BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c71_g1_i1 len=771 path=[930:0-770]

Length=771
                                                                      Score     E

ref|XP_010317039.1|  PREDICTED: wall-associated receptor kinase-l...  89.7    1e-16   
ref|XP_006365061.1|  PREDICTED: wall-associated receptor kinase-l...  84.3    6e-15   
ref|XP_009773751.1|  PREDICTED: wall-associated receptor kinase-l...  75.1    5e-12   
emb|CDP11260.1|  unnamed protein product                              75.1    7e-12   
emb|CAN65982.1|  hypothetical protein VITISV_017971                   73.6    2e-11   Vitis vinifera
ref|XP_010663523.1|  PREDICTED: wall-associated receptor kinase-l...  73.6    2e-11   
emb|CBI15394.3|  unnamed protein product                              73.9    2e-11   
emb|CDP11259.1|  unnamed protein product                              71.2    1e-10   
ref|XP_010688364.1|  PREDICTED: wall-associated receptor kinase-l...  70.9    1e-10   
ref|XP_010688363.1|  PREDICTED: wall-associated receptor kinase-l...  70.5    2e-10   
emb|CDP11258.1|  unnamed protein product                              68.6    8e-10   
ref|XP_010688575.1|  PREDICTED: wall-associated receptor kinase-l...  67.8    2e-09   
emb|CDP20610.1|  unnamed protein product                              67.0    3e-09   
ref|XP_009627286.1|  PREDICTED: wall-associated receptor kinase-l...  66.6    3e-09   
gb|KDP41928.1|  hypothetical protein JCGZ_26946                       66.6    3e-09   
emb|CDP20609.1|  unnamed protein product                              66.2    4e-09   
ref|XP_009798995.1|  PREDICTED: putative wall-associated receptor...  65.5    7e-09   
ref|XP_008342477.1|  PREDICTED: wall-associated receptor kinase-l...  65.5    7e-09   
ref|XP_010680098.1|  PREDICTED: wall-associated receptor kinase 2...  65.5    9e-09   
ref|XP_003594614.1|  Wall-associated receptor kinase-like protein     65.1    1e-08   
ref|XP_008353664.1|  PREDICTED: wall-associated receptor kinase-l...  64.3    1e-08   
ref|XP_007147586.1|  hypothetical protein PHAVU_006G137000g           63.5    2e-08   
ref|XP_007035468.1|  Wall associated kinase-like 6, putative          64.3    2e-08   
emb|CDP11262.1|  unnamed protein product                              63.9    3e-08   
ref|XP_010256630.1|  PREDICTED: putative wall-associated receptor...  63.9    3e-08   
ref|XP_011034598.1|  PREDICTED: wall-associated receptor kinase-l...  63.2    4e-08   
emb|CAN65983.1|  hypothetical protein VITISV_017972                   63.2    5e-08   Vitis vinifera
ref|XP_011013613.1|  PREDICTED: wall-associated receptor kinase-l...  63.2    5e-08   
ref|XP_002274962.1|  PREDICTED: wall-associated receptor kinase-l...  63.2    5e-08   Vitis vinifera
ref|XP_011013615.1|  PREDICTED: wall-associated receptor kinase-l...  62.8    6e-08   
ref|XP_011034597.1|  PREDICTED: wall-associated receptor kinase-l...  62.8    7e-08   
ref|XP_006368673.1|  hypothetical protein POPTR_0001s076201g          62.8    7e-08   
ref|XP_010269758.1|  PREDICTED: wall-associated receptor kinase-l...  62.8    7e-08   
ref|XP_011011593.1|  PREDICTED: wall-associated receptor kinase-l...  62.4    9e-08   
ref|XP_011078212.1|  PREDICTED: wall-associated receptor kinase-l...  62.4    9e-08   
ref|XP_011011594.1|  PREDICTED: wall-associated receptor kinase-l...  62.0    1e-07   
ref|XP_003594613.1|  Wall-associated receptor kinase-like protein     62.0    1e-07   
ref|XP_006387117.1|  hypothetical protein POPTR_1809s00200g           62.0    1e-07   
ref|XP_006368667.1|  hypothetical protein POPTR_0001s07560g           61.2    1e-07   
ref|XP_007035467.1|  Wall associated kinase-like 6, putative          62.0    1e-07   
ref|XP_011013612.1|  PREDICTED: wall-associated receptor kinase-l...  61.6    2e-07   
ref|XP_002297682.1|  kinase family protein                            60.8    3e-07   Populus trichocarpa [western balsam poplar]
ref|XP_008229606.1|  PREDICTED: wall-associated receptor kinase-l...  60.5    3e-07   
ref|XP_010023385.1|  PREDICTED: wall-associated receptor kinase-l...  60.5    4e-07   
emb|CAN64181.1|  hypothetical protein VITISV_007799                   60.1    5e-07   Vitis vinifera
ref|XP_006372235.1|  hypothetical protein POPTR_0018s14490g           59.7    5e-07   
ref|XP_008220151.1|  PREDICTED: putative wall-associated receptor...  59.7    7e-07   
emb|CAN65979.1|  hypothetical protein VITISV_017968                   58.9    8e-07   Vitis vinifera
ref|XP_010691609.1|  PREDICTED: wall-associated receptor kinase-l...  59.3    1e-06   
gb|KCW48948.1|  hypothetical protein EUGRSUZ_K02557                   59.3    1e-06   
emb|CDP22017.1|  unnamed protein product                              58.5    1e-06   
emb|CBI15571.3|  unnamed protein product                              58.9    1e-06   
ref|XP_007147592.1|  hypothetical protein PHAVU_006G137600g           58.5    1e-06   
ref|XP_007217600.1|  hypothetical protein PRUPE_ppa018374mg           58.5    2e-06   
ref|XP_006386339.1|  putative wall-associated kinase family protein   58.5    2e-06   
ref|XP_011011597.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    2e-06   
ref|XP_010663682.1|  PREDICTED: wall-associated receptor kinase-l...  58.5    2e-06   
ref|XP_004981069.1|  PREDICTED: wall-associated receptor kinase 5...  57.8    3e-06   
ref|XP_003634276.1|  PREDICTED: wall-associated receptor kinase-l...  57.8    3e-06   
ref|XP_007217318.1|  hypothetical protein PRUPE_ppa017167mg           57.8    3e-06   
ref|XP_008798624.1|  PREDICTED: uncharacterized protein LOC103713459  57.8    3e-06   
gb|EAY93773.1|  hypothetical protein OsI_15554                        57.0    4e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008380153.1|  PREDICTED: wall-associated receptor kinase-l...  57.4    4e-06   
ref|XP_010039081.1|  PREDICTED: wall-associated receptor kinase-l...  57.4    4e-06   
ref|XP_010934766.1|  PREDICTED: wall-associated receptor kinase 2...  57.0    5e-06   
ref|XP_002274809.1|  PREDICTED: wall-associated receptor kinase-l...  57.0    6e-06   Vitis vinifera
ref|XP_008229608.1|  PREDICTED: wall-associated receptor kinase-l...  57.0    6e-06   
emb|CAH66392.1|  OSIGBa0134J07.10                                     56.2    7e-06   Oryza sativa [red rice]
ref|XP_010934769.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  56.6    8e-06   
ref|XP_010273353.1|  PREDICTED: wall-associated receptor kinase 2...  55.8    9e-06   
ref|XP_010037267.1|  PREDICTED: wall-associated receptor kinase-l...  56.2    9e-06   
ref|XP_003580459.1|  PREDICTED: wall-associated receptor kinase 1...  56.2    1e-05   
gb|KCW47715.1|  hypothetical protein EUGRSUZ_K01465                   55.8    1e-05   
gb|KDO44465.1|  hypothetical protein CISIN_1g041043mg                 55.8    1e-05   
ref|XP_010273357.1|  PREDICTED: wall-associated receptor kinase 2...  55.8    1e-05   
ref|XP_008229721.1|  PREDICTED: wall-associated receptor kinase-l...  55.8    1e-05   
ref|XP_009411366.1|  PREDICTED: putative wall-associated receptor...  55.8    1e-05   
ref|XP_008803200.1|  PREDICTED: wall-associated receptor kinase 2...  55.8    1e-05   
ref|XP_010237016.1|  PREDICTED: wall-associated receptor kinase 5...  55.5    2e-05   
ref|XP_010237017.1|  PREDICTED: wall-associated receptor kinase 5...  55.5    2e-05   
ref|XP_007217680.1|  hypothetical protein PRUPE_ppa021669mg           55.5    2e-05   
gb|AAU90275.1|  calcium binding EGF domain containing protein         55.5    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010237014.1|  PREDICTED: wall-associated receptor kinase 5...  55.5    2e-05   
ref|XP_006416321.1|  hypothetical protein EUTSA_v10006905mg           55.1    2e-05   
dbj|BAB40010.1|  putative wall-associated kinase 4                    55.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010038774.1|  PREDICTED: wall-associated receptor kinase-l...  55.1    2e-05   
ref|XP_002442540.1|  hypothetical protein SORBIDRAFT_08g021540        55.1    2e-05   Sorghum bicolor [broomcorn]
gb|KCW47710.1|  hypothetical protein EUGRSUZ_K01452                   55.1    3e-05   
ref|XP_006597672.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  54.7    3e-05   
ref|XP_011017593.1|  PREDICTED: wall-associated receptor kinase-l...  54.7    3e-05   
ref|XP_010237013.1|  PREDICTED: wall-associated receptor kinase 5...  54.7    3e-05   
ref|XP_010051379.1|  PREDICTED: wall-associated receptor kinase-l...  54.7    3e-05   
ref|XP_009356568.1|  PREDICTED: wall-associated receptor kinase-l...  54.7    4e-05   
ref|XP_007147591.1|  hypothetical protein PHAVU_006G137500g           54.7    4e-05   
ref|XP_008791610.1|  PREDICTED: wall-associated receptor kinase 3...  54.7    4e-05   
ref|XP_007216176.1|  hypothetical protein PRUPE_ppa015763mg           54.3    4e-05   
ref|XP_010920488.1|  PREDICTED: putative wall-associated receptor...  54.3    4e-05   
gb|EEC83830.1|  hypothetical protein OsI_29775                        53.9    4e-05   Oryza sativa Indica Group [Indian rice]
emb|CDY04608.1|  BnaC05g16460D                                        54.3    4e-05   
ref|XP_010497736.1|  PREDICTED: wall-associated receptor kinase-l...  54.3    4e-05   
ref|XP_004251441.2|  PREDICTED: wall-associated receptor kinase 3...  54.3    5e-05   
ref|XP_010059387.1|  PREDICTED: wall-associated receptor kinase 2...  54.3    5e-05   
ref|XP_007019259.1|  Wall-associated kinase 2, putative               54.3    5e-05   
ref|XP_010023309.1|  PREDICTED: wall-associated receptor kinase-l...  53.9    6e-05   
ref|XP_010039741.1|  PREDICTED: putative wall-associated receptor...  53.9    6e-05   
ref|XP_010273350.1|  PREDICTED: uncharacterized protein LOC104608921  53.9    6e-05   
gb|KHN14302.1|  Wall-associated receptor kinase-like 9                53.9    6e-05   
ref|XP_010680013.1|  PREDICTED: wall-associated receptor kinase 2...  53.9    7e-05   
ref|XP_008358012.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  53.9    7e-05   
gb|KCW81882.1|  hypothetical protein EUGRSUZ_C03245                   53.5    7e-05   
ref|XP_007212989.1|  hypothetical protein PRUPE_ppa022572mg           53.5    7e-05   
ref|XP_007147589.1|  hypothetical protein PHAVU_006G137300g           53.5    7e-05   
ref|XP_010273252.1|  PREDICTED: putative wall-associated receptor...  53.5    8e-05   
ref|NP_001173559.1|  Os03g0643250                                     53.5    8e-05   
ref|XP_006653300.1|  PREDICTED: wall-associated receptor kinase 2...  53.5    8e-05   
gb|KCW47714.1|  hypothetical protein EUGRSUZ_K01462                   53.5    9e-05   
gb|EAZ43241.1|  hypothetical protein OsJ_27840                        53.1    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008779714.1|  PREDICTED: wall-associated receptor kinase 2...  52.8    1e-04   
gb|EMT30697.1|  Wall-associated receptor kinase 3                     53.1    1e-04   
ref|XP_007019265.1|  Wall-associated kinase 2, putative               52.8    1e-04   
ref|XP_006431622.1|  hypothetical protein CICLE_v10000464mg           52.8    1e-04   
gb|EMT28345.1|  Wall-associated receptor kinase 2                     53.1    1e-04   
ref|XP_010273347.1|  PREDICTED: putative wall-associated receptor...  52.8    1e-04   
ref|XP_002454747.1|  hypothetical protein SORBIDRAFT_04g036600        52.8    1e-04   Sorghum bicolor [broomcorn]
ref|XP_008222638.1|  PREDICTED: wall-associated receptor kinase-l...  52.8    1e-04   
ref|XP_010247760.1|  PREDICTED: wall-associated receptor kinase 2...  52.4    1e-04   
ref|XP_011077656.1|  PREDICTED: wall-associated receptor kinase 2...  52.8    2e-04   
ref|XP_004309275.1|  PREDICTED: wall-associated receptor kinase 2...  52.0    2e-04   
ref|XP_008229613.1|  PREDICTED: wall-associated receptor kinase-l...  52.8    2e-04   
ref|XP_003534747.2|  PREDICTED: wall-associated receptor kinase-l...  52.8    2e-04   
ref|XP_008225630.1|  PREDICTED: wall-associated receptor kinase 2...  52.4    2e-04   
ref|XP_002462203.1|  hypothetical protein SORBIDRAFT_02g021500        52.4    2e-04   Sorghum bicolor [broomcorn]
ref|XP_010273358.1|  PREDICTED: wall-associated receptor kinase 2...  52.8    2e-04   
ref|XP_010476729.1|  PREDICTED: wall-associated receptor kinase-l...  52.4    2e-04   
ref|XP_008441592.1|  PREDICTED: wall-associated receptor kinase 2...  52.4    2e-04   
gb|KCW81763.1|  hypothetical protein EUGRSUZ_C03129                   52.4    2e-04   
gb|KCW81737.1|  hypothetical protein EUGRSUZ_C03090                   52.4    2e-04   
ref|XP_006657321.1|  PREDICTED: wall-associated receptor kinase 3...  52.4    2e-04   
ref|XP_010051321.1|  PREDICTED: wall-associated receptor kinase-l...  52.4    2e-04   
emb|CBI18947.3|  unnamed protein product                              52.4    2e-04   
ref|XP_008229723.1|  PREDICTED: wall-associated receptor kinase-l...  52.4    2e-04   
ref|XP_010664149.1|  PREDICTED: putative wall-associated receptor...  52.0    3e-04   
ref|XP_006492575.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    3e-04   
gb|EAY86751.1|  hypothetical protein OsI_08131                        52.0    3e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_002890435.1|  wall-associated kinase 2                         52.0    3e-04   
emb|CAN64180.1|  hypothetical protein VITISV_007798                   51.2    3e-04   Vitis vinifera
ref|XP_006303914.1|  hypothetical protein CARUB_v10008422mg           52.0    3e-04   
ref|XP_008791611.1|  PREDICTED: putative wall-associated receptor...  52.0    3e-04   
ref|XP_006492574.1|  PREDICTED: wall-associated receptor kinase-l...  52.0    3e-04   
gb|KCW47708.1|  hypothetical protein EUGRSUZ_K01448                   51.2    3e-04   
ref|XP_008225752.1|  PREDICTED: putative wall-associated receptor...  52.0    3e-04   
ref|XP_002457827.1|  hypothetical protein SORBIDRAFT_03g014450        51.6    3e-04   Sorghum bicolor [broomcorn]
gb|KDP42930.1|  hypothetical protein JCGZ_23872                       51.6    3e-04   
ref|XP_006368666.1|  hypothetical protein POPTR_0001s07550g           51.6    3e-04   
ref|XP_011027426.1|  PREDICTED: putative wall-associated receptor...  51.6    3e-04   
emb|CAN82289.1|  hypothetical protein VITISV_028339                   51.2    3e-04   Vitis vinifera
emb|CDY01329.1|  BnaA07g11020D                                        51.6    4e-04   
gb|EMS58067.1|  Wall-associated receptor kinase 5                     51.6    4e-04   
ref|XP_010477387.1|  PREDICTED: wall-associated receptor kinase 3...  51.6    4e-04   
gb|AFW85650.1|  hypothetical protein ZEAMMB73_166927                  51.2    4e-04   
gb|EEE60836.1|  hypothetical protein OsJ_14457                        51.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009618525.1|  PREDICTED: wall-associated receptor kinase 1...  51.6    4e-04   
ref|XP_010051299.1|  PREDICTED: wall-associated receptor kinase-l...  51.6    4e-04   
ref|XP_004305856.1|  PREDICTED: wall-associated receptor kinase-l...  51.6    4e-04   
ref|XP_002302209.2|  hypothetical protein POPTR_0002s07670g           51.6    4e-04   Populus trichocarpa [western balsam poplar]
gb|EAZ23864.1|  hypothetical protein OsJ_07580                        51.6    4e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006372237.1|  hypothetical protein POPTR_0018s14510g           51.6    4e-04   
ref|XP_007226334.1|  hypothetical protein PRUPE_ppa022257mg           51.2    4e-04   
ref|XP_010539154.1|  PREDICTED: wall-associated receptor kinase 2...  51.2    4e-04   
ref|XP_010049240.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    4e-04   
gb|EAZ25016.1|  hypothetical protein OsJ_08797                        51.2    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010235726.1|  PREDICTED: wall-associated receptor kinase 2...  51.2    5e-04   
emb|CAD40714.2|  OSJNBb0042I07.11                                     51.2    5e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAY83890.1|  hypothetical protein OsI_39112                        51.2    5e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_007217301.1|  hypothetical protein PRUPE_ppa018696mg           51.2    5e-04   
ref|XP_002527556.1|  kinase, putative                                 51.2    5e-04   Ricinus communis
ref|XP_010277680.1|  PREDICTED: wall-associated receptor kinase 2...  51.2    5e-04   
ref|XP_010050674.1|  PREDICTED: wall-associated receptor kinase 2...  50.8    5e-04   
dbj|BAD19239.1|  putative wall-associated serine/threonine kinase     51.2    5e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010038779.1|  PREDICTED: wall-associated receptor kinase-l...  51.2    5e-04   
ref|XP_006416836.1|  hypothetical protein EUTSA_v10006974mg           50.8    5e-04   
ref|XP_006648849.1|  PREDICTED: wall-associated receptor kinase 5...  50.8    5e-04   
ref|XP_010051290.1|  PREDICTED: LOW QUALITY PROTEIN: wall-associa...  51.2    6e-04   
gb|ABA99844.1|  Protein kinase domain containing protein, expressed   50.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001177061.1|  Os12g0615000                                     50.8    6e-04   
emb|CBI31042.3|  unnamed protein product                              50.8    6e-04   
ref|NP_001062164.2|  Os08g0501500                                     50.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
dbj|BAD08904.1|  putative wall-associated serine/threonine kinase     50.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010042183.1|  PREDICTED: wall-associated receptor kinase 2...  50.4    6e-04   
ref|XP_006416322.1|  hypothetical protein EUTSA_v10009893mg           50.8    7e-04   
ref|XP_008225623.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.8    7e-04   
ref|XP_009766020.1|  PREDICTED: wall-associated receptor kinase 1...  50.4    7e-04   
ref|XP_004486489.1|  PREDICTED: wall-associated receptor kinase-l...  50.4    8e-04   
gb|KCW81780.1|  hypothetical protein EUGRSUZ_C031382                  49.7    8e-04   
ref|XP_004979730.1|  PREDICTED: wall-associated receptor kinase 5...  50.4    9e-04   
ref|XP_010051317.1|  PREDICTED: wall-associated receptor kinase-l...  50.4    9e-04   
ref|XP_007224001.1|  hypothetical protein PRUPE_ppa014914mg           50.4    0.001   
ref|XP_004305857.1|  PREDICTED: wall-associated receptor kinase-l...  50.4    0.001   
ref|XP_007212851.1|  hypothetical protein PRUPE_ppa021436mg           50.4    0.001   
gb|AAX95007.1|  wall-associated protein kinase                        50.1    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148133.1|  WAK53a - OsWAK receptor-like protein kinase ...  50.1    0.001   Zea mays [maize]



