTGARV  179



>gb|EPS65086.1| late embryogenesis abundant protein group 9 protein, partial 
[Genlisea aurea]
Length=162

 Score =   254 bits (649),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 137/162 (85%), Positives = 147/162 (91%), Gaps = 0/162 (0%)
 Frame = -2

Query  893  RMARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSI  714
            +MAR VARTLAAPLLFLNLIMY IVLGFASWCLNK+INGQT HPN GGNGAT FFL F++
Sbjct  1    KMARAVARTLAAPLLFLNLIMYFIVLGFASWCLNKYINGQTSHPNMGGNGATGFFLTFAM  60

Query  713  LAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRL  534
            LAAVLGIVSK  GGNHLR WRNDSLAAAGSS+++ WAVT LAFGLACKEIN+GGWRGWRL
Sbjct  61   LAAVLGIVSKVAGGNHLRAWRNDSLAAAGSSSILTWAVTILAFGLACKEINIGGWRGWRL  120

Query  533  RVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG  408
            RVLEAFVIIL  TQLLYVL LHAG+FSSRYGPGYRD DYG+G
Sbjct  121  RVLEAFVIILTLTQLLYVLALHAGFFSSRYGPGYRDPDYGLG  162



>ref|XP_009619887.1| PREDICTED: uncharacterized protein LOC104111821 [Nicotiana tomentosiformis]
Length=177

 Score =   253 bits (647),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVA+TLAAPLLF+NL+MY+IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARTVAKTLAAPLLFINLVMYLIVLGFASWCLNRFINGQTNHPSFGGNGATMFFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGI+SK +G  HLR WRNDSLAAAGSSA++AWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIISKLIGAKHLRTWRNDSLAAAGSSAVIAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            VLE FVI+L  TQLLYVLMLHAGWFSS YGPGYRD +Y
Sbjct  121  VLEGFVIVLGVTQLLYVLMLHAGWFSSTYGPGYRDTEY  158



>ref|XP_011073727.1| PREDICTED: uncharacterized protein LOC105158615 [Sesamum indicum]
Length=178

 Score =   253 bits (646),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 138/168 (82%), Positives = 153/168 (91%), Gaps = 2/168 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVAR LAAPLLF+NLIMY IVLGFASWCLN++INGQT HP+ GGNGAT  FL F+IL
Sbjct  1    MARTVARNLAAPLLFINLIMYFIVLGFASWCLNRYINGQTAHPSMGGNGATGHFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGIVSK  GG+HLR WRNDSLAAAGSS+++AWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIVSKIAGGSHLRAWRNDSLAAAGSSSILAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            VLE FVI+LAFTQLLYVL+LHAG+FSSRYGPGYRD +Y  G+GAPA E
Sbjct  121  VLEGFVIVLAFTQLLYVLLLHAGFFSSRYGPGYRDREY--GIGAPAAE  166



>gb|ADQ91848.1| late embryogenesis abundant protein group 9 protein [Arachis 
hypogaea]
Length=181

 Score =   247 bits (630),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNL+MY IVLGFASWCLNKFINGQT+HP+FGGNGATMFFL FS+LAAV
Sbjct  3    TVGRNVAAPLLFLNLVMYFIVLGFASWCLNKFINGQTNHPSFGGNGATMFFLTFSMLAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSKF+GGNH+R WRNDSLAAAG++++VAWAVTALAFGLACK+IN+GG RGWRLR++E
Sbjct  63   LGIVSKFLGGNHIRTWRNDSLAAAGATSVVAWAVTALAFGLACKQINIGGHRGWRLRIVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG  408
            AF+IIL FTQLLY+L++HAG +S+RYGPGYRD+DYG+G
Sbjct  123  AFIIILTFTQLLYLLLIHAGLYSTRYGPGYRDSDYGVG  160



>gb|EYU32605.1| hypothetical protein MIMGU_mgv1a026335mg, partial [Erythranthe 
guttata]
Length=160

 Score =   245 bits (626),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 147/160 (92%), Gaps = 0/160 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTVART+AAPLLFLNLIMY+IVLGFASWCLN++INGQT HP+ GGNGAT  FL F+IL
Sbjct  1    MARTVARTMAAPLLFLNLIMYLIVLGFASWCLNRYINGQTSHPSMGGNGATGHFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGIVSK  GG+HLR WRNDSLAAAGSS++VAWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   AAVLGIVSKIAGGSHLRAWRNDSLAAAGSSSIVAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGM  411
            V+E F+I+L  TQ LYV+MLHAG+FSSRYGPGYRD DYG+
Sbjct  121  VVEGFIIVLGVTQFLYVMMLHAGFFSSRYGPGYRDPDYGV  160



>ref|XP_011091363.1| PREDICTED: uncharacterized protein LOC105171820 [Sesamum indicum]
Length=176

 Score =   245 bits (626),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 136/168 (81%), Positives = 147/168 (88%), Gaps = 0/168 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA T  R+LAAPLLFLNLIMY IVLGFASWCLN++INGQT HP+ GGNGAT  FL F+IL
Sbjct  1    MASTGTRSLAAPLLFLNLIMYFIVLGFASWCLNRWINGQTAHPSMGGNGATGHFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAVLGIVSK  GGNHLR WRNDSLAAA SS++VAWAVTALAFGLACKEINVGGWRGWRLR
Sbjct  61   AAVLGIVSKIAGGNHLRAWRNDSLAAACSSSIVAWAVTALAFGLACKEINVGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            V+EAFVIILAFTQLLYVL+LHAG+FSS YGPGYRD  YG G   PA +
Sbjct  121  VVEAFVIILAFTQLLYVLLLHAGFFSSSYGPGYRDTGYGPGTHEPAPK  168



>ref|XP_010110670.1| hypothetical protein L484_009698 [Morus notabilis]
 gb|EXC27674.1| hypothetical protein L484_009698 [Morus notabilis]
Length=181

 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 127/160 (79%), Positives = 146/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY IV+GFASWCLN+FINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MAQTVGRNIAAPLLFLNLIMYFIVVGFASWCLNRFINGQTNHPSFGGNGATMFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+GIVSK  GGNH+R WRNDSLAAA + +L+AWA+TALAFG ACK+IN+GG RGWRLR
Sbjct  61   AAVVGIVSKLAGGNHIRAWRNDSLAAAAALSLIAWAITALAFGFACKQINIGGHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGM  411
            VLEAFVIIL FTQL+YVL+LHAG FSS+YGPGYRD DYG+
Sbjct  121  VLEAFVIILTFTQLMYVLLLHAGTFSSKYGPGYRDTDYGI  160



>ref|XP_006420392.1| hypothetical protein CICLE_v10006007mg [Citrus clementina]
 gb|ESR33632.1| hypothetical protein CICLE_v10006007mg [Citrus clementina]
Length=184

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 154/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY+IV+GFASWCLN+FINGQT+HP+FGGNGATMFFL F++L
Sbjct  1    MAQTVGRNIAAPLLFLNLIMYLIVVGFASWCLNRFINGQTNHPSFGGNGATMFFLTFALL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A VLG+ SKF+GGNH+R WR+DSLAAAGS++L+AWA+TA+AFGLACKEIN+G  RGWRLR
Sbjct  61   AGVLGVASKFIGGNHIRAWRSDSLAAAGSTSLIAWAITAIAFGLACKEINLGQHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            ++EAF+IIL FTQ LY+L+LHAG FSSRYGPGYRD DYG+G G P+V+ 
Sbjct  121  MVEAFIIILTFTQFLYLLLLHAGTFSSRYGPGYRDTDYGIGAG-PSVDP  168



>ref|XP_006480228.1| PREDICTED: uncharacterized protein LOC102609870 [Citrus sinensis]
 ref|XP_006480229.1| PREDICTED: uncharacterized protein LOC102610179 [Citrus sinensis]
Length=184

 Score =   244 bits (624),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/169 (76%), Positives = 153/169 (91%), Gaps = 1/169 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY+IV+GFASWCLN+FINGQT+HP+FGGNGATMFFL F++L
Sbjct  1    MAQTVGRNIAAPLLFLNLIMYLIVVGFASWCLNRFINGQTNHPSFGGNGATMFFLTFALL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A VLG+ SKF+GGNH+R WR+DSLAAAGS++L+AWA+TALAFGLACKEIN+G  RGWRLR
Sbjct  61   AGVLGVASKFIGGNHIRAWRSDSLAAAGSTSLIAWAITALAFGLACKEINLGQHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            V+EAF+IIL FTQ LY+L+LHA  FSSRYGPGYRD DYG+G G P+V+ 
Sbjct  121  VVEAFIIILTFTQFLYLLLLHASMFSSRYGPGYRDTDYGIGAG-PSVDP  168



>ref|XP_006418116.1| hypothetical protein EUTSA_v10009503mg [Eutrema salsugineum]
 gb|ESQ36469.1| hypothetical protein EUTSA_v10009503mg [Eutrema salsugineum]
Length=185

 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY IVLGFASWC+NKFINGQT+HP+FGGNGAT FFL FSIL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYFIVLGFASWCVNKFINGQTNHPSFGGNGATPFFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+GI SK  G NH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRLR
Sbjct  61   AAVIGIASKLAGANHIRFWRNDSLAAAGSASIVAWAVTALAMGLACKQINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            ++EAF+IIL FTQLLYVL++HAG FSS+YGPGYRD DY  G G
Sbjct  121  IIEAFIIILTFTQLLYVLLIHAGTFSSKYGPGYRDRDYATGQG  163



>ref|XP_007143778.1| hypothetical protein PHAVU_007G100700g [Phaseolus vulgaris]
 gb|ESW15772.1| hypothetical protein PHAVU_007G100700g [Phaseolus vulgaris]
Length=180

 Score =   243 bits (620),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 155/178 (87%), Gaps = 2/178 (1%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY IVLGF+SWCLN+FINGQT+HP+FGGNGATMFFL FSILAA+
Sbjct  3    TVGRNVAAPLLFLNLIMYFIVLGFSSWCLNRFINGQTYHPSFGGNGATMFFLTFSILAAI  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSKF+GGNH+R WR+DSLA+AG++++VAW VTALAFGLACKEIN+GG RGWRL+++E
Sbjct  63   LGIVSKFLGGNHMRTWRSDSLASAGAASVVAWGVTALAFGLACKEINIGGHRGWRLKMVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG--MGAPAVEKgttgvtgTRV  354
            AF+IIL FTQLLYVL++HAG FSSRYGPGYRD DY MG   G P  +      TGTRV
Sbjct  123  AFIIILTFTQLLYVLLIHAGLFSSRYGPGYRDTDYPMGGTTGDPMHKPAPVPATGTRV  180



>ref|XP_010556935.1| PREDICTED: uncharacterized protein LOC104826101 [Tarenaya hassleriana]
Length=184

 Score =   243 bits (619),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/169 (75%), Positives = 148/169 (88%), Gaps = 0/169 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNLIMY+IVLGFASWC+NK+INGQT+HP+FGGNGAT FFL F+IL
Sbjct  1    MATTVGRNIAAPLLFLNLIMYLIVLGFASWCINKYINGQTNHPSFGGNGATPFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+G+ SK  G NH+R WRNDSLAAAGSS++VAWAVT LAFGLACK+IN+GGWRGWRLR
Sbjct  61   AGVIGVASKLAGANHIRFWRNDSLAAAGSSSIVAWAVTVLAFGLACKQINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            +LEAF+IILAFTQLLY++++HAG FSS+YGPGYRD DY  G  AP   +
Sbjct  121  ILEAFIIILAFTQLLYLMLIHAGVFSSKYGPGYRDRDYAPGHEAPTTAE  169



>ref|XP_006306448.1| hypothetical protein CARUB_v10012389mg [Capsella rubella]
 gb|EOA39346.1| hypothetical protein CARUB_v10012389mg [Capsella rubella]
Length=184

 Score =   241 bits (616),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGFASWC+NK+INGQTHHP+FGGNGAT FFL FSIL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFASWCINKYINGQTHHPSFGGNGATPFFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+GI SK  G NH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRL+
Sbjct  61   AAVIGITSKLAGANHIRFWRNDSLAAAGSTSIVAWAVTALAMGLACKQINIGGWRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            ++EAF+IIL FTQLLY++++HAG  SS+YGPGYRD DY  G G
Sbjct  121  MIEAFIIILTFTQLLYLMLIHAGSLSSKYGPGYRDQDYATGQG  163



>emb|CDY18245.1| BnaC05g02680D [Brassica napus]
Length=185

 Score =   241 bits (616),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY+IVLGFASWCLN++INGQT+HP+FGGNGAT+FFL FSILAAV
Sbjct  3    TVGRNIAAPLLFLNLIMYLIVLGFASWCLNRYINGQTNHPSFGGNGATLFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GI SK  G NH+R WRNDSLAAAGSS++VAWAVTALA GLACK+IN+GGWRGWRLR++E
Sbjct  63   IGIASKLAGANHIRFWRNDSLAAAGSSSIVAWAVTALAMGLACKQINIGGWRGWRLRIIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLYVL++HAG FSS+YGPGYRD DY  G G
Sbjct  123  AFIIILTFTQLLYVLLIHAGVFSSKYGPGYRDRDYATGQG  162



>emb|CDO99336.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 147/169 (87%), Gaps = 2/169 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTV R+LAAPLLFLNLIMY IVLGFASWCLN +INGQT+HP+FGGNGAT FFL F+IL
Sbjct  1    MARTVGRSLAAPLLFLNLIMYFIVLGFASWCLNHYINGQTNHPSFGGNGATPFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A+VLGI SK  GGNHLR WR+DSLAAAG+S+LVAWAVT LAFGLACKEINVGG RGWRL+
Sbjct  61   ASVLGIASKLAGGNHLRAWRSDSLAAAGASSLVAWAVTILAFGLACKEINVGGRRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            VLE F+I L  TQLLYVL++HAG FSSRYGPGYRD DY  G+GAP  E 
Sbjct  121  VLEGFIIALGATQLLYVLLIHAGMFSSRYGPGYRDPDY--GLGAPGAEP  167



>ref|XP_009341621.1| PREDICTED: uncharacterized protein LOC103933654 [Pyrus x bretschneideri]
Length=180

 Score =   241 bits (614),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 148/165 (90%), Gaps = 0/165 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY+IV+GFASWCLN+FINGQT+HP+FGGNGATMFFL FS+L
Sbjct  1    MAQTVGRNVAAPLLFLNLIMYLIVVGFASWCLNRFINGQTNHPSFGGNGATMFFLIFSML  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+GI SK  G NH+R WR+DSLAAAGSSA+VAWA+TALAFGLACKEIN+GG RGWRLR
Sbjct  61   AGVMGIASKLAGANHIRSWRSDSLAAAGSSAIVAWALTALAFGLACKEINMGGHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAP  396
            VLEAFVIIL FTQLLY+LMLHAG FSS+YGPGYRD DY +  G P
Sbjct  121  VLEAFVIILMFTQLLYLLMLHAGVFSSKYGPGYRDTDYPVTGGDP  165



>ref|XP_007223551.1| hypothetical protein PRUPE_ppa012188mg [Prunus persica]
 gb|EMJ24750.1| hypothetical protein PRUPE_ppa012188mg [Prunus persica]
Length=180

 Score =   240 bits (613),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY IV+GFASWCLNKFINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MAQTVGRNVAAPLLFLNLIMYFIVVGFASWCLNKFINGQTNHPSFGGNGATMFFLIFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A VLGI SK  G NH+R WR+DSLAAAGSS++VAWA+TALAFGLACK+I++GG+RGWRL+
Sbjct  61   AGVLGIASKLAGANHIRAWRSDSLAAAGSSSVVAWALTALAFGLACKQISIGGYRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            +LEAF+IILAFTQLLY+L+LHAG FSS+YGPGYRD DY
Sbjct  121  ILEAFIIILAFTQLLYILLLHAGVFSSKYGPGYRDTDY  158



>emb|CDY59184.1| BnaC08g50170D [Brassica napus]
Length=183

 Score =   240 bits (613),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY+IVLGFASWC+NK+INGQT+HP+FGGNGAT FFL FSILAAV
Sbjct  3    TVGRNIAAPLLFLNLIMYLIVLGFASWCINKYINGQTNHPSFGGNGATPFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GI SK  GGNH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRLR++E
Sbjct  63   IGIASKLAGGNHIRFWRNDSLAAAGSASIVAWAVTALAMGLACKQINIGGWRGWRLRMIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLY+L++HAG FSS+YGPGYRD DY  G G
Sbjct  123  AFIIILTFTQLLYLLLIHAGTFSSKYGPGYRDTDYATGQG  162



>emb|CDX89812.1| BnaA10g02700D [Brassica napus]
Length=185

 Score =   240 bits (612),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY+IVLGFASWCLN++INGQT+HP+FGGNGAT FFL FSILAAV
Sbjct  3    TVGRNIAAPLLFLNLIMYLIVLGFASWCLNRYINGQTNHPSFGGNGATPFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GI SK  G NH+R WRNDSLAAAGSS++VAWAVTALA GLACK+IN+GGWRGWRLR++E
Sbjct  63   IGIASKLAGANHIRFWRNDSLAAAGSSSIVAWAVTALAMGLACKQINIGGWRGWRLRIIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLYVL++HAG FSS+YGPGYRD DY  G G
Sbjct  123  AFIIILTFTQLLYVLLIHAGVFSSKYGPGYRDRDYATGQG  162



>emb|CDY53198.1| BnaAnng12230D [Brassica napus]
Length=183

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY+IVLGFASWC+NK+INGQT+HP+FGGNGAT FFL FSILAAV
Sbjct  3    TVGRNIAAPLLFLNLIMYLIVLGFASWCINKYINGQTNHPSFGGNGATPFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G+ SK  GGNH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRLR++E
Sbjct  63   IGVASKLAGGNHIRFWRNDSLAAAGSASIVAWAVTALAMGLACKQINIGGWRGWRLRMIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLY+L++HAG FSS+YGPGYRD DY  G G
Sbjct  123  AFIIILTFTQLLYLLLIHAGTFSSKYGPGYRDTDYATGQG  162



>ref|XP_009119280.1| PREDICTED: uncharacterized protein LOC103844243 [Brassica rapa]
Length=185

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY+IVLGFASWCLN++INGQT+HP+FGGNGAT FFL FSILAAV
Sbjct  3    TVGRNIAAPLLFLNLIMYLIVLGFASWCLNRYINGQTNHPSFGGNGATPFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GI SK  G NH R WRNDSLAAAGSS++VAWAVTALA GLACK+IN+GGWRGWRLR++E
Sbjct  63   IGIASKLAGANHTRFWRNDSLAAAGSSSIVAWAVTALAMGLACKQINIGGWRGWRLRIIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLYVL++HAG FSS+YGPGYRD DY  G G
Sbjct  123  AFIIILTFTQLLYVLLIHAGVFSSKYGPGYRDRDYATGQG  162



>ref|XP_009118632.1| PREDICTED: uncharacterized protein LOC103843642 [Brassica rapa]
Length=183

 Score =   239 bits (610),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNL+MY+IVLGFASWC+NK+INGQT+HP+FGGNGAT FFL FSILAAV
Sbjct  3    TVGRNIAAPLLFLNLVMYLIVLGFASWCINKYINGQTNHPSFGGNGATPFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G+ SK  GGNH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRLR++E
Sbjct  63   IGVASKLAGGNHIRFWRNDSLAAAGSASIVAWAVTALAMGLACKQINIGGWRGWRLRMIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLY+L++HAG FSS+YGPGYRD DY  G G
Sbjct  123  AFIIILTFTQLLYLLLIHAGTFSSKYGPGYRDTDYATGQG  162



>gb|KHG09017.1| Chaperone htpG [Gossypium arboreum]
Length=179

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/166 (79%), Positives = 146/166 (88%), Gaps = 2/166 (1%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R  AAPLLFLNLIMY IVLGFASWC+N+FINGQT HP+ GGNGAT FFL FSILAAV
Sbjct  3    TVGRNAAAPLLFLNLIMYFIVLGFASWCINRFINGQTAHPSMGGNGATGFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GIVSKF GG+H+R WR+DSLAAAGSSAL+AWA+TALAFG ACK IN+GGWRGWRLR+LE
Sbjct  63   VGIVSKFAGGHHIRSWRSDSLAAAGSSALIAWALTALAFGFACKHINIGGWRGWRLRILE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            AF+IIL FTQLLYVL++HAG FSSRYGPGYRD+DY  GM AP  E 
Sbjct  123  AFIIILTFTQLLYVLLIHAGVFSSRYGPGYRDSDY--GMHAPGDEP  166



>ref|XP_002314514.1| AWPM-19-like membrane family protein [Populus trichocarpa]
 gb|EEF00685.1| AWPM-19-like membrane family protein [Populus trichocarpa]
Length=181

 Score =   239 bits (609),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 145/163 (89%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNL+MY I LGFASWC N++INGQT HP+FGGNGAT FFL F+IL
Sbjct  1    MAQTVGRNIAAPLLFLNLLMYAIALGFASWCTNRYINGQTSHPSFGGNGATGFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+G+VSKF+GG H+R WR DSLAAAGS++LVAWA+TALAFG ACKEINVGG+RGWRLR
Sbjct  61   ACVVGMVSKFVGGAHIRAWRGDSLAAAGSASLVAWAITALAFGFACKEINVGGYRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
             +EAF+IIL FTQLLYVL+LHAG FSS+YGPGYRD DYG+G G
Sbjct  121  AVEAFIIILTFTQLLYVLLLHAGMFSSKYGPGYRDTDYGVGAG  163



>gb|KDP33343.1| hypothetical protein JCGZ_12892 [Jatropha curcas]
Length=178

 Score =   238 bits (608),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY I LGFASWCLNK+INGQT+HP+FGGNGAT FFL F+ILA++
Sbjct  3    TVGRNIAAPLLFLNLIMYAIALGFASWCLNKYINGQTYHPSFGGNGATAFFLTFAILASI  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GIVSK  GG H+R WRNDSLA+AGSS+LV WA+TALAFGLACKEIN+GG RGWRLRVLE
Sbjct  63   VGIVSKLAGGLHIRSWRNDSLASAGSSSLVTWAITALAFGLACKEINLGGHRGWRLRVLE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEKgttgvtgTRV  354
            AF+IIL FTQLLYVL+LHAG FSSRYGPGYRD +Y +G G   + KG T VTGTRV
Sbjct  123  AFMIILTFTQLLYVLLLHAGVFSSRYGPGYRDTEYAVGAGGEPIPKGGTAVTGTRV  178



>ref|XP_003556252.1| PREDICTED: uncharacterized protein LOC100782087 [Glycine max]
Length=181

 Score =   239 bits (609),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R  AAPLLFLNLIMY IVLGFASWCLNKFINGQT+HP+FGGNGATMFFL FSILAAV
Sbjct  3    TVGRNAAAPLLFLNLIMYFIVLGFASWCLNKFINGQTYHPSFGGNGATMFFLIFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSK +G NH+R WR+DSLA+AG++++VAWAVTALAFGLACK+IN+GG RGWRLRV+E
Sbjct  63   LGIVSKLLGANHIRTWRSDSLASAGATSIVAWAVTALAFGLACKQINIGGHRGWRLRVVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL  TQLLY++++HAG +SSRYGPGYRD DYG   G
Sbjct  123  AFIIILTLTQLLYLILIHAGLYSSRYGPGYRDTDYGNAHG  162



>gb|KHN00885.1| hypothetical protein glysoja_000553 [Glycine soja]
Length=181

 Score =   238 bits (608),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R  AAPLLFLNLIMY +VLGFASWCLNKFINGQT+HP+FGGNGATMFFL FSILAAV
Sbjct  3    TVGRNAAAPLLFLNLIMYFVVLGFASWCLNKFINGQTYHPSFGGNGATMFFLIFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSK +G NH+R WR+DSLA+AG++++VAWAVTALAFGLACK+IN+GG RGWRLRV+E
Sbjct  63   LGIVSKLLGANHIRTWRSDSLASAGATSIVAWAVTALAFGLACKQINIGGHRGWRLRVVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL  TQLLY++++HAG +SSRYGPGYRD DYG   G
Sbjct  123  AFIIILTLTQLLYLILIHAGLYSSRYGPGYRDTDYGNAHG  162



>ref|XP_010457507.1| PREDICTED: uncharacterized protein LOC104738979 [Camelina sativa]
Length=184

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGFASWC+N++INGQTHHP+FGGNGAT  FL FSIL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFASWCINRYINGQTHHPSFGGNGATPLFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+GI SK  G NH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRL+
Sbjct  61   AAVIGITSKLAGANHIRFWRNDSLAAAGSTSIVAWAVTALAMGLACKQINIGGWRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            ++EAF+IIL FTQLLY++++HAG  SS+YGPGYRD DY  G G
Sbjct  121  MIEAFIIILTFTQLLYLMLIHAGSLSSKYGPGYRDQDYATGQG  163



>ref|XP_010483949.1| PREDICTED: uncharacterized protein LOC104762370 [Camelina sativa]
Length=184

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGFASWC+N++INGQTHHP+FGGNGAT  FL FSIL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFASWCINRYINGQTHHPSFGGNGATPLFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+GI SK  G NH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRL+
Sbjct  61   AAVIGITSKLAGANHIRFWRNDSLAAAGSTSIVAWAVTALAMGLACKQINIGGWRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            ++EAF+IIL FTQLLY++++HAG  SS+YGPGYRD DY  G G
Sbjct  121  MIEAFIIILTFTQLLYLMLIHAGSISSKYGPGYRDQDYATGQG  163



>ref|XP_008224024.1| PREDICTED: uncharacterized protein LOC103323789 [Prunus mume]
Length=180

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY IV+GFASWCLNKFINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MAQTVGRNVAAPLLFLNLIMYFIVVGFASWCLNKFINGQTNHPSFGGNGATMFFLIFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+GI SK  G NH+R WR+DSLAAAGSS++VAWA+TALAFGLACK+I++GG RGWRL+
Sbjct  61   AGVMGIASKLAGANHIRAWRSDSLAAAGSSSVVAWALTALAFGLACKQISIGGHRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            +LEAF+IILAFTQLLY+L+LHAG FSS+YGPGYRD DY
Sbjct  121  ILEAFIIILAFTQLLYILLLHAGVFSSKYGPGYRDTDY  158



