BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c72055_g1_i1 len=111 path=[1:0-110]

Length=111
                                                                      Score     E

dbj|BAJ89466.1|  predicted protein                                    83.2    6e-18   
gb|EMT26751.1|  2-oxoglutarate dehydrogenase E1 component, mitoch...  85.9    6e-18   
gb|EMS58258.1|  2-oxoglutarate dehydrogenase, mitochondrial           85.9    7e-18   
ref|NP_001169948.1|  uncharacterized protein LOC100383847             84.0    8e-18   Zea mays [maize]
gb|EPS67577.1|  hypothetical protein M569_07198                       82.8    1e-17   
ref|XP_001754525.1|  predicted protein                                85.1    1e-17   
ref|XP_002446307.1|  hypothetical protein SORBIDRAFT_06g013940        84.7    2e-17   Sorghum bicolor [broomcorn]
ref|XP_008662239.1|  PREDICTED: uncharacterized protein LOC100383...  84.7    2e-17   
ref|XP_002446306.1|  hypothetical protein SORBIDRAFT_06g013930        84.7    2e-17   Sorghum bicolor [broomcorn]
ref|NP_001169698.1|  hypothetical protein                             84.7    2e-17   Zea mays [maize]
ref|XP_006365716.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.7    2e-17   
ref|XP_004975417.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.7    2e-17   
ref|XP_002864978.1|  E1 subunit of 2-oxoglutarate dehydrogenase       84.7    2e-17   
dbj|BAJ85565.1|  predicted protein                                    84.7    2e-17   
ref|XP_001753674.1|  predicted protein                                84.7    2e-17   
ref|XP_006652215.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.3    2e-17   
ref|XP_003579623.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.3    2e-17   
emb|CAH66433.1|  OSIGBa0096P03.7                                      84.3    2e-17   Oryza sativa [red rice]
gb|EEC77180.1|  hypothetical protein OsI_15669                        84.3    2e-17   Oryza sativa Indica Group [Indian rice]
ref|XP_009798399.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.3    2e-17   
ref|XP_009625315.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.3    2e-17   
ref|NP_001052638.2|  Os04g0390000                                     84.3    2e-17   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010264879.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.3    2e-17   
ref|XP_004142737.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.3    3e-17   
ref|XP_004156723.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.0    3e-17   
ref|XP_002978362.1|  hypothetical protein SELMODRAFT_152569           84.0    3e-17   
gb|EEE60899.1|  hypothetical protein OsJ_14584                        84.0    3e-17   Oryza sativa Japonica Group [Japonica rice]
gb|ACN35332.1|  unknown                                               81.3    3e-17   Zea mays [maize]
ref|XP_008463483.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.0    3e-17   
ref|XP_006393990.1|  hypothetical protein EUTSA_v10003576mg           84.0    3e-17   
ref|XP_006279568.1|  hypothetical protein CARUB_v10025801mg           84.0    3e-17   
ref|XP_010922391.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.0    3e-17   
dbj|BAF01922.1|  2-oxoglutarate dehydrogenase, E1 component           83.6    3e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008788082.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.0    3e-17   
ref|XP_010484418.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  84.0    4e-17   
emb|CAA16684.1|  oxoglutarate dehydrogenase - like protein            83.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006345940.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.6    4e-17   
ref|NP_201376.1|  2-oxoglutarate dehydrogenase, E1 component          83.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010444593.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.6    4e-17   
emb|CAA11552.1|  2-oxoglutarate dehydrogenase, E1 subunit             83.6    4e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45626.1|  BnaCnng13340D                                        83.6    4e-17   
ref|XP_010321375.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...  83.6    5e-17   
ref|XP_010463520.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.6    5e-17   
ref|XP_009599794.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.6    5e-17   
ref|XP_010531111.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.2    5e-17   
ref|XP_009760941.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.2    5e-17   
ref|XP_009381083.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.2    5e-17   
emb|CDY08754.1|  BnaA06g24700D                                        83.2    5e-17   
gb|KDP29853.1|  hypothetical protein JCGZ_18428                       83.2    6e-17   
ref|XP_009150667.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  83.2    6e-17   
ref|XP_002312072.2|  2-oxoglutarate dehydrogenase E1 component fa...  82.8    7e-17   Populus trichocarpa [western balsam poplar]
emb|CDP00050.1|  unnamed protein product                              82.8    7e-17   
ref|XP_007009422.1|  2-oxoglutarate dehydrogenase, E1 component i...  82.8    7e-17   
ref|XP_007009419.1|  2-oxoglutarate dehydrogenase, E1 component i...  82.8    8e-17   
ref|XP_009402330.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  82.8    8e-17   
ref|XP_002971476.1|  hypothetical protein SELMODRAFT_95372            82.4    9e-17   
ref|XP_007009423.1|  2-oxoglutarate dehydrogenase, E1 component i...  82.4    9e-17   
emb|CDY29088.1|  BnaC09g18140D                                        82.4    1e-16   
ref|XP_010273259.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  82.4    1e-16   
ref|XP_011024057.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  82.4    1e-16   
emb|CDY13078.1|  BnaA09g17390D                                        82.4    1e-16   
ref|XP_007009424.1|  2-oxoglutarate dehydrogenase, E1 component i...  82.4    1e-16   
ref|XP_002528465.1|  2-oxoglutarate dehydrogenase, putative           82.4    1e-16   Ricinus communis
ref|XP_011091861.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  82.4    1e-16   
gb|EYU38297.1|  hypothetical protein MIMGU_mgv1a000672mg              82.4    1e-16   
ref|XP_008343593.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...  82.0    1e-16   
ref|XP_010658604.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  82.0    1e-16   
gb|KDO67716.1|  hypothetical protein CISIN_1g001713mg                 82.0    2e-16   
dbj|BAF01713.1|  2-oxoglutarate dehydrogenase, E1 subunit - like ...  81.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403461.1|  hypothetical protein EUTSA_v10010095mg           82.0    2e-16   
ref|XP_002876300.1|  hypothetical protein ARALYDRAFT_485968           82.0    2e-16   
ref|XP_010427311.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  82.0    2e-16   
ref|NP_191101.2|  2-oxoglutarate dehydrogenase, E1 component          82.0    2e-16   Arabidopsis thaliana [mouse-ear cress]
emb|CAB75899.1|  2-oxoglutarate dehydrogenase, E1 subunit-like pr...  81.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010516108.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
ref|XP_009113882.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
ref|XP_010504395.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
gb|AAO42889.1|  At3g55410                                             81.6    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006290542.1|  hypothetical protein CARUB_v10016624mg           81.6    2e-16   
ref|XP_010273257.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
ref|NP_001060747.1|  Os07g0695800                                     81.6    2e-16   Oryza sativa Japonica Group [Japonica rice]
gb|KDO67715.1|  hypothetical protein CISIN_1g001713mg                 81.6    2e-16   
ref|XP_008794897.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
ref|XP_006658183.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
ref|XP_006436049.1|  hypothetical protein CICLE_v10030605mg           81.6    2e-16   
ref|XP_009412603.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
ref|XP_008371340.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
emb|CDY53693.1|  BnaA07g37870D                                        81.6    2e-16   
ref|XP_002966013.1|  hypothetical protein SELMODRAFT_83943            81.6    2e-16   
ref|XP_010920685.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.6    2e-16   
gb|KEH44475.1|  E1 subunit-like 2-oxoglutarate dehydrogenase          81.3    2e-16   
emb|CDY62385.1|  BnaCnng40160D                                        81.3    2e-16   
ref|XP_006441663.1|  hypothetical protein CICLE_v10018656mg           81.3    3e-16   
ref|XP_010260071.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
ref|XP_011027137.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
ref|XP_010518723.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
ref|XP_008343553.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
ref|XP_008370980.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
ref|XP_010690901.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
dbj|BAJ94174.1|  predicted protein                                    81.3    3e-16   
ref|XP_008461652.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  81.3    3e-16   
ref|XP_009103954.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    3e-16   
ref|XP_002315242.1|  2-oxoglutarate dehydrogenase E1 component fa...  80.9    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_004147698.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    3e-16   
ref|XP_008343561.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    3e-16   
ref|XP_010113203.1|  2-oxoglutarate dehydrogenase                     77.8    3e-16   
ref|XP_004307551.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    4e-16   
ref|XP_004497299.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    4e-16   
ref|XP_009337581.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    4e-16   
ref|XP_011085850.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    4e-16   
ref|XP_007220287.1|  hypothetical protein PRUPE_ppa000730mg           80.9    4e-16   
ref|XP_008233663.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    4e-16   
gb|EMS57708.1|  2-oxoglutarate dehydrogenase, mitochondrial           80.9    4e-16   
ref|XP_007142721.1|  hypothetical protein PHAVU_007G011400g           80.9    4e-16   
ref|XP_009357686.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.9    4e-16   
ref|XP_007511265.1|  predicted protein                                80.9    4e-16   
ref|XP_010096639.1|  2-oxoglutarate dehydrogenase                     80.5    5e-16   
ref|XP_008233579.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.5    5e-16   
ref|XP_007009427.1|  2-oxoglutarate dehydrogenase, E1 component       80.5    5e-16   
gb|EMT08930.1|  2-oxoglutarate dehydrogenase E1 component, mitoch...  80.5    5e-16   
gb|KHN23142.1|  2-oxoglutarate dehydrogenase, mitochondrial           80.5    5e-16   
ref|XP_003555815.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  80.5    5e-16   
ref|XP_007220910.1|  hypothetical protein PRUPE_ppa000728mg           80.5    5e-16   
gb|EYU42921.1|  hypothetical protein MIMGU_mgv1a000687mg              80.1    7e-16   
ref|XP_006848592.1|  hypothetical protein AMTR_s00168p00055310        79.7    8e-16   
ref|XP_008355411.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...  79.3    8e-16   
ref|XP_004307550.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.7    8e-16   
ref|XP_002950899.1|  E1 subunit of 2-oxoglutarate dehydrogenase       79.7    9e-16   
ref|XP_004958820.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.7    9e-16   
ref|XP_003062637.1|  predicted protein                                79.7    9e-16   
ref|XP_006478407.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.7    1e-15   
ref|XP_003579622.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.3    1e-15   
ref|XP_002439085.1|  hypothetical protein SORBIDRAFT_10g031320        76.6    1e-15   Sorghum bicolor [broomcorn]
ref|XP_010937698.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.3    1e-15   
emb|CBI31715.3|  unnamed protein product                              79.3    1e-15   
ref|XP_004236757.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.3    1e-15   
gb|KDO41108.1|  hypothetical protein CISIN_1g002323mg                 79.3    1e-15   
gb|KFM27866.1|  2-oxoglutarate dehydrogenase, mitochondrial           79.0    2e-15   
ref|WP_025896901.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|XP_010277600.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  79.0    2e-15   
ref|WP_036260567.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|WP_035571798.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|WP_034769725.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|WP_035579944.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|WP_034810500.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|WP_035547181.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
ref|WP_034791881.1|  2-oxoglutarate dehydrogenase                     79.0    2e-15   
gb|KCZ85403.1|  2-oxoglutarate dehydrogenase E1 component             79.0    2e-15   
gb|KCZ45322.1|  MFS transporter                                       79.0    2e-15   
gb|EWM24631.1|  2-oxoglutarate dehydrogenase e1 component             78.6    2e-15   
ref|XP_002970197.1|  hypothetical protein SELMODRAFT_93779            78.6    2e-15   
ref|NP_001169536.1|  uncharacterized protein LOC100383412             78.6    2e-15   Zea mays [maize]
gb|AFW75669.1|  hypothetical protein ZEAMMB73_452342                  78.6    2e-15   
ref|XP_001416923.1|  predicted protein                                78.6    2e-15   Ostreococcus lucimarinus CCE9901
ref|XP_001692870.1|  2-oxoglutarate dehydrogenase, E1 subunit         78.6    2e-15   Chlamydomonas reinhardtii
emb|CEF97097.1|  2-oxoglutarate dehydrogenase, E1 component           78.6    3e-15   
ref|WP_034846093.1|  2-oxoglutarate dehydrogenase                     78.2    3e-15   
ref|XP_005647897.1|  E1 subunit of 2-oxoglutarate dehydrogenase       78.2    3e-15   
ref|XP_002293467.1|  2-oxoglutarate dehydrogenase E1 component        77.8    4e-15   Thalassiosira pseudonana CCMP1335
ref|WP_026872998.1|  2-oxoglutarate dehydrogenase                     77.8    4e-15   
ref|XP_003078135.1|  putative 2-oxoglutarate dehydrogenase E1 com...  77.8    4e-15   
ref|XP_003518655.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  77.4    5e-15   
ref|XP_002501705.1|  predicted protein                                77.4    6e-15   Micromonas commoda
ref|WP_020401361.1|  hypothetical protein                             77.0    7e-15   
ref|WP_029012084.1|  2-oxoglutarate dehydrogenase                     77.0    7e-15   
ref|XP_002182131.1|  2-oxoglutarate dehydrogenase E1 component        77.0    8e-15   Phaeodactylum tricornutum CCAP 1055/1
gb|EJK52677.1|  hypothetical protein THAOC_28027                      77.0    8e-15   
ref|XP_010065984.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  77.0    9e-15   
dbj|BAQ15579.1|  2-oxoglutarate dehydrogenase E1 component            76.6    1e-14   
ref|XP_005849381.1|  hypothetical protein CHLNCDRAFT_57427            76.6    1e-14   
ref|WP_018148870.1|  MFS transporter                                  76.3    1e-14   
ref|XP_003621819.1|  Oxoglutarate dehydrogenase - like protein        76.3    2e-14   
gb|AES78037.2|  E1 subunit-like 2-oxoglutarate dehydrogenase          76.3    2e-14   
ref|WP_035725505.1|  2-oxoglutarate dehydrogenase                     75.9    2e-14   
ref|WP_038066288.1|  2-oxoglutarate dehydrogenase                     75.9    2e-14   
ref|WP_023785889.1|  MFS transporter                                  75.9    2e-14   
ref|XP_007139257.1|  hypothetical protein PHAVU_008G014400g           75.9    2e-14   
ref|WP_022699108.1|  MFS transporter                                  75.5    3e-14   
gb|KHN13877.1|  2-oxoglutarate dehydrogenase, mitochondrial           75.5    3e-14   
ref|XP_003552681.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  75.5    3e-14   
ref|WP_039683565.1|  2-oxoglutarate dehydrogenase                     75.5    3e-14   
ref|WP_037925097.1|  2-oxoglutarate dehydrogenase                     75.5    3e-14   
ref|WP_028954861.1|  2-oxoglutarate dehydrogenase                     75.5    3e-14   
ref|WP_015599578.1|  MFS transporter                                  75.1    3e-14   
ref|WP_013217180.1|  MFS transporter                                  75.1    3e-14   
ref|WP_026868019.1|  2-oxoglutarate dehydrogenase                     75.1    4e-14   
ref|XP_004341587.1|  oxoglutarate dehydrogenase (succinyltransfer...  75.1    4e-14   
ref|WP_011453956.1|  MFS transporter                                  74.7    5e-14   
ref|WP_013382958.1|  MFS transporter                                  74.7    5e-14   
ref|WP_037238507.1|  2-oxoglutarate dehydrogenase                     74.3    6e-14   
ref|WP_021101093.1|  2-oxoglutarate dehydrogenase E1 component        74.3    7e-14   
ref|WP_013418332.1|  MFS transporter                                  74.3    7e-14   
ref|XP_006378732.1|  hypothetical protein POPTR_0010s21620g           74.3    7e-14   
ref|WP_038132618.1|  2-oxoglutarate dehydrogenase                     73.9    8e-14   
ref|WP_038144208.1|  2-oxoglutarate dehydrogenase                     73.9    8e-14   
ref|WP_038077486.1|  2-oxoglutarate dehydrogenase                     73.9    8e-14   
ref|WP_008031579.1|  MFS transporter                                  73.9    8e-14   
ref|WP_004271793.1|  MFS transporter                                  73.9    1e-13   
ref|WP_013950124.1|  MULTISPECIES: MFS transporter                    73.9    1e-13   
ref|WP_033406482.1|  2-oxoglutarate dehydrogenase                     73.9    1e-13   
ref|WP_033404483.1|  2-oxoglutarate dehydrogenase                     73.9    1e-13   
ref|WP_015828075.1|  MFS transporter                                  73.9    1e-13   
ref|WP_035260180.1|  2-oxoglutarate dehydrogenase                     73.6    1e-13   
ref|WP_015466947.1|  2-oxoglutarate dehydrogenase E1 component        73.6    1e-13   
ref|WP_036561347.1|  2-oxoglutarate dehydrogenase                     73.6    1e-13   
ref|WP_014102211.1|  MFS transporter                                  73.6    1e-13   
ref|WP_011256593.1|  MFS transporter                                  73.6    1e-13   
ref|WP_010126668.1|  MFS transporter                                  73.6    1e-13   
ref|WP_037503825.1|  2-oxoglutarate dehydrogenase                     73.2    1e-13   
ref|WP_011386315.1|  MFS transporter                                  73.2    2e-13   
ref|WP_007668233.1|  MFS transporter                                  73.2    2e-13   
ref|WP_007670584.1|  MFS transporter                                  73.2    2e-13   
ref|XP_005717197.1|  2-oxoglutarate dehydrogenase, E1 component       73.2    2e-13   
ref|WP_034823565.1|  2-oxoglutarate dehydrogenase                     73.2    2e-13   
ref|XP_011027349.1|  PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutara...  73.2    2e-13   
dbj|BAE52765.1|  2-oxoglutarate dehydrogenase complex, dehydrogen...  73.2    2e-13   Magnetospirillum magneticum AMB-1
ref|WP_015457533.1|  2-oxoglutarate dehydrogenase E1 component        73.2    2e-13   
ref|WP_024315925.1|  2-oxoglutarate dehydrogenase                     73.2    2e-13   
emb|CDM62619.1|  2-oxoglutarate dehydrogenase E1 component            73.2    2e-13   
ref|WP_022735558.1|  MFS transporter                                  73.2    2e-13   
ref|WP_022702492.1|  MFS transporter                                  73.2    2e-13   
ref|WP_036722312.1|  2-oxoglutarate dehydrogenase                     73.2    2e-13   
ref|WP_031447032.1|  2-oxoglutarate dehydrogenase                     73.2    2e-13   
ref|WP_008621976.1|  2-oxoglutarate dehydrogenase E1 component        72.8    2e-13   
ref|WP_039018975.1|  2-oxoglutarate dehydrogenase                     72.8    2e-13   
emb|CEG20904.1|  2-oxoglutarate dehydrogenase, E1 component           72.8    2e-13   
gb|KDB56038.1|  2-oxoglutarate dehydrogenase                          72.8    2e-13   
gb|KDB54897.1|  2-oxoglutarate dehydrogenase                          72.8    2e-13   
ref|WP_011450956.1|  MFS transporter                                  72.8    2e-13   
ref|WP_021799718.1|  2-oxoglutarate dehydrogenase E1 component        72.8    2e-13   
ref|WP_020849364.1|  MFS transporter                                  72.8    2e-13   
ref|WP_035534996.1|  2-oxoglutarate dehydrogenase                     72.8    2e-13   
ref|WP_035617876.1|  2-oxoglutarate dehydrogenase                     72.8    2e-13   
ref|WP_034736182.1|  2-oxoglutarate dehydrogenase                     72.8    2e-13   
ref|WP_013962965.1|  MFS transporter                                  72.8    2e-13   
gb|KDA04475.1|  2-oxoglutarate dehydrogenase E1 component             72.8    2e-13   