>ref|XP_010317039.1| PREDICTED: wall-associated receptor kinase-like 1 [Solanum lycopersicum]
Length=708

 Score = 89.7 bits (221),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 76/260 (29%), Positives = 119/260 (46%), Gaps = 40/260 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCH-TTAGSAV  177
            ++I C +SS     KPF++SF   +    E++S+S   Q+I    S    C+ ++ GS +
Sbjct  64   YVIKCDRSSDP--PKPFMNSFLQVELQ-SEVISVSIENQTITTSVSIVNFCNKSSEGSRI  120

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTA  357
                  I + T LSG+PF+Y+   N+ M  GCG  ++T   ++  ++GC   CS   T  
Sbjct  121  ------ITTGTDLSGSPFYYAKDRNKLMLVGCGNGLVTQ--KQNVLSGCTSICSEGATLT  172

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA---CNYAFFLATGDDFTTTSSR  528
                   C GINCC   F +D+++Y+ + T+S I   A   C+  F +    D T     
Sbjct  173  G------CYGINCCQSLFPFDLSSYKANFTNSGIQQEAYPRCSAVFLV----DQTWVPDE  222

Query  529  LSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY---W  699
            ++   +   L       PVVW W++   +L          CD+ E +   +  GT    W
Sbjct  223  VAQPFV--FLG----YAPVVWLWTLQAKELE-----AGLLCDKSEAVVKLE-DGTSVANW  270

Query  700  SCSCKFLEYGNAYLPNGCQG  759
             C C     GN Y  NGCQ 
Sbjct  271  QCRCGNGTQGNPYFSNGCQA  290



>ref|XP_006365061.1| PREDICTED: wall-associated receptor kinase-like 1-like [Solanum 
tuberosum]
Length=701

 Score = 84.3 bits (207),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 75/260 (29%), Positives = 118/260 (45%), Gaps = 40/260 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCH-TTAGSAV  177
            +LI C KS +    KPF++SF   +    E++S+S   Q+II   S    C+ ++ GS +
Sbjct  57   YLIKCDKSYNP--PKPFMNSFLQVELQ-SEVISVSIENQTIITSVSIVNFCNKSSEGSKI  113

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTA  357
                  I + T LSG+PF+Y+   N+ M  GCG  ++T   ++  ++GC   C+   T  
Sbjct  114  ------ITTGTDLSGSPFYYAKDRNKLMLVGCGNGLVTQ--KQNILSGCTSICTEGATLT  165

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA---CNYAFFLATGDDFTTTSSR  528
                   C GINCC     +D+++Y+ + T+S I   A   C+  F +    D T     
Sbjct  166  G------CYGINCCQSLVPFDLSSYKANFTNSGIQQGAYPRCSAVFLV----DQTWVPDE  215

Query  529  LSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY---W  699
            ++   +   L       PVVW W++   +L          CD+ E +   +  GT     
Sbjct  216  VAQPFV--FLGH----APVVWLWTLQSKELE-----AGLLCDKSEAVVKLE-DGTSVANL  263

Query  700  SCSCKFLEYGNAYLPNGCQG  759
             C C     GN Y  NGCQ 
Sbjct  264  QCRCGPGTQGNPYFSNGCQA  283



>ref|XP_009773751.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
sylvestris]
Length=699

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 77/259 (30%), Positives = 114/259 (44%), Gaps = 38/259 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            +LI C +S +    KPFL+SF   +    E++S+S   Q+I    S    C+   GS+ G
Sbjct  57   YLIKCDRSYNP--PKPFLNSFLQVELQ-SEVISVSLENQTITTLISIINFCN---GSSQG  110

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            S    I + T LSG+PF+YS   N+ M  GCG  ++T   ++  ++GC   CS   T   
Sbjct  111  SR--IITTGTDLSGSPFYYSKDRNKLMLVGCGNGLVTQ--KQNVLSGCTSICSEGATLTG  166

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNN---ACNYAFFLATGDDFTTTSSRL  531
                  C GINCC     +D++ Y  + T+S I       C+ AF +    D T     +
Sbjct  167  ------CYGINCCQSLVPFDLSLYTANFTNSGIQEGPYPKCSAAFLV----DQTWVPDEV  216

Query  532  SLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY---WS  702
            + Q  + L        PVVW W+V   +L          C++   +      GT      
Sbjct  217  A-QPFTFL-----GYAPVVWLWTVQAKELE-----AGLLCNK-SGVSVKLENGTSVANLQ  264

Query  703  CSCKFLEYGNAYLPNGCQG  759
            C C     GN Y  +GCQ 
Sbjct  265  CHCGPRTQGNPYFSSGCQA  283



>emb|CDP11260.1| unnamed protein product [Coffea canephora]
Length=1288

 Score = 75.1 bits (183),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 58/212 (27%), Positives = 93/212 (44%), Gaps = 30/212 (14%)
 Frame = +1

Query  7    INCTK-SSSDGVE--KPFLSSFSDGKNGVR--EILSISNVRQSIIMKESFSPLCHTTAGS  171
            I CT  S  D +   +P+L     G++  R  E+L +S   Q+I +    S +C     +
Sbjct  243  IRCTDPSGGDSINGLRPYLG-LQPGQSAQRIVEVLEVSLRDQTITINYPLSKICSFNRTT  301

Query  172  AVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVL-TTPGQEFTMAGCKLSCSSNN  348
               S     +  + L+  PFF S  +N+ MF GCG A+L    G +  ++GC   C+S  
Sbjct  302  LDAS-----VFESSLAQAPFFVSREHNKLMFLGCGNALLHLIDGSQQILSGCTSMCNSTT  356

Query  349  TTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSS-IVNNACNYAFFLATGDDFTTTSS  525
            T         C GINCC  S  Y ++ Y + +T S    ++ C YAF +    +    +S
Sbjct  357  TITG------CYGINCCQASIPYYLSQYSLQLTASENFTSSTCAYAFLVDQNWELENYTS  410

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSVTRDDLS  621
            ++ L           +  PVVW W +    + 
Sbjct  411  KVRL-----------INAPVVWSWPLNHSQIQ  431



>emb|CAN65982.1| hypothetical protein VITISV_017971 [Vitis vinifera]
Length=671

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 108/258 (42%), Gaps = 47/258 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  SS+    KPFL+          E+L++S   +++++    +PLC        G
Sbjct  55   FSINCNDSSTP--PKPFLNHTKLN----LELLNVSLEYKTVMVNSPITPLC--------G  100

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTMAGCKLSCSSNNTTA  357
             N       T + G PF +S  +N FM  GC   AVL T  QE  +AGC  +C+S  T+ 
Sbjct  101  GN--GTWRTTDVGGRPFRFSRVHNIFMVVGCDTNAVLMTDDQEEILAGCTSNCNSGITST  158

Query  358  APKFAYDCNGINCCDLSFDY-----DVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTS  522
                   C GI CC  +  Y      +  YQ+    +S     C+YAF L   D F    
Sbjct  159  GT----GCYGIQCCQTTIPYSNQSTHLGMYQVKYIKTS---GDCSYAF-LGVRDWFANNI  210

Query  523  SRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS  702
            S  ++   S          P+V  W +   +   L   YS + D        Q      S
Sbjct  211  SNPAISTNSGY-------APLVMFWEM---ETGSLGRCYSLNLDW-------QSETAIDS  253

Query  703  CSCKFLEYGNAYLPNGCQ  756
            CSC     GN YLPNGCQ
Sbjct  254  CSCVNRYEGNPYLPNGCQ  271



>ref|XP_010663523.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=708

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 108/258 (42%), Gaps = 47/258 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  SS+    KPFL+          E+L++S   +++++    +PLC        G
Sbjct  55   FSINCNDSSTP--PKPFLNHSKLN----LELLNVSLEYKTVMVNSPITPLC--------G  100

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTMAGCKLSCSSNNTTA  357
             N       T + G PF +S  +N FM  GC   AVL T  QE  +AGC  +C+S  T+ 
Sbjct  101  GN--GTWRTTDVGGRPFRFSRVHNIFMVVGCDTNAVLMTDDQEEILAGCTSNCNSGITST  158

Query  358  APKFAYDCNGINCCDLSFDY-----DVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTS  522
                   C GI CC  +  Y      +  YQ+    +S     C+YAF L   D F    
Sbjct  159  GT----GCYGIQCCQTTIPYSNQSTHLGMYQVKYIKTS---GDCSYAF-LGVRDWFANNI  210

Query  523  SRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS  702
            S  ++   S          P+V  W +   +   L   YS + D        Q      S
Sbjct  211  SNPAISTNSGY-------APLVMFWEM---ETGSLGRCYSLNLDW-------QSETAIDS  253

Query  703  CSCKFLEYGNAYLPNGCQ  756
            CSC     GN YLPNGCQ
Sbjct  254  CSCVNRYEGNPYLPNGCQ  271



>emb|CBI15394.3| unnamed protein product [Vitis vinifera]
Length=1912

 Score = 73.9 bits (180),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 79/258 (31%), Positives = 107/258 (41%), Gaps = 47/258 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  SS+    KPFL+          E+L++S   +++++    +PLC        G
Sbjct  350  FSINCNDSSTP--PKPFLNHSKLN----LELLNVSLEYKTVMVNSPITPLC--------G  395

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTMAGCKLSCSSNNTTA  357
             N       T + G PF +S  +N FM  GC   AVL T  QE  +AGC  +C+S  T+ 
Sbjct  396  GN--GTWRTTDVGGRPFRFSRVHNIFMVVGCDTNAVLMTDDQEEILAGCTSNCNSGITST  453

Query  358  APKFAYDCNGINCCDLSFDY-----DVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTS  522
                   C GI CC  +  Y      +  YQ+    +S     C+YAF L   D F    
Sbjct  454  GT----GCYGIQCCQTTIPYSNQSTHLGMYQVKYIKTS---GDCSYAF-LGVRDWFANNI  505

Query  523  SRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS  702
            S  ++   S          P+V  W +    L      YS + D        Q      S
Sbjct  506  SNPAISTNSGY-------APLVMFWEMETGSLGR---CYSLNLDW-------QSETAIDS  548

Query  703  CSCKFLEYGNAYLPNGCQ  756
            CSC     GN YLPNGCQ
Sbjct  549  CSCVNRYEGNPYLPNGCQ  566


 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 73/261 (28%), Positives = 107/261 (41%), Gaps = 55/261 (21%)
 Frame = +1