>gb|AFK34963.1| unknown [Lotus japonicus]
 gb|AFK46357.1| unknown [Lotus japonicus]
Length=177

 Score =   238 bits (606),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R +AAPLLFLNLIMY IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL FSILAAVL
Sbjct  3    VGRNVAAPLLFLNLIMYFIVLGFASWCLNRFINGQTYHPSFGGNGATMFFLIFSILAAVL  62

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            GIVSKF+GGNH+R WR+DSLAAAG+++ VAWAVTALA GLACK+I++GG RGWRLR++EA
Sbjct  63   GIVSKFIGGNHIRAWRSDSLAAAGATSSVAWAVTALAMGLACKQIHIGGHRGWRLRIVEA  122

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG  408
            F+IIL FTQLLY++++HAG +SSRYGPGYRD DYG G
Sbjct  123  FIIILTFTQLLYLMLIHAGIYSSRYGPGYRDTDYGTG  159



>gb|KFK42796.1| hypothetical protein AALP_AA1G040000 [Arabis alpina]
Length=187

 Score =   237 bits (605),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGF+SWC+NK+INGQT+HP+FGGNGAT FFL F+IL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFSSWCINKYINGQTNHPSFGGNGATPFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+G++SK  G NH+R WRNDSLAAAG+S++VA+AVTALA GLACK+IN+GGWRGWRLR
Sbjct  61   AAVIGVMSKLAGANHIRFWRNDSLAAAGASSIVAFAVTALAMGLACKQINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            ++EAF+IIL FTQLLY++++HAG FSS+YGPGYRD DY
Sbjct  121  IIEAFIIILTFTQLLYLMLIHAGSFSSKYGPGYRDQDY  158



>ref|XP_010475117.1| PREDICTED: uncharacterized protein LOC104754594 [Camelina sativa]
Length=184

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGFASWC+N++INGQTHHP+FGGNGAT  FL FS+L
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFASWCVNRYINGQTHHPSFGGNGATPLFLTFSLL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+GI SK  G NH+R WRNDSLAAAGS+++VAWAVTALA GLACK+IN+GGWRGWRL+
Sbjct  61   AAVIGITSKLAGANHIRFWRNDSLAAAGSTSIVAWAVTALAMGLACKQINIGGWRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            ++EAF+IIL FTQLLY++++HAG  SS+YGPGYRD DY  G G
Sbjct  121  MIEAFIIILTFTQLLYLMLIHAGSLSSKYGPGYRDQDYATGQG  163



>ref|NP_563710.1| AWPM-19-like family protein [Arabidopsis thaliana]
 gb|AAK28640.1|AF360343_1 unknown protein [Arabidopsis thaliana]
 gb|AAB80630.1| Strong similarity to Triticum ABA induced membrane protein (gb|U80037). 
EST gb|Z27032 comes from this gene [Arabidopsis thaliana]
 gb|AAK93757.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27715.1| AWPM-19-like family protein [Arabidopsis thaliana]
Length=186

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGFASWCLNK+INGQT+HP+FGGNGAT FFL FSIL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFASWCLNKYINGQTNHPSFGGNGATPFFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+G+ SK  G NH+R WRNDSLAAAG+S++VAWA+TALA GLACK+IN+GGWRGWRL+
Sbjct  61   AAVVGVASKLAGANHIRFWRNDSLAAAGASSIVAWAITALAMGLACKQINIGGWRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGM  405
            ++EAF+IIL FTQLLY++++HAG  SS+YGPGYRD DY  G 
Sbjct  121  MIEAFIIILTFTQLLYLMLIHAGSLSSKYGPGYRDQDYATGQ  162



>ref|NP_001238105.1| maturation protein PM3 [Glycine max]
 gb|AAC37469.1| a Lea protein with hydrophobic domain, high pI value (11.6); 
15kD protein; putative [Glycine max]
 gb|KHN37810.1| hypothetical protein glysoja_016934 [Glycine soja]
Length=181

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL FSILAAV
Sbjct  3    TVGRNVAAPLLFLNLIMYFIVLGFASWCLNRFINGQTYHPSFGGNGATMFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSK +GGNH+R WR+DSLA+AG++++VAWAVTALAFGLACK+I++GG RGWRLRV+E
Sbjct  63   LGIVSKLLGGNHMRTWRSDSLASAGATSMVAWAVTALAFGLACKQIHLGGHRGWRLRVVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            AF+IIL FTQLLY++++HAG +SSRYGPGY D DY
Sbjct  123  AFIIILTFTQLLYLILIHAGLYSSRYGPGYHDTDY  157



>ref|XP_002889515.1| hypothetical protein ARALYDRAFT_470438 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65774.1| hypothetical protein ARALYDRAFT_470438 [Arabidopsis lyrata subsp. 
lyrata]
Length=188

 Score =   235 bits (599),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY+IVLGFASWCLNK+INGQT+HP+FGGNGAT FFL FSIL
Sbjct  1    MATTVGRNIAAPLLFLNLVMYLIVLGFASWCLNKYINGQTNHPSFGGNGATPFFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            AAV+G+ SK  G NH+R WRNDSLAAAG+S++VAWA+TALA GLACK+IN+GGWRGWRL+
Sbjct  61   AAVIGVASKIAGANHIRFWRNDSLAAAGASSIVAWAITALAMGLACKQINIGGWRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGM  405
            ++EAF+IIL FTQ LY++++HAG  SS+YGPGYRD DY  G 
Sbjct  121  MIEAFIIILTFTQFLYLMLIHAGVLSSKYGPGYRDQDYATGQ  162



>ref|XP_011041466.1| PREDICTED: uncharacterized protein LOC105137431 [Populus euphratica]
Length=181

 Score =   234 bits (598),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 143/163 (88%), Gaps = 0/163 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA TV R +AAPLLFLNL+MY I LGFASWC N++INGQT HP+FGGNGAT FFL F+IL
Sbjct  1    MAPTVGRNIAAPLLFLNLLMYAIALGFASWCTNRYINGQTSHPSFGGNGATRFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+G+VSKF+GG H+R WR DSLAAAGS++LVAWA+TALAFG ACKEINVGG+RGWRLR
Sbjct  61   ACVVGMVSKFVGGAHIRAWRGDSLAAAGSASLVAWAITALAFGFACKEINVGGYRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
             +EAF+IIL FTQLLYVL+LHAG FSS+YGPGYRD  YG+G G
Sbjct  121  AVEAFIIILTFTQLLYVLLLHAGMFSSKYGPGYRDTGYGVGAG  163



>ref|XP_004296544.1| PREDICTED: uncharacterized protein LOC101311268 [Fragaria vesca 
subsp. vesca]
Length=180

 Score =   234 bits (596),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/160 (77%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY+IV+GFASWCLN+FINGQT+HP+FGGNGATMFFL FSI+A V
Sbjct  3    TVGRNIAAPLLFLNLIMYLIVVGFASWCLNRFINGQTNHPSFGGNGATMFFLIFSIMAGV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G+ SK  G  HLR WR+DSLAAAGSS++VAWA+TALAFGLACK+INVGG+RGWRLRVLE
Sbjct  63   MGVASKLAGAGHLRAWRSDSLAAAGSSSIVAWALTALAFGLACKQINVGGYRGWRLRVLE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
            AF+IIL FTQLLY+L++HAG FSS+YGPGYRD DY    G
Sbjct  123  AFIIILTFTQLLYLLLIHAGIFSSKYGPGYRDTDYPTAAG  162



>ref|XP_010918948.1| PREDICTED: uncharacterized protein LOC105043190 isoform X1 [Elaeis 
guineensis]
Length=175

 Score =   233 bits (593),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 144/169 (85%), Gaps = 1/169 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY+IV+GFASW LN FINGQT++P   GNGAT +FL F+IL
Sbjct  1    MAQTVGRNIAAPLLFLNLIMYIIVVGFASWNLNHFINGQTNYPGVAGNGATFYFLIFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A VLG+ SK  G NH+R WRNDSLAAA SS++VAWA+TALAFGLACKEIN+GG RGWRLR
Sbjct  61   AGVLGVASKLAGANHIRAWRNDSLAAAASSSVVAWAITALAFGLACKEINIGGHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
             LEAF+IIL FTQLLYVLMLHAG FSS+YGPGYRD DYG+G G P VE 
Sbjct  121  TLEAFIIILTFTQLLYVLMLHAGVFSSKYGPGYRDPDYGLG-GGPGVEP  168



>gb|ACU13395.1| unknown [Glycine max]
Length=181

 Score =   233 bits (594),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY IVL FASWCLN+FINGQT+HP+FGGNGATMFFL FSILAAV
Sbjct  3    TVGRNVAAPLLFLNLIMYFIVLDFASWCLNRFINGQTYHPSFGGNGATMFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSK +GGNH+R WR+DSLA+AG++++VAWAVTALAFGLACK+I++GG RGWRLRV+E
Sbjct  63   LGIVSKLLGGNHMRTWRSDSLASAGATSMVAWAVTALAFGLACKQIHLGGHRGWRLRVVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            AF+IIL FTQLLY++++HAG +SSRYGPGY D DY
Sbjct  123  AFIIILTFTQLLYLILIHAGLYSSRYGPGYHDTDY  157



>ref|XP_002285517.1| PREDICTED: uncharacterized protein LOC100240897 [Vitis vinifera]
 emb|CBI23737.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 148/165 (90%), Gaps = 2/165 (1%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLI+Y++V+GF SWCLN+ INGQT++P FGGNGAT+FFL F+ILA V
Sbjct  3    TVGRNMAAPLLFLNLILYILVVGFGSWCLNRLINGQTNNPGFGGNGATLFFLVFAILAGV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G+VSKF GGNH+R WRNDSLAAAGSSALVAWA+TALAFGLACKEI++GG RGWRLRVLE
Sbjct  63   VGVVSKFSGGNHIRAWRNDSLAAAGSSALVAWAITALAFGLACKEIHIGGHRGWRLRVLE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            A +IIL FTQLLY+++LHAG FSS+YGPGYRD +Y  G GAPAV+
Sbjct  123  ALIIILTFTQLLYLMLLHAGVFSSKYGPGYRDTEY--GTGAPAVD  165



>emb|CAN62925.1| hypothetical protein VITISV_041433 [Vitis vinifera]
Length=177

 Score =   232 bits (591),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/165 (76%), Positives = 147/165 (89%), Gaps = 2/165 (1%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLI+Y++V+GF SWCLN+ INGQT++P FGGNGATMFFL F+ILA V
Sbjct  3    TVGRNMAAPLLFLNLILYILVVGFGSWCLNRLINGQTNNPGFGGNGATMFFLVFAILAGV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G+ SKF GGNH+R WRNDSLAAAGSSALVAWA+TALAFGLACKEI++GG RGWRLRVLE
Sbjct  63   VGVASKFSGGNHIRAWRNDSLAAAGSSALVAWAITALAFGLACKEIHIGGHRGWRLRVLE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            A +IIL FTQLLY+++LHAG FSS+YGPGYRD +Y  G GAPAV+
Sbjct  123  ALIIILTFTQLLYLMLLHAGVFSSKYGPGYRDTEY--GTGAPAVD  165



>gb|KEH43462.1| ABA induced plasma membrane protein [Medicago truncatula]
Length=179

 Score =   229 bits (585),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            +V R +  PLLFLNL+MY IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL FSILAAV
Sbjct  3    SVGRNVLGPLLFLNLVMYFIVLGFASWCLNRFINGQTYHPSFGGNGATMFFLTFSILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            LGIVSKFMG NHLR WR+DSLA+AG+++++AWAVTALA GLACK+I++GG RGWRL+++E
Sbjct  63   LGIVSKFMGANHLRFWRSDSLASAGATSVIAWAVTALAMGLACKQIHIGGHRGWRLKMVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            AF+IIL FTQLL +L+ HAG ++SRYGPGYRD DYG+G GA
Sbjct  123  AFIIILTFTQLLCLLLTHAGLYNSRYGPGYRDTDYGVGGGA  163



>ref|XP_004247780.1| PREDICTED: uncharacterized protein LOC101267061 [Solanum lycopersicum]
Length=190

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MAR V R+LA PLLFLNL+MY+IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARAVGRSLAGPLLFLNLLMYLIVLGFASWCLNRFINGQTNHPSFGGNGATMFFLTFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A+VLGI+SK +G NHLR WRNDSLAAAGSSALVAWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   ASVLGIISKLLGANHLRAWRNDSLAAAGSSALVAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG  408
            VLE F+I+L  T+LLYVLMLH+G F+S YGPGYRDN+YG+G
Sbjct  121  VLEGFIIVLGITELLYVLMLHSGLFNSTYGPGYRDNEYGVG  161



>ref|XP_006340959.1| PREDICTED: uncharacterized protein LOC102579369 [Solanum tuberosum]
Length=184

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MAR V R+LA PLLFLNL+MY+IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MARAVGRSLAGPLLFLNLLMYLIVLGFASWCLNRFINGQTNHPSFGGNGATMFFLIFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A+VLGI+SK +G NHLR WRNDSLAAAGSSAL+AWAVTALAFGLACKEIN+GGWRGWRLR
Sbjct  61   ASVLGIISKLLGANHLRAWRNDSLAAAGSSALIAWAVTALAFGLACKEINIGGWRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG  408
            VLE F+I+L  T+LLYVLMLH+G F+S YGPGYRDN+YG+G
Sbjct  121  VLEGFIIVLGITELLYVLMLHSGLFNSTYGPGYRDNEYGVG  161



>ref|XP_007035309.1| AWPM-19-like family protein [Theobroma cacao]
 gb|EOY06235.1| AWPM-19-like family protein [Theobroma cacao]
Length=178

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 2/165 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R +AAPLLFLNL+MY IVLGFASWC+N++IN QT HP+ GGNGAT FFL FS+LAAV+
Sbjct  3    VGRNIAAPLLFLNLVMYFIVLGFASWCVNRYINAQTAHPSMGGNGATGFFLTFSMLAAVV  62

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            GIVSKF GG+H+R WR D+LA AGSS+L+AWA+TALAFG ACK IN+G WRGWRLR+LEA
Sbjct  63   GIVSKFAGGHHIRSWRTDTLAEAGSSSLIAWALTALAFGFACKHINIGSWRGWRLRILEA  122

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            F+IIL FTQLLYV++LHAG  SSRYGPGYRD DY  G+  PA E 
Sbjct  123  FIIILTFTQLLYVMLLHAGVISSRYGPGYRDADY--GIRGPADEP  165



>ref|XP_010693963.1| PREDICTED: uncharacterized protein LOC104906834 [Beta vulgaris 
subsp. vulgaris]
Length=176

 Score =   220 bits (561),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/165 (70%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R  A PLLFLNL++Y+I+LGFASWCLNK+IN  T HP  GGNGAT FFL  +ILA V
Sbjct  3    TVGRNTAGPLLFLNLVLYIIILGFASWCLNKYINFSTRHPGLGGNGATPFFLILAILAGV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G++SK  G +H+R WRNDSLAAAGSS+LVAWA+TALA GLACKEIN+GGWRGWRLRVLE
Sbjct  63   IGVISKLAGASHIRAWRNDSLAAAGSSSLVAWAITALAMGLACKEINIGGWRGWRLRVLE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
             F+I+  F +LLYVL+LHAG FSSRYGPGYR+++YGMG    AV+
Sbjct  123  GFIIVTTFFELLYVLILHAGLFSSRYGPGYREHEYGMGTQGTAVD  167



>ref|XP_009411381.1| PREDICTED: uncharacterized protein LOC103993147 [Musa acuminata 
subsp. malaccensis]
Length=172

 Score =   220 bits (560),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 141/168 (84%), Gaps = 0/168 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R LAAPLLFLN IMY+IV+GFASW LN FINGQT++P   GNGAT +FL F+IL
Sbjct  1    MAQTVGRNLAAPLLFLNFIMYIIVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+G  SK +G NH+R W NDSLAAA +S++VAWA+TALAFG+ACKEI +GG RGWRLR
Sbjct  61   AGVVGAASKLVGANHIRSWTNDSLAAAAASSIVAWAITALAFGVACKEIAIGGHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            VLEAF+IILAFTQLLYVL+LHAG FSS+YGPGYRD DY +G G   V+
Sbjct  121  VLEAFIIILAFTQLLYVLLLHAGMFSSKYGPGYRDPDYVVGGGPGEVK  168



>ref|XP_009357953.1| PREDICTED: uncharacterized protein LOC103948641 [Pyrus x bretschneideri]
Length=179

 Score =   217 bits (553),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY+I++GFASWCLN+FINGQ++HP+FGGNGATMFFL FSIL
Sbjct  1    MAQTVGRNVAAPLLFLNLIMYLILVGFASWCLNRFINGQSNHPSFGGNGATMFFLIFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+GI SK  G NH+R WR+DSLAAAGSSA+VAWA+TALAFGLA K+I++GG+RGWRLR
Sbjct  61   AGVMGIASKLAGANHIRAWRSDSLAAAGSSAIVAWALTALAFGLAWKQISIGGFRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            +LEAFVI+L FTQLLY+L+LHAG FSS+YGPGYRD DY
Sbjct  121  LLEAFVIVLTFTQLLYLLLLHAGVFSSKYGPGYRDTDY  158



>gb|KHG12423.1| 3-phosphoshikimate 1-carboxyvinyltransferase [Gossypium arboreum]
Length=174

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 131/155 (85%), Gaps = 0/155 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            TV R +AAPLLFLNLIMY IVLGFASWC N+FI+GQT HP+ GGNGAT FFL  +ILAAV
Sbjct  3    TVGRNIAAPLLFLNLIMYFIVLGFASWCFNRFIDGQTAHPSMGGNGATGFFLTIAILAAV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
             GIVSK  GG H+R WR+DSLA AGSS+L+AWA+TALAFG ACK IN+GGWRGWRLRV+E
Sbjct  63   AGIVSKLAGGGHIRSWRSDSLAEAGSSSLIAWALTALAFGFACKHINIGGWRGWRLRVIE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            A +IIL  T+LLYV ++HAG F SRYGPGYRD +Y
Sbjct  123  ALIIILTLTELLYVCLIHAGLFGSRYGPGYRDTEY  157



>ref|XP_010069093.1| PREDICTED: uncharacterized protein LOC104456070 [Eucalyptus grandis]
 gb|KCW57320.1| hypothetical protein EUGRSUZ_H00118 [Eucalyptus grandis]
Length=180

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            T+ R +A PLLFLNL+MY+IV+GFASWCLN+FINGQT HP+FGGNGATMFFL F++L+ V
Sbjct  3    TMGRNIAGPLLFLNLVMYLIVVGFASWCLNRFINGQTGHPSFGGNGATMFFLIFALLSGV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GI+SK  G +H+R WRNDSLAAA SSAL+AWA+TALAFGLACKEINVGG RGWRLRVLE
Sbjct  63   IGIISKLAGASHIRAWRNDSLAAAASSALIAWAITALAFGLACKEINVGGHRGWRLRVLE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            AF+IIL FTQLLY+L+LHAG F+SRYGPGYRD  YG    A
Sbjct  123  AFIIILTFTQLLYLLLLHAGLFNSRYGPGYRDTPYGSSAAA  163



>ref|XP_010262475.1| PREDICTED: uncharacterized protein LOC104600988 [Nelumbo nucifera]
Length=180

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 143/168 (85%), Gaps = 1/168 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA  V R +AAPLLFLNLI+Y +V+GFASWCLN+FINGQT +P FGGNGAT+FFL FSIL
Sbjct  1    MALAVGRNIAAPLLFLNLILYTLVVGFASWCLNRFINGQTGNPGFGGNGATIFFLVFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+G+ SKF G NH+R WRNDSLAAAGSS+LVAWAVTALAFGLACKEI++GGWR WRLR
Sbjct  61   AGVVGVASKFAGSNHMRAWRNDSLAAAGSSSLVAWAVTALAFGLACKEISIGGWRSWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            +LEA +IIL FTQLLY+L+LHAG  SS+YGPGYRD     G+GA  VE
Sbjct  121  ILEALIIILTFTQLLYLLLLHAGLVSSKYGPGYRDTT-NYGLGAAEVE  167



>ref|XP_002518211.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44344.1| conserved hypothetical protein [Ricinus communis]
Length=159

 Score =   212 bits (540),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 140/160 (88%), Gaps = 1/160 (1%)
 Frame = -2

Query  833  MYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVW  654
            MY I LGFASWCLN++INGQT+HP+FG NGAT FFL F+ILA+V+GI SKF GGNH+R W
Sbjct  1    MYAIALGFASWCLNRYINGQTNHPSFGPNGATPFFLTFAILASVVGIASKFAGGNHIRAW  60

Query  653  RNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLM  474
            RNDSLAAAGSS+L+AWA+TALAFGLACKEIN+ G RGWRLR++EAF+IILAFTQLLYVL+
Sbjct  61   RNDSLAAAGSSSLMAWAITALAFGLACKEINI-GHRGWRLRMVEAFMIILAFTQLLYVLL  119

Query  473  LHAGWFSSRYGPGYRDNDYGMGMGAPAVEKgttgvtgTRV  354
            LHAG FSSRYGPGYRD DYG+G G   + KG   VTGTRV
Sbjct  120  LHAGVFSSRYGPGYRDTDYGVGAGGEPMPKGGVPVTGTRV  159



>ref|XP_004147191.1| PREDICTED: uncharacterized protein LOC101215543 [Cucumis sativus]
 ref|XP_004167685.1| PREDICTED: uncharacterized LOC101215543 [Cucumis sativus]
 gb|KGN61555.1| hypothetical protein Csa_2G169790 [Cucumis sativus]
Length=180

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 126/179 (70%), Positives = 148/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+T+ R +AAPLLFLNLIMY+I+LGFASWCLN+FING T+HP+ GGNGAT FFL F++L
Sbjct  1    MAQTMGRNMAAPLLFLNLIMYLILLGFASWCLNRFINGTTYHPSMGGNGATPFFLTFAML  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
             AVLGI SK  G  H+R WR+DSLA AGS++L+ WAVT LAFGLACK+IN+GG RGWRLR
Sbjct  61   TAVLGIASKLAGLYHIRAWRSDSLAGAGSTSLLTWAVTVLAFGLACKQINIGGHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEKgttgvtgTRV  354
            V+EAF+IIL FTQLLY+L+LHAG FS RYGPGY D DYGMG G  A  +   G TGTRV
Sbjct  121  VVEAFIIILTFTQLLYLLLLHAGIFSRRYGPGYWDTDYGMGGGTAAPGEPPKGTTGTRV  179



>ref|XP_008460698.1| PREDICTED: uncharacterized protein LOC103499466 [Cucumis melo]
Length=180

 Score =   213 bits (541),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 147/179 (82%), Gaps = 0/179 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+T+ R +AAPLLFLNLIMY+I+LGFASWCLN+FING T+HP+ GGNGAT FFL F++L
Sbjct  1    MAQTMGRNMAAPLLFLNLIMYLILLGFASWCLNRFINGTTYHPSMGGNGATPFFLTFAML  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
             AVLGI SK  G  H+R WR+DSLA AGS++L+ WAVT LAFGLACK+IN+GG RGWRLR
Sbjct  61   TAVLGIASKLAGLYHIRAWRSDSLAGAGSTSLLTWAVTVLAFGLACKQINIGGHRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEKgttgvtgTRV  354
            V+EAF+IIL FTQLLY+L+LHAG FS RYGPGY D DYGMG G  A  +   G  GTRV
Sbjct  121  VVEAFIIILTFTQLLYLLLLHAGIFSRRYGPGYWDTDYGMGGGTAAPGEPPKGTAGTRV  179



>ref|XP_006854370.1| hypothetical protein AMTR_s00039p00166770 [Amborella trichopoda]
 gb|ERN15837.1| hypothetical protein AMTR_s00039p00166770 [Amborella trichopoda]
Length=179

 Score =   211 bits (538),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLN  MYVIV+GFASW LNKF+NGQT+ P   GNGAT++FL FSIL
Sbjct  1    MAQTVGRNVAAPLLFLNFSMYVIVVGFASWNLNKFVNGQTNFPGVAGNGATLYFLIFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+G+ SK +G NH+R WR+D+LAA  SSA+VAWA+TALAFG ACKEI+VGG RGWRL+
Sbjct  61   AGVVGVASKLLGANHVRAWRSDTLAATASSAVVAWAITALAFGFACKEIDVGGHRGWRLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            VLEAF+I L FTQ LYVL+LHAG  SS+YGPGYRD DY
Sbjct  121  VLEAFIITLTFTQFLYVLLLHAGLISSKYGPGYRDPDY  158



>ref|XP_008340681.1| PREDICTED: uncharacterized protein LOC103403609 [Malus domestica]
Length=179

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY+IV+GFASWCLN+FINGQT+HP+FGGNGATMFFL FSIL
Sbjct  1    MAQTVGRNVAAPLLFLNLIMYLIVVGFASWCLNRFINGQTNHPSFGGNGATMFFLIFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A V+GI SK  G NH+R WR+DSLAAAGSSA+VAWA+TALA GLACK+I++GG+RGWRLR
Sbjct  61   AGVMGIASKLAGANHIRAWRSDSLAAAGSSAIVAWALTALALGLACKQISIGGFRGWRLR  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            VLEAFVI+L  TQLLY+L+LHAG FSS+YGPGYRD DY
Sbjct  121  VLEAFVIVLTVTQLLYLLLLHAGVFSSKYGPGYRDTDY  158



>ref|XP_004496216.1| PREDICTED: uncharacterized protein LOC101497725 [Cicer arietinum]
Length=179

 Score =   209 bits (533),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 149/161 (93%), Gaps = 0/161 (0%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            +V R + APLLFLNL+MY+IVLGFASWCLN+FINGQT+HP+FGGNGATMFFL F+ILA+V
Sbjct  3    SVGRNVLAPLLFLNLLMYLIVLGFASWCLNRFINGQTYHPSFGGNGATMFFLIFAILASV  62

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +GIVSKF+GGNH+R WR+DSLA+AG+++ +AWAVTALAFG ACK+I++GG RGWRL+++E
Sbjct  63   IGIVSKFIGGNHIRAWRSDSLASAGATSSIAWAVTALAFGFACKQIHIGGHRGWRLKMVE  122

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            AF+IIL FTQLLY+L++HAG ++SRYGPGYRD DYG+G GA
Sbjct  123  AFIIILTFTQLLYLLLIHAGLYNSRYGPGYRDTDYGVGGGA  163