ref|WP_011567856.1|  MFS transporter                                  72.8    2e-13   
ref|WP_020056465.1|  MFS transporter                                  72.8    2e-13   
ref|WP_011388968.1|  MFS transporter                                  72.8    2e-13   
ref|WP_008601989.1|  2-oxoglutarate dehydrogenase E1 component        72.8    3e-13   
ref|WP_008943060.1|  MFS transporter                                  72.8    3e-13   
ref|WP_037120638.1|  2-oxoglutarate dehydrogenase                     72.8    3e-13   
ref|WP_016558405.1|  2-oxoglutarate dehydrogenase E1 component        72.8    3e-13   
gb|ABC22014.1|  2-oxoglutarate dehydrogenase E1 component             72.8    3e-13   Rhodospirillum rubrum ATCC 11170
ref|WP_023839290.1|  MFS transporter                                  72.4    3e-13   
gb|AHF91879.1|  MFS transporter                                       72.4    3e-13   
ref|WP_038005698.1|  MULTISPECIES: 2-oxoglutarate dehydrogenase       72.4    3e-13   
ref|WP_007363098.1|  MFS transporter                                  72.4    3e-13   
gb|ETO22037.1|  hypothetical protein RFI_15167                        72.4    3e-13   
ref|WP_035092321.1|  2-oxoglutarate dehydrogenase                     72.4    3e-13   
ref|WP_035073913.1|  2-oxoglutarate dehydrogenase                     72.4    3e-13   
ref|WP_028038793.1|  2-oxoglutarate dehydrogenase                     72.4    3e-13   
ref|WP_012284326.1|  MFS transporter                                  72.4    3e-13   
ref|WP_028040535.1|  2-oxoglutarate dehydrogenase                     72.4    3e-13   
gb|EAL59660.1|  2-oxoglutarate dehydrogenase, E1 component            69.7    3e-13   Wolbachia endosymbiont of Drosophila simulans
gb|AAK22326.1|  2-oxoglutarate dehydrogenase, E1 component            72.4    3e-13   Caulobacter vibrioides
ref|WP_010918228.1|  MFS transporter                                  72.4    3e-13   
dbj|BAP00077.1|  2-oxoglutarate dehydrogenase E1 component            72.4    3e-13   
ref|WP_029206223.1|  hypothetical protein                             71.6    3e-13   
ref|XP_001750783.1|  hypothetical protein                             72.4    3e-13   Monosiga brevicollis MX1
ref|WP_028099767.1|  2-oxoglutarate dehydrogenase                     72.4    4e-13   
ref|WP_029641445.1|  2-oxoglutarate dehydrogenase                     72.0    4e-13   
ref|WP_025661384.1|  2-oxoglutarate dehydrogenase                     72.0    4e-13   
ref|WP_013066468.1|  MFS transporter                                  72.0    4e-13   
gb|AAA86904.1|  alpha-ketoglutarate dehydrogenase                     72.0    4e-13   Rhodobacter capsulatus
ref|WP_023918040.1|  MFS transporter                                  72.0    4e-13   
ref|WP_009563017.1|  MULTISPECIES: MFS transporter                    72.0    4e-13   
ref|WP_013046704.1|  MFS transporter                                  72.0    4e-13   
ref|WP_023914732.1|  MFS transporter                                  72.0    4e-13   
ref|WP_011338631.1|  MFS transporter                                  72.0    4e-13   
ref|WP_011907145.1|  MFS transporter                                  72.0    4e-13   
ref|WP_033924175.1|  2-oxoglutarate dehydrogenase                     72.0    5e-13   
ref|WP_017670555.1|  MFS transporter                                  72.0    5e-13   
ref|WP_002721253.1|  MFS transporter                                  72.0    5e-13   
ref|WP_029564389.1|  2-oxoglutarate dehydrogenase                     72.0    5e-13   
gb|AII86972.1|  2-oxoglutarate dehydrogenase E1 component SucA        72.0    5e-13   
ref|WP_038015680.1|  2-oxoglutarate dehydrogenase                     72.0    5e-13   
ref|WP_026381674.1|  2-oxoglutarate dehydrogenase                     72.0    5e-13   
ref|WP_015589501.1|  2-oxoglutarate dehydrogenase E1 component        71.6    5e-13   
ref|WP_038576287.1|  2-oxoglutarate dehydrogenase                     72.0    5e-13   
ref|WP_011444839.1|  MFS transporter                                  72.0    5e-13   
ref|WP_007011830.1|  MFS transporter                                  72.0    5e-13   
gb|KDD76103.1|  transketolase                                         72.0    5e-13   
ref|WP_010963171.1|  MFS transporter                                  71.6    5e-13   
emb|CDR79653.1|  2-oxoglutarate dehydrogenase E1 component,2-oxog...  71.6    5e-13   
ref|WP_009830431.1|  MFS transporter                                  71.6    5e-13   
ref|WP_028287753.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
gb|KGM50532.1|  2-oxoglutarate dehydrogenase                          71.6    5e-13   
ref|WP_036701821.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_036732133.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_036709924.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_022708404.1|  MFS transporter                                  71.6    5e-13   
ref|WP_024811005.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_009806148.1|  MFS transporter                                  71.6    5e-13   
ref|WP_038198461.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_029622995.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_019369768.1|  MFS transporter                                  71.6    5e-13   
ref|WP_028751284.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_037256919.1|  2-oxoglutarate dehydrogenase                     71.6    5e-13   
ref|WP_012673421.1|  MFS transporter                                  71.6    6e-13   
ref|WP_037182413.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_032987332.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_028737142.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_028733520.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_027682567.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_026188546.1|  MULTISPECIES: 2-oxoglutarate dehydrogenase       71.6    6e-13   
ref|WP_018902320.1|  MFS transporter                                  71.6    6e-13   
ref|WP_034853021.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_034802556.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_018235868.1|  MFS transporter                                  71.6    6e-13   
ref|WP_010970380.1|  MFS transporter                                  71.6    6e-13   
ref|WP_037278575.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
gb|EJC68428.1|  2-oxoglutarate dehydrogenase, E1 component            71.6    6e-13   
dbj|GAK71310.1|  2-oxoglutarate dehydrogenase E1 component            71.6    6e-13   
ref|WP_026620039.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_025425083.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_012567436.1|  MFS transporter                                  71.6    6e-13   
ref|WP_037162540.1|  MULTISPECIES: 2-oxoglutarate dehydrogenase       71.6    6e-13   
ref|WP_037128247.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_037097361.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_024271129.1|  2-oxoglutarate dehydrogenase E1 component SucA   71.6    6e-13   
ref|WP_018328637.1|  MFS transporter                                  71.6    6e-13   
ref|WP_036177935.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_024324258.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_017270753.1|  MFS transporter                                  71.6    6e-13   
ref|WP_003530264.1|  MFS transporter                                  71.6    6e-13   
ref|WP_029959267.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_012067152.1|  MULTISPECIES: MFS transporter                    71.6    6e-13   
ref|WP_022571836.1|  2-oxoglutarate dehydrogenase, E1 component       71.6    6e-13   
ref|WP_028011346.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_028001747.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_027992424.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_026615515.1|  2-oxoglutarate dehydrogenase                     71.6    6e-13   
ref|WP_018097288.1|  MFS transporter                                  71.6    6e-13   
ref|WP_017270046.1|  MFS transporter                                  71.6    6e-13   
ref|WP_014766203.1|  MFS transporter                                  71.6    6e-13   
ref|WP_012709614.1|  MFS transporter                                  71.6    7e-13   
ref|WP_005978938.1|  MFS transporter                                  71.6    7e-13   
ref|WP_018304229.1|  MFS transporter                                  71.6    7e-13   
ref|WP_025662907.1|  2-oxoglutarate dehydrogenase                     71.6    7e-13   
ref|WP_026757103.1|  2-oxoglutarate dehydrogenase                     71.6    7e-13   
ref|WP_007255153.1|  MFS transporter                                  71.6    7e-13   
ref|WP_021236125.1|  MFS transporter                                  71.2    7e-13   
ref|WP_039388031.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_039337382.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_013832956.1|  MFS transporter                                  71.2    7e-13   
ref|WP_023460637.1|  MFS transporter                                  71.6    7e-13   
ref|WP_013477771.1|  MFS transporter                                  71.6    7e-13   
ref|WP_021777426.1|  acyl-CoA dehydrogenase MmgC protein              71.6    7e-13   
ref|WP_027235116.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_014879050.1|  MFS transporter                                  71.2    7e-13   
ref|WP_014873463.1|  MFS transporter                                  71.2    7e-13   
ref|WP_007548534.1|  MFS transporter                                  71.2    7e-13   
ref|WP_033232594.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_029911087.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_009813038.1|  MFS transporter                                  71.2    7e-13   
ref|WP_029207633.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|XP_005535735.1|  2-oxoglutarate dehydrogenase, E1 component       71.2    7e-13   
ref|WP_027256410.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_024088965.1|  MFS transporter                                  71.2    7e-13   
ref|WP_035598973.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_011645342.1|  MULTISPECIES: MFS transporter                    71.2    7e-13   
ref|WP_008519361.1|  MFS transporter                                  71.2    7e-13   
ref|WP_037456285.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
ref|WP_037393717.1|  2-oxoglutarate dehydrogenase                     71.2    7e-13   
gb|AHE54985.1|  MFS transporter                                       71.2    8e-13   
ref|WP_037469680.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037429635.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_025264158.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_014869243.1|  MFS transporter                                  71.2    8e-13   
ref|WP_035845933.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
gb|AJE48589.1|  2-oxoglutarate dehydrogenase E1 component             71.2    8e-13   
ref|WP_039623559.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037218937.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037196805.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037149070.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037118018.1|  MULTISPECIES: 2-oxoglutarate dehydrogenase       71.2    8e-13   
ref|WP_037101731.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037094942.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037091895.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_037072000.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_034508946.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_029870975.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_028743652.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_028739984.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_027689399.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_027666882.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_027511709.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_026265488.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_026160038.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_026154364.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_038692789.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_025668714.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_024352176.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_024320361.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_034521666.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_012652667.1|  MFS transporter                                  71.2    8e-13   
ref|WP_003589814.1|  MFS transporter                                  71.2    8e-13   
ref|WP_012485483.1|  MULTISPECIES: MFS transporter                    71.2    8e-13   
ref|WP_011427083.1|  MFS transporter                                  71.2    8e-13   
gb|AHG47200.1|  MFS transporter                                       71.2    8e-13   
gb|AHF85967.1|  MFS transporter                                       71.2    8e-13   
ref|WP_020922471.1|  2-oxoglutarate dehydrogenase E1 component        71.2    8e-13   
ref|WP_018069067.1|  MFS transporter                                  71.2    8e-13   
ref|WP_017962385.1|  MFS transporter                                  71.2    8e-13   
ref|WP_015341407.1|  oxoglutarate dehydrogenase (succinyl-transfe...  71.2    8e-13   
ref|WP_008528021.1|  MFS transporter                                  71.2    8e-13   
ref|WP_007632543.1|  MFS transporter                                  71.2    8e-13   
ref|WP_007690164.1|  MFS transporter                                  71.2    8e-13   
ref|WP_009211416.1|  MFS transporter                                  71.2    8e-13   
ref|WP_028033784.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
ref|WP_023723113.1|  MFS transporter                                  71.2    8e-13   
ref|WP_023679791.1|  MFS transporter                                  71.2    8e-13   
ref|WP_018430330.1|  MFS transporter                                  71.2    8e-13   
ref|XP_005973694.1|  PREDICTED: 2-oxoglutarate dehydrogenase, mit...  71.2    8e-13   
gb|EJJ26930.1|  2-oxoglutarate dehydrogenase, E1 component            71.2    8e-13   
gb|KEC71657.1|  2-oxoglutarate dehydrogenase E1 component             71.2    8e-13   
gb|EJC81617.1|  2-oxoglutarate dehydrogenase, E1 component            71.2    8e-13   
gb|EJC76100.1|  2-oxoglutarate dehydrogenase, E1 component            71.2    8e-13   
ref|WP_011653810.1|  MFS transporter                                  71.2    8e-13   
ref|WP_004619221.1|  2-oxoglutarate dehydrogenase E1 component        71.2    8e-13   
ref|WP_039710458.1|  2-oxoglutarate dehydrogenase                     71.2    8e-13   
emb|CDX40106.1|  2-oxoglutarate decarboxylase, component of the 2...  71.2    8e-13   
ref|WP_037566674.1|  2-oxoglutarate dehydrogenase                     71.2    9e-13   
ref|WP_017972285.1|  MFS transporter                                  71.2    9e-13   
emb|CDX22745.1|  2-oxoglutarate decarboxylase, component of the 2...  71.2    9e-13   
gb|ENN89594.1|  2-oxoglutarate dehydrogenase E1 component             71.2    9e-13   
ref|WP_034481707.1|  2-oxoglutarate dehydrogenase                     71.2    9e-13   
emb|CDX41866.1|  2-oxoglutarate decarboxylase, component of the 2...  71.2    9e-13   
emb|CDX25772.1|  2-oxoglutarate decarboxylase, component of the 2...  71.2    9e-13   
ref|WP_006202655.1|  MFS transporter                                  71.2    9e-13   
ref|WP_020180940.1|  MFS transporter                                  71.2    9e-13   
ref|WP_019219275.1|  MFS transporter                                  71.2    9e-13   
ref|WP_039001425.1|  2-oxoglutarate dehydrogenase                     70.9    9e-13   
ref|WP_022675964.1|  MFS transporter                                  70.9    9e-13   
ref|WP_006310786.1|  MFS transporter                                  70.9    1e-12   
ref|WP_003516728.1|  MULTISPECIES: MFS transporter                    70.9    1e-12   
ref|WP_010972453.1|  MULTISPECIES: MFS transporter                    70.9    1e-12   
ref|WP_039195258.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_026238968.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_026236828.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_037389812.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_021587491.1|  MFS transporter                                  70.9    1e-12   
ref|WP_006467989.1|  MFS transporter                                  70.9    1e-12   
ref|WP_024898521.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_007872218.1|  2-oxoglutarate dehydrogenase E1 component        70.9    1e-12   
ref|WP_010657592.1|  MULTISPECIES: MFS transporter                    70.9    1e-12   
emb|CDX30460.1|  2-oxoglutarate decarboxylase, component of the 2...  70.9    1e-12   
ref|WP_024847154.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_024587449.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_037417768.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
gb|EZG47695.1|  2-oxoglutarate dehydrogenase E1 component             70.9    1e-12   
gb|AHM04102.1|  2-oxoglutarate dehydrogenase E1 component             70.9    1e-12   
ref|WP_028028424.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_036485915.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_022712275.1|  MFS transporter                                  70.9    1e-12   
ref|WP_024081747.1|  2-oxoglutarate decarboxylase, component of t...  70.9    1e-12   
ref|WP_012179544.1|  MFS transporter                                  70.9    1e-12   
ref|WP_017970957.1|  MFS transporter                                  70.9    1e-12   
dbj|BAD02368.1|  2-oxoglutarate dehydrogenase                         70.1    1e-12   
emb|CAM74889.1|  2-oxoglutarate dehydrogenase E1 component            70.9    1e-12   
ref|WP_027169860.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_008233147.1|  MFS transporter                                  70.9    1e-12   
ref|WP_006163605.1|  2-oxoglutarate dehydrogenase E1 component        70.9    1e-12   
ref|WP_006014251.1|  MFS transporter                                  70.9    1e-12   
gb|AAN78226.1|  alpha-ketoglutarate dehydrogenase                     68.2    1e-12   
ref|WP_029563136.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_027839642.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_029086446.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_014330052.1|  MFS transporter                                  70.9    1e-12   
ref|WP_038659569.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_037536643.1|  2-oxoglutarate dehydrogenase                     70.9    1e-12   
ref|WP_017978731.1|  MFS transporter                                  70.9    1e-12   
ref|WP_029167295.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_035707932.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_008993484.1|  MFS transporter                                  70.5    1e-12   
ref|WP_017943587.1|  MFS transporter                                  70.5    1e-12   
ref|WP_028296789.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_006173434.1|  MULTISPECIES: MFS transporter                    70.5    1e-12   
ref|WP_004692111.1|  MULTISPECIES: MFS transporter                    70.5    1e-12   
gb|AHC73981.1|  oxoglutarate dehydrogenase (succinyl-transferring...  70.5    1e-12   
ref|WP_018038829.1|  hypothetical protein                             70.5    1e-12   
ref|WP_006169880.1|  MULTISPECIES: MFS transporter                    70.5    1e-12   
ref|WP_004689282.1|  MFS transporter                                  70.5    1e-12   
gb|AJD43107.1|  2-oxoglutarate dehydrogenase E1 component             70.5    1e-12   
ref|WP_037132141.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_037116318.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_037059223.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_028747466.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_026157494.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_025658193.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_024316822.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   
ref|WP_018855748.1|  MFS transporter                                  70.5    1e-12   
ref|WP_016556583.1|  2-oxoglutarate dehydrogenase E1 component        70.5    1e-12   
ref|WP_007528152.1|  MFS transporter                                  70.5    1e-12   
ref|WP_007796984.1|  MFS transporter                                  70.5    1e-12   
ref|WP_012759276.1|  MFS transporter                                  70.5    1e-12   
ref|WP_004687685.1|  MULTISPECIES: MFS transporter                    70.5    1e-12   
dbj|GAK34267.1|  2-oxoglutarate dehydrogenase E1 component            70.5    1e-12   
ref|WP_033922966.1|  2-oxoglutarate dehydrogenase                     70.5    1e-12   