Query  1     FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
             F INC  SSS    KPFL+          E+ ++S   +++++      LC         
Sbjct  891   FSINCNDSSSP--PKPFLNHTELN----LELFNVSLEYKTVMVNSPIPSLC---------  935

Query  181   SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             ++N +  SN    G+PF +SS +N FM  GC    +   G E  +AGC  +C  +N  A 
Sbjct  936   ADNGTWKSN-DFGGSPFRFSSVHNIFMVVGCDTNAVLATGDEI-LAGCTSNC--DNRIAR  991

Query  361   PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN--NACNYAFFLA-------TGDDFT  513
              +    C GI CC  +  Y+  +  + + + S V     C YAF            D   
Sbjct  992   TR--RRCYGIKCCQTTISYNSQSTHLGMYNVSYVKTGEGCAYAFMGGRDWYANNNSDPAN  1049

Query  514   TTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGT  693
             TT+S  +               P+V  W +   + + L   Y +D D        Q   T
Sbjct  1050  TTNSGYA---------------PLVMFWEM---ETTSLGSCYLQDLDW-------QSGKT  1084

Query  694   YWSCSCKFLEYGNAYLPNGCQ  756
                CSC+    GN YLPNGCQ
Sbjct  1085  IEICSCEHRYEGNPYLPNGCQ  1105



>emb|CDP11259.1| unnamed protein product [Coffea canephora]
Length=640

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 68/222 (31%), Positives = 99/222 (45%), Gaps = 39/222 (18%)
 Frame = +1

Query  127  MKESFSPLC-HTTAGSAVGSNN---LSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTT  294
            M ES+   C H+ A S+  +++   LS ++N+  S  PFFYS   N+ M +GCG A+L  
Sbjct  365  MNESYIVTCNHSFANSSNATSSKPCLSQVANSTWS--PFFYSKDDNKLMLFGCGNALLNQ  422

Query  295  PGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNAC  474
                  ++GC   C  N++         C GINCC  S  + +N YQ++ T ++  NN+C
Sbjct  423  DPDNQVLSGCTSMCQINSSITG------CYGINCCATSVPFYINKYQLNYTITNF-NNSC  475

Query  475  NYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCD  654
              AF      D + T  RLS   I   L      VPVV  W++         P  + DC 
Sbjct  476  ASAFL----ADQSWTPGRLSEPFIRRSLAS----VPVVLSWTLD-------GPVANPDCF  520

Query  655  RYEKIFPPQLRGTY---WSCSCKFLEYG------NAYLPNGC  753
              E   P +L   +   + C C+    G      N YL   C
Sbjct  521  LSES--PLELESGHILRYQCECQLFGTGTFVYKINPYLDGAC  560



>ref|XP_010688364.1| PREDICTED: wall-associated receptor kinase-like 4 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=568

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 91/199 (46%), Gaps = 22/199 (11%)
 Frame = +1

Query  178  GSNNLSIISNT-KLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTT  354
            GS    +I+++  + G+PF YS  +N  +  GCGG ++       T+AGC   C +N+T 
Sbjct  109  GSPETVVINDSYNMIGSPFLYSKKHNVLVVNGCGGGIVLRDRNNQTIAGCAAVCVTNST-  167

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDITD---SSIVNNACNYAFFLATGDDFTTTSS  525
               +   +C G++CC  +  + ++ Y++++     + ++   C  +    T  ++ +   
Sbjct  168  ---RPGLECYGVDCCQTTISHSIDYYEVEVASMGTTRVIGGGCVRSVLAQT--NWISKKK  222

Query  526  RLSLQRISNLLPEDKLVVPV--VWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
            +       +LL  D L  P   V  W+VT  DL+   P+Y+      +        G   
Sbjct  223  K-------DLLDYDSLCGPAHTVMEWTVT--DLAVDMPSYANSSCVNKTASADDAGGYVC  273

Query  700  SCSCKFLEYGNAYLPNGCQ  756
             C   F E GN YLP GCQ
Sbjct  274  RCKQDFYE-GNPYLPYGCQ  291



>ref|XP_010688363.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=714

 Score = 70.5 bits (171),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 52/199 (26%), Positives = 91/199 (46%), Gaps = 22/199 (11%)
 Frame = +1

Query  178  GSNNLSIISNT-KLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTT  354
            GS    +I+++  + G+PF YS  +N  +  GCGG ++       T+AGC   C +N+T 
Sbjct  109  GSPETVVINDSYNMIGSPFLYSKKHNVLVVNGCGGGIVLRDRNNQTIAGCAAVCVTNST-  167

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDITD---SSIVNNACNYAFFLATGDDFTTTSS  525
               +   +C G++CC  +  + ++ Y++++     + ++   C  +    T  ++ +   
Sbjct  168  ---RPGLECYGVDCCQTTISHSIDYYEVEVASMGTTRVIGGGCVRSVLAQT--NWISKKK  222

Query  526  RLSLQRISNLLPEDKLVVPV--VWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
            +       +LL  D L  P   V  W+VT  DL+   P+Y+      +        G   
Sbjct  223  K-------DLLDYDSLCGPAHTVMEWTVT--DLAVDMPSYANSSCVNKTASADDAGGYVC  273

Query  700  SCSCKFLEYGNAYLPNGCQ  756
             C   F E GN YLP GCQ
Sbjct  274  RCKQDFYE-GNPYLPYGCQ  291



>emb|CDP11258.1| unnamed protein product [Coffea canephora]
Length=765

 Score = 68.6 bits (166),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 52/196 (27%), Positives = 89/196 (45%), Gaps = 31/196 (16%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSG  222
            KP+LS+ +       E+L+IS    ++ +  S +  C+       GS+   I S+  L+G
Sbjct  120  KPYLSNLN------LEVLNISLENHTVTVNSSLASFCNADQAQRNGSSTTWISSD--LAG  171

Query  223  TPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCD  402
            TPFFYS   N+ M +GCG AVL     +  ++GC  +C  N +  A   +  C G++CC+
Sbjct  172  TPFFYSRIDNKMMLFGCGNAVLNQADNKI-LSGCTSTCEFNTSDLATNSSSRCYGVSCCE  230

Query  403  LSFDYDVNAYQIDITDSSI-VNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPED----  567
                + ++ Y ++   S    +  C+  F +                   N LPE     
Sbjct  231  TIIPFYLSKYNLNFRGSRFNRSGQCSTTFLVD-----------------QNWLPEKFSES  273

Query  568  KLVVPVVWRWSVTRDD  615
               +PVV  W++++ D
Sbjct  274  LQFIPVVLAWTLSQAD  289



>ref|XP_010688575.1| PREDICTED: wall-associated receptor kinase-like 2 [Beta vulgaris 
subsp. vulgaris]
Length=723

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 84/194 (43%), Gaps = 22/194 (11%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L+G+PF +S   N  +  GCGG VL       T+AGC   C   N +A  K   +C G+ 
Sbjct  134  LTGSPFLFSRKRNVLLVSGCGGGVLLRNKNMQTVAGCAAVCI--NRSAPGK---ECYGVG  188

Query  394  CCDLSFDYDVNAYQIDITDSSIV--------NNACNYAFFLATGDDFTTTSSRLSLQRIS  549
            CC  +F Y ++ Y  +  + ++         ++ C YA  +    D T   ++      S
Sbjct  189  CCQTTFSYSIDYYDFEFVNMALARPTNDLSYSSPCTYAVLV----DSTWIINKSKDINFS  244

Query  550  NLLPE--DKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLE  723
            N   E   +    VV  W+VT  DL    P+Y+     Y+        G    C  +F E
Sbjct  245  NYDNEICGQGEANVVLEWTVT--DLPIQSPSYANSSCVYKTASVDDAGGYICRCREEFFE  302

Query  724  YGNAYLPNGCQGTS  765
             GN YLP GCQ  S
Sbjct  303  -GNPYLPYGCQVVS  315



>emb|CDP20610.1| unnamed protein product [Coffea canephora]
Length=706

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/214 (29%), Positives = 104/214 (49%), Gaps = 35/214 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            + I CT S      KP+LS+ +       E+L++S   +++ +  + +P C + + ++  
Sbjct  58   YTIICTSS------KPYLSNLN------LEVLNVSLRNRTVTVSTTVTPFCSSGSQTSSI  105

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            S+  S  S+  L GTPFFYS +YN  + +GCG AVL        ++GC  +C  N    +
Sbjct  106  SSWRSNSSD--LGGTPFFYSKTYNNLVIFGCGNAVLINQNDNKILSGCTSTCEFN----S  159

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDS--SIVNNACNYAFFLATGDDFTTTSS  525
            P  A D   C G+NCC+ +  + ++ Y ++ T S  S+       + FLA   D   +  
Sbjct  160  PAQAIDTSSCYGVNCCETTIPFYLSKYHLNFTASRFSLGGTGNCSSVFLA---DQNWSPE  216

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYL  627
            + S         E    VPVV  W++ R+D+  +
Sbjct  217  KFS---------ESTQSVPVVLAWTLGRNDVQAI  241



>ref|XP_009627286.1| PREDICTED: wall-associated receptor kinase-like 1 [Nicotiana 
tomentosiformis]
Length=700

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 73/260 (28%), Positives = 111/260 (43%), Gaps = 40/260 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCH-TTAGSAV  177
            +LI C ++ +    K FL+SF   +    E++S+S   Q+I    S    C+ ++ GS +
Sbjct  57   YLIKCDRNYNP--PKLFLNSFLQVELQ-SEVISVSLKNQTITTLVSIINFCNDSSQGSRI  113

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTA  357
                  I + T LSG+PF+YS   N+ M  GCG  ++T       ++GC   CS   T  
Sbjct  114  ------ITTGTNLSGSPFYYSKDRNKLMLVGCGNGLVTQNLN--VLSGCTSICSEGATLT  165

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNN---ACNYAFFLATGDDFTTTSSR  528
                   C GINCC     +D++ Y  + T+S I       C+ AF +    D T     
Sbjct  166  G------CYGINCCQSLVPFDLSLYTANFTNSGIQQGPYPKCSAAFLV----DQTWVPDE  215

Query  529  LSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY---W  699
            ++ Q  + L        PVVW W++   +L          C++   +      GT     
Sbjct  216  VA-QPFTFL-----GYAPVVWLWTLQAKELE-----AGLLCNK-SGVAVKLEDGTSVANL  263

Query  700  SCSCKFLEYGNAYLPNGCQG  759
             C C     GN Y  NGCQ 
Sbjct  264  QCHCGPRTQGNPYFSNGCQA  283



>gb|KDP41928.1| hypothetical protein JCGZ_26946 [Jatropha curcas]
Length=692

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 102/256 (40%), Gaps = 41/256 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLINC+       E+P LSS         E++ I      +++K   SPL          
Sbjct  54   FLINCSG------ERPILSSIG------LEVIKIEYSNSRLLVK---SPLISNNCSDHKS  98

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              N++        GTPF +S  +NRF+  GC G+ L T   E ++ GC+ +C SN   A 
Sbjct  99   GQNVT------FRGTPFTFSG-FNRFVVVGCNGSALLTHA-EPSIIGCQPTC-SNKRVAR  149

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATG--DDFTTTSSRLS  534
             + A  C G  CC  S  Y +  +     +     N+C   F        D     +R+ 
Sbjct  150  EEEASPCVGNMCCQTSIPYFLQVFSPRFQEVGEGENSCMITFIAEETWMKDNVKDPNRV-  208

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSYL---PPTYSRDCDRYEKIFPPQLRGTYWSC  705
                     ++   V V+  W +   DL +L     T     D Y+ I  P  + T+  C
Sbjct  209  ---------QEWEYVHVLLDWKINASDLGWLGIDGETTDVFTDYYDGIDFPYPKNTFLMC  259

Query  706  SCKFLEYGNAYLPNGC  753
               F   GN YLP GC
Sbjct  260  RGGFT--GNPYLPEGC  273



>emb|CDP20609.1| unnamed protein product [Coffea canephora]
Length=709

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 54/207 (26%), Positives = 93/207 (45%), Gaps = 32/207 (15%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSG  222
            KP+LSS +       E+L +S +R   +   +       ++G+  G+ +    +++ L+G
Sbjct  73   KPYLSSLN------LEVLKVS-LRNLTVTVNTPITASSCSSGAQTGAISSWRSNSSDLAG  125

Query  223  TPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCD  402
            TPFFYS +YN+ + +GCG AVL        ++GC   C S+           C   NCC+
Sbjct  126  TPFFYSKTYNKLVLFGCGTAVLLNQNNNKILSGCTSICKSDTPPQPININSTC--YNCCE  183

Query  403  LSFDYDVNAYQIDITDS--------SIVN--NACNYAFFLATGDDFTTTSSRLSLQRISN  552
             +  +D+  Y ++ T S        S +N  ++C+  F +       T S  +       
Sbjct  184  TAIPFDLPKYHLNFTASRFNRGTIRSRINGTSSCSSVFLVDQSLSPVTYSQSMH------  237

Query  553  LLPEDKLVVPVVWRWSVTRDDLSYLPP  633
                    VPVV  W++ RDD+  + P
Sbjct  238  -------SVPVVLAWTLGRDDVQAIYP  257



>ref|XP_009798995.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Nicotiana 
sylvestris]
Length=745

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 74/267 (28%), Positives = 107/267 (40%), Gaps = 49/267 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC   SSDG +KP + +         E+  IS+    II   + +  C+T  G+ V 
Sbjct  79   FEINC-DISSDGSQKPLIGNI--------EVYDISDAEVRII--STVARRCYTPTGAMVE  127

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
                     T+L  +  +  S+ NRF   GCG A L T G  F   GC+ SC+S      
Sbjct  128  KG----FGYTRLPQSGPYSFSAMNRFSVVGCGDAALIT-GHNFEY-GCRASCNSRGDVRE  181

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-----NACNYAFFLATGDDFTTTSS  525
                 +C GI CC +     +  Y I++  +   +     N C YA FL   D F     
Sbjct  182  G----ECMGIGCCQIQIPKGLKYYNINMLTTRNHSDVWYFNQCGYA-FLGEADRFRFRGV  236

Query  526  R-LSLQRISNLLPEDKLVVPVVWRWSV---------TRDDLSYLPPTYSRDCDRYEKIFP  675
            + LS   ++N     +  +P+V  W++          RDD +         C R  K   
Sbjct  237  QDLS---VANFGTRIRASLPIVLDWAIGSVTCIDAKKRDDYA---------CRRNSKCVD  284

Query  676  PQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                   + CSC     G+ YL  GCQ
Sbjct  285  SDTGLGGYRCSCNEGYEGSPYLSPGCQ  311



>ref|XP_008342477.1| PREDICTED: wall-associated receptor kinase-like 22 [Malus domestica]
Length=729

 Score = 65.5 bits (158),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 57/191 (30%), Positives = 78/191 (41%), Gaps = 21/191 (11%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G PF +S S NRF   GC    L T     T+ GC   C S  T ++      CNGI+
Sbjct  98   LEGGPFVFSQSKNRFTAVGCNNLALMTMVNGSTIGGCLSFCRSGLTASSST----CNGID  153

Query  394  CCDLSFDYDVNAYQ--IDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
            CC  +   D+  +   I+  ++      C YA FL     F        L++ S++   D
Sbjct  154  CCQTTIPSDLQVFNTTIESVETGEPTEGCKYA-FLVDRQWFENE----GLRKASDIQNMD  208