>ref|XP_010026780.1| PREDICTED: uncharacterized protein LOC104417162 [Eucalyptus grandis]
 gb|KCW60174.1| hypothetical protein EUGRSUZ_H02898 [Eucalyptus grandis]
Length=175

 Score =   205 bits (522),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            +AR +A PLLFLNL++Y IV+GFASWC+N++INGQ+ HP  GGNGATMFFL F++ A V+
Sbjct  1    MARNMAGPLLFLNLVLYCIVVGFASWCINRYINGQSAHPGVGGNGATMFFLVFALSAGVV  60

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            GIVSK  G  H+R WR DSLAAA SS++VA+A+TALAFGLA KEINVGG+RGWRLRVLEA
Sbjct  61   GIVSKLPGALHIRAWRGDSLAAAASSSVVAFALTALAFGLAWKEINVGGYRGWRLRVLEA  120

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGM  405
            FVII+  TQ LY+L LHAG FSSRYGPGYRD  Y  G+
Sbjct  121  FVIIVTITQFLYILALHAGHFSSRYGPGYRDTPYSGGI  158



>gb|ACG24926.1| plasma membrane associated protein [Zea mays]
 tpg|DAA60388.1| TPA: plasma membrane associated protein [Zea mays]
Length=170

 Score =   194 bits (493),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 128/160 (80%), Gaps = 2/160 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            + R + APLL LNLIMY+IV+GFASW LN FINGQT++P   GNGAT +FL F+ILA V+
Sbjct  4    IGRNMVAPLLVLNLIMYIIVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR+DSLA   +S+L+AWA+TALAFGLACKEI++GG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRAWRHDSLATNAASSLIAWAITALAFGLACKEIHIGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            FVIILAFTQLLYVLMLH G F      GYRD+DYG+G  A
Sbjct  124  FVIILAFTQLLYVLMLHTGLFGGS--GGYRDHDYGVGGAA  161



>ref|XP_002459766.1| hypothetical protein SORBIDRAFT_02g010080 [Sorghum bicolor]
 gb|EER96287.1| hypothetical protein SORBIDRAFT_02g010080 [Sorghum bicolor]
Length=166

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 129/165 (78%), Gaps = 4/165 (2%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APL+ LNLIMY+IV+GFASW LN FINGQT++P   GNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLMVLNLIMYIIVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR+DSLA   +S+L+AWA+TALAFGLACKEI++GG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRAWRHDSLATNAASSLIAWAITALAFGLACKEIHIGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG--MGAPAV  390
            FVIILAFTQLLYVLMLHAG F      GYRD+DY  G   G P V
Sbjct  124  FVIILAFTQLLYVLMLHAGLFGGS--GGYRDHDYAAGEPKGVPRV  166



>ref|XP_004956054.1| PREDICTED: uncharacterized protein LOC101761416 [Setaria italica]
Length=171

 Score =   190 bits (483),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 2/165 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APL+ LNLIMY++V+GFASW LN FINGQT++P   GNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLMVLNLIMYLVVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R W +DSLA   +S+L+AWA+TALAFGLACKEI++GG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRAWSHDSLATNAASSLIAWAITALAFGLACKEIHIGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVEK  384
            FVIILAFTQLLYVLMLH G F      GYRD+DYG G       K
Sbjct  124  FVIILAFTQLLYVLMLHTGLFGGS--GGYRDHDYGAGAATAGEPK  166



>ref|NP_001059485.1| Os07g0422100 [Oryza sativa Japonica Group]
 gb|AAD10377.1| hydrophobic LEA-like protein [Oryza sativa]
 dbj|BAC84108.1| putative plasma membrane associated protein [Oryza sativa Japonica 
Group]
 dbj|BAC84545.1| putative plasma membrane associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF21399.1| Os07g0422100 [Oryza sativa Japonica Group]
 gb|EAZ39569.1| hypothetical protein OsJ_24006 [Oryza sativa Japonica Group]
 dbj|BAG88785.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score =   188 bits (478),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 124/154 (81%), Gaps = 1/154 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY+IV+GFASW LN FINGQT++P   GNGAT +FL F+ILA V+
Sbjct  4    VGRNMLAPLLVLNLIMYLIVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR+DSLA   +S+L+AWA+TALAFGLACKEI++GG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRAWRHDSLATNAASSLIAWAITALAFGLACKEIHIGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDY  417
            FVIILAFTQLLYVLMLH G F    G  YRD+DY
Sbjct  124  FVIILAFTQLLYVLMLHTGLFGGGDGA-YRDHDY  156



>gb|EMT28140.1| hypothetical protein F775_28015 [Aegilops tauschii]
Length=175

 Score =   188 bits (477),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 132/171 (77%), Gaps = 7/171 (4%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V+R++ APLL LNL+MY++V+G ASW LN FING T++    GNGAT +FL F+ILA V+
Sbjct  4    VSRSMVAPLLVLNLVMYIVVIGLASWNLNHFINGTTNYAGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SSALVAWA+TALAFGLACKEI+VGG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSALVAWAITALAFGLACKEIHVGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGY-RDNDY------GMGMGAPAVE  387
            F+IILAFTQLLYV+ LHAG F +++G GY  ++ Y      GMG GAPA  
Sbjct  124  FIIILAFTQLLYVMALHAGLFGNQFGDGYGAEHQYGDHHHKGMGTGAPAAR  174



>ref|XP_010111145.1| hypothetical protein L484_000734 [Morus notabilis]
 gb|EXC58967.1| hypothetical protein L484_000734 [Morus notabilis]
Length=153

 Score =   187 bits (475),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 104/160 (65%), Positives = 121/160 (76%), Gaps = 28/160 (18%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY IV+GFASWCLN+FINGQT+HP+                
Sbjct  1    MAQTVGRNIAAPLLFLNLIMYFIVVGFASWCLNRFINGQTNHPS----------------  44

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
                        GNH+R WRNDSLAAA + +L+AWA+TALAFG ACK+IN+GG RGWRLR
Sbjct  45   ------------GNHIRAWRNDSLAAAAALSLIAWAITALAFGFACKQINIGGHRGWRLR  92

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGM  411
            VLEAFVIIL FTQL+YVL+LHAG FSS+YGPGYRD DYG+
Sbjct  93   VLEAFVIILTFTQLMYVLLLHAGTFSSKYGPGYRDTDYGI  132



>dbj|BAJ87360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=182

 Score =   183 bits (465),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 127/166 (77%), Gaps = 5/166 (3%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMYVIV+GFASW LN FING T+ P  GGNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLLVLNLIMYVIVIGFASWNLNHFINGLTNRPGVGGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SS+LVAWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSSLVAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGP-----GYRDNDYGMGMGAP  396
            FVIILAFTQLLYVL LH+G F +++G      GY     G G G P
Sbjct  124  FVIILAFTQLLYVLALHSGLFGNQFGNHAGGGGYPAEHGGYGAGDP  169



>gb|AAB38504.1| ABA induced plasma membrane protein PM 19 [Triticum aestivum]
Length=182

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY++V+GFASW LN FING T+ P  GGNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLLVLNLIMYIVVIGFASWNLNHFINGLTNRPGVGGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SSALVAWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSALVAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            FVIIL FTQLLYVL LH+G F +++G       YG   GA
Sbjct  124  FVIILMFTQLLYVLALHSGLFGNQFGNHAGAGGYGAEHGA  163



>gb|EMT26307.1| hypothetical protein F775_29428 [Aegilops tauschii]
Length=182

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/160 (66%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY++V+GFASW LN FING T+ P  GGNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLLVLNLIMYIVVIGFASWNLNHFINGLTNRPGVGGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SSALVAWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSALVAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            FVIIL FTQLLYVL LH+G F +++G       YG   GA
Sbjct  124  FVIILMFTQLLYVLALHSGLFGNQFGNHAGAGGYGAEHGA  163



>gb|AFI25008.1| plama membrane protein [Triticum aestivum]
Length=182

 Score =   182 bits (461),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY+IV+GFASW LN FING T+ P  GGNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLLVLNLIMYLIVIGFASWNLNHFINGLTNRPGVGGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SSALVAWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSALVAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
            FVIIL FTQLLYVL LH+G F +++G       YG   GA
Sbjct  124  FVIILMFTQLLYVLALHSGLFGNQFGNHAGAGGYGAEHGA  163



>gb|EMT26308.1| hypothetical protein F775_29429 [Aegilops tauschii]
Length=181

 Score =   180 bits (456),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 129/176 (73%), Gaps = 14/176 (8%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY+IV+GFASW LN FING T+ P  GGNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLLVLNLIMYLIVIGFASWNLNHFINGLTNRPGVGGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SS+LVAWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSSLVAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSR--------------YGPGYRDNDYGMGMGAPA  393
            FVIILAFTQLLYVL LH+G F ++              YG G   ++ GMG G  A
Sbjct  124  FVIILAFTQLLYVLALHSGLFGNQLGGNHAGGYPAEHAYGAGGDPHNKGMGTGGVA  179



>gb|EAZ03646.1| hypothetical protein OsI_25781 [Oryza sativa Indica Group]
Length=163

 Score =   179 bits (455),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY+IV+GFASW LN FINGQT++P   GNGAT +FL F+ILA V+
Sbjct  4    VGRNMLAPLLVLNLIMYLIVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR+DSLA   +S+L+AWA+TALAFGLACKEI++GG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRAWRHDSLATNAASSLIAWAITALAFGLACKEIHIGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWF  456
            FVIILAFTQLLYVLMLH G F
Sbjct  124  FVIILAFTQLLYVLMLHTGLF  144



>ref|XP_006654338.1| PREDICTED: uncharacterized protein LOC102710696 [Oryza brachyantha]
Length=173

 Score =   178 bits (452),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 118/141 (84%), Gaps = 0/141 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY++V+GFASW LN +ING+T HP   GNGAT +FL F+ILA V+
Sbjct  4    VGRNMIAPLLVLNLIMYIVVIGFASWNLNHYINGETSHPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLAA+ +SAL+AWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRSWRGDSLAASAASALIAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWF  456
            FVIILAFTQLLYV+MLH G F
Sbjct  124  FVIILAFTQLLYVVMLHGGLF  144



>ref|XP_006658505.1| PREDICTED: uncharacterized protein LOC102721097 [Oryza brachyantha]
Length=160

 Score =   177 bits (449),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY+IV+GFASW LN FINGQT++P   GNGAT +FL F++LA V+
Sbjct  4    VGRNMLAPLLVLNLIMYLIVIGFASWNLNHFINGQTNYPGVAGNGATFYFLVFAVLAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA   +S+L+AWA+TALAFGLACKEI+VGG RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRAWRRDSLATNAASSLIAWAITALAFGLACKEIHVGGHRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHA  465
            FVIILAFTQLLYVLMLHA
Sbjct  124  FVIILAFTQLLYVLMLHA  141



>ref|XP_004980953.1| PREDICTED: uncharacterized protein LOC101784294 [Setaria italica]
Length=170

 Score =   177 bits (449),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R + APLL LNLIMYV+V+GFASW LN FING+T++P   GNGAT +FL F+ILA V+G 
Sbjct  6    RGMIAPLLVLNLIMYVVVIGFASWNLNHFINGETNYPGVAGNGATFYFLVFAILAGVVGA  65

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             SK  G +H+R WR DSLA + +SAL+AWA+TALAFGLACKEI++GG RGWRLRVLEAFV
Sbjct  66   ASKLAGIHHVRSWRGDSLATSAASALIAWAITALAFGLACKEIHIGGHRGWRLRVLEAFV  125

Query  512  IILAFTQLLYVLMLHAGWFSSRY  444
            IILAFTQLLYVL LHAG F +++
Sbjct  126  IILAFTQLLYVLALHAGLFGNQF  148



>gb|AAF29532.1|AF218627_1 plasma membrane associated protein [Hordeum vulgare]
Length=181

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 128/176 (73%), Gaps = 14/176 (8%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R + APLL LNLIMY+IV+GFASW LN FING T+ P  GGNGAT +FL F+ILA V+
Sbjct  4    VGRNMVAPLLVLNLIMYIIVIGFASWNLNHFINGITNRPGVGGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLA + SS+LVAWA+TALAFGLACKEI+VGG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRTWRGDSLATSASSSLVAWAITALAFGLACKEIHVGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWF-------------SSRYGPGYRD-NDYGMGMGAPA  393
            FVIILAFTQLLYVL LH+G F                YG G  D ++ GMG G  A
Sbjct  124  FVIILAFTQLLYVLALHSGLFGNQFGNNNGGYPAEHAYGAGVGDHHNKGMGTGGVA  179



>ref|NP_001055398.1| Os05g0381400 [Oryza sativa Japonica Group]
 gb|AAT38056.1| putative plasma membrane associated protein [Oryza sativa Japonica 
Group]
 dbj|BAF17312.1| Os05g0381400 [Oryza sativa Japonica Group]
 gb|EAY97848.1| hypothetical protein OsI_19767 [Oryza sativa Indica Group]
 dbj|BAG95356.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 118/145 (81%), Gaps = 0/145 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V RT+ APLL LNLIMY+IV+GFASW LN +ING+T+HP   GNGAT +FL F+ILA V+
Sbjct  4    VGRTMIAPLLVLNLIMYLIVIGFASWNLNHYINGETNHPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R W   SLAA  +SAL+AWA+TALAFGLACKEI++GG+RGWRLRVLEA
Sbjct  64   GAASKLAGVHHVRSWGAHSLAAGAASALIAWAITALAFGLACKEIHIGGYRGWRLRVLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRY  444
            FVIILAFTQLLYV MLH G FS  +
Sbjct  124  FVIILAFTQLLYVAMLHGGLFSGNH  148



>gb|ADE76757.1| unknown [Picea sitchensis]
Length=173

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 126/164 (77%), Gaps = 2/164 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MARTV RT+A PLL LN  MY+IVL  A W LNKFING++H P   GN AT +F  FS+L
Sbjct  1    MARTVGRTVAGPLLLLNFAMYLIVLALAGWALNKFINGESH-PYLAGNTATQYFCLFSLL  59

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A  +GI S F GG HLR WRNDSLAAA S+AL+AW +T LAFGLACKEI++ G RG RL+
Sbjct  60   AGTVGIASMFSGGYHLRAWRNDSLAAAASTALIAWLLTVLAFGLACKEIHI-GHRGRRLK  118

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGA  399
             LEAF+IIL FTQLLY+L+LHAG  SS+YGPGYRD++Y  G  A
Sbjct  119  TLEAFIIILTFTQLLYLLLLHAGLVSSKYGPGYRDSEYTGGATA  162



>ref|XP_010918949.1| PREDICTED: uncharacterized protein LOC105043190 isoform X2 [Elaeis 
guineensis]
Length=154

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -2

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GNGAT +FL F+ILA VLG+ SK  G NH+R WRNDSLAAA SS++VAWA+TALAFGLAC
Sbjct  26   GNGATFYFLIFAILAGVLGVASKLAGANHIRAWRNDSLAAAASSSVVAWAITALAFGLAC  85

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPA  393
            KEIN+GG RGWRLR LEAF+IIL FTQLLYVLMLHAG FSS+YGPGYRD DYG+G G P 
Sbjct  86   KEINIGGHRGWRLRTLEAFIIILTFTQLLYVLMLHAGVFSSKYGPGYRDPDYGLG-GGPG  144

Query  392  VE  387
            VE
Sbjct  145  VE  146



>ref|XP_003557592.1| PREDICTED: uncharacterized protein LOC100842584 [Brachypodium 
distachyon]
Length=179

 Score =   161 bits (408),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 1/145 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            + R + +PLL LNLIMY+IV+G ASW LN  ING  +HP   GNGAT +FL F+ILA V+
Sbjct  4    IGRNMVSPLLVLNLIMYIIVIGLASWNLNHHING-LNHPGAVGNGATFYFLVFAILAGVV  62

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  SK  G +H+R WR DSLAA   SALVAWA+TALAFGLACKEI +GG+RGWRLR LEA
Sbjct  63   GAASKLAGIHHVRSWRGDSLAATAGSALVAWAITALAFGLACKEIGIGGYRGWRLRTLEA  122

Query  518  FVIILAFTQLLYVLMLHAGWFSSRY  444
            F+IIL FTQL+YV MLH G F +++
Sbjct  123  FIIILTFTQLIYVAMLHTGLFGNQF  147



>gb|KDP32936.1| hypothetical protein JCGZ_12967 [Jatropha curcas]
Length=184

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 0/153 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
              R L  PLL +N I+Y+I+LG A W L+K+ING+  HP+ GGN AT F L F++L  V+
Sbjct  6    TQRDLIGPLLAVNFIVYLIILGLAGWSLDKYINGEQSHPHLGGNPATNFMLVFALLGGVI  65

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  S  +G  H R WR+DSLA+A S A+++  +TALAFGLACKEI +GG RG RL+ LEA
Sbjct  66   GGSSVVVGLFHFRSWRSDSLASASSLAIISCVITALAFGLACKEIILGGHRGKRLQTLEA  125

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDND  420
             ++I   +Q LY+++LHAG +S +YGPGYR +D
Sbjct  126  LIVISLLSQFLYIVLLHAGIYSPQYGPGYRGSD  158



>ref|XP_011021218.1| PREDICTED: uncharacterized protein LOC105123357 [Populus euphratica]
Length=177

 Score =   151 bits (382),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = -2

Query  875  ARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLG  696
            ++ L  PLL +NL+ Y++VLG A W ++K+ING+ +HP+ GGN AT F L ++++  V+G
Sbjct  8    SKDLIGPLLAVNLVFYLLVLGLAGWSVDKYINGEQNHPHLGGNPATSFMLIYALIGGVIG  67

Query  695  IVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAF  516
              S  +G  HLR WRNDSLA+A ++A+++WA+TALAFG  CK+I +GG RG RL+ LEA 
Sbjct  68   ACSILVGFVHLRAWRNDSLASASATAIISWAITALAFGFECKQILLGGHRGKRLKTLEAL  127

Query  515  VIILAFTQLLYVLMLHAGWFSSRYGPGYRD  426
            +II   +Q LYV++LHAG+F SRYGPGY +
Sbjct  128  IIISLLSQFLYVVLLHAGFFRSRYGPGYHN  157



>ref|XP_010932736.1| PREDICTED: uncharacterized protein LOC105053338 [Elaeis guineensis]
Length=179

 Score =   148 bits (374),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 115/165 (70%), Gaps = 3/165 (2%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            T  R    PLLF+N IMY+ +LG A W L+K I+G++H    G N +T + + FS++   
Sbjct  5    TAGRGFLRPLLFINFIMYITILGLAGWSLDKLIDGESHRHLGGRNTSTGYLVIFSLMTGA  64

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G  S   G  H R WR+DSLA+A SSALV+WA+TAL+FGLACK IN+G  RG  LR LE
Sbjct  65   VGACSVLAGLLHTRAWRSDSLASAISSALVSWALTALSFGLACKHINLGN-RGRHLRTLE  123

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            AF+IIL FTQLLY+++LHAG  SSRYGPGYR  +YG   GA + E
Sbjct  124  AFIIILTFTQLLYLILLHAGIISSRYGPGYR--NYGTDYGAMSHE  166



>ref|XP_010909782.1| PREDICTED: uncharacterized protein LOC105035782 [Elaeis guineensis]
Length=159

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 2/151 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
             AR    PLL +NL MY++VLG A W L+KF + Q  H + GGN +T + L FS+ A  +
Sbjct  6    AARGFLGPLLSVNLAMYIVVLGLAGWSLDKF-DDQEAHRHLGGNTSTSYLLIFSLTAGAM  64

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  S   G  H+R WR+DSLA+A SSALV+ A+TAL+FGLACK IN+G  RG RLR LEA
Sbjct  65   GSCSVLAGLLHIRAWRSDSLASAVSSALVSSALTALSFGLACKHINLGN-RGRRLRTLEA  123

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRD  426
            F+IIL FT LLY+++LHAG  S+RYGPGYR+
Sbjct  124  FIIILTFTPLLYLILLHAGIMSNRYGPGYRN  154



>ref|XP_006363128.1| PREDICTED: uncharacterized protein LOC102578503 [Solanum tuberosum]
Length=161

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            RT   PLL +NL++Y+IVLG A W L+K+I+G+ +HP+ GGN +T F L F+++  V+G 
Sbjct  8    RTFMGPLLVINLVVYLIVLGLAGWSLDKYIDGEQNHPHLGGNPSTSFMLIFALIGGVMGA  67

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S   G  HLR W + SL +A SSA+++WA+TALAFGL CK+I +GG RG RL+ LEA +
Sbjct  68   SSMLAGFFHLRKWTSHSLVSAASSAIISWAITALAFGLVCKQIIMGGHRGKRLQTLEALI  127

Query  512  IILAFTQLLYVLMLHAGWFSSRYGPGY  432
             I   +QLLY+L+LHAG F SRYGP Y
Sbjct  128  TIAMVSQLLYILLLHAGIFRSRYGPVY  154



>ref|XP_011099568.1| PREDICTED: uncharacterized protein LOC105177953 isoform X2 [Sesamum 
indicum]
Length=156

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R L  PLL +N ++Y+I+LG A W L+K+I+GQ +HP+ GGN +T+F L ++++A V+G 
Sbjct  8    RRLMGPLLAVNSVVYMILLGLAGWSLDKYIDGQQNHPHLGGNPSTIFLLVYALIAGVIGA  67

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S F+G  HLRVW N SLA+A +SA +A AVTALAFGL CK+I +GG RG RL+ LEAF+
Sbjct  68   CSVFLGFAHLRVWNNVSLASAATSATIAVAVTALAFGLVCKQITMGGHRGKRLQTLEAFI  127

Query  512  IILAFTQLLYVLMLHAGWFSSRYGPGY  432
             I   +QLLY+L+LHAG FSSRYGP Y
Sbjct  128  AISGVSQLLYLLLLHAGIFSSRYGPAY  154



>ref|XP_002283463.2| PREDICTED: uncharacterized protein LOC100242900 [Vitis vinifera]
Length=161

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLG-  696
            R+L  PLL +N ++Y+I+LG A W L+K+I+G+ +HP+ GGN +T F L F+++A V G 
Sbjct  9    RSLMGPLLAVNFVVYLIILGLAGWSLDKYIDGEQNHPHLGGNPSTSFMLIFALIAGVTGA  68

Query  695  --IVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
              +V++F+   H + W +DSLAAA SSA+++WA+TALA GL CKEI +GG+RG RL+ LE
Sbjct  69   CCVVAEFL---HYKAWTSDSLAAAASSAIISWAITALAAGLVCKEIILGGYRGKRLQTLE  125

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            A +I+   +QLLY+++LHAG +S RYGPGYR +
Sbjct  126  ALIIVSTVSQLLYLVLLHAGLWSRRYGPGYRSS  158



>ref|XP_009793588.1| PREDICTED: uncharacterized protein LOC104240443 [Nicotiana sylvestris]
Length=161

 Score =   141 bits (355),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 105/147 (71%), Gaps = 0/147 (0%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R+L  P L +N ++Y+IVLG A W L+K+I+G+ +HP+ GGN +T F L F+++  V+G 
Sbjct  8    RSLMGPFLVINFVVYLIVLGLAGWSLDKYIDGEQNHPHLGGNPSTSFMLMFALIGGVMGA  67

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S   G  HLR W   +L +A SSA+++WA+TALAFGL CK+I +GG RG RL+ LEA +
Sbjct  68   SSMLAGFVHLRKWTTQTLTSAASSAIISWAITALAFGLVCKQIIMGGHRGKRLQTLEALI  127

Query  512  IILAFTQLLYVLMLHAGWFSSRYGPGY  432
             I   +QLLY+L+LHAG F SRYGP Y
Sbjct  128  TIAMVSQLLYILLLHAGIFRSRYGPVY  154



>emb|CBI33674.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   142 bits (359),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/153 (52%), Positives = 116/153 (76%), Gaps = 6/153 (4%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLG-  696
            R+L  PLL +N ++Y+I+LG A W L+K+I+G+ +HP+ GGN +T F L F+++A V G 
Sbjct  30   RSLMGPLLAVNFVVYLIILGLAGWSLDKYIDGEQNHPHLGGNPSTSFMLIFALIAGVTGA  89

Query  695  --IVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
              +V++F+   H + W +DSLAAA SSA+++WA+TALA GL CKEI +GG+RG RL+ LE
Sbjct  90   CCVVAEFL---HYKAWTSDSLAAAASSAIISWAITALAAGLVCKEIILGGYRGKRLQTLE  146

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            A +I+   +QLLY+++LHAG +S RYGPGYR +
Sbjct  147  ALIIVSTVSQLLYLVLLHAGLWSRRYGPGYRSS  179



>ref|XP_009601672.1| PREDICTED: uncharacterized protein LOC104096921 [Nicotiana tomentosiformis]
Length=161

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 107/148 (72%), Gaps = 0/148 (0%)
 Frame = -2

Query  875  ARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLG  696
             R+L  P L +N ++Y+I+LG A+W L+K+I+G+ +HP+ GGN +T F L F+++  V+G
Sbjct  7    GRSLMGPFLVINFVVYLIILGLAAWSLDKYIDGEQNHPHLGGNTSTSFMLIFALIGGVMG  66

Query  695  IVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAF  516
              S   G  HLR W   SLA+A SSA+++WA+TALAFGL CK+I +GG RG RL+ LEA 
Sbjct  67   ASSMLAGFVHLRKWNTQSLASAASSAIISWAITALAFGLVCKQIIMGGHRGKRLQTLEAL  126

Query  515  VIILAFTQLLYVLMLHAGWFSSRYGPGY  432
            + I   +QLLY+L+LHAG F +RYGP Y
Sbjct  127  ITIAMVSQLLYILLLHAGIFRNRYGPVY  154



>emb|CAN66509.1| hypothetical protein VITISV_003619 [Vitis vinifera]
Length=585

 Score =   144 bits (363),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 80/153 (52%), Positives = 113/153 (74%), Gaps = 1/153 (1%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R+L  PLL +N ++Y+I+LG A W L+K+I+G+ +HP+ GGN +T F L F+++A V G 
Sbjct  433  RSLMGPLLAVNFVVYLIILGLAGWSLDKYIDGEQNHPHLGGNPSTSFMLIFALIAGVTGA  492