>dbj|BAJ89466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score = 83.2 bits (204),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  70   NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  106



>gb|EMT26751.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial [Aegilops 
tauschii]
Length=1154

 Score = 85.9 bits (211),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  943  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  979



>gb|EMS58258.1| 2-oxoglutarate dehydrogenase, mitochondrial [Triticum urartu]
Length=985

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  774  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  810



>ref|NP_001169948.1| uncharacterized protein LOC100383847 [Zea mays]
 gb|ACN32069.1| unknown [Zea mays]
Length=416

 Score = 84.0 bits (206),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  205  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  241



>gb|EPS67577.1| hypothetical protein M569_07198, partial [Genlisea aurea]
Length=348

 Score = 82.8 bits (203),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  217  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  253



>ref|XP_001754525.1| predicted protein [Physcomitrella patens]
 gb|EDQ80495.1| predicted protein [Physcomitrella patens]
Length=972

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HRDFRKP+I+MSPKNL
Sbjct  766  NWQVVNVTTPANYFHVLRRQVHRDFRKPMIIMSPKNL  802



>ref|XP_002446307.1| hypothetical protein SORBIDRAFT_06g013940 [Sorghum bicolor]
 gb|EES10635.1| hypothetical protein SORBIDRAFT_06g013940 [Sorghum bicolor]
Length=1025

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  814  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  850



>ref|XP_008662239.1| PREDICTED: uncharacterized protein LOC100383847 isoform X1 [Zea 
mays]
 gb|AFW58072.1| hypothetical protein ZEAMMB73_255234 [Zea mays]
 gb|AFW58073.1| hypothetical protein ZEAMMB73_255234 [Zea mays]
Length=1025

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  814  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  850



>ref|XP_002446306.1| hypothetical protein SORBIDRAFT_06g013930 [Sorghum bicolor]
 gb|EES10634.1| hypothetical protein SORBIDRAFT_06g013930 [Sorghum bicolor]
Length=1025

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  814  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  850



>ref|NP_001169698.1| hypothetical protein [Zea mays]
 ref|XP_008668443.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668444.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN34576.1| unknown [Zea mays]
 tpg|DAA38145.1| TPA: hypothetical protein ZEAMMB73_516904 [Zea mays]
 tpg|DAA38146.1| TPA: hypothetical protein ZEAMMB73_516904 [Zea mays]
Length=1025