Query  568  KLVVPVVWRWSVTRDDLSYLPPTY------SRDCDRYEKIFPPQL--RGTYWSCSCKFLE  723
             L  PVV  W + R     L          S  C+    +       + +   CSCK   
Sbjct  209  SL--PVVLEWRIDRRTYDSLATNKSIAFNNSTVCESGSFVNSTSFSNKNSMVRCSCKRGY  266

Query  724  YGNAYLPNGCQ  756
             GN YLP+GCQ
Sbjct  267  EGNPYLPDGCQ  277



>ref|XP_010680098.1| PREDICTED: wall-associated receptor kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=745

 Score = 65.5 bits (158),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 74/250 (30%), Positives = 105/250 (42%), Gaps = 31/250 (12%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSG  222
            KPFLS   + +N   EIL IS     I      +  C+ +   AV SN L       L+ 
Sbjct  48   KPFLS---ESRN--LEILEISETH--IRTNNFIAKRCYGSE-EAVKSNKLINTVMMYLTT  99

Query  223  TPFFYSSSYNRFMFYGCGGAVL--TTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINC  396
            +PF +SS+ N+    GC       +T GQ+F+  GC  +CS+ +     K    C+G+ C
Sbjct  100  SPFMFSSTANKLTVIGCDDVAFFNSTLGQDFSTTGCLATCSTIDDVL--KHNGSCSGLGC  157

Query  397  CDLSFDYDVNAYQIDITD-----SSIVNNACNYAFFLATGDDFTTTSSRLS----LQRIS  549
            C       +  + + +       S +  N C YA FLA  D +T   + LS    L RI+
Sbjct  158  CQTPIPNGLKTFTLGLESPFKHRSVMKFNPCGYA-FLADKDKYTFNVADLSDPTFLSRIN  216

Query  550  NLLPEDKLVVPVVWRWSVTRDDL--SYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLE  723
            N L       PVV  W V  ++   S    + S  C          +    + CSC    
Sbjct  217  NNL-------PVVLDWVVGANETCRSAQKNSTSYACQNNTNCTDFDIGSGGYRCSCLRGY  269

Query  724  YGNAYLPNGC  753
             GN YLP GC
Sbjct  270  EGNPYLPPGC  279



>ref|XP_003594614.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64865.1| wall associated kinase-like protein [Medicago truncatula]
Length=726

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 69/264 (26%), Positives = 108/264 (41%), Gaps = 32/264 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I C   ++    KP+L S +         L ++N    + + E  +P+          
Sbjct  63   FEIECKLDNNSQNPKPYLKSLN---------LEVNNFYLDLGLVEIMNPIHRPNCRKY--  111

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA  357
            +NN ++I N  L G PF YS  YN+F+  GC   A + + G    + GC   C  NN  +
Sbjct  112  NNNKTVIIN--LGGGPFIYSQDYNKFLAVGCNNLAFIQSSGN--MVGGCVSICDDNNINS  167

Query  358  AP-KFAYD-CNGINCCDLSFDYDVNAYQIDITDSSIVN-NACNYAFFLATG----DDFTT  516
                 + D CNG  CC+ S    ++ Y   +      N + C+YA  L+      D  ++
Sbjct  168  NYFNLSSDGCNGRYCCETSLPMHLSEYNATLQGLRGPNISECSYALILSRRWVYFDGLSS  227

Query  517  TSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQL----  684
              S   L+  + L  ED    P +  W +  D L  +  T+    D Y   +  Q+    
Sbjct  228  YLSTYYLENFNKL--EDMEYAPAMLEWEILNDML--INSTFQLPSDSYSNCYDSQVTSIN  283

Query  685  -RGTYWSCSCKFLEYGNAYLPNGC  753
             R T   C C    +GN Y+  GC
Sbjct  284  NRNTGRQCQCFSGYFGNPYIAGGC  307



>ref|XP_008353664.1| PREDICTED: wall-associated receptor kinase-like 8 [Malus domestica]
Length=327

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/191 (29%), Positives = 77/191 (40%), Gaps = 21/191 (11%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G PF +S S NRF   GC    L T     T+ GC   C S  T ++      CNGI+
Sbjct  98   LEGGPFVFSQSKNRFTAVGCNNLALMTMVNGSTIGGCLSFCRSGLTASSST----CNGID  153

Query  394  CCDLSFDYDVNAYQ--IDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
            CC  +   D+  +   I+  ++      C YAF +              L++ S++   D
Sbjct  154  CCQTTIPSDLQVFNTTIESVETGEPTEGCKYAFLVD-----RQWFENEGLRKASDIQNMD  208

Query  568  KLVVPVVWRWSVTRDDLSYLPPTY------SRDCDRYEKIFPPQL--RGTYWSCSCKFLE  723
             L  PVV  W + R     L          S  C+    +       + +   CSCK   
Sbjct  209  SL--PVVLEWRIDRRTYDSLATNKSIAFNNSTVCESGSFVNSTSFSNKNSMVRCSCKRGY  266

Query  724  YGNAYLPNGCQ  756
             GN YLP+GCQ
Sbjct  267  EGNPYLPDGCQ  277



>ref|XP_007147586.1| hypothetical protein PHAVU_006G137000g [Phaseolus vulgaris]
 gb|ESW19580.1| hypothetical protein PHAVU_006G137000g [Phaseolus vulgaris]
Length=306

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/194 (28%), Positives = 84/194 (43%), Gaps = 16/194 (8%)
 Frame = +1

Query  205  NTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA----APKF  369
            N  L G+PF YS  +N F+  GC   A+L   G E  ++GC  +C+ N            
Sbjct  110  NQSLEGSPFVYSQEHNIFVAAGCNSVAILKLNGSE--VSGCVSTCNENYKVGDIGNIKLI  167

Query  370  AYDCNGINCCDLSFDYDVNAYQIDIT--DSSIVNNACNYAFFLATGDDFTTTSSRLSLQR  543
              DCNG +CC+ S    +  Y I+I     +  ++ C+YA  +    D+       +  R
Sbjct  168  ESDCNGTSCCESSLPPYLKEYSIEIKGLKENESSHECSYALVVQPDRDYGYRHYSYNDPR  227

Query  544  ---ISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYE-KIFPPQLRGTYWSCSC  711
               + + L +D  VVP +  W +  +    LP  +   C  Y+ KI     + +   CSC
Sbjct  228  GYFVEDRLMKDLDVVPALLEWEIVNNLNLTLPSDHHSQC--YDTKITSSLYKRSGQRCSC  285

Query  712  KFLEYGNAYLPNGC  753
                +GN Y   GC
Sbjct  286  N-TGFGNPYFEGGC  298



>ref|XP_007035468.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06394.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=719

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/184 (27%), Positives = 73/184 (40%), Gaps = 16/184 (9%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            ++G+PFF+S S N+F+  GC      T G E T+ GC+ +C  N           CNG  
Sbjct  110  ITGSPFFFSGSMNKFIAAGCNNKAFMT-GTEPTIVGCESACIDNRLFGPNN---TCNGET  165

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATG-DDFTTTSSRLSLQRISNLLPEDK  570
            CC+      +  +          +  C  AF +     D   T    +LQ +        
Sbjct  166  CCETVIPSRLRVFNARFESKESQSEGCKLAFLVEEKWFDVNITDKSSALQNMD-------  218

Query  571  LVVPVVWRWSVTRDDLSYLPPTYSRD--CDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLP  744
              VP +  W +  + L  LP    R+  C  Y  +           C C++   GNAYL 
Sbjct  219  -YVPALLDWGIPDEALG-LPKKRGREYYCTGYYSMHLEPYYLNSSRCYCQYGYEGNAYLL  276

Query  745  NGCQ  756
            NGCQ
Sbjct  277  NGCQ  280



>emb|CDP11262.1| unnamed protein product [Coffea canephora]
Length=580

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 54/205 (26%), Positives = 90/205 (44%), Gaps = 33/205 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLS-SFSDGKNGVREILSISNVRQSIIMKESFSPLC--HTTAGS  171
            + I C  + + G  KP+LS  F        E+L IS + Q++ + +S + +C  H  A  
Sbjct  31   YTIICVDNYASG-SKPYLSFLFQSVSQFFVEVLEISLIDQTVTINKSATRICSDHRQADL  89

Query  172  AVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQE-FTMAGCKLSCSSNN  348
            A+ S          L G+PFF ++ +N+ M  GCG A L +       ++GC   C++  
Sbjct  90   AMAS--------YLLDGSPFFVAAEHNKLMLVGCGNAFLMSASDSPEILSGCTSICTNKK  141

Query  349  TTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDS-SIVNNACNYAFFLATGDDFTTTSS  525
             T        C G+NCC  S  Y + +Y ++IT S +  +  C  A  +     F     
Sbjct  142  VTG-------CYGLNCCQASIPYYLGSYTVNITASQNFTSRTCPAASLVDQKWKF-----  189

Query  526  RLSLQRISNLLPEDKLVVPVVWRWS  600
                    +L P+  +  P+V  W+
Sbjct  190  -------QDLDPKTDMFFPLVLSWA  207



>ref|XP_010256630.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Nelumbo 
nucifera]
Length=754

 Score = 63.9 bits (154),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 66/255 (26%), Positives = 103/255 (40%), Gaps = 46/255 (18%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSG  222
            KPFLS  +       E++ IS     I  K +F+  C+  +G  +       ++   L G
Sbjct  71   KPFLSETN------IEVVEISQDVARI--KNTFAFTCYAQSGPVIDYK----LAWIYLDG  118

Query  223  TPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCD  402
            TPF +S + NRF   GC    L    +E  +      C S            C+G+ CC 
Sbjct  119  TPFTFSHTANRFTVIGCDSLALILGVEEHNLKNHSSGCLSQCYHKEDIIDGVCSGVGCCQ  178

Query  403  LSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            +     +  + +  +  S+ N       +AC+Y+F L   D +T  +S +S       +P
Sbjct  179  VPIPKGLKRFIV--SSGSLYNSTRVWSFDACSYSF-LGEQDSYTFKASDVSDPSFRTRIP  235

Query  562  EDKLVVPVVWRWSV-------TRDDLSYLP---PTYSRDCDRYEKIFPPQLRGTYWSCSC  711
            +    +PVV  W V        + +L+  P    +Y  D +           G  + C C
Sbjct  236  D----IPVVLDWVVGNQTCQEAKRNLTTFPCRENSYCYDSNN----------GQGYRCGC  281

Query  712  KFLEYGNAYLPNGCQ  756
            K    GN YLPNGCQ
Sbjct  282  KKGYQGNPYLPNGCQ  296



>ref|XP_011034598.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=739

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 69/270 (26%), Positives = 114/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSPSRAFLSRIN------MEVLGISLGSSRVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+      ++G+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  105  GANLAF----DMTGSPFVFSS-LNIFIAMGCNNHALLNR-IEPEVVGCTSTCGANNLTSS  158

Query  361  ---PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                K    C+G NCC      ++  +   +  +   N    N C  AF +  G      
Sbjct  159  ITEGKEKRYCSGNNCCQTRIPSNLQVFNASLGTTEDPNDQGRNQCKVAFIVDRGWSLDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  ++Q        D+  VPV+  W V  D++  +  + +++C       P QL    W
Sbjct  219  KSPEAVQ--------DRQHVPVILDWFVYSDNIR-VENSDAKNCRP-----PVQLPSGRW  264

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  265  GLSTLTLYSNSTTCSCNLGYDGNPYLPDGC  294



>emb|CAN65983.1| hypothetical protein VITISV_017972 [Vitis vinifera]
Length=649

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 108/254 (43%), Gaps = 41/254 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  SSS    KPFL+          E+ ++S   +++++      LC         
Sbjct  56   FSINCNDSSSP--PKPFLNHTELN----LELFNVSLEYKTVMVNSPIPSLC---------  100

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            ++N +  SN    G+PF +SS +N FM  GC    +   G E  +AGC  +C  +N  A 
Sbjct  101  ADNGTWKSN-DFGGSPFRFSSVHNIFMVVGCDTNAVLATGDEI-LAGCTSNC--DNRIAR  156

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN--NACNYAFFLATGDDFTTTSSRLS  534
             +    C GI CC  +  Y+  +  + + + S V     C YAF +   D +   +S  +
Sbjct  157  TR--RRCYGIKCCQTTISYNSQSTHLGMYNVSYVKTGEGCAYAF-MGGRDWYANNNSDPA  213

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCK  714
                S          P+V  W +   + + L   Y +D D        Q   T   CSC+
Sbjct  214  NTTNSGY-------APLVMFWEM---ETTSLGSCYLQDLDW-------QSGKTIEICSCE  256

Query  715  FLEYGNAYLPNGCQ  756
                GN YLPNGCQ
Sbjct  257  HRYEGNPYLPNGCQ  270



>ref|XP_011013613.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X1 
[Populus euphratica]
 ref|XP_011013614.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X2 
[Populus euphratica]
Length=739

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 67/270 (25%), Positives = 113/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSPSRAFLSRIN------MEVLGISLGNSRVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+      ++G+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  105  GANLAF----DMTGSPFIFSS-LNIFIAMGCNNRALLNR-IEPEIVGCTSTCGANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      ++  +   +  +   N    N C  AF +  G      
Sbjct  159  STEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTTEDPNDQGRNQCKVAFIVDRGWSLDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  +++ + +        VPV+  W V  DD   +  + +++C       P QL    W
Sbjct  219  KSPEAVRDMQH--------VPVILDWFVYSDDFR-VENSDAKNCSP-----PVQLASGRW  264

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  265  GLSTLTLYSNSTTCSCNLGYDGNPYLPDGC  294



>ref|XP_002274962.1| PREDICTED: wall-associated receptor kinase-like 2 [Vitis vinifera]
Length=717

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 72/254 (28%), Positives = 108/254 (43%), Gaps = 41/254 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  SSS    KPFL+          E+ ++S   +++++      LC         
Sbjct  56   FSINCNDSSSP--PKPFLNHTELN----LELFNVSLEYKTVMVNSPIPSLC---------  100

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            ++N +  SN    G+PF +SS +N FM  GC    +   G E  +AGC  +C  +N  A 
Sbjct  101  ADNGTWKSN-DFGGSPFRFSSVHNIFMVVGCDTNAVLATGDEI-LAGCTSNC--DNRIAR  156

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN--NACNYAFFLATGDDFTTTSSRLS  534
             +    C GI CC  +  Y+  +  + + + S V     C YAF +   D +   +S  +
Sbjct  157  TR--RRCYGIKCCQTTISYNSQSTHLGMYNVSYVKTGEGCAYAF-MGGRDWYANNNSDPA  213

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCK  714
                S          P+V  W +   + + L   Y +D D        Q   T   CSC+
Sbjct  214  NTTNSGY-------APLVMFWEM---ETTSLGSCYLQDLDW-------QSGKTIEICSCE  256

Query  715  FLEYGNAYLPNGCQ  756
                GN YLPNGCQ
Sbjct  257  HRYEGNPYLPNGCQ  270



>ref|XP_011013615.1| PREDICTED: wall-associated receptor kinase-like 22 isoform X3 
[Populus euphratica]
Length=728