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
                 G  H + W +DSLAAA SSA+++WA+TALA GL CKEI +GG+RG RL+ LEA +
Sbjct  493  CCVVAGFLHYKAWTSDSLAAAASSAIISWAITALAIGLVCKEIILGGYRGKRLQTLEALI  552

Query  512  IILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYG  414
            I+   +QLLY+++LHAG +S RYGPGYR + YG
Sbjct  553  IVSTVSQLLYLVLLHAGLWSRRYGPGYR-SSYG  584



>gb|EYU43779.1| hypothetical protein MIMGU_mgv1a023451mg, partial [Erythranthe 
guttata]
Length=102

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            M  T AR++AAPLL+LNLIMY IVLGF+SWCLN++INGQT HP+ GGNGAT  FL FSIL
Sbjct  1    MVSTSARSVAAPLLYLNLIMYFIVLGFSSWCLNRYINGQTAHPSMGGNGATGHFLTFSIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAF  585
            AAVLGIVSK  GG HLRVWR+DSLAAA SSA+VAWAVTALAF
Sbjct  61   AAVLGIVSKVAGGQHLRVWRSDSLAAACSSAIVAWAVTALAF  102



>ref|XP_011099567.1| PREDICTED: uncharacterized protein LOC105177953 isoform X1 [Sesamum 
indicum]
Length=161

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 112/152 (74%), Gaps = 5/152 (3%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R L  PLL +N ++Y+I+LG A W L+K+I+GQ +HP+ GGN +T+F L ++++A V+G 
Sbjct  8    RRLMGPLLAVNSVVYMILLGLAGWSLDKYIDGQQNHPHLGGNPSTIFLLVYALIAGVIGA  67

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFG-----LACKEINVGGWRGWRLRV  528
             S F+G  HLRVW N SLA+A +SA +A AVTALAFG     L CK+I +GG RG RL+ 
Sbjct  68   CSVFLGFAHLRVWNNVSLASAATSATIAVAVTALAFGSMGYRLVCKQITMGGHRGKRLQT  127

Query  527  LEAFVIILAFTQLLYVLMLHAGWFSSRYGPGY  432
            LEAF+ I   +QLLY+L+LHAG FSSRYGP Y
Sbjct  128  LEAFIAISGVSQLLYLLLLHAGIFSSRYGPAY  159



>ref|XP_008230390.1| PREDICTED: uncharacterized protein LOC103329670 [Prunus mume]
Length=160

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  860  APLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGIVSKF  681
            APL+ +NL++++I+LG A W L+K+ING+ +HP+ GGN +T F L F+++A V+G  S  
Sbjct  2    APLIAVNLVVHLIMLGLAGWSLDKYINGERNHPHLGGNPSTSFMLIFALIAGVVGACSML  61

Query  680  MGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFVIILA  501
             G  HLR+WR DSLAAA SSA++A A+ ALAFG  CKEI +GG RG RL+ LEA + I  
Sbjct  62   YGWMHLRIWRTDSLAAASSSAIIAQAIVALAFGFVCKEIILGGHRGKRLQTLEAMIAISL  121

Query  500  FTQLLYVLMLHAGWFSSRYGPG  435
             +QL+Y+++LHAG F SRY  G
Sbjct  122  LSQLMYLVLLHAGMFKSRYRSG  143



>gb|ACH58418.1| unknown [Prunus dulcis]
Length=81

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA+TV R +AAPLLFLNLIMY IV+GFASWCLNKFINGQT+HP+FGGNGATMFFL F+IL
Sbjct  1    MAQTVGRNVAAPLLFLNLIMYFIVVGFASWCLNKFINGQTNHPSFGGNGATMFFLIFAIL  60

Query  710  AAVLGIVSKFMGGNHLRVWRN  648
            A V+GI SK  G NH+R WR+
Sbjct  61   AGVMGIASKLAGANHIRAWRS  81



>ref|XP_010103810.1| hypothetical protein L484_008662 [Morus notabilis]
 gb|EXB97172.1| hypothetical protein L484_008662 [Morus notabilis]
Length=184

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R L  PLL +NL++YV+VLG A W L+K+ING+ +HP+ GGN +T F L F+++A V+G 
Sbjct  8    RDLLGPLLAVNLVVYVVVLGLAGWSLDKYINGEQNHPHLGGNPSTSFMLMFALIAGVVGA  67

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S   G  HLR WR +SL +A + AL++WA+TALAFGL CKEI +GG RG RL+ LEAF+
Sbjct  68   CSLLPGLLHLRAWRGESLPSASALALLSWALTALAFGLVCKEIILGGRRGKRLQTLEAFI  127

Query  512  IILAFTQLLYVLMLHAGWFSSRYGPGYRDND  420
            +I   +Q LYV++LH G +SS YGPGYR++D
Sbjct  128  VISLLSQFLYVVLLHGGMYSSHYGPGYRNDD  158



>ref|XP_008800777.1| PREDICTED: uncharacterized protein LOC103715048 [Phoenix dactylifera]
Length=176

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 112/159 (70%), Gaps = 6/159 (4%)
 Frame = -2

Query  881  TVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAV  702
            T  R    PLLF+N +M++I+LG A W L++ I+ +   P   GN +T + L  S++A  
Sbjct  5    TAGRGFLVPLLFINFVMHIIILGLAGWSLDRIID-RDRRPQ--GNPSTSYLLILSLMAGA  61

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G  S   G  H+R WR+DSLA+A SSALV+WA+TAL+FG+ACK IN+G  RG  LR LE
Sbjct  62   VGACSAVAGLLHMRAWRSDSLASAISSALVSWALTALSFGVACKHINLGN-RGRHLRTLE  120

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRD--NDYGM  411
            AF+IIL FTQLLY+++LHAG  +SRYGPGY +   DYG+
Sbjct  121  AFIIILTFTQLLYLILLHAGIMNSRYGPGYWNYGTDYGV  159



>ref|XP_002516743.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45641.1| conserved hypothetical protein [Ricinus communis]
Length=180

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R L  PLL +NLI+++IVLG A W L+K+I+GQ  HP+ GGN +T F L ++++A V+
Sbjct  6    VQRDLIGPLLAVNLIVHLIVLGLAGWSLDKYIDGQQDHPHLGGNPSTSFMLVYALIAGVI  65

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G  S  +G  H R WR+DSLA+A S A+ +WA+ ALAFGL C++I +GG RG RL+ LEA
Sbjct  66   GASSVLIGILHFRSWRSDSLASATSLAINSWAIAALAFGLVCQQIILGGHRGKRLKTLEA  125

Query  518  FVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMG  402
             + +   +QLLY+L+LHAG F+ RYGPG+ +++   G G
Sbjct  126  LITVSFLSQLLYLLLLHAGMFNPRYGPGFHNHECDRGPG  164



>gb|EEE63546.1| hypothetical protein OsJ_18362 [Oryza sativa Japonica Group]
Length=175

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 90/112 (80%), Gaps = 0/112 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V RT+ APLL LNLIMY+IV+GFASW LN +ING+T+HP   GNGAT +FL F+ILA V+
Sbjct  4    VGRTMIAPLLVLNLIMYLIVIGFASWNLNHYINGETNHPGVAGNGATFYFLVFAILAGVV  63

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRG  543
            G  SK  G +H+R W   SLAA  +SAL+AWA+TALAFGLACKEI++GG+RG
Sbjct  64   GAASKLAGVHHVRSWGAHSLAAGAASALIAWAITALAFGLACKEIHIGGYRG  115



>ref|XP_010692699.1| PREDICTED: uncharacterized protein LOC104905764 [Beta vulgaris 
subsp. vulgaris]
Length=178

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = -2

Query  857  PLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGIVSKFM  678
            P+L ++L++Y+I+LG +SW LNK+I+GQ +HP+ GGN AT + L F++LA+  G+ S   
Sbjct  13   PILVVDLVVYLIILGLSSWSLNKYIDGQQNHPHLGGNAATNYMLIFALLASTTGVASVVA  72

Query  677  GGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFVIILAF  498
            G  H R W   S+AAA SSA ++WA++ LAFGLA KE+ +GG RG RL+ LE F+II   
Sbjct  73   GFTHFRAWSVASMAAAASSAAISWAISGLAFGLAWKEVKLGGRRGKRLQTLEIFLIISTL  132

Query  497  TQLLYVLMLHAGWFSSRYGPGY  432
              LLY+++LHAG F+ +YG  Y
Sbjct  133  IHLLYIMLLHAGSFNQKYGLSY  154



>emb|CDP02791.1| unnamed protein product [Coffea canephora]
Length=174

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 104/145 (72%), Gaps = 0/145 (0%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            ++L  PLL +N ++++IVLG A W L+K+I+G+  HP+ GGN +T F L F+++  V+G 
Sbjct  8    KSLMGPLLAVNSVVHLIVLGLAGWSLDKYIDGEQDHPHLGGNPSTSFLLVFALIGGVIGA  67

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S F G  HLR W +DSLA A SSA ++W +TALAFGL CK+I +GG RG RL+ LEAF+
Sbjct  68   CSLFAGLIHLRAWHSDSLAGAASSAFISWTITALAFGLVCKQIILGGHRGKRLQTLEAFI  127

Query  512  IILAFTQLLYVLMLHAGWFSSRYGP  438
             +   +QLLY+L+LH G  S R+GP
Sbjct  128  TLSLLSQLLYLLLLHGGMCSGRFGP  152



>ref|XP_006430802.1| hypothetical protein CICLE_v10013040mg [Citrus clementina]
 gb|ESR44042.1| hypothetical protein CICLE_v10013040mg [Citrus clementina]
Length=147

 Score =   115 bits (289),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/141 (51%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R L +PLL +N ++Y+I+LG A+W LNK+ING+ +HP+ GGN +T F L F++    +
Sbjct  6    VGRGLVSPLLAVNFVVYLIILGLAAWSLNKYINGEQNHPHLGGNTSTWFLLTFALTTGAI  65

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G+ S   G  HLR WR++SLAAA S A+++W+VTA+A G  CKEI +GG RG RL+ LEA
Sbjct  66   GVCSVTAGLMHLRAWRSESLAAASSLAILSWSVTAIAVGFVCKEIILGGHRGKRLQTLEA  125

Query  518  FVIILAFTQLLYVLMLHAGWF  456
            F +I   +QLLY+ ++HA WF
Sbjct  126  FAVISLLSQLLYLGLVHA-WF  145



>ref|WP_033581559.1| hypothetical protein [Dickeya zeae]
Length=88

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +1

Query  511  MTNASSTLSRHPLHPPTFISLHANPKAKAVTAHATNAEDPAAARLSFLHTLRWFPPMNFD  690
            M  AS  L+ HPLHPP FI LHANP A+AVTAHAT  EDPAAARLSFL  L W  P +FD
Sbjct  1    MMKASIILNLHPLHPPMFICLHANPMARAVTAHATIEEDPAAARLSFLQNLIWLAPASFD  60

Query  691  TIPSTAASIENARKNIVAPFPPKLG*WV  774
             +P TAA IEN +K  VAP PPKLG W+
Sbjct  61   AMPITAAKIENVKKKGVAPLPPKLG-WL  87



>ref|XP_006482274.1| PREDICTED: uncharacterized protein LOC102618346 isoform X1 [Citrus 
sinensis]
Length=147

 Score =   113 bits (283),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 101/141 (72%), Gaps = 1/141 (1%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R L +PLL +N ++Y+I+LG A+W LNK+IN + +HP+ GGN +T F L F++    +
Sbjct  6    VGRGLVSPLLAVNFVVYLIILGLAAWSLNKYINDEQNHPHLGGNTSTWFLLTFALTTGAI  65

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G+ S   G  HLR WR++SLAAA S A+++W+VTA+A G  CKEI +GG RG RL+ LEA
Sbjct  66   GVCSVTAGLMHLRAWRSESLAAASSLAILSWSVTAIAVGFVCKEIILGGHRGKRLQTLEA  125

Query  518  FVIILAFTQLLYVLMLHAGWF  456
            F +I   +QLLY+ ++HA WF
Sbjct  126  FAVISLLSQLLYLGLVHA-WF  145



>ref|XP_002983355.1| hypothetical protein SELMODRAFT_180070 [Selaginella moellendorffii]
 gb|EFJ15697.1| hypothetical protein SELMODRAFT_180070 [Selaginella moellendorffii]
Length=189

 Score =   113 bits (282),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 114/182 (63%), Gaps = 16/182 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFGG-----------N  747
            MA    R++AA LLFLN  MY++VLG A W +NK I+  Q +  N  G           N
Sbjct  1    MAFGPGRSVAAFLLFLNFCMYMVVLGLAGWAMNKAIDYSQANIVNQTGAVTTLTRFPVGN  60

Query  746  GATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKE  567
             AT FFL F + A VLG+ S   G  H+ +WR++SLAAA SSAL+AW  T LAFG ACKE
Sbjct  61   AATPFFLLFILGAGVLGLASILAGAIHVSLWRSESLAAAISSALIAWLFTLLAFGFACKE  120

Query  566  INV-GGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAV  390
            I + GG+R  RL+ LEAF IILA  QLLY+L LH+G   +R GP  ++  YG GM A  V
Sbjct  121  IQLRGGYRNRRLKALEAFSIILAGMQLLYILSLHSGML-ARMGPRIKEPGYG-GM-AQGV  177

Query  389  EK  384
            E+
Sbjct  178  EQ  179



>ref|XP_002984669.1| hypothetical protein SELMODRAFT_423735 [Selaginella moellendorffii]
 gb|EFJ14314.1| hypothetical protein SELMODRAFT_423735 [Selaginella moellendorffii]
Length=182

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 103/169 (61%), Gaps = 6/169 (4%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLN-KFINGQTHHPNFGGNGATMFFLAFSI  714
            MA  + R L  PL+FLN  +Y+I+LG A   LN  F  G       GGNG T+  + F++
Sbjct  1    MAAILRRALLCPLVFLNFFLYMILLGIAGAKLNDSFERGFVP----GGNGITVTLVIFAL  56

Query  713  LAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRL  534
            +A V+G+ S   G +HL  WR DS AAAG++ L+AW +T L+FG+ACK I  G      +
Sbjct  57   IAGVVGVASSLAGMHHLAAWRTDSFAAAGAAGLIAWLLTLLSFGIACKHIRRGRIYSKSV  116

Query  533  RVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMGMGAPAVE  387
            RVLE+  IILA TQL Y+LMLH G FS R G GY++  Y     AP VE
Sbjct  117  RVLESIAIILAGTQLFYLLMLHTGIFSRRLG-GYKEPGYVATRSAPTVE  164



>ref|XP_002960681.1| hypothetical protein SELMODRAFT_437726 [Selaginella moellendorffii]
 gb|EFJ38220.1| hypothetical protein SELMODRAFT_437726 [Selaginella moellendorffii]
Length=189

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 108/172 (63%), Gaps = 14/172 (8%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFGG-----------N  747
            MA    R++AA LLFLN  MY++VLG A W +NK I+  Q +  N  G           N
Sbjct  1    MAFGPGRSVAAFLLFLNFCMYMVVLGLAGWAMNKAIDYSQANIVNQTGAVTTLTRFPVGN  60

Query  746  GATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKE  567
             AT FFL F + A VLG+ S   G  H+ +WR++SLAAA SSAL+AW  T LAFG ACKE
Sbjct  61   AATPFFLLFILGAGVLGLASILAGAIHVSLWRSESLAAAISSALIAWLFTLLAFGFACKE  120

Query  566  INV-GGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYG  414
            I + GG+R  RL+ LEAF IILA  QLLY+L LH+G   +R GP  ++  YG
Sbjct  121  IQLRGGYRNRRLKALEAFSIILAGMQLLYILSLHSGML-ARMGPRIKEPGYG  171



>ref|XP_002982433.1| hypothetical protein SELMODRAFT_421806 [Selaginella moellendorffii]
 gb|EFJ16678.1| hypothetical protein SELMODRAFT_421806 [Selaginella moellendorffii]
Length=142

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 67/135 (50%), Positives = 97/135 (72%), Gaps = 4/135 (3%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R LAAPLL +NL++Y+I+LG ASW L++ ++G       GGNGAT   + FS++A V+GI
Sbjct  8    RGLAAPLLGVNLVLYIILLGLASWALDEQLDGHL----AGGNGATSDLIRFSLIAGVVGI  63

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S  +G  HL+  R++S   AGS+A++A  +T LAFG+ACK+I+VG     RL+ LEAF 
Sbjct  64   ASVLVGLFHLKHRRSESHGGAGSAAVIALLLTLLAFGVACKQIHVGYIYSDRLKALEAFA  123

Query  512  IILAFTQLLYVLMLH  468
            I++A TQLLYVL+++
Sbjct  124  IVVAATQLLYVLLMY  138



>gb|EEC73942.1| hypothetical protein OsI_08811 [Oryza sativa Indica Group]
Length=185

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 103/146 (71%), Gaps = 2/146 (1%)
 Frame = -2

Query  887  ARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILA  708
            A T  R    PLL +NL+M+  VLG A W LNKFI+G+THH + GGN ++ + L FS++A
Sbjct  3    AGTACRRYIGPLLCVNLVMHAAVLGLAGWSLNKFIDGETHH-HLGGNTSSGYLLVFSLMA  61

Query  707  AVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRV  528
             V+G+ S   G  H+R WR ++LAAA S+ LV+WA+TAL+FGLACK I +G  RG RLR 
Sbjct  62   GVVGVCSVLPGLLHVRAWRGETLAAAASTGLVSWALTALSFGLACKHITLGN-RGRRLRT  120

Query  527  LEAFVIILAFTQLLYVLMLHAGWFSS  450
            LEAF+ IL  TQLLY+++LH G   S
Sbjct  121  LEAFIAILTLTQLLYLILLHTGSLGS  146



>gb|EYU43780.1| hypothetical protein MIMGU_mgv11b016991mg, partial [Erythranthe 
guttata]
Length=77

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/58 (84%), Positives = 53/58 (91%), Gaps = 0/58 (0%)
 Frame = -2

Query  581  LACKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYGMG  408
            LACKEINVGGWRGWRLR++EAFVIILAFTQLLYVLMLHAG  +  YGPGYRD+DYG G
Sbjct  1    LACKEINVGGWRGWRLRMVEAFVIILAFTQLLYVLMLHAGLVNRAYGPGYRDSDYGFG  58



>ref|XP_002966597.1| hypothetical protein SELMODRAFT_439591 [Selaginella moellendorffii]
 gb|EFJ32624.1| hypothetical protein SELMODRAFT_439591 [Selaginella moellendorffii]
Length=142

 Score =   105 bits (262),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 65/135 (48%), Positives = 96/135 (71%), Gaps = 4/135 (3%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R LAAPLL +NL++Y+I+LG ASW L++ ++G       GGN AT   + FS++A V+GI
Sbjct  8    RGLAAPLLGVNLVLYIILLGLASWALDEQLDGHL----AGGNQATSDLIRFSLIAGVVGI  63

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S  +G  HL+  R++S   AGS+A++A  +T LAFG+ACK+++VG     RL+ LEAF 
Sbjct  64   ASVLVGLFHLKHRRSESHGGAGSAAVIALLLTLLAFGVACKQVHVGYIYSDRLKALEAFA  123

Query  512  IILAFTQLLYVLMLH  468
            I++A TQLLYVL+++
Sbjct  124  IVVAATQLLYVLLMY  138



>dbj|BAD15935.1| putative ABA-induced plasma membrane protein [Oryza sativa Japonica 
Group]
 gb|EEE57748.1| hypothetical protein OsJ_08266 [Oryza sativa Japonica Group]
Length=185

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 102/146 (70%), Gaps = 2/146 (1%)
 Frame = -2

Query  887  ARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILA  708
            A T  R    PLL +NL+M+  VLG A W LNKFI+G+THH + GGN ++ + L FS++A
Sbjct  3    AGTACRRYIGPLLCVNLVMHAAVLGLAGWSLNKFIDGETHH-HLGGNTSSGYLLVFSLMA  61

Query  707  AVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRV  528
             V+G+ S      H+R WR ++LAAA S+ LV+WA+TAL+FGLACK I +G  RG RLR 
Sbjct  62   GVVGVCSVLPRLLHVRAWRGETLAAAASTGLVSWALTALSFGLACKHITLGN-RGRRLRT  120

Query  527  LEAFVIILAFTQLLYVLMLHAGWFSS  450
            LEAF+ IL  TQLLY+++LH G   S
Sbjct  121  LEAFIAILTLTQLLYLILLHTGSLGS  146



>ref|XP_004304141.1| PREDICTED: uncharacterized protein LOC101293215 [Fragaria vesca 
subsp. vesca]
Length=176

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 112/160 (70%), Gaps = 1/160 (1%)
 Frame = -2

Query  917  CIVYLRKLRMARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGAT  738
            C++ L  + + R V +   APLL +NL+++VIV+G A W L+K+I+G+ +HP+ GGN +T
Sbjct  15   CVLKLLSMALGR-VGKNFMAPLLAVNLVVHVIVVGLAGWSLDKYIDGEQNHPHLGGNTST  73

Query  737  MFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINV  558
             F L F+++A   G  S  +G  HLR W+++S AAA S A+++WA+ ALAFG+ CKE+ +
Sbjct  74   SFMLIFALIAGTFGACSVIIGMMHLRAWQHESHAAAASVAIISWALIALAFGVVCKEVIL  133

Query  557  GGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGP  438
            GG RG RL+ LE F+ I   +QLLY+++L+ G F  RYGP
Sbjct  134  GGHRGKRLQTLELFIAISLLSQLLYLVLLNTGMFKRRYGP  173



>ref|XP_006430801.1| hypothetical protein CICLE_v10013040mg [Citrus clementina]
 gb|ESR44041.1| hypothetical protein CICLE_v10013040mg [Citrus clementina]
Length=139

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 92/141 (65%), Gaps = 9/141 (6%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R L +PLL +N ++Y+I+LG A+W LNK+ING+ +HP+ GGN +T F L F++    +
Sbjct  6    VGRGLVSPLLAVNFVVYLIILGLAAWSLNKYINGEQNHPHLGGNTSTWFLLTFALTTGAI  65

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G+ S   G  HLR WR++SLAAA S         A+     CKEI +GG RG RL+ LEA
Sbjct  66   GVCSVTAGLMHLRAWRSESLAAASSL--------AILSCFVCKEIILGGHRGKRLQTLEA  117

Query  518  FVIILAFTQLLYVLMLHAGWF  456
            F +I   +QLLY+ ++HA WF
Sbjct  118  FAVISLLSQLLYLGLVHA-WF  137



>ref|XP_001767555.1| predicted protein [Physcomitrella patens]
 gb|EDQ67690.1| predicted protein [Physcomitrella patens]
Length=182

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 104/160 (65%), Gaps = 1/160 (1%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA  + R ++ PLL LN  MY+     A W LNK I+       + GN AT +FL   ++
Sbjct  1    MAFGIGRGISTPLLALNFCMYIATGAIAGWALNKNIDSSAGAGGYVGNAATFYFLPMVLI  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A+V+G+ S   G +HLR WR +SLAAA S+AL+AW +T LAFG+ACKEI++GG R  +L+
Sbjct  61   ASVVGLASTLAGIHHLREWRIESLAAAASAALIAWTLTLLAFGVACKEIHIGGPRSRKLK  120

Query  530  VLEAFVIILAFTQLLYVLMLHAGWF-SSRYGPGYRDNDYG  414
            V+EA +I+LA  +LLY+L LHAG     R+GP Y +   G
Sbjct  121  VVEALIIVLALFELLYLLSLHAGVLGGDRFGPAYSNTGAG  160



>gb|ABK23186.1| unknown [Picea sitchensis]
Length=189

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 106/170 (62%), Gaps = 17/170 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--------------  753
            M   V ++LA  LL LN  MYV+V   A W LNK ++  T++   G              
Sbjct  1    MTLGVVKSLAGFLLLLNFCMYVVVGAIAGWALNKALD-HTYYTGHGRALPVGFSPIYFPM  59

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT F + F+++AAV+G  S   G +HLRVW   SLA++ +S++ AWA+T LA GLAC
Sbjct  60   GNEATGFLVVFALIAAVVGAASCLSGLHHLRVWGAQSLASSAASSMTAWALTLLASGLAC  119

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            KEI++GG R  +LR+LE+F+IIL  T+L Y+L++HAG+F   Y   Y+D 
Sbjct  120  KEIHIGG-RNTKLRMLESFLIILCGTKLFYILLIHAGFFGGNY-CSYQDT  167



>ref|XP_006482275.1| PREDICTED: uncharacterized protein LOC102618346 isoform X2 [Citrus 
sinensis]
Length=139

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 91/141 (65%), Gaps = 9/141 (6%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
            V R L +PLL +N ++Y+I+LG A+W LNK+IN + +HP+ GGN +T F L F++    +
Sbjct  6    VGRGLVSPLLAVNFVVYLIILGLAAWSLNKYINDEQNHPHLGGNTSTWFLLTFALTTGAI  65

Query  698  GIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEA  519
            G+ S   G  HLR WR++SLAAA S         A+     CKEI +GG RG RL+ LEA
Sbjct  66   GVCSVTAGLMHLRAWRSESLAAASSL--------AILSCFVCKEIILGGHRGKRLQTLEA  117

Query  518  FVIILAFTQLLYVLMLHAGWF  456
            F +I   +QLLY+ ++HA WF
Sbjct  118  FAVISLLSQLLYLGLVHA-WF  137



>gb|ADE77639.1| unknown [Picea sitchensis]
Length=189

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 101/169 (60%), Gaps = 15/169 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA  V ++LA  LL LN  M+VIV   A W LN  +N       G+     F       G
Sbjct  1    MALGVVKSLAGFLLLLNFCMFVIVGAIAGWVLNNALNHTYSTGTGKAFSVGFSPVYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT F + FS++AAV+G  S   G +HLRVW   SLA + +S++ AWA+T LA GLACK
Sbjct  61   NEATGFMIIFSLIAAVVGAASCLSGLHHLRVWTAQSLAPSTASSMTAWALTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            EI++GG R  +L  LE+F+IIL  T+L Y+L++H G+F   Y   Y+D 
Sbjct  121  EIHIGG-RNAKLITLESFLIILCGTKLFYILLIHGGFFGGNY-CSYQDT  167