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  814  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  850



>ref|XP_006365716.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006365717.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006365718.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X3 [Solanum tuberosum]
Length=1020

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>ref|XP_004975417.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Setaria 
italica]
Length=1023

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  812  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  848



>ref|XP_002864978.1| E1 subunit of 2-oxoglutarate dehydrogenase [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41237.1| E1 subunit of 2-oxoglutarate dehydrogenase [Arabidopsis lyrata 
subsp. lyrata]
Length=1025

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  849



>dbj|BAJ85565.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1016

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  805  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  841



>ref|XP_001753674.1| predicted protein [Physcomitrella patens]
 gb|EDQ81426.1| predicted protein [Physcomitrella patens]
Length=1041

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLI+MSPKNL
Sbjct  831  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIIMSPKNL  867



>ref|XP_006652215.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Oryza 
brachyantha]
Length=1017

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  806  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  842



>ref|XP_003579623.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Brachypodium 
distachyon]
Length=1016

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  805  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  841



>emb|CAH66433.1| OSIGBa0096P03.7 [Oryza sativa Indica Group]
Length=1016

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  805  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  841



>gb|EEC77180.1| hypothetical protein OsI_15669 [Oryza sativa Indica Group]
Length=1016

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  805  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  841



>ref|XP_009798399.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nicotiana 
sylvestris]
Length=1020

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>ref|XP_009625315.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nicotiana 
tomentosiformis]
 ref|XP_009625316.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=1020

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>ref|NP_001052638.2| Os04g0390000 [Oryza sativa Japonica Group]
 dbj|BAF14552.2| Os04g0390000, partial [Oryza sativa Japonica Group]
Length=1001

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  790  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  826



>ref|XP_010264879.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nelumbo 
nucifera]
 ref|XP_010264880.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nelumbo 
nucifera]
Length=1022

 Score = 84.3 bits (207),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  811  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  847



>ref|XP_004142737.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 gb|KGN51279.1| hypothetical protein Csa_5G512860 [Cucumis sativus]
Length=1021

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  846



>ref|XP_004156723.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
Length=1021

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  846



>ref|XP_002978362.1| hypothetical protein SELMODRAFT_152569 [Selaginella moellendorffii]
 gb|EFJ20348.1| hypothetical protein SELMODRAFT_152569 [Selaginella moellendorffii]
Length=969

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HRDFRKPLI+MSPKNL
Sbjct  762  NWQVVNVTTPANYFHVLRRQLHRDFRKPLIIMSPKNL  798



>gb|EEE60899.1| hypothetical protein OsJ_14584 [Oryza sativa Japonica Group]
Length=999

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  788  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  824



>gb|ACN35332.1| unknown [Zea mays]
Length=302

 Score = 81.3 bits (199),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  91   NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  127



>ref|XP_008463483.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
melo]
 ref|XP_008463484.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
melo]
Length=1021

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  846



>ref|XP_006393990.1| hypothetical protein EUTSA_v10003576mg [Eutrema salsugineum]
 gb|ESQ31276.1| hypothetical protein EUTSA_v10003576mg [Eutrema salsugineum]
Length=1025

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  849



>ref|XP_006279568.1| hypothetical protein CARUB_v10025801mg [Capsella rubella]
 gb|EOA12466.1| hypothetical protein CARUB_v10025801mg [Capsella rubella]
Length=1025

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  849



>ref|XP_010922391.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Elaeis 
guineensis]
 ref|XP_010922392.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Elaeis 
guineensis]
Length=1020

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>dbj|BAF01922.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
Length=673

 Score = 83.6 bits (205),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  461  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  497



>ref|XP_008788082.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008788084.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Phoenix 
dactylifera]
Length=1020

 Score = 84.0 bits (206),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>ref|XP_010484418.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
Length=1025

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  849



>emb|CAA16684.1| oxoglutarate dehydrogenase - like protein [Arabidopsis thaliana]
Length=973

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  849



>ref|XP_006345940.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Solanum 
tuberosum]
Length=1019

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|NP_201376.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
 dbj|BAB10682.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
 gb|AAL67070.1| putative 2-oxoglutarate dehydrogenase E1 component [Arabidopsis 
thaliana]
 gb|AAM20281.1| putative 2-oxoglutarate dehydrogenase E1 component [Arabidopsis 
thaliana]
 gb|AED98101.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
Length=1025

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  849



>ref|XP_010444593.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
Length=1027

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  815  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  851



>emb|CAA11552.1| 2-oxoglutarate dehydrogenase, E1 subunit [Arabidopsis thaliana]
Length=1027

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  815  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  851



>emb|CDY45626.1| BnaCnng13340D [Brassica napus]
Length=904

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  692  NWQIVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  728



>ref|XP_010321375.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase, 
mitochondrial [Solanum lycopersicum]
Length=1020

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  846



>ref|XP_010463520.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
Length=1025

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  849



>ref|XP_009599794.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nicotiana 
tomentosiformis]
Length=1020

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_010531111.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Tarenaya 
hassleriana]
 ref|XP_010531173.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Tarenaya 
hassleriana]
 ref|XP_010531256.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Tarenaya 
hassleriana]
 ref|XP_010531334.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Tarenaya 
hassleriana]
Length=1020

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NWQIVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>ref|XP_009760941.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nicotiana 
sylvestris]
 ref|XP_009760942.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nicotiana 
sylvestris]
Length=1020

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_009381083.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=1021

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HRDFRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQLHRDFRKPLIVMSPKNL  846



>emb|CDY08754.1| BnaA06g24700D [Brassica napus]
Length=904

 Score = 83.2 bits (204),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  692  NWQIVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  728



>gb|KDP29853.1| hypothetical protein JCGZ_18428 [Jatropha curcas]
Length=1021

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  846



>ref|XP_009150667.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Brassica 
rapa]
Length=1014

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  802  NWQIVNVTTPANYFHVLRRQIHRDFRKPLIVMAPKNL  838



>ref|XP_002312072.2| 2-oxoglutarate dehydrogenase E1 component family protein [Populus 
trichocarpa]
 gb|EEE89439.2| 2-oxoglutarate dehydrogenase E1 component family protein [Populus 
trichocarpa]
Length=1021

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPL+VM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNL  846



>emb|CDP00050.1| unnamed protein product [Coffea canephora]
Length=1021

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  811  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  847



>ref|XP_007009422.1| 2-oxoglutarate dehydrogenase, E1 component isoform 4 [Theobroma 
cacao]
 gb|EOY18232.1| 2-oxoglutarate dehydrogenase, E1 component isoform 4 [Theobroma 
cacao]
Length=944

 Score = 82.8 bits (203),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>ref|XP_007009419.1| 2-oxoglutarate dehydrogenase, E1 component isoform 1 [Theobroma 
cacao]
 ref|XP_007009420.1| 2-oxoglutarate dehydrogenase, E1 component isoform 1 [Theobroma 
cacao]
 gb|EOY18229.1| 2-oxoglutarate dehydrogenase, E1 component isoform 1 [Theobroma 
cacao]
 gb|EOY18230.1| 2-oxoglutarate dehydrogenase, E1 component isoform 1 [Theobroma 
cacao]
Length=1023

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>ref|XP_009402330.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=1024

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  849



>ref|XP_002971476.1| hypothetical protein SELMODRAFT_95372 [Selaginella moellendorffii]
 gb|EFJ27225.1| hypothetical protein SELMODRAFT_95372 [Selaginella moellendorffii]
Length=971

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPL+VM+PKNL
Sbjct  764  NWQVVNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNL  800



>ref|XP_007009423.1| 2-oxoglutarate dehydrogenase, E1 component isoform 5 [Theobroma 
cacao]
 gb|EOY18233.1| 2-oxoglutarate dehydrogenase, E1 component isoform 5 [Theobroma 
cacao]
Length=899

 Score = 82.4 bits (202),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>emb|CDY29088.1| BnaC09g18140D [Brassica napus]
Length=899

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  691  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  727



>ref|XP_010273259.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=1002

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFH LRRQIHRDFRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHALRRQIHRDFRKPLIVMAPKNL  846



>ref|XP_011024057.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Populus 
euphratica]
 ref|XP_011024131.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Populus 
euphratica]
Length=1021

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHRDFRKPL+VM+PKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNL  846



>emb|CDY13078.1| BnaA09g17390D [Brassica napus]
Length=899

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  691  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  727



>ref|XP_007009424.1| 2-oxoglutarate dehydrogenase, E1 component isoform 6 [Theobroma 
cacao]
 gb|EOY18234.1| 2-oxoglutarate dehydrogenase, E1 component isoform 6 [Theobroma 
cacao]
Length=907

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>ref|XP_002528465.1| 2-oxoglutarate dehydrogenase, putative [Ricinus communis]
 gb|EEF33948.1| 2-oxoglutarate dehydrogenase, putative [Ricinus communis]
Length=1021

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HRDFRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQLHRDFRKPLIVMAPKNL  846



>ref|XP_011091861.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Sesamum 
indicum]
Length=1018

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>gb|EYU38297.1| hypothetical protein MIMGU_mgv1a000672mg [Erythranthe guttata]
Length=1023

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  846



>ref|XP_008343593.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase, 
mitochondrial-like [Malus domestica]
Length=864

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  653  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  689



>ref|XP_010658604.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Vitis 
vinifera]
Length=1024

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  813  NWQIVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  849



>gb|KDO67716.1| hypothetical protein CISIN_1g001713mg [Citrus sinensis]
Length=925

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPL+VMSPKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHREFRKPLVVMSPKNL  846



>dbj|BAF01713.1| 2-oxoglutarate dehydrogenase, E1 subunit - like protein [Arabidopsis 
thaliana]
Length=611

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  403  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  439



>ref|XP_006403461.1| hypothetical protein EUTSA_v10010095mg [Eutrema salsugineum]
 ref|XP_006403462.1| hypothetical protein EUTSA_v10010095mg [Eutrema salsugineum]
 gb|ESQ44914.1| hypothetical protein EUTSA_v10010095mg [Eutrema salsugineum]
 gb|ESQ44915.1| hypothetical protein EUTSA_v10010095mg [Eutrema salsugineum]
Length=996

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  788  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  824



>ref|XP_002876300.1| hypothetical protein ARALYDRAFT_485968 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52559.1| hypothetical protein ARALYDRAFT_485968 [Arabidopsis lyrata subsp. 
lyrata]
Length=1017

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_010427311.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
 ref|XP_010427312.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
Length=1017

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|NP_191101.2| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
 gb|AEE79381.1| 2-oxoglutarate dehydrogenase, E1 component [Arabidopsis thaliana]
Length=1017

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>emb|CAB75899.1| 2-oxoglutarate dehydrogenase, E1 subunit-like protein [Arabidopsis 
thaliana]
Length=1009

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_010516108.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
Length=1017

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_009113882.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Brassica 
rapa]
Length=1019

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  811  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  847



>ref|XP_010504395.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Camelina 
sativa]
Length=1017

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>gb|AAO42889.1| At3g55410 [Arabidopsis thaliana]
 dbj|BAE99494.1| 2-oxoglutarate dehydrogenase, E1 subunit - like protein [Arabidopsis 
thaliana]
Length=1017

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_006290542.1| hypothetical protein CARUB_v10016624mg [Capsella rubella]
 gb|EOA23440.1| hypothetical protein CARUB_v10016624mg [Capsella rubella]
Length=1017

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQIHRDFRKPLIVM+PKNL
Sbjct  809  NWQIVNATTPANYFHVLRRQIHRDFRKPLIVMAPKNL  845



>ref|XP_010273257.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=1021

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFH LRRQIHRDFRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHALRRQIHRDFRKPLIVMAPKNL  846



>ref|NP_001060747.1| Os07g0695800 [Oryza sativa Japonica Group]
 dbj|BAC84070.1| putative 2-oxoglutarate dehydrogenase, E1 subunit [Oryza sativa 
Japonica Group]
 dbj|BAF22661.1| Os07g0695800 [Oryza sativa Japonica Group]
 dbj|BAG94630.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1008

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  798  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  834



>gb|KDO67715.1| hypothetical protein CISIN_1g001713mg [Citrus sinensis]
Length=1021

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPL+VMSPKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHREFRKPLVVMSPKNL  846



>ref|XP_008794897.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Phoenix 
dactylifera]
 ref|XP_008794906.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Phoenix 
dactylifera]
Length=1026

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  815  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  851



>ref|XP_006658183.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like, 
partial [Oryza brachyantha]
Length=978

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  768  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  804



>ref|XP_006436049.1| hypothetical protein CICLE_v10030605mg [Citrus clementina]
 ref|XP_006486062.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Citrus 
sinensis]
 gb|ESR49289.1| hypothetical protein CICLE_v10030605mg [Citrus clementina]
Length=1021

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPL+VMSPKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHREFRKPLVVMSPKNL  846



>ref|XP_009412603.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009412604.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Musa 
acuminata subsp. malaccensis]
Length=1024

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  813  NWQIVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  849



>ref|XP_008371340.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Malus 
domestica]
Length=1019

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  808  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  844