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 67/270 (25%), Positives = 113/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSPSRAFLSRIN------MEVLGISLGNSRVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+      ++G+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  105  GANLAF----DMTGSPFIFSS-LNIFIAMGCNNRALLNR-IEPEIVGCTSTCGANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      ++  +   +  +   N    N C  AF +  G      
Sbjct  159  STEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTTEDPNDQGRNQCKVAFIVDRGWSLDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  +++ + +        VPV+  W V  DD   +  + +++C       P QL    W
Sbjct  219  KSPEAVRDMQH--------VPVILDWFVYSDDFR-VENSDAKNCSP-----PVQLASGRW  264

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  265  GLSTLTLYSNSTTCSCNLGYDGNPYLPDGC  294



>ref|XP_011034597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 69/265 (26%), Positives = 113/265 (43%), Gaps = 40/265 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FL   +       E+L I    + + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSSSRAFLRRIN------MEVLGIPLGERWVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+I     ++G+PF +SSS N F   GC    L     E  + GCK +CS+NN T++
Sbjct  105  GANLAI----NMTGSPFAFSSS-NSFAAMGCNNRALLNR-IEPEIVGCKSTCSANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      D+  +   +  +   N    N C  AF +         
Sbjct  159  STEGKENCYCSGNNCCQTRIPSDLQVFSASLETTEDPNDHGRNQCKVAFIVDREWSRDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSY-------LPPTYSRDCDRYEKIFPP  678
             S  ++Q + +        VPV+  W V  DD+S          PT +    R+  +   
Sbjct  219  KSPEAVQDMQH--------VPVILDWFVYSDDISVGNSDAKNCSPTVNLISGRW-GLRTV  269

Query  679  QLRGTYWSCSCKFLEYGNAYLPNGC  753
            +L     +C C     GN YLP+GC
Sbjct  270  KLYSNSTTCRCNPGYDGNPYLPDGC  294



>ref|XP_006368673.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
 gb|ERP65242.1| hypothetical protein POPTR_0001s076201g, partial [Populus trichocarpa]
Length=678

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 67/270 (25%), Positives = 113/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  59   FSVDCNKTTADSPSRAFLSRIN------MEVLKISLGSSRVRVN---SPI--ISSGCSGR  107

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NLS      ++G+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  108  GANLSF----DMTGSPFVFSS-LNIFIAMGCNNRALLNR-IEPEIVGCTSTCGANNLTSS  161

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      ++  +   +  +   N    N C  AF +         
Sbjct  162  STEGKEKRYCSGNNCCQTRIPSNLQVFSASLGTTEDSNDQGRNQCKVAFIVDRAWSLDNI  221

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  ++Q + +        VPV+  W +  DD+  +  + +++C       P QL    W
Sbjct  222  KSPEAVQDMQH--------VPVILDWFMYSDDIR-VENSEAKNCSP-----PVQLVSGMW  267

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  268  GLSTLTLYSNSTTCSCNLGYDGNPYLPDGC  297



>ref|XP_010269758.1| PREDICTED: wall-associated receptor kinase-like 8 [Nelumbo nucifera]
Length=690

 Score = 62.8 bits (151),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 67/255 (26%), Positives = 97/255 (38%), Gaps = 48/255 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I C +SSS     PFLS  S G+    ++L+IS   +  I   +FS            
Sbjct  62   FEITCDRSSSHPT--PFLS-LSTGR---FQVLNISMNGELRINVPTFS-----------S  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             N   +     L G+PFF+S S N F+  GC          + +  GC  +CS  +    
Sbjct  105  PNETEVHGRISLEGSPFFFSQSGNVFVAVGCNNRAFVHNHHDNSTVGCISTCSGRDVKKK  164

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNN--ACNYAFFLATGDDFTTTSSRLS  534
                  C GI+CC     + +    + IT + I N    C  AF +          +   
Sbjct  165  -----GCCGISCCQTPIPWSLQTVDVTITSAGICNEILGCKSAFVVDQQWFVVNLPNPYD  219

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCK  714
            ++ ++         VPVV  W                DC      +P  L     +C CK
Sbjct  220  VRNMTE--------VPVVLDW--------------WSDCG--PNSYPISLSSLRNTCICK  255

Query  715  FLEYGNAYLPNGCQG  759
            +   GN YLP+GCQG
Sbjct  256  YPFEGNPYLPHGCQG  270



>ref|XP_011011593.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X1 
[Populus euphratica]
Length=739

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 113/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSPSRAFLSRIN------MEVLGISLGNSRVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+      +SG+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  105  GANLAF----DMSGSPFIFSS-LNIFIAMGCNNRALLNR-IEPEIVGCTSTCGANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      ++  +   +  +   N    N C  AF +  G      
Sbjct  159  STEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTTEDPNDQGRNQCKVAFIVDRGWSLDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  +++ + +        VPV+  W V  DD   +  + +++C       P QL    W
Sbjct  219  KSPEAVRDMQH--------VPVILDWFVYSDDFR-VENSDAKNCSP-----PVQLASGRW  264

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  265  GLSTLTLYSNSTTCSCNPGYDGNPYLPDGC  294



>ref|XP_011078212.1| PREDICTED: wall-associated receptor kinase-like 10 [Sesamum indicum]
Length=731

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 65/231 (28%), Positives = 96/231 (42%), Gaps = 28/231 (12%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            EIL+IS V   + + +  SPL + +A     S      S   L G+PF  S+ +N  +  
Sbjct  76   EILNISLVDGIVRIVQPVSPL-NCSAEMRRQS------SGKALLGSPFTISAVHNSVIVL  128

Query  268  GCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDIT  447
            GC   V     +   + GC   CS N+T         CNG++CC ++    +   Q    
Sbjct  129  GCRNTVWLLANETTIVGGCTAICSENSTDIR------CNGVSCCQITIPRGLQELQFTYR  182

Query  448  DSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLV--VPVVWRWSVTRDD  615
             +   NN+  C YA F+A    F     R +  R + L P D+      +V  W +   +
Sbjct  183  SNEFSNNSTFCGYA-FVAEQKWFLEDYRRYNGLRANFLDPFDQEFRNASMVLEWELNNVE  241

Query  616  LSYLPPTYSRDCDRYEKIFPPQLRGTYWS----CSCKFLEYGNAYLPNGCQ  756
            LS         C+ Y    PP  R  + +    C C     GN YLP+GCQ
Sbjct  242  LS-----LHSSCE-YRGTTPPSSRDEFDALTRLCYCDNGFEGNPYLPDGCQ  286



>ref|XP_011011594.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X2 
[Populus euphratica]
 ref|XP_011011595.1| PREDICTED: wall-associated receptor kinase-like 2 isoform X3 
[Populus euphratica]
Length=739

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/270 (25%), Positives = 113/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSPSRAFLSRIN------MEVLGISLGNSRVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+      +SG+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  105  GANLAF----DMSGSPFIFSS-LNIFIAMGCNNRALLNR-IEPEIVGCTSTCGANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      ++  +   +  +   N    N C  AF +  G      
Sbjct  159  STEGKEKRYCSGDNCCQTRIPSNLQVFSASLGTTEDPNDQGRNQCKVAFIVDRGWSLDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  +++ + +        VPV+  W V  DD   +  + +++C       P QL    W
Sbjct  219  KSPEAVRDMQH--------VPVILDWFVYSDDFR-VENSDAKNCSP-----PVQLASGRW  264

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  265  GLSTLTLYSNSTTCSCNPGYDGNPYLPDGC  294



>ref|XP_003594613.1| Wall-associated receptor kinase-like protein [Medicago truncatula]
 gb|AES64864.1| wall associated kinase-like protein [Medicago truncatula]
Length=712

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 68/263 (26%), Positives = 105/263 (40%), Gaps = 32/263 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I C   +S    KP+L S +         L ++NV   + M E  +P+ H+     + 
Sbjct  63   FEIECKLDNSSQNPKPYLKSLN---------LEVNNVYLDLGMVEIMNPIYHSNCQQNIN  113

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA  357
            +  ++I     L  +PF YS SYN+F+  GC   A L + G   T+ GC   C   N   
Sbjct  114  NKTVTI----NLGVSPFMYSQSYNKFLAVGCNNLAFLQSNGT--TVGGCVSICDDGNFNN  167

Query  358  APKFAYD-CNGINCCDLSFDYDVNAYQI---DITDSSIVNNACNYAFFLATGDDFTTTSS  525
                + D CNG  CC+ S    ++ Y      +++ SI  + C+YA  L+        S 
Sbjct  168  NFNSSNDRCNGRYCCETSLPTHLSEYNATFQGLSEQSI--DQCSYALILSDNWISFDGSY  225

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPP-TYSRDCDRYEKIFPPQLRGTYWS  702
              +   + N+        P +  W +  +    LP  +Y  D     K+     R T   
Sbjct  226  LSTFNELGNM-----EYAPAMLEWEILVNSTFQLPSDSYCYD----SKVTSLNNRTTGRK  276

Query  703  CSCKFLEYGNAYLPNGCQGTSTL  771
            C C     GN Y+  GC  T   
Sbjct  277  CQCSSGYTGNPYIVGGCTETEVF  299



>ref|XP_006387117.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
 gb|ERP46031.1| hypothetical protein POPTR_1809s00200g [Populus trichocarpa]
Length=739

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 67/270 (25%), Positives = 113/270 (42%), Gaps = 50/270 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS     + +    SP+   ++G +  
Sbjct  57   FSVDCNKTTADSPSRAFLSRIN------MEVLKISLGNSRVRVN---SPI--ISSGCSGR  105

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+      ++G+PF +SS  N F+  GC    L     E  + GC  +C +NN T++
Sbjct  106  GANLAF----NMTGSPFVFSS-LNIFIAMGCNNRALLNR-IEPEIVGCTSTCGANNLTSS  159

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      ++  +   +  +   N    N C  AF +  G      
Sbjct  160  STTGEEKRYCSGNNCCQTRIPSNLQVFSASLGTTEDPNDQGRNQCKVAFIVDRGWSLDNI  219

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S  ++Q + +        VPV   W +  DD+  +  + +++C       P QL    W
Sbjct  220  KSPEAVQDMQH--------VPVFLDWFMYSDDIG-VENSDAKNCSP-----PVQLVSGRW  265

Query  700  ------------SCSCKFLEYGNAYLPNGC  753
                        +CSC     GN YLP+GC
Sbjct  266  GLSTLTLYSNSTTCSCNLGYDGNPYLPDGC  295



>ref|XP_006368667.1| hypothetical protein POPTR_0001s07560g [Populus trichocarpa]
 gb|ERP65236.1| hypothetical protein POPTR_0001s07560g [Populus trichocarpa]
Length=319

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 72/261 (28%), Positives = 113/261 (43%), Gaps = 43/261 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E L IS   + + +    SP+   ++G A  
Sbjct  87   FSVDCNKTTADSPSRAFLSRIN------MEFLGISLEDRVVRVN---SPI--ISSGCAGR  135

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLS-CSSNNTTA  357
              NL+I     ++ +PF +SSS NRF   GC    L T  Q   + GC  S CS+NN T+
Sbjct  136  GANLAI----NMTRSPFAFSSS-NRFAAMGCNNHALLTQIQP-EIVGCTTSTCSANNLTS  189

Query  358  APKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTT  516
                  +   C+G NCC  S   ++  +   +  +   N    N C  AF +        
Sbjct  190  FSTEGKENCYCSGNNCCQTSIPSNLQVFNASLGPTEDPNDQGRNQCKLAFIVDGEWSLDN  249

Query  517  TSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY  696
              S  ++Q + +        VPV+  W V  DD+    P  + D     K   P ++   
Sbjct  250  IKSPKAVQYMQH--------VPVILDWFVYGDDI----PVENSD----AKYCSPPVKLVS  293

Query  697  WSCSCKFLEYGNAYLPNGCQG  759
              C+  +   GN YLP+GC G
Sbjct  294  GRCNQGY--DGNPYLPDGCTG  312



>ref|XP_007035467.1| Wall associated kinase-like 6, putative [Theobroma cacao]
 gb|EOY06393.1| Wall associated kinase-like 6, putative [Theobroma cacao]
Length=758

 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 54/188 (29%), Positives = 80/188 (43%), Gaps = 22/188 (12%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            ++G+PF +S S N+F+  GC      T G E T+ GC+ +C  N     P     C+G  
Sbjct  114  ITGSPFCFSESMNKFIAAGCNNEAFMT-GIEPTIVGCESACIGNRL-FGPNPNATCDGST  171

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATG---DDFTTTSSRLSLQRISNLLPE  564
            CC+      ++ +          +  C  AF +      ++ T  SS  + Q +      
Sbjct  172  CCETVIPSRLHVFNATFQSKESESEGCKLAFLVEEEWFYNNITDKSS--AFQNVD-----  224

Query  565  DKLVVPVVWRWSVTRDDLSYLPPTYSRD--CD--RYEKIFPPQLRGTYWSCSCKFLEYGN  732
                VP +  W++  D+   LP    RD  C+  RY    P  L  +   C C     GN
Sbjct  225  ---YVPALLDWAIP-DEAFELPTKRGRDYYCNGHRYMDTEPYYLNSS--RCYCYGGYEGN  278

Query  733  AYLPNGCQ  756
            AYLPNGCQ
Sbjct  279  AYLPNGCQ  286



>ref|XP_011013612.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 68/265 (26%), Positives = 112/265 (42%), Gaps = 40/265 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FL   +       E+L I    + + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSSSRAFLRRIN------MEVLGIPLGERWVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+I     ++G+PF +SSS N F   GC    L     E  + GCK +C +NN T++
Sbjct  105  GANLAI----NMTGSPFAFSSS-NSFAAMGCNNRALLNR-IEPEIVGCKSTCGANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTT  519
                 +   C+G NCC      D+  +   +  +   N    N C  AF +         
Sbjct  159  STEGKENCYCSGNNCCQTRIPSDLQVFNASLETTEDPNDHGRNQCKVAFIVDREWSRDNI  218

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSY-------LPPTYSRDCDRYEKIFPP  678
             S  ++Q + +        VPV+  W V  DD+S          PT +    R+  +   
Sbjct  219  KSPEAVQDMQH--------VPVILDWFVYSDDISVGNSDAKNCSPTVNLISGRW-GLRTV  269

Query  679  QLRGTYWSCSCKFLEYGNAYLPNGC  753
            +L     +C C     GN YLP+GC
Sbjct  270  KLYSNSTTCRCNPGYDGNPYLPDGC  294



>ref|XP_002297682.1| kinase family protein [Populus trichocarpa]
 gb|EEE82487.1| kinase family protein [Populus trichocarpa]
Length=741

 Score = 60.8 bits (146),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 117/266 (44%), Gaps = 39/266 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS    +I +    SP+   ++G A  
Sbjct  56   FSVDCNKTTADSPSRAFLSRIN------MEVLEISLGYSTIPLVRVNSPI--ISSGCAGS  107

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+I     ++G+PF +SSS N F+  GC    L +   E  + GC  +C +NN T++
Sbjct  108  GANLAI----NMTGSPFAFSSS-NIFIAMGCNNRALLS-RIEPEIVGCTSTCGANNLTSS  161

Query  361  PKFAYD---CNGINCCDLS-------FDYDVNAYQIDITDSSIVNNACNYAFFLATGDDF  510
                 +   C+G NCC  +       FD  +   +  I D     N C  AF +   + F
Sbjct  162  SAEGKENSYCSGNNCCQTTIPSSLQVFDASLGTPEHPINDQG--RNQCKTAFIVEE-EWF  218