>ref|XP_006647844.1| PREDICTED: uncharacterized protein LOC102711043 [Oryza brachyantha]
Length=186

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = -2

Query  887  ARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILA  708
            A   +R    PLL +NL+M+  VLG A W LNKFI+G+TH  + GGN +T + L FS++A
Sbjct  3    AGAASRRYVGPLLCVNLVMHAAVLGLAGWSLNKFIDGETHR-HLGGNTSTGYLLVFSLMA  61

Query  707  AVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRV  528
             V+G+ S   G  H+R WR ++LAAA S+ L++WA+TAL+FGLA K I +G  RG RLR 
Sbjct  62   GVVGVCSVLPGFLHVRAWRGETLAAAASTGLISWALTALSFGLAFKHITLGN-RGRRLRT  120

Query  527  LEAFVIILAFTQLLYVLMLHAG  462
            LEAF+ IL  TQLLY+++LHAG
Sbjct  121  LEAFIAILTLTQLLYLILLHAG  142



>gb|EYU44649.1| hypothetical protein MIMGU_mgv1a0155012mg, partial [Erythranthe 
guttata]
Length=111

 Score = 99.0 bits (245),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = -2

Query  758  FGGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGL  579
             GGN +T+F L ++++A ++G+ S  +G  HLRVW N +LA+A +SA+++WAVTALAFGL
Sbjct  1    LGGNPSTVFLLVYALIAGIIGLCSVILGFAHLRVWNNTTLASAATSAIISWAVTALAFGL  60

Query  578  ACKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGY  432
             CK+I +GG RG RL+ LEAF+ I   +QLLY+L+LHAG FSSRYGP Y
Sbjct  61   VCKQITMGGHRGKRLQTLEAFIAISGVSQLLYLLLLHAGIFSSRYGPTY  109



>dbj|BAK06029.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 102/156 (65%), Gaps = 3/156 (2%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
             +R    PLL +NL+M+  VLG + W LNKFI+ +TH  + GGN AT + L FS++A V+
Sbjct  6    ASRRYIGPLLCINLVMHAAVLGISGWSLNKFIDRETHR-HLGGNTATGYLLVFSLMAGVV  64

Query  698  GIVSKFMGGNHLRV-WRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            G  S      H+R  W ++SLAAA S+ LV+WA+TALAFGLACK I +G  RG RLR LE
Sbjct  65   GACSVLPALLHVRAPWHSESLAAAASTGLVSWALTALAFGLACKHITLGN-RGRRLRTLE  123

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYG  414
            AF+ I   TQL Y+L+LHAG  S  +G G    + G
Sbjct  124  AFITISTLTQLFYLLLLHAGALSGVFGVGQACGNQG  159



>dbj|BAJ89281.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=188

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 78/156 (50%), Positives = 101/156 (65%), Gaps = 3/156 (2%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVL  699
             +R    PLL +NL+M+  VLG + W LNKFI+ +TH  + GGN AT + L FS++A V+
Sbjct  6    ASRRYIGPLLCINLVMHAAVLGISGWSLNKFIDRETHR-HLGGNTATGYLLVFSLMAGVV  64

Query  698  GIVSKFMGGNHLRV-WRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            G  S      H+R  W ++SLAAA S+ LV+WA+TALAFGLACK I +G  RG RLR LE
Sbjct  65   GACSVLPALLHVRAPWHSESLAAAASTGLVSWALTALAFGLACKHITLGN-RGRRLRTLE  123

Query  521  AFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYG  414
            AF+ I   TQL Y+L+LHAG  S   G G    + G
Sbjct  124  AFITISTLTQLFYLLLLHAGALSGVLGVGQACGNQG  159



>gb|KHG10022.1| Major envelope [Gossypium arboreum]
Length=156

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/156 (46%), Positives = 90/156 (58%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            M  T  + +AA LLFLN  MYVIVLG  +W +N+ I+ G    P F             G
Sbjct  1    MVDTQMKPVAALLLFLNFCMYVIVLGIGAWAMNRAIDYGFIIGPGFKLPAHFAPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G+ S   G NH+R W   SL +A S A VAW  T LA G ACK
Sbjct  61   NAATGFFVTFAMLAGVVGVASAIAGLNHIRSWNASSLPSAASIAGVAWTFTLLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI +   R   LR +EAF+IIL  TQL+Y+  +H G
Sbjct  121  EIEL-EIRNAHLRTMEAFLIILTVTQLVYIAAIHGG  155



>ref|XP_002519754.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42727.1| conserved hypothetical protein [Ricinus communis]
Length=162

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA +  + +A+ LL LN  MY IVLG  SW +N+ I+ G    P F             G
Sbjct  1    MANSQMKPVASLLLVLNFCMYAIVLGIGSWAMNRAIDHGFVIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL AA S A +AW++T LA G  CK
Sbjct  61   NAATGFFVTFALIAGVVGAASALAGLNHIRSWNADSLPAAASVATIAWSLTLLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IILA TQLLY+  +H
Sbjct  121  EIELHN-RNARLRTMEAFLIILAATQLLYIAAIH  153



>ref|XP_001783630.1| predicted protein [Physcomitrella patens]
 gb|EDQ51525.1| predicted protein [Physcomitrella patens]
Length=175

 Score = 98.2 bits (243),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 108/172 (63%), Gaps = 7/172 (4%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA  + RTL A +L +N  +++I    A W LN+ +        F GN  T  FL  +++
Sbjct  1    MAFGMGRTLPALVLLINFFLHLISACLAGWALNRNLGATIGIEFFAGNVVTPTFLPLALI  60

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGW-RGWRL  534
            A+++G+ S F G NHLRV+R+DSL++A S++L+AW ++ LA G+ACKEI+ GG  R  RL
Sbjct  61   ASMVGLASVFAGVNHLRVFRSDSLSSAASTSLIAWFLSLLAMGVACKEIHTGGSNRQKRL  120

Query  533  RVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN-----DYGMGMGAPA  393
            + LEAF IILAF ++LY+L+L AG+F +    GY  +       G+  G PA
Sbjct  121  KTLEAFTIILAFFEVLYLLLLQAGFFRTS-DDGYDQSRAANAKTGITYGTPA  171



>ref|XP_002978756.1| hypothetical protein SELMODRAFT_37585, partial [Selaginella moellendorffii]
 gb|EFJ20203.1| hypothetical protein SELMODRAFT_37585, partial [Selaginella moellendorffii]
Length=141

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 90/144 (63%), Gaps = 3/144 (2%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLGI  693
            R L  PL+FLN  +Y+I+LG A   LN     +   P  GGNG T+  + F+++A V+G+
Sbjct  1    RALLCPLVFLNFFLYMILLGIAGAKLNDSFE-RGFVP--GGNGITVTLVIFALIAGVVGV  57

Query  692  VSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLEAFV  513
             S   G +HL  WR DS AAAG++ L+AW +T L+FG+ACK I  G      +R LE+  
Sbjct  58   ASSLAGMHHLAAWRTDSFAAAGAAGLIAWLLTLLSFGIACKHIRRGRIYSKSVRALESIA  117

Query  512  IILAFTQLLYVLMLHAGWFSSRYG  441
            IILA TQL Y+LMLH G FS R G
Sbjct  118  IILAGTQLFYLLMLHTGIFSRRLG  141



>ref|XP_007212182.1| hypothetical protein PRUPE_ppa012671mg [Prunus persica]
 gb|EMJ13381.1| hypothetical protein PRUPE_ppa012671mg [Prunus persica]
Length=159

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 92/156 (59%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    +++A  LL LN  MYVIVLG   W +N+ I+ G    P F             G
Sbjct  1    MANQQLKSVAGLLLLLNFCMYVIVLGIGGWAMNRAIDHGFIIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL +A ++A VAW +T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVVGAASAISGINHIRSWTADSLPSAAAAATVAWTLTLLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI +   R  RLR LEAF+IIL+ TQLLY+  +H+ 
Sbjct  121  EIEL-RIRNARLRTLEAFLIILSATQLLYIAAIHSA  155



>gb|KHG04455.1| hypothetical protein F383_29509 [Gossypium arboreum]
Length=151

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/150 (46%), Positives = 88/150 (59%), Gaps = 14/150 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------GNGATMF  732
            + +A  LLFLN  MYVIVLG   W +NK I+ G    P F             GN AT F
Sbjct  2    QPVAGLLLFLNFCMYVIVLGIGGWAVNKAIDHGFIIGPGFELPAHFSPIYFPMGNAATGF  61

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ F++LA V+G+ S   G NH+R W   SL +A S A VAW +T LA G ACK+I++  
Sbjct  62   FVTFAMLAGVVGVASAIAGINHIRSWHASSLPSAASVAGVAWTLTLLAMGFACKQIDL-E  120

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
             R  RLR +EAF+IIL  TQL Y+  +H G
Sbjct  121  IRNARLRTMEAFIIILTVTQLFYIAAIHGG  150



>ref|XP_008225379.1| PREDICTED: uncharacterized protein LOC103325034 [Prunus mume]
Length=159

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 14/155 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    +++A  LL LN  MYVIVLG   W +N+ I+ G    P F             G
Sbjct  1    MANQQLKSVAGLLLLLNFCMYVIVLGIGGWAMNRAIDHGFIIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL +A ++A VAW +T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVVGAASAISGINHIRSWTADSLPSAAAAATVAWTLTLLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHA  465
            EI +   R  RLR LEAF+IIL+ TQLLY+  +H+
Sbjct  121  EIEL-RIRNARLRTLEAFLIILSATQLLYIAAIHS  154



>gb|EMT01942.1| hypothetical protein F775_09898 [Aegilops tauschii]
Length=196

 Score = 97.8 bits (242),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 104/165 (63%), Gaps = 13/165 (8%)
 Frame = -2

Query  875  ARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILAAVLG  696
            +R    PLL +NL+M+  VLG A W LNKFI+ +TH  + GGN AT + L FS++A V+G
Sbjct  7    SRRYIGPLLCINLVMHAAVLGIAGWSLNKFIDRETHR-HLGGNTATGYLLVFSLMAGVVG  65

Query  695  IVSKFMGGNHLRV-WRNDslaaagssalvawaVTALAFG----------LACKEINVGGW  549
              S      H+R  W ++SLAAA S+ LV+WA+TALAFG          LACK I +G  
Sbjct  66   ACSVLPALLHVRAPWHSESLAAAASTGLVSWALTALAFGFCPTLAPPVILACKHITLGN-  124

Query  548  RGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDNDYG  414
            RG RLR LEAF+ I   TQL Y+L+LHAG  SS +G G    ++G
Sbjct  125  RGRRLRTLEAFITISTLTQLFYLLLLHAGALSSVHGVGQACGNHG  169



>ref|XP_006449606.1| hypothetical protein CICLE_v10017020mg [Citrus clementina]
 gb|ESR62846.1| hypothetical protein CICLE_v10017020mg [Citrus clementina]
Length=159

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 94/156 (60%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            M  T  + +A+ LL LN  M+VIVLG   W +N+ I+ G    P+F             G
Sbjct  1    MVNTQMKPVASLLLVLNFCMFVIVLGIGGWAMNRAIDHGFVIGPSFELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+RVW  DS+ AA S+A +AW +T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVVGAASCIAGLNHVRVWTADSMPAAASAATIAWTLTLLAAGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H G
Sbjct  121  EIEL-HIRNARLRTMEAFLIILSVTQLLYIAAIHGG  155



>ref|XP_006467552.1| PREDICTED: uncharacterized protein LOC102611422 [Citrus sinensis]
 gb|KDO78019.1| hypothetical protein CISIN_1g031462mg [Citrus sinensis]
Length=159

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 94/156 (60%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFI-NGQTHHPNFG------------G  750
            M  T  + +A+ LL LN  M+VIVLG   W +N+ I +G    P+F             G
Sbjct  1    MVNTQMKPVASLLLVLNFCMFVIVLGIGGWAMNRAIEHGFVIGPSFELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+RVW  DS+ AA S+A +AW +T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVVGAASCIAGLNHVRVWTADSMPAAASAATIAWTLTLLAAGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H G
Sbjct  121  EIEL-HIRNARLRTMEAFLIILSVTQLLYIAAIHGG  155



>emb|CDP20500.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 94/161 (58%), Gaps = 14/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    R +A  LL LN  MYVI+LG   W LN+ I+       G     +F       G
Sbjct  1    MAVAAMRPVAGLLLALNFCMYVIILGIGGWSLNRAIDHGFIIGAGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT F + FS++A V+G+ S   G NHLR W  DSL AA S+A +AW++T LA GLACK
Sbjct  61   NAATGFLVLFSLIAGVVGVASVITGANHLRFWDIDSLPAAASAATIAWSLTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +   R  RLR +EAF+IIL+ TQLLY+  +HA     R
Sbjct  121  EIEL-RIRITRLRTMEAFLIILSATQLLYIAAIHAASTRRR  160



>ref|XP_002316743.1| AWPM-19-like membrane family protein [Populus trichocarpa]
 gb|EEE97355.1| AWPM-19-like membrane family protein [Populus trichocarpa]
Length=161

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 98/161 (61%), Gaps = 14/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LNLIMY+IVLG  SW +N+ I+ G    P +             G
Sbjct  1    MASEQMKPVALLLLVLNLIMYIIVLGIGSWAMNRAIDHGFIIGPGYDLPAHFSPIFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ FS++A V+G+ S  +G NH+R W +DS+ +A S+A +AWA+T LA G A K
Sbjct  61   NAATGFFVTFSLIAGVVGVASAIVGLNHIRSWHSDSMPSAVSTAAIAWALTLLAMGFASK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H    S R
Sbjct  121  EIEL-SIRNARLRTMEAFMIILSATQLLYIAAIHGASSSRR  160



>ref|XP_009390003.1| PREDICTED: uncharacterized protein LOC103976504 [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 89/150 (59%), Gaps = 14/150 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------GNGATMF  732
            + +A+ LLFLN  MYV+V     W +N  IN G    P               GN AT F
Sbjct  4    KPVASLLLFLNFCMYVVVTAIGGWAINVAINRGFIIGPELALPAHFAPVYFPIGNFATGF  63

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ F+++A  +G  S   G NH+R W  DS+  A SSA+ AW +T LA GLACKEI + G
Sbjct  64   FVVFALIAGTVGAASAIAGFNHIRFWNYDSMQPAASSAVTAWLLTLLAMGLACKEIVLEG  123

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
             R  RLR +EAF+IIL+ TQL+Y+L++H G
Sbjct  124  -RNARLRTMEAFLIILSVTQLVYILVIHGG  152



>ref|XP_003533836.1| PREDICTED: uncharacterized protein LOC100780911 [Glycine max]
 gb|KHN41436.1| hypothetical protein glysoja_031069 [Glycine soja]
Length=160

 Score = 95.1 bits (235),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+ G    P F             G
Sbjct  1    MATDQMKPIATLLLGLNFCMYVIVLGIGGWAMNRAIDHGFVIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G+ S   G NH+R W ++SL +A S A +AWA+T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVAGVGSIISGVNHVRSWTSESLPSAASVASIAWALTVLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  RL+ +EAF+IIL+ TQL Y+  +H
Sbjct  121  EIQLTG-RNARLKTMEAFMIILSATQLFYIAAIH  153



>ref|XP_008383523.1| PREDICTED: uncharacterized protein LOC103446220 [Malus domestica]
 ref|XP_008366011.1| PREDICTED: uncharacterized protein LOC103429656 [Malus domestica]
Length=159

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+ G    P+F             G
Sbjct  1    MAYQQLKPVAGLLLALNFCMYVIVLGIGGWAMNRAIDHGFVIGPSFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G+ S   G NHLR W  +SL +A ++  +AW +T LA G  CK
Sbjct  61   NAATGFFVTFALLAGVVGVASAISGINHLRSWTYESLPSAATAXTIAWTLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL+ TQLLY+ ++H
Sbjct  121  EIEL-RIRNSRLRTMEAFLIILSATQLLYLAVIH  153



>ref|XP_008443837.1| PREDICTED: uncharacterized protein LOC103487332 [Cucumis melo]
 gb|ABQ53641.1| AWPM19-like protein [Cucumis melo]
Length=159

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 95/161 (59%), Gaps = 15/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA T  +++A  LL LN  MYVI+LG   W +NK I+       G     +F       G
Sbjct  1    MASTQMKSIATLLLLLNFCMYVIILGIGGWAMNKAIDHGFIIGPGLRLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V G  S   G NH+R W  +SL AA S+A+ AW +T LA G ACK
Sbjct  61   NAATGFFVTFALLAGVFGAASAISGLNHIRSWSVESLGAASSAAVFAWTLTILAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +  +R  RL  +EAF IIL+ TQL+Y++ +H G  S+R
Sbjct  121  EIAL-DFRNARLVTMEAFFIILSATQLVYIMAIH-GVISTR  159



>ref|XP_004293658.1| PREDICTED: uncharacterized protein LOC101308262 [Fragaria vesca 
subsp. vesca]
Length=165

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 100/167 (60%), Gaps = 15/167 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNK-----FINGQTHH--PNFG------G  750
            MA    +++A  LL LN  MYVIVLG   W +N+     FI G  ++   +F       G
Sbjct  1    MAGQQLKSVAGLLLVLNFCMYVIVLGIGGWAMNRAIDHGFIIGADYNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ S   G NHLR W  DSL +A ++A +AW +T LA G A K
Sbjct  61   NAATGFFVTFALIAGVVGVASAISGLNHLRSWTYDSLPSAAAAATIAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYR  429
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H G  S+ +GP  R
Sbjct  121  EIEL-EIRNARLRTMEAFLIILSVTQLLYIAAIH-GSVSAIHGPVSR  165



>gb|ACU19489.1| unknown [Glycine max]
Length=160

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+ G    P F             G
Sbjct  1    MATDQMKPIATLLLGLNFCMYVIVLGIGGWAMNRAIDHGFVIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G+ S   G NH+R W ++SL  A S A +AWA+T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVAGVGSIISGVNHVRSWTSESLPFAASVASIAWALTVLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  RL+ +EAF+IIL+ TQL Y+  +H
Sbjct  121  EIQLTG-RNARLKTMEAFMIILSATQLFYIAAIH  153



>ref|XP_007025202.1| AWPM-19-like family protein [Theobroma cacao]
 gb|EOY27824.1| AWPM-19-like family protein [Theobroma cacao]
Length=156

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+ G    P+F             G
Sbjct  1    MANLQLKPVATLLLLLNFCMYVIVLGIGGWAMNRAIDHGFIIGPDFNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G+ S   G NH+R W  +SL +A S A VAW +T LA G ACK
Sbjct  61   NAATGFFVTFALLAGVVGVASAIAGLNHVRSWNANSLPSAASVAGVAWTLTLLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL  TQL Y+  +H
Sbjct  121  EIEL-EIRNARLRTMEAFLIILTATQLFYIAAIH  153



>ref|XP_009352163.1| PREDICTED: uncharacterized protein LOC103943576 [Pyrus x bretschneideri]
Length=159

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 92/154 (60%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN------GQTHHP-NFG------G  750
            MA    + +A  LL LNL MYV+VLG  SW +N+ I+         H P +F       G
Sbjct  1    MANQQLKPVAGLLLVLNLCMYVVVLGIGSWAINRAIDHGFIIGPDIHLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G NHLR W ++SL +A ++A +AW +T LA G  CK
Sbjct  61   NAATGFFVTFALLAGVVGAASAISGINHLRSWTSESLPSAATAATIAWTLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL  TQLLY+  +H
Sbjct  121  EIEL-RIRNSRLRTMEAFLIILTATQLLYLAAIH  153



>ref|XP_011005830.1| PREDICTED: uncharacterized protein LOC105111993 [Populus euphratica]
Length=162

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 90/148 (61%), Gaps = 14/148 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------GNGATMF  732
            + +A+ LL LN  MYVIVLG   W +N+ I+ G    P F             GN AT F
Sbjct  8    KLVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFIIGPGFNLPAHFSPIYFPMGNAATGF  67

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ F+++A V+G  S  +G NH+R W  DSL +A S+A V+W +T LA G ACKEI +  
Sbjct  68   FVMFALIAGVVGAASAIVGLNHIRTWTGDSLPSAASAAAVSWTLTLLAMGFACKEIEL-S  126

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLH  468
             R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  127  IRNARLRTMEAFLIILSATQLLYIAAIH  154



>ref|XP_011096475.1| PREDICTED: uncharacterized protein LOC105175661 [Sesamum indicum]
Length=161

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LLFLN  MY I+LG   W +N+ IN G    P F             G
Sbjct  1    MAGEQLKPVAGLLLFLNFCMYTIILGIGGWAMNRAINHGFVIGPGFELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ ++++A V+G+ S   G NH+R W  DSL AA S+A +AW +T LA G ACK
Sbjct  61   NAATGFFVVYALIAGVVGVASAISGLNHIRYWDVDSLPAAASAATIAWTLTLLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +  +R  RLR +EAF+IIL+ TQL Y+  +H
Sbjct  121  EIEL-HFRNARLRTMEAFIIILSATQLFYLAAIH  153



>gb|KDP21192.1| hypothetical protein JCGZ_21663 [Jatropha curcas]
Length=161

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA T  + +A+ LL LN  MYVI+LG   W +N+ I+       G     +F       G
Sbjct  1    MANTQLKPVASLLLVLNFCMYVIILGIGGWAMNRAIDHGFVIGPGLDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL AA S A +AW +T LA G  CK
Sbjct  61   NAATGFFVTFALIAGVVGAASAIAGVNHIRSWNADSLPAAASVAAIAWTLTLLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEL-QIRNARLRAMEAFLIILSATQLLYIAAIH  153



>ref|XP_006281194.1| hypothetical protein CARUB_v10027229mg, partial [Capsella rubella]
 gb|EOA14092.1| hypothetical protein CARUB_v10027229mg, partial [Capsella rubella]
Length=176

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 89/156 (57%), Gaps = 18/156 (12%)
 Frame = -2

Query  902  RKLRMARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTH  768
            +K +M     + +A+ LL LN  MY IVLG  +W +NK IN                  H
Sbjct  16   KKKKMVEHQMKPVASFLLVLNFCMYAIVLGIGAWSMNKAINHGFLIGADYSLPAHFSPIH  75

Query  767  HPNFGGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALA  588
             P   GN AT FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA
Sbjct  76   FPM--GNAATGFFVTFALIAGVAGAASVISGVSHLQSWTTTSLPAAVSAATIAWSLTLLA  133

Query  587  FGLACKEINVGGWRGWRLRVLEAFVIILAFTQLLYV  480
             G  CKEI + G R  RLR +EAF+IIL+ TQLLY+
Sbjct  134  MGFGCKEIEL-GMRNARLRTMEAFLIILSATQLLYI  168



>ref|XP_011015863.1| PREDICTED: uncharacterized protein LOC105119422 [Populus euphratica]
Length=161

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 96/161 (60%), Gaps = 14/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LNLIMY+IVLG   W +N+ I+ G    P +             G
Sbjct  1    MASEQMKPVALLLLVLNLIMYIIVLGIGGWAMNRAIDYGFIIGPGYDLPAHFSPIFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ FS++A V+G+ S  +G NH+R W  DS+ +A S+A +AWA+T LA G A K
Sbjct  61   NAATGFFVTFSLIAGVVGVASAIVGLNHIRSWHRDSMPSAASAAAIAWALTLLAMGFASK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H    S R
Sbjct  121  EIEL-SIRNARLRTMEAFIIILSATQLLYIAAIHGASSSGR  160



>ref|XP_008371555.1| PREDICTED: uncharacterized protein LOC103434952 [Malus domestica]
 ref|XP_008345930.1| PREDICTED: uncharacterized protein LOC103408886 [Malus domestica]
Length=159

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN------GQTHHP-NFG------G  750
            MA    + +A  LL LNL MYVIVLG  SW +N+ I+         H P +F       G
Sbjct  1    MANQQLKPVAGLLLVLNLCMYVIVLGIGSWAINRAIDHGFIIGPDIHLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F +LA V+G  S   G NHLR W ++SL +A ++A +AW +T LA G  CK
Sbjct  61   NAATGFFVTFXLLAGVVGAASAISGINHLRSWTSESLPSAATAATIAWTLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +E F+IIL  TQLLY+ ++H
Sbjct  121  EIEL-RIRNSRLRTMEXFLIILTATQLLYLAVIH  153



>gb|ABK26630.1| unknown [Picea sitchensis]
Length=189

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 71/170 (42%), Positives = 100/170 (59%), Gaps = 17/170 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--------------  753
            M+  V ++L   LL LN  M+VIV   A W LN  ++  T+    G              
Sbjct  1    MSLGVVKSLVGFLLLLNFCMFVIVAAIAGWALNNALD-HTYSTGSGKPFPVGFSPVYFPM  59

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT F + FS++AAV+G  S   G +HLRVW   SLA++ +S++ AWA+T LA GLA 
Sbjct  60   GNEATGFMVIFSLIAAVVGAASCLSGLHHLRVWTAHSLASSTASSMTAWALTLLAMGLAY  119

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            KEI++GG R  +L  LE+F+IIL  T+L Y+L++H G+F   Y   Y+D 
Sbjct  120  KEIHMGG-RNAKLITLESFLIILCVTKLFYILLIHGGFFGGNY-CSYQDT  167



>ref|XP_007138501.1| hypothetical protein PHAVU_009G214500g [Phaseolus vulgaris]
 gb|ESW10495.1| hypothetical protein PHAVU_009G214500g [Phaseolus vulgaris]
Length=160

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 93/161 (58%), Gaps = 14/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+       G     +F       G
Sbjct  1    MANDQLKPIATLLLGLNFCMYVIVLGIGGWAMNRAIDQGFEIGPGLDLPAHFSPISFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G+ S   G NH+R W ++SL +A S A +AWA+T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVAGVGSLISGVNHVRSWTSESLPSAASVASIAWALTVLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +   R  RL+ +EAF+IIL+ TQL Y+  +H    +SR
Sbjct  121  EIQL-NVRNSRLKTMEAFMIILSATQLFYIAAIHGAAANSR  160



>ref|NP_001237651.1| uncharacterized protein LOC100527291 [Glycine max]
 gb|ACU16362.1| unknown [Glycine max]
 gb|KHN35592.1| hypothetical protein glysoja_042207 [Glycine soja]
Length=160