>emb|CDY53693.1| BnaA07g37870D [Brassica napus]
Length=899

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQ+HRDFRKPLIVM+PKNL
Sbjct  691  NWQIVNATTPANYFHVLRRQLHRDFRKPLIVMAPKNL  727



>ref|XP_002966013.1| hypothetical protein SELMODRAFT_83943 [Selaginella moellendorffii]
 gb|EFJ33433.1| hypothetical protein SELMODRAFT_83943 [Selaginella moellendorffii]
Length=971

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV+NVTTPANYFHVLRRQIHRDFRKPL+VM+PKNL
Sbjct  764  NWQVMNVTTPANYFHVLRRQIHRDFRKPLVVMAPKNL  800



>ref|XP_010920685.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Elaeis 
guineensis]
 ref|XP_010920686.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Elaeis 
guineensis]
Length=1026

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  815  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  851



>gb|KEH44475.1| E1 subunit-like 2-oxoglutarate dehydrogenase [Medicago truncatula]
Length=1023

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  812  NWQVVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  848



>emb|CDY62385.1| BnaCnng40160D [Brassica napus]
Length=899

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQ+HRDFRKPLIVM+PKNL
Sbjct  691  NWQIVNATTPANYFHVLRRQLHRDFRKPLIVMAPKNL  727



>ref|XP_006441663.1| hypothetical protein CICLE_v10018656mg [Citrus clementina]
 gb|ESR54903.1| hypothetical protein CICLE_v10018656mg [Citrus clementina]
Length=1024

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR FRKPLIVMSPKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHRGFRKPLIVMSPKNL  846



>ref|XP_010260071.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nelumbo 
nucifera]
Length=1022

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  811  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  847



>ref|XP_011027137.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Populus 
euphratica]
 ref|XP_011027138.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Populus 
euphratica]
Length=1021

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPL+V++PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLVVIAPKNL  846



>ref|XP_010518723.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Tarenaya 
hassleriana]
Length=1021

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN+TTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNITTPANYFHVLRRQIHREFRKPLIVMAPKNL  846



>ref|XP_008343553.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Malus 
domestica]
Length=1019

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  808  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  844



>ref|XP_008370980.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial [Malus 
domestica]
Length=1019

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  808  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  844



>ref|XP_010690901.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Beta 
vulgaris subsp. vulgaris]
Length=1030

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  816  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMAPKNL  852



>dbj|BAJ94174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1018

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIV +PKNL
Sbjct  808  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVTAPKNL  844



>ref|XP_008461652.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
melo]
 ref|XP_008461653.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
melo]
Length=1022

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPL+VM+PKNL
Sbjct  811  NWQVVNVTTPANYFHVLRRQIHREFRKPLVVMAPKNL  847



>ref|XP_009103954.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Brassica 
rapa]
Length=1016

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQ+HRDFRKPLIVM+PKNL
Sbjct  808  NWQIVNATTPANYFHVLRRQLHRDFRKPLIVMAPKNL  844



>ref|XP_002315242.1| 2-oxoglutarate dehydrogenase E1 component family protein [Populus 
trichocarpa]
 gb|EEF01413.1| 2-oxoglutarate dehydrogenase E1 component family protein [Populus 
trichocarpa]
Length=1021

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPL+V++PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHRDFRKPLVVIAPKNL  846



>ref|XP_004147698.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 ref|XP_004166082.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cucumis 
sativus]
 gb|KGN50538.1| hypothetical protein Csa_5G181450 [Cucumis sativus]
Length=1022

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPL+VM+PKNL
Sbjct  811  NWQVVNVTTPANYFHVLRRQIHREFRKPLVVMAPKNL  847



>ref|XP_008343561.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Malus 
domestica]
Length=1011

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN+TTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  808  NWQVVNLTTPANYFHVLRRQIHREFRKPLIVMAPKNL  844



>ref|XP_010113203.1| 2-oxoglutarate dehydrogenase [Morus notabilis]
 gb|EXC73703.1| 2-oxoglutarate dehydrogenase [Morus notabilis]
Length=234

 Score = 77.8 bits (190),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHV+RRQIHR+FRKPLIVM+PKNL
Sbjct  24   NWQVVNVTTPANYFHVMRRQIHREFRKPLIVMAPKNL  60



>ref|XP_004307551.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=1013

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPL+VM+PKNL
Sbjct  805  NWQVVNVTTPANYFHVLRRQIHREFRKPLVVMAPKNL  841



>ref|XP_004497299.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Cicer 
arietinum]
Length=1024

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  813  NWQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  849



>ref|XP_009337581.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=1034

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  823  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  859



>ref|XP_011085850.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Sesamum 
indicum]
 ref|XP_011085858.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Sesamum 
indicum]
 ref|XP_011085864.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Sesamum 
indicum]
Length=1019

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  846



>ref|XP_007220287.1| hypothetical protein PRUPE_ppa000730mg [Prunus persica]
 gb|EMJ21486.1| hypothetical protein PRUPE_ppa000730mg [Prunus persica]
Length=1021

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  845



>ref|XP_008233663.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Prunus 
mume]
Length=1033

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  809  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  845



>gb|EMS57708.1| 2-oxoglutarate dehydrogenase, mitochondrial [Triticum urartu]
Length=1146

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIV +PKNL
Sbjct  936  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVTAPKNL  972



>ref|XP_007142721.1| hypothetical protein PHAVU_007G011400g [Phaseolus vulgaris]
 gb|ESW14715.1| hypothetical protein PHAVU_007G011400g [Phaseolus vulgaris]
Length=1026

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  815  NWQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  851



>ref|XP_009357686.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009357687.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009347455.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009347456.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=1013

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN+TTPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNLTTPANYFHVLRRQIHREFRKPLIVMAPKNL  846



>ref|XP_007511265.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66825.1| predicted protein [Bathycoccus prasinos]
Length=1124

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ NVTTPANYFH+LRRQIHRD+RKPLIVMSPKNL
Sbjct  917  NWQICNVTTPANYFHLLRRQIHRDYRKPLIVMSPKNL  953



>ref|XP_010096639.1| 2-oxoglutarate dehydrogenase [Morus notabilis]
 gb|EXB65307.1| 2-oxoglutarate dehydrogenase [Morus notabilis]
Length=1020

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHV+RRQIHR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVMRRQIHREFRKPLIVMAPKNL  846



>ref|XP_008233579.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Prunus 
mume]
Length=1021

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  846



>ref|XP_007009427.1| 2-oxoglutarate dehydrogenase, E1 component [Theobroma cacao]
 gb|EOY18237.1| 2-oxoglutarate dehydrogenase, E1 component [Theobroma cacao]
Length=1026

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNATTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>gb|EMT08930.1| 2-oxoglutarate dehydrogenase E1 component, mitochondrial [Aegilops 
tauschii]
Length=847

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHRDFRKPLIV +PKNL
Sbjct  637  NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVTAPKNL  673



>gb|KHN23142.1| 2-oxoglutarate dehydrogenase, mitochondrial [Glycine soja]
Length=1021

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  846



>ref|XP_003555815.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Glycine 
max]
Length=1021

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  846



>ref|XP_007220910.1| hypothetical protein PRUPE_ppa000728mg [Prunus persica]
 gb|EMJ22109.1| hypothetical protein PRUPE_ppa000728mg [Prunus persica]
Length=1021

 Score = 80.5 bits (197),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQ+HR+FRKPLIVM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQLHREFRKPLIVMAPKNL  846



>gb|EYU42921.1| hypothetical protein MIMGU_mgv1a000687mg [Erythranthe guttata]
Length=1018

 Score = 80.1 bits (196),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  846



>ref|XP_006848592.1| hypothetical protein AMTR_s00168p00055310 [Amborella trichopoda]
 gb|ERN10173.1| hypothetical protein AMTR_s00168p00055310 [Amborella trichopoda]
Length=1020

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQI+R+FRKPLIVMSPKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQINREFRKPLIVMSPKNL  846



>ref|XP_008355411.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase, 
mitochondrial-like, partial [Malus domestica]
Length=617

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN+ TPANYFHVLRRQIHR+FRKPLIVM+PKNL
Sbjct  414  NWQVVNLXTPANYFHVLRRQIHREFRKPLIVMAPKNL  450



>ref|XP_004307550.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=1018

 Score = 79.7 bits (195),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQI+RDFRKPL+VM+PKNL
Sbjct  810  NWQVVNVTTPANYFHVLRRQINRDFRKPLVVMAPKNL  846



>ref|XP_002950899.1| E1 subunit of 2-oxoglutarate dehydrogenase [Volvox carteri f. 
nagariensis]
 gb|EFJ48214.1| E1 subunit of 2-oxoglutarate dehydrogenase [Volvox carteri f. 
nagariensis]
Length=1040

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQ+HR FRKPLIVMSPKNL
Sbjct  824  NWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMSPKNL  860



>ref|XP_004958820.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Setaria 
italica]
Length=1017

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIV +PKNL
Sbjct  807  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVTAPKNL  843



>ref|XP_003062637.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53456.1| predicted protein [Micromonas pusilla CCMP1545]
Length=1067

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ NVTTPANYFH+LRRQ+HRDFRKPLIV+SPKNL
Sbjct  860  NWQICNVTTPANYFHLLRRQVHRDFRKPLIVVSPKNL  896



>ref|XP_006478407.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Citrus 
sinensis]
Length=1024

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR FRKPLIV+SPKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHRGFRKPLIVISPKNL  846



>ref|XP_003579622.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Brachypodium 
distachyon]
Length=1016

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  805  NLQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  841



>ref|XP_002439085.1| hypothetical protein SORBIDRAFT_10g031320 [Sorghum bicolor]
 gb|EER90452.1| hypothetical protein SORBIDRAFT_10g031320 [Sorghum bicolor]
Length=301

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFH+LRRQIHR+FRKPLIV +PKNL
Sbjct  91   NWQVVNVTTPANYFHLLRRQIHREFRKPLIVTAPKNL  127



>ref|XP_010937698.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Elaeis 
guineensis]
Length=1024

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFHVLRRQIHR+FRKPLIV++PKNL
Sbjct  813  NWQVVNVTTPANYFHVLRRQIHREFRKPLIVIAPKNL  849



>emb|CBI31715.3| unnamed protein product [Vitis vinifera]
Length=899

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  725  NWQIVNVTTPANYFHVLRRQIHREFRKPLIVMSPKNL  761



>ref|XP_004236757.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Solanum 
lycopersicum]
 ref|XP_010319264.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Solanum 
lycopersicum]
Length=1020

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL
Sbjct  809  NLQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  845



>gb|KDO41108.1| hypothetical protein CISIN_1g002323mg [Citrus sinensis]
Length=936

 Score = 79.3 bits (194),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR FRKPLIV+SPKNL
Sbjct  792  NWQIVNVTTPANYFHVLRRQIHRGFRKPLIVISPKNL  828



>gb|KFM27866.1| 2-oxoglutarate dehydrogenase, mitochondrial [Auxenochlorella 
protothecoides]
Length=1028

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQIHR FRKPL+V SPKNL
Sbjct  817  NWQVVNCTTPANYFHVLRRQIHRQFRKPLVVFSPKNL  853



>ref|WP_025896901.1| 2-oxoglutarate dehydrogenase [Sneathiella glossodoripedis]
Length=963

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQIHR FRKPL+VM+PK+L
Sbjct  766  NWQVVNCTTPANYFHVLRRQIHRKFRKPLVVMTPKSL  802



>ref|XP_010277600.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Nelumbo 
nucifera]
Length=1021

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VNVTTPANYFHVLRRQIHR+FRKPLIV++PKNL
Sbjct  810  NWQIVNVTTPANYFHVLRRQIHREFRKPLIVIAPKNL  846



>ref|WP_036260567.1| 2-oxoglutarate dehydrogenase [Mastigocoleus testarum]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_035571798.1| 2-oxoglutarate dehydrogenase [Hyphomonas adhaerens]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_034769725.1| 2-oxoglutarate dehydrogenase [Hyphomonas sp. CY54-11-8]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_035579944.1| 2-oxoglutarate dehydrogenase [Hyphomonas jannaschiana]
 gb|KCZ88957.1| 2-oxoglutarate dehydrogenase E1 component [Hyphomonas jannaschiana 
VP2]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_034810500.1| 2-oxoglutarate dehydrogenase [Hyphomonas sp. L-53-1-40]
 gb|KCZ65773.1| MFS transporter [Hyphomonas sp. L-53-1-40]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_035547181.1| 2-oxoglutarate dehydrogenase [Hyphomonas sp. 22II1-22F38]
 gb|KCZ65028.1| MFS transporter [Hyphomonas sp. 22II1-22F38]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_034791881.1| 2-oxoglutarate dehydrogenase [Hyphomonas sp. 25B14_1]
 gb|KCZ56398.1| MFS transporter [Hyphomonas sp. 25B14_1]
Length=1002

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>gb|KCZ85403.1| 2-oxoglutarate dehydrogenase E1 component [Hyphomonas adhaerens 
MHS-3]
Length=1004

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  793  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  829



>gb|KCZ45322.1| MFS transporter [Hyphomonas sp. CY54-11-8]
Length=1004

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  793  NWQVCNLTTPANYFHALRRQIHRDFRKPLIIMTPKSL  829



>gb|EWM24631.1| 2-oxoglutarate dehydrogenase e1 component [Nannochloropsis gaditana]
Length=1039