Query  511  TTTSSRLSLQRISNLLPEDKLVVPVVWRWSV--TRDDLSYLPPTYSRDCDRYEKIFPPQL  684
                S   + R       D   VPV+  W +    D    +  + +++C R   ++  + 
Sbjct  219  RNNISSPEVVR-------DMQYVPVILDWEMYYGTDIPEDVTNSDAKNCWRGLTMWGLRT  271

Query  685  RGTY---WSCSCKFLEYGNAYLPNGC  753
               Y    +CSC     GN YLP+GC
Sbjct  272  VTLYSNSTTCSCNPGYDGNPYLPDGC  297



>ref|XP_008229606.1| PREDICTED: wall-associated receptor kinase-like 22 [Prunus mume]
Length=732

 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 70/248 (28%), Positives = 106/248 (43%), Gaps = 37/248 (15%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSG  222
            KPFL+S         E+L +S   +  I++ +F    ++T G    +N +S      + G
Sbjct  67   KPFLNSTK------LEVLEVST--ELGIVRVNFP--VNSTCGDRSSANVMS------MEG  110

Query  223  TPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCD  402
            +PF +S + NRF   GC    L T     T+ GC   C S +T  +   +  CNGI+CC 
Sbjct  111  SPFVFSQADNRFTGVGCNNLALMTLLNGSTIGGCLSFCFSGSTGGS---STTCNGIDCCQ  167

Query  403  LSFDYDVNAYQIDITDSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLV  576
             +   D+ A+   I +     N+  C YAF +    D     S + + + S +   D   
Sbjct  168  TTIPSDLQAFNTTIENIEARENSEGCKYAFLV----DQQWFESNVRVAKASAIQNRDNFP  223

Query  577  VPVVW---RWS----VTRDDLSYLPPTYSRDCDRYEKIFPPQL--RGTYWSCSCKFLEYG  729
            V + W   RW     VT   +S+   T    C+    I       + +   CSCK    G
Sbjct  224  VVLEWRIDRWKYDSLVTNKSISFNNSTL---CESGVLINSTSFSNQTSVVRCSCKRGYEG  280

Query  730  NAYLPNGC  753
            N YLP GC
Sbjct  281  NPYLPEGC  288



>ref|XP_010023385.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=747

 Score = 60.5 bits (145),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 102/236 (43%), Gaps = 44/236 (19%)
 Frame = +1

Query  109  VRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AV  285
            V Q +   E   P C    G AV  N   I ++  L+G+ F YS + N F+  GC   A 
Sbjct  100  VFQPVFYSEPNLPNC---TGRAVSGN---IPTSLNLTGSSFMYSHTKNVFVSGGCNNLAY  153

Query  286  LTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDC-NGINCCDLSFDYDVNAYQIDITDSS--  456
            + +P     + GC+ +CS    TA+     DC NGI CC  +  + +  Y ++ T  +  
Sbjct  154  MVSPSMMSAVVGCRSTCSG---TASQD---DCWNGIGCCMNTIPFGLQVYWVNFTTENGS  207

Query  457  --IVNNACNYAFFL-ATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYL  627
                + +C YAF +   G DF +  +       +  LP     VPV   W ++ +   ++
Sbjct  208  PMGTDGSCRYAFLVDHLGYDFPSNMTD------TRTLPSH---VPVTLEWGISDEVFVHM  258

Query  628  PP---------TYSRDCDRYEKIF----PPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            P          T S  CD Y  ++     P+L   Y  C C+    GN Y+ +GC+
Sbjct  259  PISNDLYLYNLTTSYWCDDYGYLYYGSDNPRL---YVQCRCRSGFAGNPYIKDGCK  311



>emb|CAN64181.1| hypothetical protein VITISV_007799 [Vitis vinifera]
Length=705

 Score = 60.1 bits (144),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 58/194 (30%), Positives = 83/194 (43%), Gaps = 28/194 (14%)
 Frame = +1

Query  187  NLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPK  366
            N S      LS TPFFYS   N     GC  +VL T  Q   +AGC   C ++++     
Sbjct  105  NRSTWKGIDLSKTPFFYSEG-NALRVVGCANSVLITR-QGTILAGCSSICDNSSSV----  158

Query  367  FAYDCNGINCCDLSFDYDVNAYQIDITDSS--IVNNACNYAFFLATGDDFTTTSSRLSLQ  540
             +  C GINCC  +   +++ Y ++ T S+  +    C YA F   G +F          
Sbjct  159  LSNGCYGINCCKTTVPSNLDFYILNTTWSTNMVTELNCTYAAF---GRNFILRGKSSG--  213

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRG--TYWSCSCK  714
              S +  E      V+W    + +           DC  ++   P    G  +Y+SCSC 
Sbjct  214  --SGMEYEASSEGEVIWMIKESVE---------GSDC--HKNTVPDGALGNHSYYSCSCP  260

Query  715  FLEYGNAYLPNGCQ  756
              + GN YLPNGCQ
Sbjct  261  AYQEGNPYLPNGCQ  274



>ref|XP_006372235.1| hypothetical protein POPTR_0018s14490g, partial [Populus trichocarpa]
 gb|ERP50032.1| hypothetical protein POPTR_0018s14490g, partial [Populus trichocarpa]
Length=332

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 67/245 (27%), Positives = 100/245 (41%), Gaps = 44/245 (18%)
 Frame = +1

Query  76   NGVR-EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYN  252
            NG+  E+L+IS    +I +K    P+ +++      SN   +I N  L G+PF YS  +N
Sbjct  26   NGINLEVLNISVDEGTIHVK---FPIFYSSNCRGKESN--PVIVN--LEGSPFVYSEIWN  78

Query  253  RFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAY  432
            RF+  GC   VL T        GC   C  ++ +A  +    CNGINCC +     + ++
Sbjct  79   RFVVVGCNNIVLMTQNDSI-YGGCMSICDESSNSA--RNHASCNGINCCQMRIPSHLMSF  135

Query  433  QIDITD----SSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRW-  597
                 D         + C +A+       ++ T               D   VPVV  W 
Sbjct  136  NAVFKDLDGGQGRGRDQCKHAYLTP----YSVT---------------DMDSVPVVLDWM  176

Query  598  -------SVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                   S+ R+       TY    + Y+ I   Q   +   CSC    +GN YLP GC 
Sbjct  177  IDYWIFESLERNGSLADNKTYHCHVNNYDNISSNQ--KSMVKCSCSASYHGNPYLPAGCP  234

Query  757  GTSTL  771
            G  +L
Sbjct  235  GKLSL  239



>ref|XP_008220151.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Prunus 
mume]
Length=764

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 74/272 (27%), Positives = 118/272 (43%), Gaps = 58/272 (21%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C  + +    KPFL      K+   E+ +IS V   + +K+  +  C   +G+ +G
Sbjct  73   FLITCNDTYNP--PKPFLR-----KSDSIEVTNIS-VDGKLYIKQYIAIQCFNKSGTPLG  124

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT---MAGCKLSCSSNNT  351
                  + N+ LS + FF S + N+F+  GC  +   T  +        GC  +C S + 
Sbjct  125  G-----LENS-LSLSRFFISDTDNKFVAVGCDTSAKITGYKRRAYGYTGGCTTTCGSIDF  178

Query  352  TAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA-----CNYAFFLATGD-DFT  513
             A     Y C+GI CC  S    + ++ + +T S+   N      C+YAF +  G  +F+
Sbjct  179  VAN----YSCSGIGCCQTSIAKGMTSFNVSVTSSNNHKNVWDFSPCSYAFVVEEGKFNFS  234

Query  514  TTSSRLSLQRISNLLP--EDKLVVPVVWRWSV---------TRDDLSYLPPTYSRDCDRY  660
                       SN+L   ED  ++PVV  WS+          +  ++Y     SR CD  
Sbjct  235  -----------SNMLKDLEDVRLLPVVLDWSIGNEACEVVENKKLMNYTCQKNSR-CDNV  282

Query  661  EKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            +        G  + C C    +GN YL NGC+
Sbjct  283  DN-------GVGYRCKCMDGYHGNPYL-NGCR  306



>emb|CAN65979.1| hypothetical protein VITISV_017968 [Vitis vinifera]
Length=294

 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 76/258 (29%), Positives = 96/258 (37%), Gaps = 43/258 (17%)
 Frame = +1

Query  7    INCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSN  186
            +NC+ + S G EKPFL       N  +  L + NV       E  SP+   +     G +
Sbjct  60   VNCSVNMSSGAEKPFL-------NHTKLNLELLNVSLEHRTVEVNSPI--ASYDQRQGES  110

Query  187  NLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPK  366
            N S  S   L  +PF +S   N F+  GCG A L     E   A C   C  NN+  A  
Sbjct  111  NTSQPS-IDLDKSPFLFSRLDNIFVVLGCGQAKLMD--HENVWADCTSIC--NNSYPAQG  165

Query  367  FAYDCNGINCCDLSF----DYDVNAYQIDITDSSIVNNACNYA--FFLATGDDFTTTSSR  528
                 NG N C         Y +N Y +  T     NN  N     FL     F+  S++
Sbjct  166  R----NGFNFCQTPIPSTDSYYLNNYLVGFTRGCEGNNYSNSTTHAFLVDRHWFSHNSTK  221

Query  529  LSLQRISNLLPEDKLVV---PVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
                      PED   V   P+   W     D        S DC+R     P      + 
Sbjct  222  ----------PEDITRVKYAPLSLLWKTKSGD------NASSDCNRIAYYNPMMGLYVHC  265

Query  700  SCSCKFLEYGNAYLPNGC  753
            SCSC     GN YLP GC
Sbjct  266  SCSCPLRHEGNPYLPKGC  283



>ref|XP_010691609.1| PREDICTED: wall-associated receptor kinase-like 6 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010691610.1| PREDICTED: wall-associated receptor kinase-like 6 [Beta vulgaris 
subsp. vulgaris]
Length=763

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/208 (26%), Positives = 85/208 (41%), Gaps = 48/208 (23%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYD-----  378
            +  +PF  S+S N+ +  GC G  +    +  T+AGC   C   NTT   K   +     
Sbjct  145  MDKSPFRMSTSGNQLVVKGCPGVPILMNRKSETVAGCSTVCQGGNTTDEDKRKGNISTLT  204

Query  379  -CNGINCCDLSFDYD---VNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRL-SLQR  543
             C+GI CC +S D     V+ YQI +  S +  +     F L   + F     ++ + +R
Sbjct  205  SCDGIGCCLMSVDQQYLGVDFYQIALRSSYVDTSQVCMEFALM--EKFVDPEEKIAAAER  262

Query  544  ISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRD-----------------CDRYEKIF  672
            I  LL +D+  VP VW W         +PP    +                 C  Y++  
Sbjct  263  I--LLTDDQ--VPTVWYW---------MPPALPEENFTNNHQNPRSFSCRPFCGYYDEAQ  309

Query  673  PPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
              Q+      C+C     GN Y+ +GCQ
Sbjct  310  CAQI------CTCNEGYEGNPYISDGCQ  331



>gb|KCW48948.1| hypothetical protein EUGRSUZ_K02557 [Eucalyptus grandis]
Length=633

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 55/194 (28%), Positives = 79/194 (41%), Gaps = 17/194 (9%)
 Frame = +1

Query  196  IISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTP----GQEFTMAGCKLSCSSNNTTAAP  363
            II    L G+ FF+S  +N F   GC      T     G  FT  GC+  C+  NT+   
Sbjct  110  IIEPVSLEGSNFFFSQRWNVFTLVGCDTNATVTSTKSDGMVFTSTGCRSKCAGTNTSIRR  169

Query  364  KFAYDCNGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQ  540
              A  C+G + CC      ++ AY ++I +       CNYAF         +  S+L++ 
Sbjct  170  YSA--CSGWDGCCQTMLPLNLQAYSVNIKEEG-GQQGCNYAFPAE-----RSWFSKLNVT  221

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFL  720
             + +L   D   VPV   W +  +    +    S         +   LR  Y  C C+  
Sbjct  222  GLYDLRLND--TVPVELVWGIQNNTDYSIGLHQSSKNSHVLWCYNSSLRSVY--CYCREG  277

Query  721  EYGNAYLPNGCQGT  762
              GN YL  GCQG 
Sbjct  278  YDGNPYLIGGCQGV  291



>emb|CDP22017.1| unnamed protein product [Coffea canephora]
Length=353

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 74/269 (28%), Positives = 115/269 (43%), Gaps = 52/269 (19%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INCT SS+  V +  L +  D    V EI    ++   + + +  +  C+   GS + 
Sbjct  63   FFINCTNSSTS-VPQTVLQNAVD----VTEI----SLEGQVHLMQDIASDCYNKNGSLLN  113

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMA-GCKLSCSSNNTT  354
              +  I  + +     F +SS+ N+F+  GC   A++   GQ  + A GC  SC      
Sbjct  114  KKSPWIELSDR-----FTFSSTANKFIAVGCDALAIVKGFGQNRSYATGCIPSCDYKEDV  168

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFT  513
                    C+GI CC    D    A+ I+++ +S+ N       N C+YAF +       
Sbjct  169  ----IDGSCSGIGCCRT--DTPPGAWNINVSLTSLNNHTKVWDFNPCSYAFVVEE-----  217

Query  514  TTSSRLSLQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDCDRYEKI  669
              +   S   ++NL   D L +PVV  W++         R+  SY     +  C  YE  
Sbjct  218  -KAFNFSASNLTNL--SDDLSLPVVVDWTIEEGSCEVAQRNTTSYACSGKNSHC--YEP-  271

Query  670  FPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                 +G  + CSC     GN YLP+GCQ
Sbjct  272  ----FKGLGYRCSCDQGYEGNPYLPDGCQ  296



>emb|CBI15571.3| unnamed protein product [Vitis vinifera]
Length=908

 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/194 (29%), Positives = 81/194 (42%), Gaps = 28/194 (14%)
 Frame = +1

Query  187  NLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPK  366
            N S      LS TPFFYS   N     GC  +VL T  Q   +AGC   C ++++     
Sbjct  287  NRSTWKGIDLSKTPFFYSEG-NALRVVGCANSVLITR-QGTILAGCSSICDNSSSV----  340

Query  367  FAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQ  540
             +  C GINCC  +   +++ Y ++ T S+ +     C YA F   G +F          
Sbjct  341  LSNGCYGINCCKTTVPSNLDFYILNTTWSTNMGTELNCTYAAF---GRNFILRGKSSGSG  397

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRG--TYWSCSCK  714
                   E +++      W +              DC  ++   P    G  +Y+SCSC 
Sbjct  398  MEYEASSEGEMI------WMIKES-------VEGSDC--HKNTVPDGALGNHSYYSCSCP  442

Query  715  FLEYGNAYLPNGCQ  756
              + GN YLPNGCQ
Sbjct  443  AYQEGNPYLPNGCQ  456



>ref|XP_007147592.1| hypothetical protein PHAVU_006G137600g [Phaseolus vulgaris]
 gb|ESW19586.1| hypothetical protein PHAVU_006G137600g [Phaseolus vulgaris]
Length=359

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 71/270 (26%), Positives = 115/270 (43%), Gaps = 30/270 (11%)
 Frame = +1