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+ G    P F             G
Sbjct  1    MANDQMKPIATLLLGLNFCMYVIVLGIGGWAMNRAIDHGFVIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G+ S   G NH+R W ++SL +A S A +AWA+T LA G ACK
Sbjct  61   NAATGFFVTFALIAGVAGVGSIISGVNHVRSWTSESLPSAASVASIAWALTVLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RL+ +EAF+IIL+ TQL Y+  +H
Sbjct  121  EIEL-NVRNARLKTMEAFMIILSATQLFYIAAIH  153



>ref|XP_010924094.1| PREDICTED: uncharacterized protein LOC105047019 [Elaeis guineensis]
Length=159

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 93/154 (60%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MY IV   + W L+  I+ G T  P F             G
Sbjct  1    MAGDGVKPIASLLLVLNFCMYAIVATISGWALDVAIHRGFTIGPGFEVPAHFSPIFFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            NGAT F + F+++A V+G  +   G +H+R W  DSL +A SS + AWA+T LA GLACK
Sbjct  61   NGATGFMVIFALVAGVVGAATAIAGVDHIRSWNYDSLPSAVSSGIAAWALTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  RLR +EAF+IIL+ TQL+Y+L++H
Sbjct  121  EIELEG-RNARLRTIEAFLIILSATQLIYILVIH  153



>ref|XP_011045325.1| PREDICTED: uncharacterized protein LOC105140263 [Populus euphratica]
Length=161

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 71/161 (44%), Positives = 96/161 (60%), Gaps = 14/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LNLIMY+IVLG   W +N+ I+ G    P +             G
Sbjct  1    MASEQMKPVALLLLVLNLIMYIIVLGIGGWAMNRAIDYGFIIGPGYDLPAHFSPIFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ FS++A V+G+ S  +G NH+R W  DS+ +A S+A +AWA+T LA G A K
Sbjct  61   NAATGFFVTFSLIAGVVGVASAIVGLNHIRSWHRDSMPSAASAAAIAWALTLLAMGFASK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H    S R
Sbjct  121  EIEL-SIRNARLRTMEAFMIILSATQLLYIAAIHGASSSGR  160



>gb|EPS68447.1| hypothetical protein M569_06323, partial [Genlisea aurea]
Length=158

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 14/148 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------GNGATMF  732
            + LA  LL +N++++ +VLG   W +NK I+       G T   NF       GN AT F
Sbjct  5    KPLAELLLIVNVVLFAVVLGIGGWAVNKAIDDGFIIGRGFTSPTNFSPIYFPFGNAATGF  64

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ FS++A V+GI S F G +H+R W  DSL AA S+A +++ +T LA G A KEI +  
Sbjct  65   FVTFSLIAGVVGIASAFSGADHVRYWDADSLPAANSAASISFGLTLLAMGFAWKEIGLYS  124

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLH  468
             R  RL  LE  +I+LA TQLLY+  +H
Sbjct  125  -RNRRLETLEGLIIVLAATQLLYIAAIH  151



>ref|XP_010052117.1| PREDICTED: uncharacterized protein LOC104440830 [Eucalyptus grandis]
 gb|KCW75978.1| hypothetical protein EUGRSUZ_D00344 [Eucalyptus grandis]
Length=157

 Score = 91.7 bits (226),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 90/150 (60%), Gaps = 14/150 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------GNGATMF  732
            + +A+ LL LN  M+ IVLG + W +NK I+ G    P F             GN AT F
Sbjct  6    KPVASVLLLLNFCMFAIVLGISGWAMNKAIDHGFIIGPGFDLPAHFSPIYFPMGNAATGF  65

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ FS++A V+G+ S   G NH+R W + SL +A S+A +AW +T LA G A KEI +  
Sbjct  66   FVTFSLIAGVVGVASVLAGVNHVRSWNSYSLPSAASTAAIAWTLTLLAMGFASKEIEL-R  124

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
             R  RLR +EAF+IIL+ TQL+Y+  +H G
Sbjct  125  IRNSRLRTMEAFMIILSVTQLIYIAAIHGG  154



>ref|XP_010926217.1| PREDICTED: uncharacterized protein LOC105048572 [Elaeis guineensis]
Length=165

 Score = 91.7 bits (226),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 89/151 (59%), Gaps = 14/151 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + + + L+FLN  MYVIV     W +N  I+ G    P  G            G
Sbjct  1    MAIEQLKPIVSLLVFLNFCMYVIVAAIGGWAINIAIDRGFIIGPELGLPAHFPPIFFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL  A SS ++AWA+T +A GLACK
Sbjct  61   NAATGFFVMFALIAGVVGAASAIAGSNHIRFWTYDSLQPAASSGIIAWALTLIAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVL  477
            EIN+ G R  RL+ +EAF IIL+ TQL+YVL
Sbjct  121  EINLEG-RNTRLKTMEAFWIILSATQLVYVL  150



>ref|XP_002988427.1| hypothetical protein SELMODRAFT_447317 [Selaginella moellendorffii]
 gb|EFJ10517.1| hypothetical protein SELMODRAFT_447317 [Selaginella moellendorffii]
Length=191

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 6/144 (4%)
 Frame = -2

Query  899  KLRMARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAF  720
            +LR   T+ + L  PLL LN  +Y ++LGFA W  +K ++G+      GGN  T   + +
Sbjct  6    QLRHQMTL-KPLLRPLLALNFALYAVILGFAGWAYDKQMSGR-----LGGNKVTSDLITY  59

Query  719  SILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGW  540
            ++LA V+GI S   G  +LR W ++S A+A +++++A  VT LA G+A K I+VGG    
Sbjct  60   TLLAGVVGIASVLAGLYYLRRWNSESRASAMATSILAVPVTILALGVASKYIHVGGLHNK  119

Query  539  RLRVLEAFVIILAFTQLLYVLMLH  468
            +L  L A+ II A TQLLY L++H
Sbjct  120  KLTTLAAYAIISAITQLLYTLLVH  143



>gb|EPS60342.1| hypothetical protein M569_14462, partial [Genlisea aurea]
Length=150

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 88/149 (59%), Gaps = 16/149 (11%)
 Frame = -2

Query  854  LLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------GNGATMFFLAFSI  714
            LLFLN  M+ I+LG   W +N  I+ G    P F             GN AT FF+ F++
Sbjct  4    LLFLNFTMFTIILGIGGWSINSAIDHGFIIGPEFPLPAKFTPLYFPMGNAATGFFVVFAL  63

Query  713  LAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRL  534
            +AA +G+ S   G NHLR W + SLA A S+A  AW +T LA G ACKEI++   R  RL
Sbjct  64   IAAAIGVASAVAGVNHLRHWEDYSLAPAASAATFAWTLTLLALGFACKEIDL-RIRNARL  122

Query  533  RVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            R +EAF+IIL+ TQLLY+  +H    SSR
Sbjct  123  RTMEAFIIILSATQLLYIAAIHGA--SSR  149



>ref|XP_004233016.1| PREDICTED: uncharacterized protein LOC101265094 [Solanum lycopersicum]
Length=159

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 95/161 (59%), Gaps = 16/161 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFI-NGQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYV+VLG   W +N  I NG    P               G
Sbjct  1    MASEQMKPVASLLLVLNFCMYVVVLGIGGWAMNFAIDNGFVIGPGMNLPAHFSPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ S   G NH+R W  DSL +A S+A +AW++T LA G A K
Sbjct  61   NAATGFFVVFALIAGVVGVASVLSGLNHIRHWNIDSLPSAASAATIAWSLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +  +R  +L+ +EAF+IIL+FTQL+Y+  +H    SSR
Sbjct  121  EIEL-NYRNSKLKTMEAFMIILSFTQLVYIAAIHGA--SSR  158



>ref|XP_007033303.1| AWPM-19-like family protein, putative [Theobroma cacao]
 gb|EOY04229.1| AWPM-19-like family protein, putative [Theobroma cacao]
Length=114

 Score = 89.7 bits (221),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 74/100 (74%), Gaps = 0/100 (0%)
 Frame = -2

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
             L F+++A V+G  S   G  H   WR+DSLAAA S A+++WAVTALAFGL CKEI +GG
Sbjct  1    MLIFALIAGVIGACSVLDGVVHYLSWRSDSLAAAASLAIISWAVTALAFGLVCKEIILGG  60

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGY  432
             RG RL+ LEAF+ I   +QLLYV++LH G F+SRYGPGY
Sbjct  61   HRGKRLQTLEAFITISLASQLLYVVLLHVGMFNSRYGPGY  100



>emb|CDX87708.1| BnaC02g32410D [Brassica napus]
Length=157

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MY IVLG  +W +NK I+ G     +F             G
Sbjct  1    MAEQQMKPVASLLLLLNFCMYAIVLGIGAWSMNKAISHGFPIGADFSLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G  S   G +HL+ W   S  AA S+A++AW++T LA G  CK
Sbjct  61   NAATGFFVMFALIAGVAGAASVISGVSHLQSWTTASFPAAVSAAMIAWSLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +G  R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIELG-MRNARLRTMEAFLIILSATQLLYIAAIH  153



>ref|XP_010538226.1| PREDICTED: uncharacterized protein LOC104812652 [Tarenaya hassleriana]
Length=157

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    +++A+ LL LN  MYVIVLG   W +N+ I+ G    P+              G
Sbjct  1    MAGDQTKSVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFAIGPDLNLPARFSPIFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ FS+LA VLG  S   G NH+R W  +SL AA  +A +AWA+T LA G A K
Sbjct  61   NAATGFFVTFSLLAGVLGAASAISGLNHIRSWNQESLPAAAMAATIAWALTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI     R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIAF-HVRNARLRTMEAFLIILSVTQLLYIAAVH  153



>ref|XP_010916116.1| PREDICTED: uncharacterized protein LOC105041024 [Elaeis guineensis]
Length=165

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 91/156 (58%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLN-----KFINGQT------HHPNF--GG  750
            MA  + R   + L+FLN  MY IV     W ++      FI G          P F   G
Sbjct  1    MANEMLRPFVSLLVFLNFCMYAIVASIGGWAIHIAIDRGFIIGPELVLPAHFAPIFFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL  A SS ++AWA+T +  GLACK
Sbjct  61   NAATGFFVMFALIAGVVGAASALAGLNHIRFWNYDSLQPAASSGIIAWALTLIPMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EIN+GG R  RLR +EAF+IIL+ TQL+YVL + A 
Sbjct  121  EINLGG-RNARLRTMEAFLIILSATQLVYVLAIRAA  155



>ref|XP_011085292.1| PREDICTED: uncharacterized protein LOC105167323 [Sesamum indicum]
Length=160

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LLFLN  MY IVLG   W +N+ I+       G     +F       G
Sbjct  1    MAGEQLKPVAGLLLFLNFCMYAIVLGIGGWAMNRAIDHGFIIGPGLDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G N+LR W  DS++AA S+  +AW +T LA G ACK
Sbjct  61   NAATGFFVLFALIAGVVGAASAISGVNNLRFWDEDSMSAAASAGTIAWTLTLLAMGFACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI++   R  RLR +EAF+IIL+ TQ  Y+  +H
Sbjct  121  EIDL-YVRNVRLRTMEAFIIILSATQFFYIAAIH  153



>ref|XP_002865183.1| hypothetical protein ARALYDRAFT_330772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41442.1| hypothetical protein ARALYDRAFT_330772 [Arabidopsis lyrata subsp. 
lyrata]
Length=157

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 87/152 (57%), Gaps = 18/152 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNF  756
            M     + +A+ LL LN  MY IVLG  +W +NK IN                  H P  
Sbjct  1    MVEQQMKPVASFLLVLNFCMYAIVLGIGAWSMNKAINHGFLIGADYSLPAHFSPIHFPM-  59

Query  755  GGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLA  576
             GN AT FF+ F+++A V G  S   G +HL+ W + SL AA S+A +AW++T LA G  
Sbjct  60   -GNAATGFFIMFALIAGVAGAASVISGVSHLQSWTSTSLPAAVSAATIAWSLTLLAMGFG  118

Query  575  CKEINVGGWRGWRLRVLEAFVIILAFTQLLYV  480
            CKEI + G R  RLR +EAF+IIL+ TQLLY+
Sbjct  119  CKEIEL-GMRNARLRTMEAFLIILSATQLLYI  149



>gb|ABK25437.1| unknown [Picea sitchensis]
Length=189

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 104/170 (61%), Gaps = 17/170 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--------------  753
            MA  + ++LA  LL LNL M+VIV   A W LN  ++  T+    G              
Sbjct  1    MALGMVKSLAGFLLLLNLCMFVIVGAIAGWALNNALD-HTYSTGSGKAFPVGFSPVYFPM  59

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT F + FS++AAV+G  S   G +HLRVW   SLA++ +S++ AWA+T LA GLAC
Sbjct  60   GNEATGFMVIFSLIAAVVGAASCLSGLHHLRVWTAHSLASSTASSMTAWALTLLAMGLAC  119

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            KEI++GG R  +L  LE+F+IIL  ++L Y+L++HAG+F   Y   Y+D 
Sbjct  120  KEIHMGG-RNTKLITLESFLIILCVSKLFYILLIHAGFFGGNY-CSYQDT  167



>ref|XP_010494829.1| PREDICTED: uncharacterized protein LOC104771910 [Camelina sativa]
Length=157

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 88/156 (56%), Gaps = 18/156 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNF  756
            M     + +A+ LL LN  MY IVLG  +W +NK IN                  H P  
Sbjct  1    MVEQKMKPVASFLLVLNFCMYAIVLGIGAWSMNKAINHGFVIGADYSLPAHFSPIHFPM-  59

Query  755  GGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLA  576
             GN AT FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA G  
Sbjct  60   -GNAATGFFVTFALIAGVAGAASVISGVSHLQSWTTTSLPAAVSAATIAWSLTLLAMGFG  118

Query  575  CKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            CKEI + G R  RLR +EAF+IIL+ TQLLY+  ++
Sbjct  119  CKEIEL-GMRNARLRTMEAFLIILSATQLLYIAAIY  153



>ref|XP_010549440.1| PREDICTED: uncharacterized protein LOC104820623 [Tarenaya hassleriana]
Length=157

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 93/155 (60%), Gaps = 14/155 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    ++ AA LL LN  MYVIVLG   W +N+ I+ G    P+              G
Sbjct  1    MAGEETKSAAALLLVLNFCMYVIVLGIGGWAINRAIDHGFVIGPDLNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N +T FF+ FS+LA V+G  S   G NH+R W  +SL AA S+A +AW +T LA G A K
Sbjct  61   NASTGFFVTFSLLAGVVGAASAISGLNHIRSWSVESLPAAASAATIAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHA  465
            EI +   R  RLR +EAF+IIL+ TQLLY++++H+
Sbjct  121  EIAL-HVRNARLRTMEAFMIILSVTQLLYIVLVHS  154



>gb|ABR18054.1| unknown [Picea sitchensis]
Length=189

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 103/170 (61%), Gaps = 17/170 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--------------  753
            MA  V ++LA  LL LNL M+VIV   A W LN  ++  T+    G              
Sbjct  1    MALGVVKSLAGFLLLLNLCMFVIVGAIAGWALNNALD-HTYSTGSGKAFPVGFSPVYFPM  59

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT F + FS++AAV+G  S   G +HLR W   SLA++ +S++ AWA+T LA GLAC
Sbjct  60   GNEATGFMVIFSLIAAVVGAASCLSGLHHLRAWTAHSLASSTASSMTAWALTLLAMGLAC  119

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            KEI++GG R  +L  LE+F+IIL  T+L Y+L++HAG+F   Y   Y+D 
Sbjct  120  KEIHLGG-RNTKLITLESFLIILFVTKLFYILLIHAGFFGGNY-CSYQDT  167



>gb|ABK27087.1| unknown [Picea sitchensis]
Length=189

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 102/172 (59%), Gaps = 21/172 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--------------  753
            MA  V ++LA  LL LNL M+VIV   A W LN   N   H  + G              
Sbjct  1    MALGVVKSLAGFLLLLNLCMFVIVGAIAGWALN---NALDHTYSIGPGKALPVGFSPVYF  57

Query  752  --GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGL  579
              GN AT F + FS++AAV+G  S   G +HLRVW   SLA++ +S++ AWA+T LA GL
Sbjct  58   PMGNEATGFMVMFSLIAAVVGAASCLSGLHHLRVWTAHSLASSTASSMTAWALTLLAMGL  117

Query  578  ACKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            ACKEI++GG R   L  LE+F+IIL  ++L Y+L++HAG+F   Y   Y+D 
Sbjct  118  ACKEIHMGG-RNTMLITLESFLIILCVSKLFYILLIHAGFFGGNY-CSYQDT  167



>gb|KHN48046.1| hypothetical protein glysoja_015516 [Glycine soja]
Length=156

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 16/153 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG------------GN  747
            MA    + +A  LL LN  MY IVLG   W +N+ I+   H P               GN
Sbjct  1    MANEQMKPIATLLLGLNFCMYAIVLGIGGWAMNRAID---HGPELKLPAHFSPLFFPMGN  57

Query  746  GATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKE  567
             +T FF+ F++LA V+G  S   G NH+R W ++SL +A S A +AW +T LA G A KE
Sbjct  58   ASTGFFVTFALLAGVVGAASAISGINHIRSWTSESLPSAASVATMAWTLTLLAMGFAWKE  117

Query  566  INVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            I +   R  RL+ +EAF+IIL+ TQL Y++ +H
Sbjct  118  IEI-HIRNARLKTMEAFIIILSATQLFYIVAIH  149



>ref|XP_010441574.1| PREDICTED: uncharacterized protein LOC104724727 [Camelina sativa]
 ref|XP_010441575.1| PREDICTED: uncharacterized protein LOC104724728 [Camelina sativa]
Length=157

 Score = 89.0 bits (219),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 86/152 (57%), Gaps = 18/152 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNF  756
            M     + +A+ LL LN  MY IVLG  +W +NK IN                  H P  
Sbjct  1    MVEQKMKPVASFLLVLNFCMYAIVLGIGAWSMNKAINHGFLIGADYSLPAHFSPIHFPM-  59

Query  755  GGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLA  576
             GN AT FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA G  
Sbjct  60   -GNAATGFFVTFALIAGVSGAASVISGVSHLQSWTTTSLPAAVSAATIAWSLTLLAMGFG  118

Query  575  CKEINVGGWRGWRLRVLEAFVIILAFTQLLYV  480
            CKEI + G R  RLR +EAF++IL+ TQLLY+
Sbjct  119  CKEIEL-GMRNARLRTMEAFLVILSATQLLYI  149



>gb|KFK31462.1| hypothetical protein AALP_AA6G114800 [Arabis alpina]
Length=158

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 18/150 (12%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNFGGNGAT  738
            + +A+ LL LN  MY IVLG  +W +NK IN                  + P   GN AT
Sbjct  8    KPVASLLLVLNFCMYAIVLGIGAWSMNKAINHGFLIGADFSLPAHFSPIYFPM--GNAAT  65

Query  737  MFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINV  558
             FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA G  CKEI +
Sbjct  66   GFFVMFALIAGVAGAASVISGASHLQSWTTTSLPAAVSAATIAWSLTLLAMGFGCKEIEL  125

Query  557  GGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
             G R  RLR +EAF+IIL+ TQLLY+  ++
Sbjct  126  -GMRNARLRTMEAFLIILSVTQLLYIAAIY  154



>ref|NP_199465.4| AWPM-19-like family protein [Arabidopsis thaliana]
 gb|AED95395.1| AWPM-19-like family protein [Arabidopsis thaliana]
Length=157

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 85/146 (58%), Gaps = 18/146 (12%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNFGGNGAT  738
            + +A+ LL LN  MY IVLG  +W +NK IN                  H P   GN AT
Sbjct  7    KPVASFLLVLNFCMYAIVLGIGAWSMNKAINHGFLIGADYSLPAHFSPIHFPM--GNAAT  64

Query  737  MFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINV  558
             FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA G  CKEI +
Sbjct  65   GFFIMFALIAGVAGAASVISGISHLQSWTTTSLPAAVSAATIAWSLTLLAMGFGCKEIEL  124

Query  557  GGWRGWRLRVLEAFVIILAFTQLLYV  480
             G R  RLR +EAF+IIL+ TQLLY+
Sbjct  125  -GMRNARLRTMEAFLIILSATQLLYI  149



>ref|XP_002272619.1| PREDICTED: uncharacterized protein LOC100253821 [Vitis vinifera]
 ref|XP_010655617.1| PREDICTED: uncharacterized protein LOC100253821 [Vitis vinifera]
 emb|CBI30807.3| unnamed protein product [Vitis vinifera]
Length=159

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 98/158 (62%), Gaps = 16/158 (10%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNF------------GGNGATMF  732
            ++ A+ LL LN  MY +VLG   W +N+ I+ G    P+F             G+ AT F
Sbjct  5    KSAASLLLVLNFCMYGVVLGIGGWAMNRAIDHGFIIGPDFYLPAHFSPIYFPMGDAATGF  64

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ F+++A V+G  S  +G NH+R W  DS+ AA S+A +AW++T LA G A KEI++ G
Sbjct  65   FVLFALIAGVVGAASAIVGLNHVRSWHLDSMPAAVSAATIAWSLTLLAMGFAWKEISL-G  123

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGP  438
            +R  +LR +EAF+IIL+ TQL+Y++ +H    ++R  P
Sbjct  124  FRNAKLRTMEAFIIILSATQLMYIISIHGS--TARRNP  159



>ref|XP_009128866.1| PREDICTED: uncharacterized protein LOC103853714 [Brassica rapa]
Length=157

 Score = 88.6 bits (218),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MY IVLG  +W +NK I+ G     +F             G
Sbjct  1    MAEQQMKPVASLLLLLNFCMYAIVLGIGAWSMNKAISHGFPIGADFSLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA G  CK
Sbjct  61   NAATGFFVMFALIAGVAGAASVISGFSHLQSWTTASLPAAVSAATIAWSLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  RLR +EAF+IIL+ TQLLY+  ++
Sbjct  121  EIEL-GMRNARLRTMEAFLIILSATQLLYIAAIY  153



>gb|ABK23412.1| unknown [Picea sitchensis]
Length=184

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 94/153 (61%), Gaps = 21/153 (14%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNG---------------  744
            V ++LA  LL LN  MYVIV   A W LNK I+   HH  F G G               
Sbjct  5    VVKSLAGFLLLLNFCMYVIVAAIAGWALNKAID---HHNYFNGPGGALPGRFSPVYFPIG  61

Query  743  --ATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
              AT F + F+++AAV+G  S   G +HLRVW   SLA++ SSA+ +WA+T LA GLACK
Sbjct  62   NEATGFMVIFALIAAVVGAGSCLSGLHHLRVWTAQSLASSASSAMTSWALTLLAMGLACK  121

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLML  471
            EI++GG R  +L  LE+F+IIL+ T+L Y+L++
Sbjct  122  EIHIGG-RNSKLITLESFLIILSGTKLFYILVI  153



>ref|XP_009360815.1| PREDICTED: uncharacterized protein LOC103951228 [Pyrus x bretschneideri]
Length=159

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+ G    P F             G
Sbjct  1    MANQQLKPVAGLLLALNFCMYVIVLGIGGWAMNRAIDHGFVIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G+ S   G NH R W  +SL +A ++A +AW +T LA    CK
Sbjct  61   NAATGFFVTFALLAGVVGVASAISGINHFRSWTYESLPSAATAATIAWTLTLLAMSFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL+ TQLLY+ ++H
Sbjct  121  EIEL-RIRNSRLRTMEAFLIILSVTQLLYLAVIH  153



>ref|XP_002979858.1| hypothetical protein SELMODRAFT_444324 [Selaginella moellendorffii]
 gb|EFJ19260.1| hypothetical protein SELMODRAFT_444324 [Selaginella moellendorffii]
Length=195

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 88/144 (61%), Gaps = 6/144 (4%)
 Frame = -2

Query  899  KLRMARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAF  720
            +LR   T+ + L  PLL LN  +Y ++LGFA W  +K ++G+      GGN  T   + +
Sbjct  6    QLRHQMTL-KPLLRPLLALNFALYAVILGFAGWAYDKQMSGR-----LGGNKVTPDLITY  59

Query  719  SILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGW  540
            ++L+ V+GI S   G  +LR W ++S A+A +++++A  VT LA G+A K I+ GG    
Sbjct  60   TLLSGVVGIASVLAGLYYLRKWNSESRASAMATSILALPVTILALGVASKYIHAGGLHNK  119

Query  539  RLRVLEAFVIILAFTQLLYVLMLH  468
            +L  L A+ II A TQLLY L++H
Sbjct  120  KLTTLAAYAIISAITQLLYTLLVH  143



>ref|XP_010529132.1| PREDICTED: uncharacterized protein LOC104806110 [Tarenaya hassleriana]
Length=157

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 87/156 (56%), Gaps = 18/156 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNF  756
            MA    R +A+ LL LN  MY IVLG   W +NK IN                  H P  
Sbjct  1    MADQQMRPVASFLLLLNFCMYAIVLGIGGWAINKAINHGFVIGADFSLPAHFSPIHFPM-  59

Query  755  GGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLA  576
             GN AT FF+ F+++A V G  S   G NHLR W   SL AA ++A++AW++T LA G  
Sbjct  60   -GNEATGFFVTFALIAGVAGAASVISGVNHLRSWTPASLPAASTAAIIAWSLTLLAMGFG  118

Query  575  CKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            CKEI +   R  RLR +EAF+IIL+ TQL Y+  ++
Sbjct  119  CKEIEL-EIRNARLRTMEAFLIILSATQLAYIAAIY  153



>ref|XP_010481448.1| PREDICTED: uncharacterized protein LOC104760250 [Camelina sativa]
Length=157

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 86/146 (59%), Gaps = 18/146 (12%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNFGGNGAT  738
            + +A+ LL LN  MY IVLG  +W +NK I                   H P   GN AT
Sbjct  7    KPVASFLLVLNFCMYAIVLGIGAWSMNKAIKHGFLIGADYSLPAHFSPIHFPM--GNAAT  64

Query  737  MFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINV  558
             FF+ F+++A V G  S   G +HL+ W + SL+AA S+A +AW++T LA G  CKEI +
Sbjct  65   GFFVTFALIAGVAGAASVISGVSHLQSWTSTSLSAAVSAATIAWSLTLLAMGFGCKEIEL  124