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANY+HVLRRQ+HRDFRKPLIV++PKNL
Sbjct  844  NWQVVNCTTPANYYHVLRRQVHRDFRKPLIVIAPKNL  880



>ref|XP_002970197.1| hypothetical protein SELMODRAFT_93779 [Selaginella moellendorffii]
 gb|EFJ28327.1| hypothetical protein SELMODRAFT_93779 [Selaginella moellendorffii]
Length=972

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVNVTTPANYFHVLRRQ+HRDFRKPLI+MSPKNL
Sbjct  765  NCQVVNVTTPANYFHVLRRQLHRDFRKPLIIMSPKNL  801



>ref|NP_001169536.1| uncharacterized protein LOC100383412 [Zea mays]
 gb|ACN34052.1| unknown [Zea mays]
Length=814

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFH+LRRQIHR+FRKPLIV +PKNL
Sbjct  604  NWQVVNVTTPANYFHLLRRQIHREFRKPLIVTAPKNL  640



>gb|AFW75669.1| hypothetical protein ZEAMMB73_452342 [Zea mays]
Length=1016

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVTTPANYFH+LRRQIHR+FRKPLIV +PKNL
Sbjct  806  NWQVVNVTTPANYFHLLRRQIHREFRKPLIVTAPKNL  842



>ref|XP_001416923.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95216.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=994

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ NVTTPANYFH+LRRQ+HR+FRKPL+VMSPKNL
Sbjct  789  NWQICNVTTPANYFHMLRRQVHREFRKPLVVMSPKNL  825



>ref|XP_001692870.1| 2-oxoglutarate dehydrogenase, E1 subunit [Chlamydomonas reinhardtii]
 gb|EDP03439.1| 2-oxoglutarate dehydrogenase, E1 subunit [Chlamydomonas reinhardtii]
Length=1037

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQ+HR FRKPLIVM+PKNL
Sbjct  820  NWQVVNCTTPANYFHVLRRQVHRQFRKPLIVMAPKNL  856



>emb|CEF97097.1| 2-oxoglutarate dehydrogenase, E1 component [Ostreococcus tauri]
Length=1077

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ NVTTPANYFH+LRRQ+HR+FRKPL+VMSPKNL
Sbjct  872  NWQICNVTTPANYFHMLRRQVHREFRKPLVVMSPKNL  908



>ref|WP_034846093.1| 2-oxoglutarate dehydrogenase [Inquilinus limosus]
 gb|KGM31320.1| 2-oxoglutarate dehydrogenase [Inquilinus limosus MP06]
Length=975

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN+TTPANYFH LRRQIHRDFRKPL+V +PK+L
Sbjct  782  NWQVVNLTTPANYFHALRRQIHRDFRKPLVVFTPKSL  818



>ref|XP_005647897.1| E1 subunit of 2-oxoglutarate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE23353.1| E1 subunit of 2-oxoglutarate dehydrogenase [Coccomyxa subellipsoidea 
C-169]
Length=1020

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ N TTPANYFH+LRRQIHR FRKPLIVMSPKNL
Sbjct  812  NWQIANCTTPANYFHLLRRQIHRQFRKPLIVMSPKNL  848



>ref|XP_002293467.1| 2-oxoglutarate dehydrogenase E1 component [Thalassiosira pseudonana 
CCMP1335]
 gb|EED89203.1| 2-oxoglutarate dehydrogenase E1 component [Thalassiosira pseudonana 
CCMP1335]
Length=1015

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFH LRRQIHRDFRKPLIV++PKNL
Sbjct  818  NWQIVNCTTPANYFHCLRRQIHRDFRKPLIVVAPKNL  854



>ref|WP_026872998.1| 2-oxoglutarate dehydrogenase [Inquilinus limosus]
Length=969

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN+TTPANYFH LRRQIHRDFRKPL+V +PK+L
Sbjct  776  NWQVVNLTTPANYFHALRRQIHRDFRKPLVVFTPKSL  812



>ref|XP_003078135.1| putative 2-oxoglutarate dehydrogenase E1 component (ISS) [Ostreococcus 
tauri]
Length=1122

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ NVTTPANYFH+LRRQ+HR+FRKPL+VMSPKNL
Sbjct  872  NWQICNVTTPANYFHMLRRQVHREFRKPLVVMSPKNL  908



>ref|XP_003518655.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Glycine 
max]
 gb|KHN27211.1| 2-oxoglutarate dehydrogenase, mitochondrial [Glycine soja]
Length=1029

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N Q+VNVTTPAN+FHVLRRQ+HRDFRKPLIVMSPKNL
Sbjct  818  NLQIVNVTTPANFFHVLRRQVHRDFRKPLIVMSPKNL  854



>ref|XP_002501705.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62963.1| predicted protein [Micromonas sp. RCC299]
Length=996

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+ NVTTPANYFH+LRRQ+HR+FRKPLIV+SPKNL
Sbjct  786  NWQICNVTTPANYFHLLRRQVHREFRKPLIVISPKNL  822



>ref|WP_020401361.1| hypothetical protein [Kordiimonas gwangyangensis]
Length=969

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQ+HR FRKPL++M+PK+L
Sbjct  768  NWQVVNCTTPANYFHVLRRQMHRKFRKPLVIMTPKSL  804



>ref|WP_029012084.1| 2-oxoglutarate dehydrogenase [Niveispirillum irakense]
Length=979

 Score = 77.0 bits (188),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQ+ RDFRKPLIVMSPK+L
Sbjct  786  NWQVCNITTPANYFHALRRQVRRDFRKPLIVMSPKSL  822



>ref|XP_002182131.1| 2-oxoglutarate dehydrogenase E1 component [Phaeodactylum tricornutum 
CCAP 1055/1]
 gb|EEC46671.1| 2-oxoglutarate dehydrogenase E1 component [Phaeodactylum tricornutum 
CCAP 1055/1]
Length=1073

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFH LRRQIHRDFRKPL+V++PKNL
Sbjct  871  NWQVVNCTTPANYFHCLRRQIHRDFRKPLVVVAPKNL  907



>gb|EJK52677.1| hypothetical protein THAOC_28027 [Thalassiosira oceanica]
Length=987

 Score = 77.0 bits (188),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFH LRRQ+HRDFRKPLIV++PKNL
Sbjct  803  NWQIVNCTTPANYFHCLRRQVHRDFRKPLIVVAPKNL  839



>ref|XP_010065984.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like [Eucalyptus 
grandis]
 gb|KCW63729.1| hypothetical protein EUGRSUZ_G01375 [Eucalyptus grandis]
Length=1021

 Score = 77.0 bits (188),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQI+R+FRKPLIVM+PKNL
Sbjct  810  NWQVVNTTTPANYFHVLRRQINREFRKPLIVMAPKNL  846



>dbj|BAQ15579.1| 2-oxoglutarate dehydrogenase E1 component [Methyloceanibacter 
caenitepidi]
Length=962

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQ+HR FRKPL++M+PK+L
Sbjct  763  NWQVVNCTTPANYFHVLRRQLHRQFRKPLVLMTPKSL  799



>ref|XP_005849381.1| hypothetical protein CHLNCDRAFT_57427 [Chlorella variabilis]
 gb|EFN57279.1| hypothetical protein CHLNCDRAFT_57427 [Chlorella variabilis]
Length=841

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN TTPANYFHVLRRQ+HR FRKPLI+ +PKNL
Sbjct  676  NWQVVNCTTPANYFHVLRRQLHRQFRKPLILFAPKNL  712



>ref|WP_018148870.1| MFS transporter [Henriciella marina]
Length=1002

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+TTPANYFH LRRQIHRDFRKPLI+M+PK+L
Sbjct  791  NMQVVNITTPANYFHALRRQIHRDFRKPLIIMTPKSL  827



>ref|XP_003621819.1| Oxoglutarate dehydrogenase - like protein [Medicago truncatula]
Length=1040

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N Q+VNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  829  NLQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  865



>gb|AES78037.2| E1 subunit-like 2-oxoglutarate dehydrogenase [Medicago truncatula]
Length=1023

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N Q+VNVTTPAN+FHVLRRQIHR+FRKPLIVMSPKNL
Sbjct  812  NLQIVNVTTPANFFHVLRRQIHREFRKPLIVMSPKNL  848



>ref|WP_035725505.1| 2-oxoglutarate dehydrogenase, partial [Fodinicurvata fenggangensis]
Length=942

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL+VM+PK+L
Sbjct  751  NMQVVNCTTPANYFHVLRRQVHRDFRKPLVVMTPKSL  787



>ref|WP_038066288.1| 2-oxoglutarate dehydrogenase [Thioclava dalianensis]
 gb|KEP69483.1| 2-oxoglutarate dehydrogenase [Thioclava dalianensis]
Length=983

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V NV+TPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  784  NWIVANVSTPANYFHILRRQIHRDFRKPLILMTPKSL  820



>ref|WP_023785889.1| MFS transporter [Hyphomicrobium nitrativorans]
 ref|YP_008865253.1| MFS transporter [Hyphomicrobium nitrativorans NL23]
 gb|AHB47502.1| MFS transporter [Hyphomicrobium nitrativorans NL23]
Length=982

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+HR+FRKPLI+M+PK+L
Sbjct  790  NWQVANCTTPANYFHILRRQLHRNFRKPLILMTPKSL  826



>ref|XP_007139257.1| hypothetical protein PHAVU_008G014400g [Phaseolus vulgaris]
 gb|ESW11251.1| hypothetical protein PHAVU_008G014400g [Phaseolus vulgaris]
Length=1028

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N Q+VNVTTPAN+FHVLRRQ+HR+FRKPLIVMSPKNL
Sbjct  817  NLQIVNVTTPANFFHVLRRQVHREFRKPLIVMSPKNL  853



>ref|WP_022699108.1| MFS transporter [Maricaulis sp. JL2009]
Length=987

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N +TPANYFH+LRRQIHR+FRKPLI+M+PK+L
Sbjct  786  NWQVANCSTPANYFHILRRQIHRNFRKPLILMTPKSL  822



>gb|KHN13877.1| 2-oxoglutarate dehydrogenase, mitochondrial [Glycine soja]
Length=1025

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N Q+VNVTTPAN+FHVLRRQ+HR+FRKPLIVMSPKNL
Sbjct  814  NLQIVNVTTPANFFHVLRRQVHREFRKPLIVMSPKNL  850



>ref|XP_003552681.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X1 [Glycine max]
 ref|XP_006603028.1| PREDICTED: 2-oxoglutarate dehydrogenase, mitochondrial-like isoform 
X2 [Glycine max]
Length=1025

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N Q+VNVTTPAN+FHVLRRQ+HR+FRKPLIVMSPKNL
Sbjct  814  NLQIVNVTTPANFFHVLRRQVHREFRKPLIVMSPKNL  850



>ref|WP_039683565.1| 2-oxoglutarate dehydrogenase [Tateyamaria sp. ANG-S1]
 gb|KIC51281.1| 2-oxoglutarate dehydrogenase [Tateyamaria sp. ANG-S1]
Length=985

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  784  NWIVANCTTPANYFHILRRQIHRDFRKPLILMTPKSL  820



>ref|WP_037925097.1| 2-oxoglutarate dehydrogenase [Sulfitobacter sp. H3]
 gb|KEJ96063.1| 2-oxoglutarate dehydrogenase [Sulfitobacter sp. H3]
Length=988

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  785  NWIVANCTTPANYFHILRRQIHRDFRKPLILMTPKSL  821



>ref|WP_028954861.1| 2-oxoglutarate dehydrogenase [Sulfitobacter sp. 20_GPM-1509m]
Length=988

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  785  NWIVANCTTPANYFHILRRQIHRDFRKPLILMTPKSL  821



>ref|WP_015599578.1| MFS transporter [Hyphomicrobium denitrificans]
 ref|YP_007916062.1| 2-oxoglutarate dehydrogenase E1 component [Hyphomicrobium denitrificans 
1NES1]
 gb|AGK59563.1| 2-oxoglutarate dehydrogenase E1 component [Hyphomicrobium denitrificans 
1NES1]
Length=986

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+HR+FRKPLI+M+PK+L
Sbjct  787  NWQVANCTTPANYFHILRRQLHRNFRKPLILMTPKSL  823



>ref|WP_013217180.1| MFS transporter [Hyphomicrobium denitrificans]
 ref|YP_003757342.1| 2-oxoglutarate dehydrogenase, E1 subunit [Hyphomicrobium denitrificans 
ATCC 51888]
 gb|ADJ25021.1| 2-oxoglutarate dehydrogenase, E1 subunit [Hyphomicrobium denitrificans 
ATCC 51888]
Length=986

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+HR+FRKPLI+M+PK+L
Sbjct  787  NWQVANCTTPANYFHILRRQLHRNFRKPLILMTPKSL  823



>ref|WP_026868019.1| 2-oxoglutarate dehydrogenase [Hyphomicrobium zavarzinii]
Length=983

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+HR+FRKPLI+M+PK+L
Sbjct  791  NWQVANCTTPANYFHILRRQLHRNFRKPLILMTPKSL  827