Query  1    FLINCTKSS-SDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAV  177
            F I C  S+ ++    P+L S      GV E++SI+    ++ +K   +P+  +  GS  
Sbjct  56   FEIECRNSTYTNYTHTPYLKSI-----GV-EVISINLQLGTVNIK---NPIYRSNCGS--  104

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTMAGCKLSCSSNNTT  354
                 S   N  L G+PF YS  YN+FM  GC   A+L     E  ++GC   C  N   
Sbjct  105  ---KDSPPVNKSLEGSPFVYSQKYNKFMAAGCNIIAILQLNRSE--VSGCVSICDENYKV  159

Query  355  A-APKFAY---DCNGINCCDLSFDYDVNAYQIDIT--DSSIVNNACNYAFFLATGDDFTT  516
                K  +   DCNG +CCD S    +  Y  +I     +  ++ C+YA  +     ++ 
Sbjct  160  GDIGKMDFRKSDCNGKSCCDSSLPLYLKEYSTEIKGLKDNETSDECSYAMVVQQHLAYSY  219

Query  517  TSSRLSLQRISNLLPEDKL----VVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQL  684
             SS  +  +    + + ++    VVPVV  W +  +    LP  +   CD          
Sbjct  220  RSSSYNDPKTYYFIMDGEMKDLDVVPVVLEWEILNNLNLTLPLDHLSHCDDTNVTSSSGY  279

Query  685  RGTYWSCSCKF--LEYGNAYLPNGCQGTST  768
            + +   C C+   +  GN Y+  GC  T +
Sbjct  280  KRSGQRCYCQTGSVSGGNPYVEGGCPATDS  309



>ref|XP_007217600.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
 gb|EMJ18799.1| hypothetical protein PRUPE_ppa018374mg, partial [Prunus persica]
Length=689

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 56/190 (29%), Positives = 80/190 (42%), Gaps = 19/190 (10%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            + G+PF +S + NRF   GC    L T     T+ GC   C S +T  +   +  CNGI+
Sbjct  116  MEGSPFVFSQADNRFTGVGCNNLALMTLLNGSTIGGCLSFCFSGSTGGS---STTCNGID  172

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
            CC  +   D+ A+   I +     N+  C YAF +    D     S + + + S +   D
Sbjct  173  CCQTTIPSDLQAFNTTIENIEARENSEGCKYAFLV----DQQWFESNVRVAKASAIQNRD  228

Query  568  KLVVPVVWRWSVTR---DDL---SYLPPTYSRDCDRYEKIFPPQL--RGTYWSCSCKFLE  723
                PVV  W + R   D L     +    S  C+    I       + +   CSCK   
Sbjct  229  NF--PVVLEWRIDRWKYDSLVTNKSISLNNSTLCESGVFINSTSFSNQTSVVRCSCKRGY  286

Query  724  YGNAYLPNGC  753
             GN YLP GC
Sbjct  287  EGNPYLPEGC  296



>ref|XP_006386339.1| putative wall-associated kinase family protein [Populus trichocarpa]
 gb|ERP64136.1| putative wall-associated kinase family protein [Populus trichocarpa]
Length=743

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 68/263 (26%), Positives = 110/263 (42%), Gaps = 38/263 (14%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C  + +     P  +   +G   V EI     +R    + +  +  C+  AG A  
Sbjct  54   FLITCNHTFN-----PPKAFLGNGNLSVTEITLDGKLR----LMQYIAKDCYNRAG-ART  103

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGC----GGAVLTTPGQEFTMAGCKLSCSSNN  348
            + N+  I N  + G P+ +S + N F+  GC    G   +     +  + GC   CS  N
Sbjct  104  TRNIPWI-NLPVQG-PYVFSDTDNMFVAIGCDTYAGLLGIREDTNDTYLVGCISECS--N  159

Query  349  TTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-----NACNYAFFLATGDDFT  513
             T  P     C+G+ CC  S    +  +++ ++  +        N C++AF +     F+
Sbjct  160  KTVVPN---TCSGVGCCQTSIAKGMKYFEVRLSSETNHTGIWEFNPCSFAFMIEK-KQFS  215

Query  514  TTSSRLS-LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPP-TYSRDCDRYEKIFPPQLR  687
               S LS L+++          VP++  WS+ R+    L     S  C    K   P+  
Sbjct  216  FFPSNLSDLEQVRK--------VPIIVDWSIGRNKCETLEKNKMSNACQGQSKCHDPE-N  266

Query  688  GTYWSCSCKFLEYGNAYLPNGCQ  756
            G+ + C C     GN YLPNGCQ
Sbjct  267  GSGYICKCLDGYQGNPYLPNGCQ  289



>ref|XP_011011597.1| PREDICTED: wall-associated receptor kinase-like 22 [Populus euphratica]
Length=738

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 114/268 (43%), Gaps = 46/268 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L I    + + +    SP+   ++G +  
Sbjct  56   FSVDCNKTTADSSSRAFLSRIN------MEVLKIPLGERWVRVN---SPI--ISSGCSGR  104

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
              NL+I     ++G+PF +SSS N F   GC    L T  +   + GC  +C +NN T++
Sbjct  105  GANLAI----NMTGSPFAFSSS-NSFAAMGCNNHALLTQIKP-EIVGCTSTCGANNLTSS  158

Query  361  PKFAYD---CNGINCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLA---TGDDF  510
                 +   C+G NCC      D+  +   +  +   N    N C  AF +    + D+ 
Sbjct  159  STEGKENCYCSGNNCCQTRIPSDLQVFNASLETTEDPNDHGRNQCKVAFIVDREWSRDNI  218

Query  511  TTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPP----  678
             +  +   +Q            VPV+  W V  DD+  +  + +++C     +       
Sbjct  219  KSPEAVRDMQH-----------VPVILDWFVYSDDIR-VENSDAKNCSPTMNLISGRWGS  266

Query  679  ---QLRGTYWSCSCKFLEYGNAYLPNGC  753
               +L     +C C     GN YLP+GC
Sbjct  267  RTVKLYSNSTTCRCNPGYDGNPYLPDGC  294



>ref|XP_010663682.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=705

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 57/194 (29%), Positives = 83/194 (43%), Gaps = 28/194 (14%)
 Frame = +1

Query  187  NLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPK  366
            N S      LS TPFFYS   N     GC  +VL T  Q   +AGC   C ++++     
Sbjct  105  NRSTWKGIDLSKTPFFYSEG-NALRVVGCANSVLITR-QGTILAGCSSICDNSSSV----  158

Query  367  FAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQ  540
             +  C GINCC  +   +++ Y ++ T S+ +     C YA F   G +F          
Sbjct  159  LSNGCYGINCCKTTVPSNLDFYILNTTWSTNMGTELNCTYAAF---GRNFILRGKSSG--  213

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRG--TYWSCSCK  714
              S +  E      ++W    + +           DC  ++   P    G  +Y+SCSC 
Sbjct  214  --SGMEYEASSEGEMIWMIKESVE---------GSDC--HKNTVPDGALGNHSYYSCSCP  260

Query  715  FLEYGNAYLPNGCQ  756
              + GN YLPNGCQ
Sbjct  261  AYQEGNPYLPNGCQ  274



>ref|XP_004981069.1| PREDICTED: wall-associated receptor kinase 5-like [Setaria italica]
Length=746

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 72/279 (26%), Positives = 118/279 (42%), Gaps = 62/279 (22%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTA-GSAV  177
            F ++C +   DGV KPFL  F        E+L+IS +  +I      S  C+ ++ G  +
Sbjct  56   FNVSC-QEVQDGVYKPFLGDF--------ELLNISLIHGTIRELNHISTYCYNSSDGGFM  106

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTT  354
             S+  S  +    S TPF +S  +N+F   GC   A +     +   +GC  +C + +  
Sbjct  107  SSSTWSFDA----SNTPFRFSDVHNKFTVIGCNTLAYIVDNTDKGYQSGCVSTCQNLSDL  162

Query  355  AAPKFAYDCNGINCC-----------DLSFDYDVNAYQIDITDSSIVNNACNYAFFLATG  501
            A    A  C+G+ CC           ++SFD   +  QI    S +    C+YA  +   
Sbjct  163  AD---ASSCSGLGCCQTDIPKGMGFYNVSFDRGFDTSQI----SRLGLGGCSYAVLMEAA  215

Query  502  D-DFTTT---SSRLSLQRISNLLPEDKLVVPVVWRWSV----------TRDDLSYLPPTY  639
            + +F+TT   ++  +  +I           PVV  W++           RDD +Y   + 
Sbjct  216  EFNFSTTYINTTDFNDTKIGR--------APVVMDWAIREGTSSCEVAKRDDSTYACLSS  267

Query  640  SRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            +  C     +  P   G  + C+C     GN YLP+GC 
Sbjct  268  NSKC-----VVSPN--GPGYLCNCSNGYEGNPYLPDGCH  299



>ref|XP_003634276.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=706

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 54/185 (29%), Positives = 84/185 (45%), Gaps = 30/185 (16%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSC--SSNNTTAAPKFAYDCNG  387
            L  TPFF+S+  N     GCG AVL T     T+AGC   C  +SNN          C G
Sbjct  114  LKETPFFFSAERNSLRVIGCGNAVLVTRSG-VTLAGCSSFCQNTSNNFVGNG----GCFG  168

Query  388  INCCDLSFDYDVNAYQIDITDSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            INCC  +   ++N ++++ T +S +++   C +A   A G+ F+T  +  S Q+    + 
Sbjct  169  INCCQATIPSNLNFFRLNTTATSYLSSESPCTFA---ALGNGFSTDQA--SPQQSWASIE  223

Query  562  EDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL  741
               ++   V      ++ L+        +   Y          TY++CSC   E GN Y 
Sbjct  224  LTWMIEEAVEGSQCQKNTLN------GAEVGNY----------TYYNCSCLPYEEGNPYR  267

Query  742  PNGCQ  756
            P+ CQ
Sbjct  268  PHACQ  272



>ref|XP_007217318.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
 gb|EMJ18517.1| hypothetical protein PRUPE_ppa017167mg, partial [Prunus persica]
Length=715

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 70/273 (26%), Positives = 113/273 (41%), Gaps = 48/273 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I+C +S+     KPFL      +    E+L+IS +  ++ +K   SP+  T +G   G
Sbjct  50   FQIDCNESTG---HKPFL------RRSQMEVLNIS-IDGTLQVK---SPV--TFSGGCKG  94

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
                       L+G+PF Y    N F    C G + T    E  + GC  +C   +T +A
Sbjct  95   KETRQA---PNLTGSPFVYLDRKNMFTAVSC-GRLATMRSDENVVHGCSSTCDDQSTDSA  150

Query  361  PKFAYDCN--GINCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLS  534
                + C   G NCC  +   +++ +  +I     + + CNYAF +         SS  +
Sbjct  151  ---THRCGTIGTNCCQTTIPPNISVFTTEIQPRDQI-DGCNYAFLVDQDWFLKNLSSYRA  206

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPT-----------YSRDCDRYEKIFPPQ  681
            +Q + +        VPVV  W+++ D+ S+               ++ D   Y +I+   
Sbjct  207  IQGMDS--------VPVVLEWNISLDNTSHKAFEGFIGRRVGVYDFNNDSTPYCEIYNAT  258

Query  682  LRGTY----WSCSCKFLEYGNAYLPNGCQGTST  768
               TY      C C     GN YL   CQGT +
Sbjct  259  TSSTYNQSSVHCFCPGGFQGNPYLLQPCQGTGS  291



>ref|XP_008798624.1| PREDICTED: uncharacterized protein LOC103713459 [Phoenix dactylifera]
Length=1427

 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 52/202 (26%), Positives = 86/202 (43%), Gaps = 24/202 (12%)
 Frame = +1

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTA  357
            G +N   I +  ++G P+ +S S N+FM  GC    +    +     GC  SC  N+T  
Sbjct  797  GKDNDYNIPSINITGMPYKFSDSRNKFMAVGCDTLAVLRDDELGLKTGCITSC--NSTRN  854

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN------NACNYAFFLATGDDFTTT  519
             P  +  C GI CC+      + A+++ I D  + +      N C+Y F    G    + 
Sbjct  855  IP--SGTCAGIGCCETPIPKGLTAFEV-IVDGPMNHTNCWDFNPCSYGFLADEGWLNFSV  911

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTR---DDLSYLPPTYSRDCDRYEKIFPPQLRG  690
            SS   L+ ++N        VPV   W++     ++ S   P ++  C     +      G
Sbjct  912  SSFSYLRNLTN--------VPVTLDWAIGNQSCEEASTSSPAFA--CKAKHSLCLNSTNG  961

Query  691  TYWSCSCKFLEYGNAYLPNGCQ  756
              + C+C     GN Y+ +GCQ
Sbjct  962  PGYRCNCSVGFEGNPYMEDGCQ  983



>gb|EAY93773.1| hypothetical protein OsI_15554 [Oryza sativa Indica Group]
Length=338

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 66/270 (24%), Positives = 109/270 (40%), Gaps = 45/270 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C  S      +PFL  F        E+L+IS     + +    S  C+ T    + 
Sbjct  61   FKLHCNNS------RPFLGDF--------EVLNISLQLGQLRVLNRISSFCYNTTSQEME  106

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             +      N  LS  PF +S + N+F   GC      T      ++GC  +C  +  T A
Sbjct  107  QHKW----NKTLSA-PFRFSDTGNKFTVIGCRTLAYITDRDARYLSGCVSACQRDGVTGA  161

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQI------DITDSSIVNNACNYAFFLATGD-DFTT-  516
               +  C+GI CC  +   D++ YQ+      + +DS      C+YA  + + + +F+T 
Sbjct  162  TNGS--CSGIGCCQTTIPKDLHHYQVSFDKGLNTSDSMYNATRCSYAVLMDSSNFNFSTN  219

Query  517  --TSSRLSLQRISNLLPEDKLVVPVVWRWSVTR----DDLSYLPPTYSRDCDRYEKIFPP  678
              TSS  +               P+V  W++      D+      +Y+   D  + +   
Sbjct  220  FVTSSEFNTTNGGQ--------APMVLDWAIRTPNNCDEAKNNHTSYACKSDNSKCVN--  269

Query  679  QLRGTYWSCSCKFLEYGNAYLPNGCQGTST  768
               G  + C+CK    GN Y  +GCQG  T
Sbjct  270  SSNGPGYICNCKNGYQGNPYRQDGCQGPPT  299



>ref|XP_008380153.1| PREDICTED: wall-associated receptor kinase-like 1 [Malus domestica]
Length=764

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 53/182 (29%), Positives = 81/182 (45%), Gaps = 26/182 (14%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            E+L+IS    +I +K   +  C   +G    +          L+GTPF YS  +NRF   
Sbjct  101  EVLNISIADGTIQVKNPVAFFCGGKSGRQPAN----------LTGTPFVYSERHNRFTAV  150

Query  268  GCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCN-GINCCDLSFDYDVNAYQID-  441
             CG   +     E+ + GC+  C   +         +C  GINCC  +    ++A   D 
Sbjct  151  SCGYLAMVG-SDEYLVGGCRSICEGTSINYG-----NCEVGINCCQTTIPPHLSAISTDI  204

Query  442  ITDSSIVNNACNYAF-FLATGDDFTTTSSRLSLQRISNL-LPEDKLVVPVVWRWSVTRDD  615
            I D+    + CN A+ FL   + F + +S      +SN  +  D   VPVV RWS+  D+
Sbjct  205  IKDNRGRGDDCNNAYAFLVDKNWFRSIAS------VSNFSVNGDTENVPVVLRWSLNYDN  258