Query  557  GGWRGWRLRVLEAFVIILAFTQLLYV  480
             G R  RLR +EAF+IIL+ TQLLY+
Sbjct  125  -GMRNARLRTMEAFLIILSATQLLYI  149



>ref|XP_006398347.1| hypothetical protein EUTSA_v10001059mg [Eutrema salsugineum]
 gb|ESQ39800.1| hypothetical protein EUTSA_v10001059mg [Eutrema salsugineum]
Length=157

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 89/156 (57%), Gaps = 18/156 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN---------------GQTHHPNF  756
            MA    + +A+ LL LN  MY IVLG  +W +NK I+                  + P  
Sbjct  1    MAAQQMKPVASLLLVLNFCMYAIVLGIGAWSMNKAISHGFLIGADYSLPAHFSPIYFPM-  59

Query  755  GGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLA  576
             GN AT FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA G  
Sbjct  60   -GNAATGFFVMFALIAGVAGAASVIAGASHLQSWTTASLPAAVSAATIAWSLTLLAMGFG  118

Query  575  CKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            CKEI + G R  RLR +EAF+IIL+ TQLLY+  ++
Sbjct  119  CKEIEL-GMRNARLRTIEAFLIILSATQLLYIAAIY  153



>ref|XP_006369867.1| AWPM-19-like membrane family protein [Populus trichocarpa]
 gb|ERP66436.1| AWPM-19-like membrane family protein [Populus trichocarpa]
Length=162

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 82/138 (59%), Gaps = 14/138 (10%)
 Frame = -2

Query  842  NLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------GNGATMFFLAFSILAAV  702
            N  MYVIVLG   W +N+ I+ G    P F             GN AT FF+ F+++A V
Sbjct  18   NFCMYVIVLGIGGWAMNRAIDHGFIIGPGFDLPAHFSPIYFPMGNAATGFFVMFALIAGV  77

Query  701  LGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLRVLE  522
            +G+ S  +G NH+R W  DSL +A S A V+W +T LA G A KEI +   R  RLR +E
Sbjct  78   VGVASAIVGLNHIRTWTGDSLPSAASVAAVSWTLTLLAMGFAWKEIEL-SIRNARLRTME  136

Query  521  AFVIILAFTQLLYVLMLH  468
            AF+IIL+ TQLLY+  +H
Sbjct  137  AFLIILSATQLLYIAAIH  154



>ref|XP_006355583.1| PREDICTED: uncharacterized protein LOC102586633 [Solanum tuberosum]
Length=159

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 95/161 (59%), Gaps = 16/161 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFI-NGQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYV+VLG   W +N  I NG    P               G
Sbjct  1    MASGQMKPVASLLLVLNFCMYVVVLGIGGWAMNFAIDNGFVIGPGMELPAHFSPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ S   G NH+R W  DSL AA S+A +AW++T LA G A K
Sbjct  61   NAATGFFVVFALIAGVVGVASVLSGLNHIRHWNIDSLPAAASAAAIAWSLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +  +R  +L+ +EAF+IIL+FTQL+Y+  +H    SSR
Sbjct  121  EIEL-NYRNSKLKTMEAFLIILSFTQLVYIAAIHGA--SSR  158



>gb|EYU43292.1| hypothetical protein MIMGU_mgv1a015292mg [Erythranthe guttata]
Length=162

 Score = 87.4 bits (215),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LLFLN  MY +VLG   W +N+ I+       G     +F       G
Sbjct  1    MADQQLKPVAGLLLFLNFCMYAVVLGIGGWAMNRAIDHGFIIGAGYDLPAHFSPVYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ +   G NH+R W  DSL +A S+A +AW +T LA G A K
Sbjct  61   NAATGFFVVFALIAGVVGVAAAISGLNHIRYWDADSLPSAASAASIAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI++G  R  RLR +EAF+IIL+ TQL Y+  +H
Sbjct  121  EIDLGR-RNARLRTMEAFIIILSATQLFYIAAIH  153



>ref|NP_001149332.1| LOC100282955 [Zea mays]
 gb|ACG35059.1| plasma membrane associated protein [Zea mays]
 gb|ACG42522.1| plasma membrane associated protein [Zea mays]
 gb|AFW83664.1| plasma membrane associated protein [Zea mays]
Length=157

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 88/156 (56%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNK------FINGQTHHP------NFG-G  750
            MA    + +A  LL LNL MYVIV     W +N       FI    H P      NF  G
Sbjct  1    MANAGMKPVAGLLLVLNLCMYVIVAAVGGWAINHAINYGFFIGTGLHLPAHFSPINFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  +SL AA S+  +AW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIAGVVGAGSALAGLNHVRAWSTESLPAAASAGFIAWTLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI + G R  RL  +E+F IIL+ TQL Y+L +H G
Sbjct  121  EIELHG-RNARLICMESFTIILSATQLFYLLAIHGG  155



>ref|XP_010922603.1| PREDICTED: uncharacterized protein LOC105045871 [Elaeis guineensis]
Length=158

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 92/154 (60%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MY IV   + W LN  I+ G    P+              G
Sbjct  1    MAGEGVKPIASLLLVLNFCMYAIVAAISGWALNVAIDRGFIVGPSLALPAHFSPVFFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT F + F+++A V+G  +   G  H+R W + SLA A SS +VAWA+T LA GLACK
Sbjct  61   NAATGFLVIFALIAGVVGSAAAIAGIQHIRAWDHLSLAPAASSGIVAWALTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +GG R  RLR +EAF+IIL+ TQL+Y+L++H
Sbjct  121  EIVLGG-RNVRLRTVEAFLIILSATQLVYILVIH  153



>ref|XP_003569627.1| PREDICTED: uncharacterized protein LOC100832331 [Brachypodium 
distachyon]
Length=156

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 90/156 (58%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MY+IV     W +N  IN       G     +F       G
Sbjct  1    MANAAMKPVAGLLLVLNFCMYLIVAAIGGWAINHAINYGFFIGSGLELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A+V+G+ +   G +H+R W ++S+ AA SS  +AW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIASVVGMAAALAGFHHVRAWSHESMPAAASSGFIAWLLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI++ G R  RL  +EAF IIL+ TQL Y+L +H G
Sbjct  121  EIDLHG-RNARLITMEAFTIILSATQLFYILAIHGG  155



>ref|XP_009788391.1| PREDICTED: uncharacterized protein LOC104236211 [Nicotiana sylvestris]
Length=159

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 94/154 (61%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MY +VLG A W +N  I+ G     +F             G
Sbjct  1    MAGGQLKPVASLLLVLNFCMYAVVLGIAGWAMNFAIDHGFIIGADFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ S   G NH+R W  DSL AA S+A +AW++T LA G A K
Sbjct  61   NSATGFFVVFALIAGVVGVASLLSGLNHIRQWNIDSLPAATSAAAIAWSLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            E+ +  +R  +LR +EAF+IIL+FTQL+Y++ +H
Sbjct  121  EVQL-NYRNAKLRTMEAFLIILSFTQLVYIMAIH  153



>ref|XP_003531288.1| PREDICTED: uncharacterized protein LOC100781792 isoform X1 [Glycine 
max]
 ref|XP_006585187.1| PREDICTED: uncharacterized protein LOC100781792 isoform X2 [Glycine 
max]
Length=160

 Score = 86.3 bits (212),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MY IVLG   W +N+ I+ G    P               G
Sbjct  1    MANEQMKPIATLLLGLNFCMYAIVLGIGGWAMNRAIDHGFIIGPELKLPAHFSPLFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N +T FF+ F++LA V+G  S   G NH+R W ++SL +A S A +AW +T LA G A K
Sbjct  61   NASTGFFVTFALLAGVVGAASAISGINHIRSWTSESLPSAASVATMAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RL+ +EAFVIIL+ TQL Y++ +H
Sbjct  121  EIEI-HIRNARLKTMEAFVIILSATQLFYIVAIH  153



>ref|XP_008780296.1| PREDICTED: uncharacterized protein LOC103700073 [Phoenix dactylifera]
Length=165

 Score = 86.3 bits (212),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + + + L+FLN  MY IV     W ++  I+ G    P               G
Sbjct  1    MASEQFKPIVSLLVFLNFCMYAIVAAIGGWAIDIAIDRGFIIGPELRLPAHFIPIFFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  DSL  A SS ++AWA+T +A GLACK
Sbjct  61   NAATGFFVMFALIAGVVGAASALAGFNHIRFWNYDSLQPAASSGIIAWALTLIAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EIN+ G R  RL+ +EAF+IIL+ TQL+YVL + 
Sbjct  121  EINLEG-RNARLKTMEAFLIILSATQLVYVLSIR  153



>ref|XP_002890814.1| hypothetical protein ARALYDRAFT_473160 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67073.1| hypothetical protein ARALYDRAFT_473160 [Arabidopsis lyrata subsp. 
lyrata]
Length=158

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    PN              G
Sbjct  1    MAGEQMKPVASGLLVLNFCMYVIVLGIGGWAMNRAIDHGFEVGPNLELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVIFALLAGVVGAASTISGLSHIRSWTMGSLPAAATAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  +LR LEAF+IIL+ TQL+Y+  +H
Sbjct  121  EIELQG-RNAKLRTLEAFLIILSVTQLIYIAAVH  153



>ref|XP_009632029.1| PREDICTED: uncharacterized protein LOC104121681 [Nicotiana tomentosiformis]
Length=159

 Score = 85.9 bits (211),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 97/161 (60%), Gaps = 15/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A+ LL LN  MY +VLG A W +N  I+       G     +F       G
Sbjct  1    MAGGQLKPVASLLLVLNFCMYAVVLGIAGWAMNFAIDHGFIIGAGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+GI S   G NH+R W  DSL AA S+A +AW++T LA G A K
Sbjct  61   NSATGFFVVFALIAGVVGIASLLSGLNHIRQWNIDSLPAATSAAAIAWSLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            E+ +   R  +LR +EAF+IIL+FTQL+Y+ ++H G  +SR
Sbjct  121  EVQLND-RNAKLRTMEAFLIILSFTQLVYITVIH-GASTSR  159



>ref|XP_010273381.1| PREDICTED: uncharacterized protein LOC104608952 [Nelumbo nucifera]
Length=160

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 88/154 (57%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + LA  LL LN  M VIV     W +N+ I+ G    P+              G
Sbjct  1    MAGEGLKPLATGLLLLNFCMCVIVASIGGWAINRAIDHGFVIGPSLELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G NH+R W  +SL +A S A++AW +  LA GLACK
Sbjct  61   NAATGFFVLFAVIAGVVGGASAIAGLNHIRSWNVNSLPSAASVAIIAWTLILLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI   G+R  RLR +EAF+IIL+ TQ LY+L +H
Sbjct  121  EIE-RGFRNARLRTMEAFLIILSATQFLYILAIH  153



>ref|XP_004962154.1| PREDICTED: uncharacterized protein LOC101769987 isoform X2 [Setaria 
italica]
Length=169

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 90/156 (58%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFING-----QTHHPNFG--------G  750
            MA +  R++A+ LLFLNLIMYV+V   A W +N  I+      Q   P           G
Sbjct  1    MASSAQRSMASALLFLNLIMYVVVAAIAGWAINYSIDESMNSLQGASPPVRLFPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++  V+GI +   G + +      ++ +A +SALV W +T LA GLACK
Sbjct  61   NLATGFFVIFALITGVVGISTSLTGLHDVSQGFPANMMSAAASALVTWTLTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI++  WR   LR LEAF IIL+ TQLL    LHAG
Sbjct  121  EISI-SWRPASLRTLEAFTIILSGTQLLCAGSLHAG  155



>gb|AFK34750.1| unknown [Lotus japonicus]
Length=161

 Score = 85.9 bits (211),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 89/149 (60%), Gaps = 18/149 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNK-----FINGQ----------THHPNF  756
            MA    + +A  LL LN  MYVIVLG  +W +N+     FI GQ           H P  
Sbjct  1    MANEQMKPVATLLLGLNFCMYVIVLGIGAWAMNRAIDYGFIIGQGLELPAHFSPIHFPM-  59

Query  755  GGNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLA  576
             GN AT FF+ F+++A V+G  S   G NH+R W ++SL +A S A++AW++T LA G A
Sbjct  60   -GNAATGFFVTFALIAGVVGAGSLISGLNHIRSWTSESLPSAASVAVIAWSLTLLAMGFA  118

Query  575  CKEINVGGWRGWRLRVLEAFVIILAFTQL  489
            CKEI +   R  RL+ +EAF+IIL+ TQL
Sbjct  119  CKEIEL-NVRNARLKTMEAFLIILSATQL  146



>dbj|BAJ98607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=171

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 89/150 (59%), Gaps = 14/150 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHH-----------PNF--GGNGATMF  732
            +++A+  LFLNLIMYV+V   A W +N  I+   H            P +   GN AT F
Sbjct  7    KSMASGFLFLNLIMYVVVAVIAGWAINYSIDNSAHSLKGASPPVRLFPIYFPMGNLATGF  66

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+ F++LA+ +GI +   G   +      S+ +A +SALVAW +T LA GLACKEI++G 
Sbjct  67   FVIFALLASAVGISTSLTGLRDVTEGYPASMMSAAASALVAWTLTLLAMGLACKEISIG-  125

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            WR   LR LE F IILA TQLL V  LHAG
Sbjct  126  WRPPSLRALETFTIILAVTQLLCVGSLHAG  155



>ref|XP_006655300.1| PREDICTED: uncharacterized protein LOC102709744 [Oryza brachyantha]
Length=169

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 89/156 (57%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFING-----QTHHPNFG--------G  750
            MA     +++A LLFLNLIMYV+V   A W +N  I+      Q   P           G
Sbjct  1    MATGGPSSMSAGLLFLNLIMYVVVAVIAGWAINYSIDESFNSLQGVSPPVRMFPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G+ +   G + +      S+ +A +++LV W +T LA GLACK
Sbjct  61   NLATGFFVIFALLAGVVGVSTSLTGLHDVSQGHPSSMMSAAATSLVTWTLTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI++G WR   LR LE F IILA TQLL    LHAG
Sbjct  121  EISIG-WRPPSLRALETFTIILAGTQLLCAGSLHAG  155



>ref|XP_001780831.1| predicted protein [Physcomitrella patens]
 gb|EDQ54388.1| predicted protein [Physcomitrella patens]
Length=176

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 107/159 (67%), Gaps = 5/159 (3%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--GNGATMFFLAFS  717
            MA  + R+L+APLL +N ++Y++    A W LN+ + G T     G  GN  T  FL  +
Sbjct  1    MAIGIGRSLSAPLLVINFMLYLVSACLAGWALNRNL-GATIGIGAGPIGNIVTPTFLPLA  59

Query  716  ILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGW-RGW  540
            ++A+++G+ S F G NHLRV+R+DSL++A S++L+AW +T LA G+ACKEI+ GG  R  
Sbjct  60   LIASMVGLASVFAGINHLRVFRSDSLSSAASTSLIAWLLTLLAMGVACKEIHTGGSNRQK  119

Query  539  RLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
            R+R LEAF+IILA  +LLY+L L AG F +  G GY + 
Sbjct  120  RIRALEAFIIILALFELLYLLSLQAGLFGTSDG-GYDET  157



>gb|ADE77128.1| unknown [Picea sitchensis]
Length=189

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 74/172 (43%), Positives = 100/172 (58%), Gaps = 21/172 (12%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG--------------  753
            MA    ++LA  LL LNL M+VIV   A W LN   N   H  + G              
Sbjct  1    MALGAVKSLAGFLLLLNLCMFVIVGVIAGWALN---NALDHTYSTGRRRTLPVGFYPLYF  57

Query  752  --GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGL  579
              GN AT F + F+++AAV+G  S   G +HLRVW   SLA++ +S++ AWA+T LA GL
Sbjct  58   PMGNEATGFMIIFALIAAVVGAASCLSGLHHLRVWTAQSLASSTASSMTAWALTLLAMGL  117

Query  578  ACKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDN  423
             CKEI++GG R  +L  LE+F+IIL  T+L Y+L++HAG+F   Y   Y D 
Sbjct  118  GCKEIHIGG-RNTKLITLESFLIILCGTKLFYILLIHAGFFGGNY-CSYEDT  167



>ref|XP_009769804.1| PREDICTED: uncharacterized protein LOC104220604 [Nicotiana sylvestris]
Length=159

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 91/154 (59%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N  I+ G    P F             G
Sbjct  1    MADGQLKPVASLLLVLNFCMYVIVLGIGGWAMNFGIDHGFIIGPRFNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ S   G NH+R W  DSL AA S+A++AW+ T LA G A K
Sbjct  61   NAATGFFVVFALIAGVVGVASTLSGFNHIRYWNIDSLQAAASAAIIAWSFTLLATGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RL  +EAF+IIL+FTQL+Y+  +H
Sbjct  121  EIEL-ELRNARLITMEAFLIILSFTQLVYIAAIH  153



>ref|XP_006304542.1| hypothetical protein CARUB_v10011510mg [Capsella rubella]
 gb|EOA37440.1| hypothetical protein CARUB_v10011510mg [Capsella rubella]
Length=158

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    PN              G
Sbjct  1    MAGEQMKPVASGLLVLNFCMYVIVLGIGGWAMNRAIDHGFEVGPNLNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVIFALLAGVVGAASTISGLSHIRSWTVGSLPAAATAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  +LR +EAF+IIL+ TQL+Y+  +H
Sbjct  121  EIELQG-RNAKLRTMEAFLIILSVTQLVYIAAVH  153



>ref|XP_010499463.1| PREDICTED: uncharacterized protein LOC104776981 [Camelina sativa]
 ref|XP_010460730.1| PREDICTED: uncharacterized protein LOC104741544 [Camelina sativa]
 ref|XP_010478320.1| PREDICTED: uncharacterized protein LOC104757290 [Camelina sativa]
Length=158

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    PN              G
Sbjct  1    MAGEQMKPVASGLLVLNFCMYVIVLGIGGWAMNRAIDHGFEVGPNLNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVIFALLAGVVGAASTISGLSHIRSWTVGSLPAAATAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  +LR +EAF+IIL+ TQL+Y+  +H
Sbjct  121  EIELQG-RNAKLRTMEAFLIILSVTQLVYIAAVH  153



>ref|NP_174245.1| AWPM19-like protein [Arabidopsis thaliana]
 gb|AAG51728.1|AC068667_7 plasma membrane associated protein, putative; 66162-66952 [Arabidopsis 
thaliana]
 gb|AAL67020.1| putative plasma membrane associated protein [Arabidopsis thaliana]
 gb|AAM20247.1| putative plasma membrane associated protein [Arabidopsis thaliana]
 gb|AEE31099.1| AWPM19-like protein [Arabidopsis thaliana]
Length=158

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    PN              G
Sbjct  1    MAGEQIKPVASGLLVLNFCMYVIVLGIGGWAMNRAIDHGFEVGPNLELPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVIFALLAGVVGAASTISGLSHIRSWTVGSLPAAATAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI + G R  +LR +EAF+IIL+ TQL+Y+  +H
Sbjct  121  EIELQG-RNAKLRTMEAFLIILSVTQLIYIAAVH  153



>emb|CDY35167.1| BnaA09g18040D [Brassica napus]
Length=157

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 14/150 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTH-----------HPNF--GG  750
            MA    + +A+ LL LN  MY IVLG  +W +NK I+   H            P +   G
Sbjct  1    MAEQRMQPVASLLLLLNFCMYAIVLGIGAWSMNKAISHGFHIGADYSLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ FS++A V G  S   G +H++     SL AA S+A +AW++T LA G  CK
Sbjct  61   NAATGFFVMFSLIAGVAGAASVITGVSHIQSSTTASLPAAVSAATIAWSLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYV  480
            EI + G R  RLR +EAF+IIL+ TQL+Y+
Sbjct  121  EIEL-GMRNARLRTMEAFLIILSATQLIYI  149



>ref|XP_009109659.1| PREDICTED: uncharacterized protein LOC103835268 [Brassica rapa]
Length=159

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+              G
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFEIGPDLKLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVVFALLAGVVGAASTISGLSHIRSWTAGSLPAAAAAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEL-HVRNARLRTMEAFLIILSVTQLLYIAAVH  153



>emb|CDX94673.1| BnaC07g09850D [Brassica napus]
Length=159

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+              G
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFEIGPDLKLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL +A S+A +AW +T LA G A K
Sbjct  61   NAATGFFVTFALLAGVVGAASTISGLSHIRSWTVRSLPSAASAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEL-HVRNAKLRTMEAFLIILSVTQLLYIAAVH  153



>ref|XP_003595559.1| hypothetical protein MTR_2g049340 [Medicago truncatula]
 gb|AES65810.1| ABA induced plasma membrane protein [Medicago truncatula]
 gb|AFK40940.1| unknown [Medicago truncatula]
Length=160

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 85/149 (57%), Gaps = 14/149 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A  LL LN  MYVIV+    W +N+ I+ G    P F             G
Sbjct  1    MANEQMKPIATLLLALNFCMYVIVISIGGWAMNRAIDHGFEIGPGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+GI S   G NH+R W ++SL +A S A +AWA+T LA G  CK
Sbjct  61   NAATGFFVTFALIAGVVGIGSLISGLNHIRSWTSESLPSAASVAAIAWALTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLY  483
            EI +   R  RL+ +EAF+IIL  TQL Y
Sbjct  121  EIQL-NIRNSRLKTMEAFLIILTATQLFY  148



>emb|CDX90196.1| BnaA08g17880D [Brassica napus]
Length=160

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 89/155 (57%), Gaps = 15/155 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFING--QTHHPNFG------------  753
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+   +   P+              
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFEIAGPDLKLPAHFSPIYFPM  60

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A 
Sbjct  61   GNAATGFFVVFALLAGVVGAASTISGLSHIRSWTAGSLPAAAAAATIAWTLTVLAMGFAW  120

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            KEI +   R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  121  KEIEL-HVRNARLRTMEAFLIILSVTQLLYIAAVH  154



>ref|XP_004488295.1| PREDICTED: uncharacterized protein LOC101512772 isoform X2 [Cicer 
arietinum]
Length=160

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 87/149 (58%), Gaps = 14/149 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MYVIVLG   W +N+ I+       G     +F       G
Sbjct  1    MANDQMKPIATLLLGLNFCMYVIVLGIGGWAMNRAIDHGFVIGSGFDLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G+ S   G NH+R W ++SL +A S A +AWA+T LA G  CK
Sbjct  61   NAATGFFVTFALIAGVVGVGSLISGLNHIRSWTSESLPSAASVASIAWALTLLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLY  483
            EI +   R  RL+ +EAF+IIL+ TQL Y
Sbjct  121  EIEL-NVRNARLKTMEAFLIILSATQLFY  148



>ref|XP_009115232.1| PREDICTED: uncharacterized protein LOC103840476 [Brassica rapa]
Length=159

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 87/154 (56%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+F             G
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDRGFEIGPDFNLPAHFAPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G  H+R W   SL AA  +A +AW +T LA G A K
Sbjct  61   NAATGFFVTFALLAGVVGAASTISGLTHIRSWTVGSLPAAAMAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI     R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEF-QVRNAKLRTMEAFLIILSVTQLLYIAAVH  153



>dbj|BAK03367.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96908.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=156

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 89/156 (57%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MY+IV     W +N  IN       G     +F       G
Sbjct  1    MANAGLKPVAGLLLMLNFCMYLIVTAVGGWAINYAINNGFFIGSGLQLPSHFSPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A+V+G+ +   G +H+R W ++SL AA SS  VAW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIASVVGMGASLAGFHHVRAWSHESLPAAASSGFVAWMLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI + G R  RL  +EAF IIL+ TQL Y+L +H G
Sbjct  121  EIELNG-RNSRLITMEAFTIILSVTQLFYILAIHGG  155



>emb|CDY35302.1| BnaC03g59210D [Brassica napus]
Length=159

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+              G
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFEIGPDLKLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVVFALLAGVVGAASTISGLSHIRSWTVGSLPAAAAAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RLR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEL-HVRNARLRTMEAFLIILSVTQLLYIAAVH  153



>ref|XP_001766667.1| predicted protein [Physcomitrella patens]
 gb|EDQ68520.1| predicted protein [Physcomitrella patens]
Length=173

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 105/171 (61%), Gaps = 7/171 (4%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNK-FINGQTHHPNFGGNGATMFFLAFSI  714
            MA  +++ + APL+ +N  +Y+I    A + LN  F +  T   +  GN AT  FL F +
Sbjct  1    MAFGISKGMVAPLMVINFCLYLISAAIAGYLLNSAFDHELTSFVSISGNPATSTFLTFVL  60

Query  713  LAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRL  534
            +A+++G+ S   G +HLRVWR +SLA+A ++A +AW +T LA G+ACKEI+    R  RL
Sbjct  61   IASMVGLASVIAGAHHLRVWRTESLASAAAAATIAWLLTLLAMGVACKEIHFRYGRNKRL  120

Query  533  RVLEAFVIILAFTQLLYVLMLHAGWFSSRYG----PGYRDNDYGMGMGAPA  393
            + +EAF+IIL+  +LLY+L LHAG   +R G    PG R N      G PA
Sbjct  121  KTIEAFMIILSLFELLYLLALHAGSV-TREGYANTPGDR-NVKNPNYGTPA  169



>gb|KHN06453.1| hypothetical protein glysoja_010797 [Glycine soja]
Length=162

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 88/156 (56%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA+   + +A  LL LN  MY IVLG   W +N+ I+ G    P               G
Sbjct  1    MAKEQMKPIATLLLGLNFCMYAIVLGIGGWAMNRAIDHGFIIGPELKLPAHFSPLFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N +T FF+ F++LA V+G  S   G NH++ W  +SL +A S A +AW +T LA G A K
Sbjct  61   NASTGFFVTFALLAGVVGAASAISGINHIQSWTAESLPSAASVATMAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI +   R  RL+ +EAF+IIL+ TQL Y++ +H+ 
Sbjct  121  EIEL-HIRNARLKTMEAFIIILSATQLFYIVAIHSA  155



>ref|NP_001235518.1| uncharacterized protein LOC100527398 [Glycine max]
 gb|ACU16487.1| unknown [Glycine max]
Length=162