>ref|XP_004341587.1| oxoglutarate dehydrogenase (succinyltransferring), E1 component, 
putative [Acanthamoeba castellanii str. Neff]
 gb|ELR19501.1| oxoglutarate dehydrogenase (succinyltransferring), E1 component, 
putative [Acanthamoeba castellanii str. Neff]
Length=1034

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVNVTTPANYFH LRRQ+HRDFRKPLIVMSPK L
Sbjct  839  NIQVVNVTTPANYFHALRRQVHRDFRKPLIVMSPKRL  875



>ref|WP_011453956.1| MFS transporter [Jannaschia sp. CCS1]
 ref|YP_508773.1| 2-oxoglutarate dehydrogenase E1 [Jannaschia sp. CCS1]
 gb|ABD53748.1| 2-oxoglutarate dehydrogenase E1 component [Jannaschia sp. CCS1]
Length=985

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHRDFRKPL++M+PK+L
Sbjct  784  NWIVANCTTPANYFHILRRQIHRDFRKPLVLMTPKSL  820



>ref|WP_013382958.1| MFS transporter [Ketogulonicigenium vulgare]
 ref|YP_003962605.1| 2-oxoglutarate dehydrogenase E1 [Ketogulonicigenium vulgare Y25]
 ref|YP_005796290.1| oxoglutarate dehydrogenase (Succinyl-transferring), E1 component 
[Ketogulonicigenium vulgare WSH-001]
 gb|ADO41305.1| 2-oxoglutarate dehydrogenase, E1 component [Ketogulonicigenium 
vulgare Y25]
 gb|AEM42294.1| Oxoglutarate dehydrogenase (Succinyl-transferring), E1 component 
[Ketogulonicigenium vulgare WSH-001]
Length=990

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHRDFRKPL++M+PK+L
Sbjct  788  NWIVANCTTPANYFHILRRQIHRDFRKPLVLMTPKSL  824



>ref|WP_037238507.1| 2-oxoglutarate dehydrogenase [Rhodomicrobium udaipurense]
 gb|KAI94341.1| 2-oxoglutarate dehydrogenase [Rhodomicrobium udaipurense JA643]
Length=985

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+HR FRKPLI+M+PK+L
Sbjct  783  NWQVANCTTPANYFHILRRQLHRSFRKPLILMTPKSL  819



>ref|WP_021101093.1| 2-oxoglutarate dehydrogenase E1 component [Thalassobacter arenae]
 gb|EPX81594.1| 2-oxoglutarate dehydrogenase E1 component [Thalassobacter arenae 
DSM 19593]
Length=984

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQ+HRDFRKPLI+M+PK+L
Sbjct  782  NWIVANCTTPANYFHILRRQLHRDFRKPLILMTPKSL  818



>ref|WP_013418332.1| MFS transporter [Rhodomicrobium vannielii]
 ref|YP_004011027.1| 2-oxoglutarate dehydrogenase, E1 subunit [Rhodomicrobium vannielii 
ATCC 17100]
 gb|ADP69928.1| 2-oxoglutarate dehydrogenase, E1 subunit [Rhodomicrobium vannielii 
ATCC 17100]
Length=989

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+HR FRKPLI+M+PK+L
Sbjct  787  NWQVANCTTPANYFHILRRQLHRSFRKPLILMTPKSL  823



>ref|XP_006378732.1| hypothetical protein POPTR_0010s21620g [Populus trichocarpa]
 gb|ERP56529.1| hypothetical protein POPTR_0010s21620g [Populus trichocarpa]
Length=796

 Score = 74.3 bits (181),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVV+VTTPANYFHVLRRQIH  FRKPL+VMSPK+L
Sbjct  608  NWQVVDVTTPANYFHVLRRQIHGGFRKPLVVMSPKSL  644



>ref|WP_038132618.1| 2-oxoglutarate dehydrogenase [Thioclava sp. DT23-4]
 gb|KEO53877.1| MFS transporter [Thioclava sp. DT23-4]
Length=983

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N +TPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  784  NWIVANCSTPANYFHILRRQIHRDFRKPLILMTPKSL  820



>ref|WP_038144208.1| 2-oxoglutarate dehydrogenase [Thioclava sp. 13D2W-2]
 gb|KFE35935.1| 2-oxoglutarate dehydrogenase E1 component [Thioclava sp. 13D2W-2]
Length=984

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N +TPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  785  NWIVANCSTPANYFHILRRQIHRDFRKPLILMTPKSL  821



>ref|WP_038077486.1| 2-oxoglutarate dehydrogenase [Thioclava pacifica]
 gb|KEO53078.1| MFS transporter [Thioclava pacifica DSM 10166]
Length=984

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N +TPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  785  NWIVANCSTPANYFHILRRQIHRDFRKPLILMTPKSL  821



>ref|WP_008031579.1| MFS transporter [Rhodobacter sp. SW2]
 gb|EEW24479.1| 2-oxoglutarate dehydrogenase, E1 subunit [Rhodobacter sp. SW2]
Length=989

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N +TPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  788  NWIVANCSTPANYFHILRRQIHRDFRKPLILMTPKSL  824



>ref|WP_004271793.1| MFS transporter [Nitrospirillum amazonense]
 gb|EGY02307.1| 2-oxoglutarate dehydrogenase E1 component [Nitrospirillum amazonense 
Y2]
Length=862

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQ+VN TTPANYFHVLRRQ++R+FRKPL+V SPK+L
Sbjct  668  NWQIVNCTTPANYFHVLRRQVNREFRKPLVVFSPKSL  704



>ref|WP_013950124.1| MULTISPECIES: MFS transporter [Hyphomicrobium]
 ref|YP_004678298.1| 2-oxoglutarate dehydrogenase E1 [Hyphomicrobium sp. MC1]
 emb|CCB67734.1| 2-oxoglutarate dehydrogenase complex, E1 component, 2-oxoglutarate 
decarboxylase, thiamine binding [Hyphomicrobium sp. MC1]
Length=987

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N +TPANYFH+LRRQ+HR+FRKPLI+M+PK+L
Sbjct  788  NWQVANCSTPANYFHILRRQLHRNFRKPLILMTPKSL  824



>ref|WP_033406482.1| 2-oxoglutarate dehydrogenase, partial [Kiloniella laminariae]
Length=939

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQIHR FRKPLIVM+PK+L
Sbjct  747  NIQVVNCTTPANYFHVLRRQIHRGFRKPLIVMTPKSL  783



>ref|WP_033404483.1| 2-oxoglutarate dehydrogenase [Hirschia maritima]
Length=983

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N TTPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  782  NMQVANCTTPANYFHILRRQIHRDFRKPLILMTPKSL  818



>ref|WP_015828075.1| MFS transporter [Hirschia baltica]
 ref|YP_003060622.1| 2-oxoglutarate dehydrogenase E1 component [Hirschia baltica ATCC 
49814]
 gb|ACT59925.1| 2-oxoglutarate dehydrogenase, E1 subunit [Hirschia baltica ATCC 
49814]
Length=1004

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N TTPANYFH+LRRQIHRDFRKPLI+M+PK+L
Sbjct  803  NMQVANCTTPANYFHILRRQIHRDFRKPLILMTPKSL  839



>ref|WP_035260180.1| 2-oxoglutarate dehydrogenase [Actibacterium mucosum]
 gb|KAJ55017.1| 2-oxoglutarate dehydrogenase [Actibacterium mucosum KCTC 23349]
Length=985

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQ+HRDFRKPL++M+PK+L
Sbjct  784  NWIVANCTTPANYFHILRRQLHRDFRKPLVLMTPKSL  820



>ref|WP_015466947.1| 2-oxoglutarate dehydrogenase E1 component [Micavibrio aeruginosavorus]
 ref|YP_007642014.1| 2-oxoglutarate dehydrogenase E1 component [Micavibrio aeruginosavorus 
EPB]
 gb|AGH97394.1| 2-oxoglutarate dehydrogenase E1 component [Micavibrio aeruginosavorus 
EPB]
Length=960

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+ RDFRKPLI+M+PK+L
Sbjct  766  NWQVANCTTPANYFHILRRQMVRDFRKPLIIMTPKSL  802



>ref|WP_036561347.1| 2-oxoglutarate dehydrogenase [Oceanicola sp. MCTG156(1a)]
Length=986

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQ+HRDFRKPL++M+PK+L
Sbjct  784  NWIVANCTTPANYFHILRRQLHRDFRKPLVLMTPKSL  820



>ref|WP_014102211.1| MFS transporter [Micavibrio aeruginosavorus]
 ref|YP_004864990.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component 
[Micavibrio aeruginosavorus ARL-13]
 gb|AEP08988.1| oxoglutarate dehydrogenase (succinyl-transferring), E1 component 
[Micavibrio aeruginosavorus ARL-13]
Length=967

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+ RDFRKPLI+M+PK+L
Sbjct  773  NWQVANCTTPANYFHILRRQMVRDFRKPLIIMTPKSL  809



>ref|WP_011256593.1| MFS transporter [Wolbachia endosymbiont of Brugia malayi]
 ref|YP_198225.1| 2-oxoglutarate dehydrogenase E1 [Wolbachia endosymbiont strain 
TRS of Brugia malayi]
 gb|AAW70983.1| 2-oxoglutarate dehydrogenase complex, E1 component [Wolbachia 
endosymbiont strain TRS of Brugia malayi]
Length=887

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN +TPANYFHVLRRQIHRDFRKPLIV +PK+L
Sbjct  697  NMQVVNCSTPANYFHVLRRQIHRDFRKPLIVFTPKSL  733



>ref|WP_010126668.1| MFS transporter [Sphingomonas sp. KC8]
Length=966

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFH LRRQ+HRDFRKPLI+M+PK+L
Sbjct  769  NMQVCNITTPANYFHALRRQLHRDFRKPLIIMTPKSL  805



>ref|WP_037503825.1| 2-oxoglutarate dehydrogenase, partial [Sphingomonas jaspsi]
Length=923

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFHVLRRQ+HR+FRKPLI+M+PK+L
Sbjct  731  NLQVANITTPANYFHVLRRQMHREFRKPLIIMTPKSL  767



>ref|WP_011386315.1| MFS transporter [Magnetospirillum magneticum]
 ref|YP_423324.2| 2-oxoglutarate dehydrogenase E1 component [Magnetospirillum magneticum 
AMB-1]
Length=988

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQ+ R+FRKPLI+M+PK+L
Sbjct  776  NWQVCNITTPANYFHALRRQLRRNFRKPLIIMTPKSL  812



>ref|WP_007668233.1| MFS transporter [alpha proteobacterium BAL199]
 gb|EDP66523.1| 2-oxoglutarate dehydrogenase, E1 component [alpha proteobacterium 
BAL199]
Length=963

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ++RDFRKPLIVM+PK+L
Sbjct  759  NMQVVNCTTPANYFHVLRRQLNRDFRKPLIVMTPKSL  795



>ref|WP_007670584.1| MFS transporter [Caulobacter sp. AP07]
 gb|EJL30211.1| 2-oxoglutarate dehydrogenase, E1 component [Caulobacter sp. AP07]
Length=987

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+TTPANYFH LRRQ+HR+FRKPLIVM+PK+L
Sbjct  787  NMQVVNLTTPANYFHALRRQMHREFRKPLIVMTPKSL  823



>ref|XP_005717197.1| 2-oxoglutarate dehydrogenase, E1 component [Chondrus crispus]
 emb|CDF37378.1| 2-oxoglutarate dehydrogenase, E1 component [Chondrus crispus]
Length=1014

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVN +TPANYFHVLRRQ+ R+FRKPLIVM+PK+L
Sbjct  819  NWQVVNCSTPANYFHVLRRQVAREFRKPLIVMTPKSL  855



>ref|WP_034823565.1| 2-oxoglutarate dehydrogenase [Hyphomonas sp. T16B2]
 gb|KCZ53020.1| MFS transporter [Hyphomonas sp. T16B2]
Length=1002

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFH LRRQIHRDFRKPL++M+PK+L
Sbjct  791  NMQVCNLTTPANYFHALRRQIHRDFRKPLVIMTPKSL  827



>ref|XP_011027349.1| PREDICTED: LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase, 
mitochondrial [Populus euphratica]
Length=971

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQVVNVT PANYFH LRRQIHR FRKPL+VMSPK+L
Sbjct  783  NWQVVNVTKPANYFHALRRQIHRGFRKPLVVMSPKSL  819



>dbj|BAE52765.1| 2-oxoglutarate dehydrogenase complex, dehydrogenase (E1) component, 
and related enzyme [Magnetospirillum magneticum AMB-1]
Length=861

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQ+ R+FRKPLI+M+PK+L
Sbjct  649  NWQVCNITTPANYFHALRRQLRRNFRKPLIIMTPKSL  685



>ref|WP_015457533.1| 2-oxoglutarate dehydrogenase E1 component [Sphingomonas sp. MM-1]
 ref|YP_007615114.1| 2-oxoglutarate dehydrogenase E1 component [Sphingomonas sp. MM-1]
 gb|AGH48518.1| 2-oxoglutarate dehydrogenase E1 component [Sphingomonas sp. MM-1]
Length=970

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFHVLRRQ+HR+FRKPLI+M+PK+L
Sbjct  773  NMQVCNITTPANYFHVLRRQMHRNFRKPLIIMTPKSL  809



