BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7202_g1_i1 len=1033 path=[1011:0-640 1652:641-1032]

Length=1033
                                                                      Score     E

ref|XP_011100097.1|  PREDICTED: uncharacterized protein LOC105178329  67.8    3e-10   
ref|XP_002310885.1|  hypothetical protein POPTR_0007s14730g           60.5    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_007018435.1|  Uncharacterized protein TCM_034658               52.4    6e-05   
gb|KHN01731.1|  hypothetical protein glysoja_013042                   49.7    6e-04   
gb|EYU44520.1|  hypothetical protein MIMGU_mgv1a015674mg              48.9    8e-04   



>ref|XP_011100097.1| PREDICTED: uncharacterized protein LOC105178329 [Sesamum indicum]
Length=157

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 71/158 (45%), Gaps = 13/158 (8%)
 Frame = +3

Query  210  MSHRIIFSQGNVPFSWEEKPGVSKFNHQKIPSPTDVPDKHEFLDlgkpllpppppsatpt  389
            MSHR I S G+VPFSWEEKPGV KFNHQK  S     +  + +               P 
Sbjct  1    MSHRKIRSHGSVPFSWEEKPGVPKFNHQKSSSDIMSLNALQIMQPVPDNFSSSISIPPPP  60

Query  390  pgrrssssslkGMIR---DDPFMVAFVKCTKNQNSKTVHNNSGDHNHHQRkkssyssvgl  560
               +    S  G +    DDPF+ A   CT     K+V N+       Q+   S  +   
Sbjct  61   CTSQPPRRSYSGKVSWLHDDPFIAALKSCT-----KSVTNDRRSEGLRQKGNESKRNSYS  115

Query  561  sskkGRLFFFCKNAFADVEVDNLMKYSNLPPLPGHKDS  674
             S      F CK +  +VE D+L+K S  PP+P  + S
Sbjct  116  KSS----LFSCKES-CNVESDHLVKLSKFPPIPKERYS  148



>ref|XP_002310885.1| hypothetical protein POPTR_0007s14730g [Populus trichocarpa]
 gb|EEE91335.1| hypothetical protein POPTR_0007s14730g [Populus trichocarpa]
Length=163

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 82/169 (49%), Gaps = 32/169 (19%)
 Frame = +3

Query  210  MSHRIIFSQGNVPFSWEEKPGVSKFNHQK-----------IPSPT-------DVPDKHEF  335
            MSHR ++SQG++PFSWE+ PGVSK  H++           I SPT       D    ++ 
Sbjct  1    MSHRKVYSQGSIPFSWEDSPGVSKVIHKEYTIDIGLNAVNISSPTSPILFPRDSDTSYKV  60

Query  336  LDlgkpllpppppsatptpgrrssssslk-GMIRDDPFMVAFVKCTKNQNSKTVHNNSGD  512
            L      +P PP  +      R S S       ++DPF+ A+ +CTKN  +  + + S  
Sbjct  61   LGSHGIKIPLPPCVSAKIEPPRRSKSVKGFRWWQEDPFLAAYKECTKNGRNGKLSSESKK  120

Query  513  HNHHQRkkssyssvglsskkGRLFFFCKNAFADVEVDNLMKYSNLPPLP  659
            +   +             +K RL F CK++  DV+ DNL+  +NLP +P
Sbjct  121  NVRSK------------LRKSRLIFSCKDS-CDVQDDNLVMLANLPAIP  156



>ref|XP_007018435.1| Uncharacterized protein TCM_034658 [Theobroma cacao]
 gb|EOY15660.1| Uncharacterized protein TCM_034658 [Theobroma cacao]
Length=147

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 46/158 (29%), Positives = 66/158 (42%), Gaps = 32/158 (20%)
 Frame = +3

Query  210  MSHRIIFSQGNVPFSWEEKPGVSKFNH----------QKIPSPTDVPDKHEFLDlgkpll  359
            M+  ++ SQGNVPFSWE KPGV K             QK+PSP   P+          + 
Sbjct  1    MNQSMVHSQGNVPFSWENKPGVCKLTSQEGSEEYYFLQKLPSPPYPPESARI-----SIH  55

Query  360  pppppsatptpgrrssssslkGMIR-DDPFMVAFVKCTKNQNSKTVHNNSGDHNHHQRkk  536
                P           +SS +G+ + DDPF+ A+ +CTKN +   +    G     +   
Sbjct  56   DIKIPPPPCAFQHPFKTSSRRGLRKSDDPFLAAYKECTKNTSKGKLAKRDGGSGLKK---  112

Query  537  ssyssvglsskkGRLFFFCKNAFADVEVDNLMKYSNLP  650
                        G   + CK +   V  DNL++ S LP
Sbjct  113  ------------GMFNWSCKQS-CSVRNDNLVRISQLP  137



>gb|KHN01731.1| hypothetical protein glysoja_013042 [Glycine soja]
Length=178

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 78/181 (43%), Gaps = 37/181 (20%)
 Frame = +3

Query  210  MSHRIIFSQGNVPFSWEEKPGVSKFNHQKIP-------------------SPTDVPDKHE  332
            MSHR   S G++PFSWE+KPGV K  +   P                   +PT + +   
Sbjct  1    MSHRKSHSHGSIPFSWEDKPGVCKTPNSDFPLNNIGINKKSCSPLPPPPFAPTHLSNSRR  60

Query  333  FLDlgkpllpppppsatptpgrrssssslkGMIRDDPFMVAFVKCTKNQNSKTV--HNNS  506
             L++      P PP     P R +S        ++DPF+VA+ +CTK++ +  V   N  
Sbjct  61   MLEIQDNEKIPLPPCPLQPPRRSTSEKEKGFRWQEDPFLVAYKECTKSEKNYKVPRKNKK  120

Query  507  GDHNHHQRkkssyssvglsskkGRLFFFCKNAFADVEVDNLMKYSNLPPLPGHKDSSIRL  686
            G              VG +    +  F CK A  DV+ D  +K   LP LP  +D S+ L
Sbjct  121  GG-------------VGSNFSLSKSIFSCKGAINDVKDDIYVK---LPCLPAARDRSLTL  164

Query  687  H  689
             
Sbjct  165  E  165



>gb|EYU44520.1| hypothetical protein MIMGU_mgv1a015674mg [Erythranthe guttata]
Length=149

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 1/30 (3%)
 Frame = +3

Query  210  MSHRIIFSQGNVPFSWEEKPGVSKFN-HQK  296
            MSHR I S+GNVPFSWEEKPGV K N HQK
Sbjct  1    MSHRRIHSKGNVPFSWEEKPGVPKSNRHQK  30



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2363439201630