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 88/156 (56%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA+   + +A  LL LN  MY IVLG   W +N+ I+ G    P               G
Sbjct  1    MAKEQMKPIATLLLGLNFCMYAIVLGIGGWAMNRAIDHGFIIGPELKLPAHFSPLFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N +T FF+ F++LA V+G  S   G NH++ W  +SL +A S A +AW +T LA G A K
Sbjct  61   NASTGFFVTFALLAGVVGAASAISGINHIQSWTAESLPSAASVATMAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI +   R  RL+ +EAF+IIL+ TQL Y++ +H+ 
Sbjct  121  EIEL-RIRNARLKTMEAFIIILSATQLFYIVAIHSA  155



>ref|XP_009604262.1| PREDICTED: uncharacterized protein LOC104099076 [Nicotiana tomentosiformis]
Length=159

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N  I+ G    P F             G
Sbjct  1    MADGQLKPVASLLLVLNFCMYVIVLGIGGWAMNFAIDHGFILGPGFNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++++ V+G+ S   G NH+R W  DSL AA S+A++AW  T LA G A K
Sbjct  61   NAATGFFVVFALISGVVGVASALSGFNHIRYWNIDSLQAAASAAIIAWGFTLLATGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RL  +EAF+IIL+FTQL+Y+  +H
Sbjct  121  EIEL-ELRNARLITMEAFLIILSFTQLVYIAAIH  153



>emb|CDY69073.1| BnaCnng61750D [Brassica napus]
Length=157

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 14/150 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTH-----------HPNF--GG  750
            MA    + + + LL LN  MY IVLG  +W +NK I+   H            P +   G
Sbjct  1    MAEQRMQPVTSLLLLLNFCMYAIVLGIGAWSMNKSISHGFHIGADYSLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ FS++A V G  S   G +H++     SL AA S+A +AW++T LA G  CK
Sbjct  61   NAATGFFVMFSLIAGVAGAASVITGVSHIQSSTTASLPAAVSAATIAWSLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYV  480
            EI++ G R  RLR +EAF+IIL+ TQL+Y+
Sbjct  121  EIDL-GMRNARLRTMEAFLIILSATQLIYI  149



>ref|XP_004161137.1| PREDICTED: uncharacterized LOC101207031 [Cucumis sativus]
 gb|KGN65578.1| AWPM19-like protein [Cucumis sativus]
Length=159

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 94/161 (58%), Gaps = 15/161 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA T  ++ A  LL LN  MYVI+LG   W +NK I+       G     +F       G
Sbjct  1    MASTQMKSFATLLLLLNFCMYVIILGIGGWAMNKAIDHGFIIGPGLRLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V G  S   G NH+R W  +SL+AA S+A+ AW +T LA G A K
Sbjct  61   NAATGFFVLFALLAGVFGAASAISGLNHIRSWSVESLSAASSAAVFAWTLTILAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSR  447
            EI +  +R  RL  +EAF IIL+ TQL+Y++ +H G  S+R
Sbjct  121  EIAL-DFRNARLVTMEAFFIILSATQLVYIMAIH-GDISTR  159



>ref|XP_009102850.1| PREDICTED: uncharacterized protein LOC103828959 [Brassica rapa]
Length=162

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 89/155 (57%), Gaps = 14/155 (9%)
 Frame = -2

Query  893  RMARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------  753
             MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+              
Sbjct  3    EMAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFEIGPDLKLPAHFSPIYFPM  62

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A 
Sbjct  63   GNAATGFFVTFALLAGVVGAASTISGLSHIRSWTVGSLPAAAAAATIAWTLTVLAMGFAW  122

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            KEI +   R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  123  KEIEL-HVRNAKLRTMEAFLIILSVTQLLYIAAVH  156



>ref|XP_009114344.1| PREDICTED: uncharacterized protein LOC103839594 [Brassica rapa]
Length=157

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 87/150 (58%), Gaps = 14/150 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTH-----------HPNF--GG  750
            MA    + +A+ LL LN  MY IVLG  +W +NK I+   H            P +   G
Sbjct  1    MAEQRMQPVASLLLLLNFCMYAIVLGIGAWSMNKAISHGFHIGADYSLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V G  S   G +H++     SL AA S+A +AW++T LA G  CK
Sbjct  61   NAATGFFVMFALIAGVAGAASVITGVSHIQSSTTASLPAAVSAATIAWSLTVLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYV  480
            EI + G R  RLR +EAF+IIL+ TQL+Y+
Sbjct  121  EIEL-GMRNARLRTMEAFLIILSATQLIYI  149



>ref|XP_001769881.1| predicted protein [Physcomitrella patens]
 gb|EDQ65241.1| predicted protein [Physcomitrella patens]
Length=168

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSIL  711
            MA  V++ + APLL +N  +Y I    A   LNK  +  +     GGN AT  FLAF ++
Sbjct  1    MAFGVSKGMVAPLLVINFCLYFISADIAGSLLNKAFDRGSFVLG-GGNTATSIFLAFVLI  59

Query  710  AAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWRLR  531
            A+++G+ S   G +HL VWR +SLAAA ++A +AW +T LA G+ACKEI++   R  RL+
Sbjct  60   ASMVGLASTLAGAHHLSVWRTESLAAAAAAATIAWTLTLLAMGVACKEIHIRYGRNKRLK  119

Query  530  VLEAFVIILAFTQLLYVLMLHAGWFSSR---YGPGYRDNDYGMGMGA  399
             LEAF+IIL+  +LLY+L L+AG  +       PG ++ +YG    A
Sbjct  120  TLEAFMIILSLLELLYLLALYAGAVTREGYNNAPGVKNPNYGTPAAA  166



>ref|XP_001753907.1| predicted protein [Physcomitrella patens]
 gb|EDQ81229.1| predicted protein [Physcomitrella patens]
Length=175

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 103/168 (61%), Gaps = 9/168 (5%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPN--FGGNGATMFFLAFS  717
            MA  + + L  PL+ +N  +Y I    A   LN+ ++   H  +    GN AT+ F+ F+
Sbjct  1    MAFGIGKVLIMPLMVINFGLYFIAACLAGSILNRNLDANMHRNDDIQIGNVATVNFIPFA  60

Query  716  ILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWR  537
            ++A + G+ S F GG+H+R+WR +SLAAA +++L+AW +T LA GLACKEI+    R  R
Sbjct  61   LIACMAGLASVFAGGHHIRIWRTESLAAAAATSLIAWLLTLLAMGLACKEIHTSYGRTKR  120

Query  536  LRVLEAFVIILAFTQLLYVLMLHAGWFSSRYG-------PGYRDNDYG  414
            L+ LEAF+IIL+  +LLY+L LHAG   +  G        G ++ +YG
Sbjct  121  LKTLEAFMIILSLFELLYLLALHAGSVHTNDGVVNTTGHRGVKNPNYG  168



>ref|XP_004147399.1| PREDICTED: uncharacterized protein LOC101207031 [Cucumis sativus]
Length=159

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 90/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA T  ++ A  LL LN  MYVI+LG   W +NK I+       G     +F       G
Sbjct  1    MASTQMKSFATLLLLLNFCMYVIILGIGGWAMNKAIDHGFIIGPGLRLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V G  S   G NH+R W  +SL+AA S+A+ AW +T LA G A K
Sbjct  61   NAATGFFVLFALLAGVFGAASAISGLNHIRSWSVESLSAASSAAVFAWTLTILAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +  +R  RL  +EAF IIL+ TQL+Y++ +H
Sbjct  121  EIAL-DFRNARLVTMEAFFIILSATQLVYIMAIH  153



>gb|EMT09286.1| hypothetical protein F775_29954 [Aegilops tauschii]
Length=163

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 87/148 (59%), Gaps = 14/148 (9%)
 Frame = -2

Query  866  LAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHH-----------PNF--GGNGATMFFL  726
            +A+ LLFLNLIMYV+V   A W +N  I    H            P +   GN AT FF+
Sbjct  1    MASGLLFLNLIMYVVVAVIAGWAVNYSIEDSAHSLRGASPPVRLFPIYFPMGNLATGFFI  60

Query  725  AFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWR  546
             F++LA+ +GI +   G   +      S+ +A +SA+V+W +T LA GLACKEI++G WR
Sbjct  61   IFALLASAVGISTSLTGLRDVTEGYPASMMSAAASAVVSWTLTLLAMGLACKEISIG-WR  119

Query  545  GWRLRVLEAFVIILAFTQLLYVLMLHAG  462
               LR LE F IILA TQLL V  LHAG
Sbjct  120  PPSLRALETFTIILAGTQLLCVGSLHAG  147



>emb|CDY44311.1| BnaA07g07950D [Brassica napus]
Length=159

 Score = 83.2 bits (204),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+              G
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFEIGPDLKLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL AA ++A +AW +T LA G A K
Sbjct  61   NAATGFFVTFALLAGVVGAASTISGLSHIRSWTVGSLPAAAAAATIAWTLTVLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEL-HVRNAKLRTMEAFLIILSVTQLLYIAAVH  153



>ref|XP_007159519.1| hypothetical protein PHAVU_002G244300g [Phaseolus vulgaris]
 gb|ESW31513.1| hypothetical protein PHAVU_002G244300g [Phaseolus vulgaris]
Length=161

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN------GQTHHP-NFG------G  750
            MA    + +A  LL LN  MY IVLG   W +N+ I+       Q   P +F       G
Sbjct  1    MANEQMKPIATLLLGLNFCMYAIVLGIGGWAMNRAIDHGFIIGPQLKLPAHFSPLFFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N +T FF+ FS+LA V+G  S   G NH+R W  +SL +A S A +AW +T LA G A K
Sbjct  61   NASTGFFVTFSLLAGVVGAASAISGINHIRSWTAESLPSAASVATMAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  RL+ +E+F+IIL+ TQL Y+  +H
Sbjct  121  EIGL-RVRNARLKTMESFIIILSATQLFYIFAIH  153



>emb|CDM83710.1| unnamed protein product [Triticum aestivum]
Length=156

 Score = 83.2 bits (204),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 91/156 (58%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MY+IV     W +N  IN       G     +F       G
Sbjct  1    MANEGLKPVAGLLLMLNFCMYLIVAAVGGWAINFAINNGFFIGSGLELPSHFSPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A+V+G+ +   G +H+R W ++SL AA SSA +AW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIASVVGMGAALAGFHHVRAWSHESLPAAASSAFIAWMLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI++ G R  RL  +EAF IIL+ TQL Y+L +H G
Sbjct  121  EIDLNG-RNARLITMEAFTIILSGTQLFYILAIHGG  155



>emb|CDX99831.1| BnaC05g22530D [Brassica napus]
Length=160

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 87/155 (56%), Gaps = 15/155 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFING--QTHHPNFG------------  753
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+   +   P+F             
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDRGFEIAGPDFNLPAHFAPIYFPM  60

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT FF+ F++LA V+G  S   G  H+R W   SL AA  +A +AW +T LA G A 
Sbjct  61   GNAATGFFVTFALLAGVVGGASTISGLTHIRSWTVGSLPAAAMAATIAWTLTVLAMGFAW  120

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            KEI     R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  121  KEIEF-QVRNAKLRTMEAFLIILSVTQLLYIAAVH  154



>ref|XP_004982944.1| PREDICTED: uncharacterized protein LOC101755263 isoform X2 [Setaria 
italica]
Length=182

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 95/159 (60%), Gaps = 10/159 (6%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNG----ATMFFLAFSILAA  705
            R +A PLL LNL++YV ++GFASW LN F++G  HH  +   G    A + F+  ++LAA
Sbjct  12   RNVAGPLLLLNLVLYVFMMGFASWALNSFVDG--HHKQYYSPGPRDEAALQFIQSALLAA  69

Query  704  VLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEI----NVGGWRGWR  537
            V+G  +K     H R WR   LAAA +   VAWA TALAFGLACKE+      G  RGWR
Sbjct  70   VVGAAAKAATAFHARAWRPQGLAAAAALGTVAWAATALAFGLACKEMRAAGAGGVARGWR  129

Query  536  LRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGPGYRDND  420
            +R LE    +LA TQLLYV MLHA     R  PG    D
Sbjct  130  MRALEGITAVLALTQLLYVAMLHAAVAGDRCEPGCPTED  168



>dbj|BAK08343.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=76

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -2

Query  878  VARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILA  708
            V R + APLL LNLIMYVIV+GFASW LN FING T+ P  GGNGAT +FL F+ILA
Sbjct  4    VGRNMVAPLLVLNLIMYVIVIGFASWNLNHFINGLTNRPGVGGNGATFYFLVFAILA  60



>ref|XP_009396324.1| PREDICTED: uncharacterized protein LOC103981346 [Musa acuminata 
subsp. malaccensis]
Length=160

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 93/156 (60%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A+ LLFLN  MYVIV     W LN  I+       G     +F       G
Sbjct  1    MAAEGMKPVASLLLFLNFCMYVIVASIGGWALNFAIDHGFTIGQGLALPAHFSPVYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  +   G  H R W  D+L +A SSA++AW +T LA GLACK
Sbjct  61   NQATGFFVIFALIAGVVGAAAAIAGIQHARRWNYDTLPSAASSAVIAWGLTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EIN+ G R  RLR +EAF+IIL+ TQL+Y+L +H G
Sbjct  121  EINLEG-RNTRLRTMEAFLIILSATQLVYILAIHGG  155



>ref|XP_006415566.1| hypothetical protein EUTSA_v10008973mg [Eutrema salsugineum]
 gb|ESQ33919.1| hypothetical protein EUTSA_v10008973mg [Eutrema salsugineum]
Length=159

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 89/154 (58%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MYVIVLG   W +N+ I+ G    P+F             G
Sbjct  1    MAGEQMKPVASLLLVLNFCMYVIVLGIGGWAMNRAIDHGFQIGPDFNLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA V+G  S   G +H+R W   SL A  ++A +AW +T LA G A K
Sbjct  61   NAATGFFVTFALLAGVVGAASTISGLSHIRSWTVGSLPATATAATIAWTLTLLAMGFAWK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +   R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  121  EIEL-HVRNAKLRTMEAFLIILSVTQLLYIAAVH  153



>ref|XP_002511445.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52047.1| conserved hypothetical protein [Ricinus communis]
Length=170

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 86/167 (51%), Gaps = 18/167 (11%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN----------GQTHHPNFG----  753
            MA    +  +  LL LN  MY++ LG  +W +N  I+          G    P+      
Sbjct  1    MAHAAMKHFSTLLLVLNFCMYLVALGICAWAVNIAIDYYAFDVIIEPGSDFPPHLSPLYF  60

Query  752  --GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGL  579
              GN AT  F+ F+++A  +G  S F G NH+R W  DSL  A S A +AW +T LA G 
Sbjct  61   PMGNAATGLFVVFALIAGAVGAGSAFAGFNHIRHWNADSLQPAASVAAIAWILTLLAMGF  120

Query  578  ACKEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAGWFSSRYGP  438
             CKEI +   R   L+ LE+F+IIL  TQL+Y+  +H    SS  GP
Sbjct  121  GCKEIELRTMRNGCLKTLESFMIILGATQLMYMGAIHGA--SSIRGP  165



>gb|EMT03177.1| hypothetical protein F775_14927 [Aegilops tauschii]
Length=156

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 91/156 (58%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MY+IV     W +N  IN       G     +F       G
Sbjct  1    MANAGLKPVAGFLLMLNFCMYLIVAAVGGWAINFAINNGFFIGSGLELPSHFSPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A+V+G+ +   G +H+R W ++SL AA SSA +AW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIASVVGMGAALAGFHHVRAWSHESLPAAASSAFIAWMLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI++ G R  RL  +EAF IIL+ TQL Y+L +H G
Sbjct  121  EIDLNG-RDARLITMEAFTIILSGTQLFYILAIHGG  155



>gb|EMS45462.1| hypothetical protein TRIUR3_17420 [Triticum urartu]
Length=171

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 88/156 (56%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHH-----------PNF--GG  750
            MA    +T+A+ LLFLNLIMYV+V   A W +N  I    H            P +   G
Sbjct  1    MASGGIKTMASGLLFLNLIMYVVVAVIAGWAVNYSIEDSAHSLRGASPPVRLVPVYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F++LA  +GI +   G   +      S+ +A +SALV W +T LA GLACK
Sbjct  61   NLATGFFVIFALLAGAVGISTSLTGLRDVTEGYPASMMSAAASALVTWTLTLLAMGLACK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI++ G R   LR LE F IILA TQLL V  LHAG
Sbjct  121  EISI-GLRPPSLRALETFTIILAGTQLLCVGSLHAG  155



>ref|NP_001152675.1| plasma membrane associated protein [Zea mays]
 gb|ACG48886.1| plasma membrane associated protein [Zea mays]
Length=226

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 69/148 (47%), Positives = 85/148 (57%), Gaps = 13/148 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHH----------PNFGGNGATMFFLA  723
            R +A PLL  NL +YV +LGFASW LN F++    H          P   G+ A + FL 
Sbjct  12   RNVAGPLLLFNLALYVSMLGFASWALNAFVDHIGDHQYYDPPAGAAPRSAGDEAMLHFLQ  71

Query  722  FSILAAVLG-IVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEIN--VGG  552
            F++LAAVLG         +   +WR   LAAA +   VAWA TALA GLACKE+      
Sbjct  72   FALLAAVLGSAAKAAAAFHARALWRPQGLAAAAALGTVAWAATALALGLACKEMRAAAAA  131

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLH  468
             RGW++R LEA   +LA TQL YVLMLH
Sbjct  132  ARGWQMRTLEAVTAVLAVTQLAYVLMLH  159



>ref|XP_003619776.1| hypothetical protein MTR_6g068860 [Medicago truncatula]
 gb|AES75994.1| ABA induced plasma membrane protein [Medicago truncatula]
Length=157

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 86/148 (58%), Gaps = 14/148 (9%)
 Frame = -2

Query  872  RTLAAPLLFLNLIMYVIVLGFASWCLNKFI----------NGQTH-HPNF--GGNGATMF  732
            +++A  LL LN  MYVIV+G  +W +N+ I          N   H  P F   GN +T F
Sbjct  2    KSVATLLLVLNFCMYVIVIGIGAWAMNRAIDHGFIIGPELNLPAHFSPIFFPMGNASTGF  61

Query  731  FLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGG  552
            F+  S+LA V+G  S   G  H+  W  +SL +A S A +AW +T LA G A KEI +  
Sbjct  62   FVTISLLAGVIGAASTISGVKHICSWTAESLPSAASIATLAWTLTLLAMGFAWKEIELQ-  120

Query  551  WRGWRLRVLEAFVIILAFTQLLYVLMLH  468
             R  RL+ +EAF+IIL+ TQLLY++ +H
Sbjct  121  IRNARLKTMEAFIIILSVTQLLYIVAIH  148



>ref|XP_010255851.1| PREDICTED: uncharacterized protein LOC104596402 [Nelumbo nucifera]
Length=166

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 87/156 (56%), Gaps = 17/156 (11%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFG-------------G  750
            MA    + +A  LL LNL+MYVIV   A W +N    G  H P                G
Sbjct  1    MASGATKVMAFTLLILNLLMYVIVTIIAGWAINY---GIEHTPTTVPIPAHIFPIYFPIG  57

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+  S++A ++GI +   G  ++  W   +L ++ SS+++ W++T LA GLACK
Sbjct  58   NMATGFFVIVSLIAGLVGIATSVSGIGNVLQWNLSNLLSSASSSILTWSLTLLAMGLACK  117

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EIN+G WR   LR +E   IIL+ TQL Y+  +HAG
Sbjct  118  EINIG-WRDANLRTMEVLTIILSGTQLFYMGTIHAG  152



>emb|CDY48343.1| BnaA09g26780D [Brassica napus]
Length=160

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 85/155 (55%), Gaps = 15/155 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFING--QTHHPNFG------------  753
            MA    + +A+ LL LN  M VIVLG   W +N+ I+   +   P+F             
Sbjct  1    MAGEQMKPVASLLLVLNFCMCVIVLGIGGWAMNRAIDRGFEIAGPDFNLPAHFAPIYFPM  60

Query  752  GNGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLAC  573
            GN AT FF+ F++LA V+G  S   G  H+R W   SL AA   A +AW +T LA G A 
Sbjct  61   GNAATGFFVTFALLAGVVGAASTISGLTHIRSWTVGSLPAAAMPATIAWTLTVLAMGFAW  120

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            KEI     R  +LR +EAF+IIL+ TQLLY+  +H
Sbjct  121  KEIEF-QVRNAKLRTMEAFLIILSVTQLLYIAAVH  154



>ref|XP_010667529.1| PREDICTED: uncharacterized protein LOC104884553 [Beta vulgaris 
subsp. vulgaris]
Length=145

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 85/143 (59%), Gaps = 7/143 (5%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGG--NGATMFFLAFS  717
            M     R  A+ LLFLN  MY +VLG   W +N+ IN    + + GG  N AT++F+ FS
Sbjct  1    MVNKQLRPAASFLLFLNFCMYAVVLGICGWAMNRMIN----YGSVGGGQNAATVYFVIFS  56

Query  716  ILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACKEINVGGWRGWR  537
            ++A  +G VS   G NH+  W  DSL AA ++  +AW++T LA G A K I +      R
Sbjct  57   LIAGAVGAVSCLFGLNHVAYWGPDSLPAAAAAGAIAWSLTMLALGFASKHIRLHT-DSHR  115

Query  536  LRVLEAFVIILAFTQLLYVLMLH  468
            L+ LEAF+IIL+ T LLY+  +H
Sbjct  116  LKTLEAFIIILSGTMLLYIGAIH  138



>ref|XP_002456208.1| hypothetical protein SORBIDRAFT_03g032160 [Sorghum bicolor]
 gb|EES01328.1| hypothetical protein SORBIDRAFT_03g032160 [Sorghum bicolor]
Length=157

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 86/156 (55%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    + +A  LL LN  MYVIV     W +N  IN       G     +F       G
Sbjct  1    MANEGMKPVAGLLLVLNFCMYVIVAAVGGWAINHAINYGFFIGTGLELPAHFSPIYFPIG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G +H+R W  +SL AA S+  VAW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIAGVVGAASALAGFHHVRAWSAESLPAAASAGFVAWTLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI + G R  RL  +E+F IIL+ TQL Y++ +H G
Sbjct  121  EIELHG-RNARLICMESFTIILSATQLFYLVAIHGG  155



>ref|NP_001048020.2| Os02g0731500 [Oryza sativa Japonica Group]
 dbj|BAH00961.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF09934.2| Os02g0731500 [Oryza sativa Japonica Group]
Length=132

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 72/103 (70%), Gaps = 1/103 (1%)
 Frame = -2

Query  887  ARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFINGQTHHPNFGGNGATMFFLAFSILA  708
            A T  R    PLL +NL+M+  VLG A W LNKFI+G+THH + GGN ++ + L FS++A
Sbjct  3    AGTACRRYIGPLLCVNLVMHAAVLGLAGWSLNKFIDGETHH-HLGGNTSSGYLLVFSLMA  61

Query  707  AVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGL  579
             V+G+ S      H+R WR ++LAAA S+ LV+WA+TAL+FGL
Sbjct  62   GVVGVCSVLPRLLHVRAWRGETLAAAASTGLVSWALTALSFGL  104



>emb|CDY43979.1| BnaA02g24570D [Brassica napus]
Length=158

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 65/155 (42%), Positives = 89/155 (57%), Gaps = 15/155 (10%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-GQTHHPNFG------------G  750
            MA    + +A+ LL LN  MY IVLG  +W +NK I+ G     +F             G
Sbjct  1    MAEQQMKPVASLLLLLNFCMYAIVLGIGAWSMNKAISHGFPIGADFSLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAF-GLAC  573
            N AT FF+ F+++A V G  S   G +HL+ W   SL AA S+A +AW++T LA     C
Sbjct  61   NAATGFFVMFALIAGVAGAASVISGFSHLQSWTTASLPAAVSAATIAWSLTVLAMRPFGC  120

Query  572  KEINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            KEI + G R  RLR +EAF+IIL+ TQLLY+  ++
Sbjct  121  KEIEL-GMRNARLRTMEAFLIILSATQLLYIAAIY  154



>ref|NP_001152147.1| plasma membrane associated protein [Zea mays]
 gb|ACF82901.1| unknown [Zea mays]
 gb|ACG46066.1| plasma membrane associated protein [Zea mays]
 tpg|DAA57968.1| TPA: plasma membrane associated protein [Zea mays]
Length=157

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 86/156 (55%), Gaps = 14/156 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    R +A  LL LN  MY+IV     W +N  IN       G     +F       G
Sbjct  1    MANAGMRPVAGLLLVLNFCMYIIVAAVGGWAINHAINYGFFIGAGLQLPAHFSPIYFPVG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G +H+R W  +SL AA S+  +AW +T LA GLA K
Sbjct  61   NAATGFFVIFAVIAGVVGAASALAGFHHVRAWNAESLPAAASAGFIAWTLTLLAMGLAVK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLHAG  462
            EI + G R  RL  +E+F IIL+ TQL Y+L ++ G
Sbjct  121  EIELHG-RNARLICMESFTIILSATQLFYLLAIYGG  155



>ref|XP_010687918.1| PREDICTED: uncharacterized protein LOC104901978 [Beta vulgaris 
subsp. vulgaris]
Length=157

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 59/154 (38%), Positives = 83/154 (54%), Gaps = 14/154 (9%)
 Frame = -2

Query  890  MARTVARTLAAPLLFLNLIMYVIVLGFASWCLNKFIN-------GQTHHPNFG------G  750
            MA    +  A  LL LN  MY ++LG   W +N+ I+       G     +F       G
Sbjct  1    MANESMKPAATLLLLLNFCMYAVLLGIGGWAMNRAIDHGFIIGPGLQLPAHFSPIYFPMG  60

Query  749  NGATMFFLAFSILAAVLGIVSKFMGGNHLRVWRNDslaaagssalvawaVTALAFGLACK  570
            N AT FF+ F+++A V+G  S   G  HLR W  ++  A  + A +AW +T LA G  CK
Sbjct  61   NAATGFFVMFALIAGVVGAASCISGFIHLRAWSRETTPATVTVATIAWTLTLLAMGFGCK  120

Query  569  EINVGGWRGWRLRVLEAFVIILAFTQLLYVLMLH  468
            EI +  +R  RL  +EAF IIL+ TQLLY+ +L+
Sbjct  121  EIQL-HYRNARLVAMEAFSIILSVTQLLYIAVLY  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2121035180950