>ref|WP_024315925.1| 2-oxoglutarate dehydrogenase [Rhizobium sp. OR191]
Length=982

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N +TPANYFHVLRRQ+ RDFRKPLI+M+PK+L
Sbjct  782  NWQVANCSTPANYFHVLRRQLTRDFRKPLILMTPKSL  818



>emb|CDM62619.1| 2-oxoglutarate dehydrogenase E1 component [Rhizobium sp. LPU83]
Length=986

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N +TPANYFHVLRRQ+ RDFRKPLI+M+PK+L
Sbjct  786  NWQVANCSTPANYFHVLRRQLTRDFRKPLILMTPKSL  822



>ref|WP_022735558.1| MFS transporter [Candidatus Pelagibacter ubique]
Length=964

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HR+FRKPLIVM+PK+L
Sbjct  763  NMQVVNCTTPANYFHVLRRQMHREFRKPLIVMTPKSL  799



>ref|WP_022702492.1| MFS transporter [Pseudorhodobacter ferrugineus]
Length=986

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N +TPANYFH+LRRQ+HRDFRKPLI+M+PK+L
Sbjct  786  NWIVANCSTPANYFHILRRQLHRDFRKPLILMTPKSL  822



>ref|WP_036722312.1| 2-oxoglutarate dehydrogenase [Paracoccus sphaerophysae]
 gb|KGJ01676.1| 2-oxoglutarate dehydrogenase [Paracoccus sphaerophysae]
Length=989

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N+TTPANYFH+LRRQIHR FRKPLI+M+PK+L
Sbjct  787  NWIVANLTTPANYFHILRRQIHRPFRKPLILMTPKSL  823



>ref|WP_031447032.1| 2-oxoglutarate dehydrogenase [Caulobacteraceae bacterium PMMR1]
Length=989

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HR FRKPLIVM+PK+L
Sbjct  789  NMQVVNCTTPANYFHVLRRQLHRAFRKPLIVMTPKSL  825



>ref|WP_008621976.1| 2-oxoglutarate dehydrogenase E1 component [Magnetospirillum sp. 
SO-1]
 gb|EME67766.1| 2-oxoglutarate dehydrogenase E1 component [Magnetospirillum sp. 
SO-1]
Length=990

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N+TTPANYFH LRRQ+ R+FRKPLI+M+PK+L
Sbjct  778  NWQVCNITTPANYFHALRRQLRRNFRKPLIIMTPKSL  814



>ref|WP_039018975.1| 2-oxoglutarate dehydrogenase [Halocynthiibacter namhaensis]
Length=987

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQ+HRD+RKPLI+M+PK+L
Sbjct  785  NWIVANCTTPANYFHILRRQMHRDYRKPLILMTPKSL  821



>emb|CEG20904.1| 2-oxoglutarate dehydrogenase, E1 component [Anaplasma phagocytophilum]
Length=905

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL++ +PK+L
Sbjct  720  NMQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSL  756



>gb|KDB56038.1| 2-oxoglutarate dehydrogenase [Anaplasma phagocytophilum str. 
MRK]
Length=905

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL++ +PK+L
Sbjct  720  NMQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSL  756



>gb|KDB54897.1| 2-oxoglutarate dehydrogenase [Anaplasma phagocytophilum str. 
Norway variant2]
Length=905

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL++ +PK+L
Sbjct  720  NMQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSL  756



>ref|WP_011450956.1| MFS transporter [Anaplasma phagocytophilum]
 ref|YP_505440.1| 2-oxoglutarate dehydrogenase E1 component [Anaplasma phagocytophilum 
str. HZ]
 ref|YP_008332924.1| MFS transporter [Anaplasma phagocytophilum str. HZ2]
 gb|ABD43872.1| 2-oxoglutarate dehydrogenase, E1 component [Anaplasma phagocytophilum 
str. HZ]
 gb|AGR78933.1| MFS transporter [Anaplasma phagocytophilum str. HZ2]
Length=905

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL++ +PK+L
Sbjct  720  NMQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSL  756



>ref|WP_021799718.1| 2-oxoglutarate dehydrogenase E1 component [Anaplasma phagocytophilum]
 gb|EOA62322.1| 2-oxoglutarate dehydrogenase E1 component [Anaplasma phagocytophilum 
str. CRT38]
 gb|KDB57146.1| 2-oxoglutarate dehydrogenase [Anaplasma phagocytophilum str. 
CRT35]
Length=905

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL++ +PK+L
Sbjct  720  NMQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSL  756



>ref|WP_020849364.1| MFS transporter [Anaplasma phagocytophilum]
 ref|YP_008334174.1| MFS transporter [Anaplasma phagocytophilum str. JM]
 ref|YP_008335427.1| MFS transporter [Anaplasma phagocytophilum str. Dog2]
 gb|EOA61130.1| 2-oxoglutarate dehydrogenase E1 component [Anaplasma phagocytophilum 
str. HGE1]
 gb|AGR80180.1| MFS transporter [Anaplasma phagocytophilum str. JM]
 gb|AGR81435.1| MFS transporter [Anaplasma phagocytophilum str. Dog2]
Length=905

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFHVLRRQ+HRDFRKPL++ +PK+L
Sbjct  720  NMQVVNCTTPANYFHVLRRQLHRDFRKPLVIFTPKSL  756



>ref|WP_035534996.1| 2-oxoglutarate dehydrogenase [Hyphomonas oceanitis]
Length=1002

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFH +RRQIHRDFRKPLI+M+PK+L
Sbjct  791  NMQVCNLTTPANYFHAIRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_035617876.1| 2-oxoglutarate dehydrogenase [Hyphomonas johnsonii]
 gb|KCZ89998.1| 2-oxoglutarate dehydrogenase E1 component [Hyphomonas johnsonii 
MHS-2]
Length=1002

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFH +RRQIHRDFRKPLI+M+PK+L
Sbjct  791  NMQVCNLTTPANYFHAIRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_034736182.1| 2-oxoglutarate dehydrogenase [Hyphomonas sp. BH-BN04-4]
 gb|KCZ61052.1| MFS transporter [Hyphomonas sp. BH-BN04-4]
Length=1002

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFH +RRQIHRDFRKPLI+M+PK+L
Sbjct  791  NMQVCNLTTPANYFHAIRRQIHRDFRKPLIIMTPKSL  827



>ref|WP_013962965.1| MFS transporter [Roseobacter litoralis]
 ref|YP_004692018.1| 2-oxoglutarate dehydrogenase E1 component SucA [Roseobacter litoralis 
Och 149]
 gb|AEI95055.1| 2-oxoglutarate dehydrogenase E1 component SucA [Roseobacter litoralis 
Och 149]
Length=986

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHR FRKPLI+M+PK+L
Sbjct  784  NWIVANCTTPANYFHILRRQIHRSFRKPLILMTPKSL  820



>gb|KDA04475.1| 2-oxoglutarate dehydrogenase E1 component [Hyphomonas oceanitis 
SCH89]
Length=1014

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFH +RRQIHRDFRKPLI+M+PK+L
Sbjct  803  NMQVCNLTTPANYFHAIRRQIHRDFRKPLIIMTPKSL  839



>ref|WP_011567856.1| MFS transporter [Roseobacter denitrificans]
 ref|YP_681922.1| 2-oxoglutarate dehydrogenase E1 [Roseobacter denitrificans OCh 
114]
 gb|ABG31236.1| alpha-ketoglutarate dehydrogenase [Roseobacter denitrificans 
OCh 114]
Length=986

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTPANYFH+LRRQIHR FRKPLI+M+PK+L
Sbjct  784  NWIVANCTTPANYFHILRRQIHRSFRKPLILMTPKSL  820



>ref|WP_020056465.1| MFS transporter [alpha proteobacterium SCGC AAA015-O19]
Length=989

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N +TPANYFH+LRRQ+HRDFRKPL++M+PK+L
Sbjct  785  NWIVANCSTPANYFHILRRQVHRDFRKPLVLMTPKSL  821



>ref|WP_011388968.1| MFS transporter [Rhodospirillum rubrum]
 ref|YP_426301.2| 2-oxoglutarate dehydrogenase E1 component [Rhodospirillum rubrum 
ATCC 11170]
 ref|YP_006047523.1| 2-oxoglutarate dehydrogenase E1 component [Rhodospirillum rubrum 
F11]
 gb|AEO47726.1| 2-oxoglutarate dehydrogenase E1 component [Rhodospirillum rubrum 
F11]
Length=987

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+T+PANYFH LRRQ+HR+FRKPLIVM+PK+L
Sbjct  776  NMQVVNITSPANYFHALRRQVHRNFRKPLIVMAPKSL  812



>ref|WP_008601989.1| 2-oxoglutarate dehydrogenase E1 component [alpha proteobacterium 
JLT2015]
 gb|EMD82739.1| 2-oxoglutarate dehydrogenase E1 component [alpha proteobacterium 
JLT2015]
Length=969

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N TTPANYFH+LRRQ+HRDFRKPL++M+PK+L
Sbjct  777  NMQVANCTTPANYFHILRRQMHRDFRKPLVIMTPKSL  813



>ref|WP_008943060.1| MFS transporter [Oceanibaculum indicum]
 gb|EKE78337.1| 2-oxoglutarate dehydrogenase E1 component [Oceanibaculum indicum 
P24]
Length=956

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+TTPANYFH LRRQ+HR FRKPLI+M+PK+L
Sbjct  762  NMQVVNITTPANYFHALRRQLHRKFRKPLIIMTPKSL  798



>ref|WP_037120638.1| 2-oxoglutarate dehydrogenase [Rhizobium sp. OV201]
Length=981

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+ R+FRKPLI+M+PK+L
Sbjct  781  NWQVANCTTPANYFHILRRQLERNFRKPLILMTPKSL  817



>ref|WP_016558405.1| 2-oxoglutarate dehydrogenase E1 component [Rhizobium grahamii]
 gb|EPE94145.1| 2-oxoglutarate dehydrogenase E1 component [Rhizobium grahamii 
CCGE 502]
Length=981

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/37 (76%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NWQV N TTPANYFH+LRRQ+ R+FRKPLI+M+PK+L
Sbjct  781  NWQVANCTTPANYFHILRRQLERNFRKPLILMTPKSL  817



>gb|ABC22014.1| 2-oxoglutarate dehydrogenase E1 component [Rhodospirillum rubrum 
ATCC 11170]
Length=983

 Score = 72.8 bits (177),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+T+PANYFH LRRQ+HR+FRKPLIVM+PK+L
Sbjct  772  NMQVVNITSPANYFHALRRQVHRNFRKPLIVMAPKSL  808



>ref|WP_023839290.1| MFS transporter [Blastomonas sp. CACIA14H2]
 gb|ESZ85840.1| MFS transporter [Blastomonas sp. CACIA14H2]
Length=941

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QV N+TTPANYFHVLRRQ+HR+FRKPLI+M+PK+L
Sbjct  737  NIQVCNITTPANYFHVLRRQMHRNFRKPLIIMTPKSL  773



>gb|AHF91879.1| MFS transporter [Opitutaceae bacterium TAV5]
Length=915

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+TTPANYFH LRRQ+ RDFRKPLIVMSPK+L
Sbjct  731  NMQVVNITTPANYFHALRRQMKRDFRKPLIVMSPKSL  767



>ref|WP_038005698.1| MULTISPECIES: 2-oxoglutarate dehydrogenase [Thalassobacter]
 gb|KGK79561.1| 2-oxoglutarate dehydrogenase [Thalassobacter stenotrophicus]
 gb|KGL01497.1| 2-oxoglutarate dehydrogenase [Thalassobacter sp. 16PALIMAR09]
Length=985

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 27/37 (73%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            NW V N TTP+NYFH+LRRQ+HRDFRKPL++M+PK+L
Sbjct  784  NWIVANCTTPSNYFHILRRQLHRDFRKPLVLMTPKSL  820



>ref|WP_007363098.1| MFS transporter [Opitutaceae bacterium TAV1]
 gb|EIQ00141.1| LOW QUALITY PROTEIN: 2-oxoglutarate dehydrogenase, E1 component 
[Opitutaceae bacterium TAV1]
Length=915

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN+TTPANYFH LRRQ+ RDFRKPLIVMSPK+L
Sbjct  731  NMQVVNITTPANYFHALRRQMKRDFRKPLIVMSPKSL  767



>gb|ETO22037.1| hypothetical protein RFI_15167, partial [Reticulomyxa filosa]
Length=1019

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPK  105
            NWQ+VN TTPANYFHVLRRQ+HR+FRKPLIV +PK
Sbjct  795  NWQIVNCTTPANYFHVLRRQMHRNFRKPLIVFTPK  829



>ref|WP_035092321.1| 2-oxoglutarate dehydrogenase [Caulobacter henricii]
Length=987

 Score = 72.4 bits (176),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  1    NWQVVNVTTPANYFHVLRRQIHRDFRKPLIVMSPKNL  111
            N QVVN TTPANYFH LRRQ+HR+FRKPLIVM+PK+L
Sbjct  787  NMQVVNCTTPANYFHALRRQMHREFRKPLIVMTPKSL  823



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284