Query  616  LS  621
             S
Sbjct  259  TS  260



>ref|XP_010039081.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=582

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 78/192 (41%), Gaps = 17/192 (9%)
 Frame = +1

Query  196  IISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTP----GQEFTMAGCKLSCSSNNTTAAP  363
            II    L G+ FF+S  +N F   GC      T     G  FT  GC+  C+  NT+   
Sbjct  20   IIEPVSLEGSNFFFSQRWNVFTLVGCDTNATVTSTKSDGMVFTSTGCRSKCAGTNTSIRR  79

Query  364  KFAYDCNGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQ  540
              A  C+G + CC      ++ AY ++I +       CNYAF         +  S+L++ 
Sbjct  80   YSA--CSGWDGCCQTMLPLNLQAYSVNIKEEG-GQQGCNYAFPAE-----RSWFSKLNVT  131

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFL  720
             + +L   D   VPV   W +  +    +    S         +   LR  Y  C C+  
Sbjct  132  GLYDLRLND--TVPVELVWGIQNNTDYSIGLHQSSKNSHVLWCYNSSLRSVY--CYCREG  187

Query  721  EYGNAYLPNGCQ  756
              GN YL  GCQ
Sbjct  188  YDGNPYLIGGCQ  199



>ref|XP_010934766.1| PREDICTED: wall-associated receptor kinase 2-like [Elaeis guineensis]
Length=741

 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 67/208 (32%), Positives = 96/208 (46%), Gaps = 31/208 (15%)
 Frame = +1

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNT  351
            G N  S  S    +GTPF  S + N+F   GC     +L + GQ++ ++GC  +C   N 
Sbjct  97   GKNAPSGFSIMNFTGTPFKLSDTRNKFTAIGCNTYAYILNSDGQKY-VSGCLPTCF--NI  153

Query  352  TAAPKFAYDCNGINCCDLSFDYDVNAY--QIDITDSSI-VNNA--CNYAFFLATGDDFTT  516
            ++A   +  CNG+ CC  S    +  Y   ID TDSS  V+ A  C Y+F LA    +  
Sbjct  154  SSA--ISGSCNGLGCCQASIPKGIVQYYCTIDPTDSSTGVHQAYPCIYSF-LADEKWYKF  210

Query  517  TSSRLSLQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDCDRYEKIF  672
             +S +S     +    +K  VPVV  W+V          +  SYL  + + +C       
Sbjct  211  KASDISSL---DFYERNKNGVPVVLDWAVGGTSCEKVKLNTTSYLCLSENSECTD-----  262

Query  673  PPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
             P   G Y +CS  +   GN YL NGCQ
Sbjct  263  SPNGPGYYCNCSVGY--EGNPYLSNGCQ  288



>ref|XP_002274809.1| PREDICTED: wall-associated receptor kinase-like 8 [Vitis vinifera]
Length=718

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 51/185 (28%), Positives = 76/185 (41%), Gaps = 31/185 (17%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF YS  +N  +  GC   +L    +E  MAGC  +C  + TT    +     GIN
Sbjct  120  LWGSPFLYSL-HNDLVGVGCHNVLLRDRNEEI-MAGCASTCDKSITTKGCLY-----GIN  172

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNA--CNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
            CC      D++ Y +  T SS       C YAF     ++ +  ++          +  D
Sbjct  173  CCLTRLQEDLDFYSLSTTASSSERGDPDCTYAFLAYNYNNVSNVTT----------IVRD  222

Query  568  KLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY--WSCSCKFLEYGNAYL  741
                P++  W +       + P    D   Y        RG Y  + C+C + E GN YL
Sbjct  223  AKYAPLLISWLIPEQ----VDPQNCVDDTVYTS------RGNYPNYRCACNWAEEGNPYL  272

Query  742  PNGCQ  756
             +GCQ
Sbjct  273  AHGCQ  277



>ref|XP_008229608.1| PREDICTED: wall-associated receptor kinase-like 3 [Prunus mume]
Length=750

 Score = 57.0 bits (136),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 83/199 (42%), Gaps = 36/199 (18%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCN-GI  390
            LSG+PF YS  +N+F    CG   L +  +++ + GC+  C    T+ +P+   DC  G+
Sbjct  122  LSGSPFVYSGKHNKFTAVSCGYLALVS-SEKYLVGGCRSIC--EGTSISPE---DCEIGV  175

Query  391  NCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTT--TSSRLSLQRISNLLPE  564
            NCC  S    ++    DI D        +   FL   D F     +S  S+ +       
Sbjct  176  NCCQTSIPPHLSVINTDIEDDRRARACKDVYAFLVDQDWFRNNFMASNFSVLK-------  228

Query  565  DKLVVPVVWRWSVTRDDLS------YLPPTYSRDCD------RYEKIFP---PQLRGTYW  699
            D   VPVV  WS+  DD S      ++P   SR  D      + + +     P L     
Sbjct  229  DMHSVPVVLDWSLGLDDTSLRLFQRFIPQHDSRAYDDPTPTCKIQNVTSTSRPSL-----  283

Query  700  SCSCKFLEYGNAYLPNGCQ  756
             CSC     GNAYL   C 
Sbjct  284  VCSCPRGFEGNAYLGYDCH  302



>emb|CAH66392.1| OSIGBa0134J07.10 [Oryza sativa Indica Group]
Length=338

 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 112/271 (41%), Gaps = 47/271 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSIS-NVRQSIIMKESFSPLCHTTAGSAV  177
            F ++C  S      +PFL  F        E+L+IS  + Q  ++   FS  C+ T    +
Sbjct  61   FKLHCNNS------RPFLGDF--------EVLNISLQLGQLRVLNRIFS-FCYNTTSQEM  105

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTA  357
              +      N  LS  PF +S + N+F   GC      T      ++GC  +C  +  T 
Sbjct  106  EQHKW----NKTLSA-PFRFSDTGNKFTVIGCRTLAYITDRDARYLSGCVSACQRDGVTG  160

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQI------DITDSSIVNNACNYAFFLATGD-DFTT  516
            A   +  C+GI CC  +   D++ YQ+      + +DS      C+YA  + + + +F+T
Sbjct  161  ATNGS--CSGIGCCQTTIPKDLHHYQVSFDKGLNTSDSMYNATRCSYAVLMDSSNFNFST  218

Query  517  ---TSSRLSLQRISNLLPEDKLVVPVVWRWSVTR----DDLSYLPPTYSRDCDRYEKIFP  675
               TSS  +               P+V  W++      D+      +Y+   D  + +  
Sbjct  219  NFVTSSEFNTTNGGQ--------APMVLDWAIRTPNNCDEAKNNHTSYACKSDNSKCVN-  269

Query  676  PQLRGTYWSCSCKFLEYGNAYLPNGCQGTST  768
                G  + C+CK    GN Y  +GCQG  T
Sbjct  270  -SSNGPGYICNCKNGYQGNPYRQDGCQGPPT  299



>ref|XP_010934769.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase 
2-like [Elaeis guineensis]
Length=742

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 65/268 (24%), Positives = 103/268 (38%), Gaps = 49/268 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F + C KS      KP L        G  E++ +  V     +    S  C+ T G+  G
Sbjct  55   FEVTCNKS------KPLLG-------GNVELIDVDLVLGLAHVYSPISSTCYDTNGNFTG  101

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTP---GQEFTMAGCKLSCSSNNT  351
            ++     S    +GTPF +S + N+F   GC   V       G +   + C  +C+  N 
Sbjct  102  ND-----SGMNFAGTPFKFSDTRNKFTILGCSIVVYLQSSDNGSQIYESACSPTCNDTNR  156

Query  352  TAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA-----CNYAFFLATGDDFTT  516
                     CNG+ CC +S    +  Y      +  +++      CNY +FLA  + +  
Sbjct  157  ITDGS----CNGVGCCQISIPKGLVRYNFSFNPTLNISSVDPQYPCNY-YFLADKNRYQF  211

Query  517  TSSRLSLQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDCDRYEKIF  672
              S +   +I   L   +  +PVV  W V          +  SYL  +   +C       
Sbjct  212  MVSDIIKHQI---LERRQKGMPVVLDWLVGGTSCKKAKLNTTSYLCLSEHSEC-------  261

Query  673  PPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                 G  + CSC     GN ++P+GCQ
Sbjct  262  IDSTNGLGYYCSCSVGYEGNPFVPSGCQ  289



>ref|XP_010273353.1| PREDICTED: wall-associated receptor kinase 2-like [Nelumbo nucifera]
Length=349

 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 59/235 (25%), Positives = 101/235 (43%), Gaps = 32/235 (14%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            EIL IS     + +       C+  +GS   S    +         P+ +S ++NRF   
Sbjct  71   EILEISPSLTQLRIYGFMGXXCYBRSGSXTESWYXWV----BJDBLPYTFSDTHNRFTTI  126

Query  268  GCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSF-----DYDVN  426
            GC     +  + G+ FT +GC ++CS   +         C GI CC  S      +++VN
Sbjct  127  GCDTXSZITGSEGRNFT-SGCXMACSDKESVINGS----CTGIGCCQTSIPKGFKNFNVN  181

Query  427  AYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV-  603
             +  +        N C+YAF +    D+     R S++ +S+        +P+V  W++ 
Sbjct  182  VWSYENHTRVWNFNPCSYAFLV----DYDWY--RFSVEDLSHFYERYGDSLPLVLDWAIE  235

Query  604  --TRDDLSYLPPTYS--RDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
              T + +S + P+Y+  ++ D Y         G  + C+C     GN YL +GCQ
Sbjct  236  NETCETVSRIYPSYACGKNSDCYNSP-----NGLGYLCNCSQGYQGNPYLEDGCQ  285



>ref|XP_010037267.1| PREDICTED: wall-associated receptor kinase-like 22 [Eucalyptus 
grandis]
 gb|KCW48947.1| hypothetical protein EUGRSUZ_K02556 [Eucalyptus grandis]
Length=723

 Score = 56.2 bits (134),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 53/186 (28%), Positives = 84/186 (45%), Gaps = 19/186 (10%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTP---GQEFTMAGCKLSCSSNNTTAAPKFAYDCN  384
            L G+ FF+S  +N F   G   A + +    G  FT +GC+  C+  NT  +  ++  C+
Sbjct  116  LEGSDFFFSQRWNVFTSVGSTEATVISKESAGIVFTSSGCRSKCAGTNTNIS--WSSACS  173

Query  385  GIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            G + CC  +   ++ A+ +DI +       C YAF LA    F    S+  +  + +L  
Sbjct  174  GADGCCQTTLPLNLQAFGVDIKEEG-GQQGCKYAF-LAERSWF----SKADVTGLYDLRV  227

Query  562  EDKLVVPVVWRWSVTRD-DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAY  738
            +DK  VPVV +W +  + D S      S + D    +    +  T   C C+    GN Y
Sbjct  228  KDK--VPVVLQWGIQNNTDYSLALRNSSMNSD----VVSCYMSSTPLECWCRDGYGGNPY  281

Query  739  LPNGCQ  756
               GCQ
Sbjct  282  FIGGCQ  287



>ref|XP_003580459.1| PREDICTED: wall-associated receptor kinase 1-like [Brachypodium 
distachyon]
Length=831

 Score = 56.2 bits (134),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 64/226 (28%), Positives = 99/226 (44%), Gaps = 28/226 (12%)
 Frame = +1

Query  121  IIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPG  300
            II+  +   +CH   G  + S  +  IS   L GTPFF  SS N+ +  GC   ++    
Sbjct  101  IIIVGAIHQVCHDHNGKPMKSTGIGEIS---LEGTPFF--SSRNKLVVTGCNYRLVANFA  155

Query  301  QEF---TMAGCKLSCSSNNTTAAPKFAYDCN-GINCCD------LSFDYDVNAYQIDITD  450
             E    T+  C   C   ++T +   A DCN G+ CC+       S ++ +   +I    
Sbjct  156  GEINPSTLTSCSPYCDGRSSTTS---ATDCNHGVACCETPMPMNASQEFTLTLEKIQGPI  212

Query  451  SSIVNNACNYAFFLATGDDFTTTSSRLSLQRISN-LLPEDKLVVPVVWRWSVTR----DD  615
            +S  N+ C+ AFFL   +D +  SS      +   LLP     +  +  W+V R      
Sbjct  213  TSDENSTCSTAFFLDQDEDVSVNSSDDGQTPLKGPLLPAGDHRM--ILDWTVGRGTCDQA  270

Query  616  LSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGC  753
            L+Y   T   + D+ E I    + G  + C+C    YGN Y  +GC
Sbjct  271  LNYNFATQYCN-DKSECI--DAVSGAGYLCNCNAGYYGNPYTADGC  313



>gb|KCW47715.1| hypothetical protein EUGRSUZ_K01465 [Eucalyptus grandis]
Length=625

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 66/248 (27%), Positives = 105/248 (42%), Gaps = 39/248 (16%)
 Frame = +1

Query  73   KNGVREI-LSISNVRQSIIMKESFS-PLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSS  246
            K G+R + +S+ N R+ +    S S PL +++A  + G   L   +    +G+ F +S +
Sbjct  70   KIGLRVLNISLPNYREFVDGMISVSLPLIYSSA--SCGGEGLG--ARVNFNGSQFVFSQT  125

Query  247  YNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN-CCDLSFDYDV  423
             N F   GC    +     E  + GC+  C+ +N    P  A  C G + CC  +  +++
Sbjct  126  ENVFTSVGCNAQTIVNS-TESAVVGCRSKCAGSNADIGPYSA--CFGRDQCCQTTLSFNL  182

Query  424  NAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV  603
              + +D  +       C YAF LA    F     R ++  + +L   D   VPVV  W +
Sbjct  183  QGFDVDFQEER-EPQGCKYAF-LADRSWFL----RSNVTGLYDLSLND--TVPVVLEWGI  234

Query  604  TRD---DLSYLPPTYSRD------CDRYEKIFPPQLRGTYWS------CSCKFLEYGNAY  738
            +     +L  +   Y         C RY       L G+Y S      C C++   GN Y
Sbjct  235  SNKTDYELKLIQQGYGSGYLDPFGCSRYS------LYGSYTSEMPIIQCYCRWGYRGNPY  288

Query  739  LPNGCQGT  762
            L  GCQG 
Sbjct  289  LTEGCQGV  296



>gb|KDO44465.1| hypothetical protein CISIN_1g041043mg [Citrus sinensis]
Length=678

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/202 (27%), Positives = 78/202 (39%), Gaps = 46/202 (23%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L   PF++S   N F   GC   A +++   +F + GC   C   N T        CNGI
Sbjct  112  LEKLPFYFSYYDNIFSGIGCNNLASMSSADHDFILGGCFSICDPRNKTEDD----SCNGI  167

Query  391  NCCDLSFDYDVNAYQIDITDSSIVNNA------------CNYAFFLATGDDFTTTSSRLS  534
             CC     + + ++ I I     +NNA            C YAF +   +     S+  S
Sbjct  168  ECCKAGVPWALKSFNISIIS---INNATSSSSSSQEEGKCKYAFMV---EKEWFESNFKS  221

Query  535  LQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDCDRYEKIFPPQLRG  690
             +R+ N        VPV+  W +         RD+ S    T   + D           G
Sbjct  222  ARRVQNWNQ-----VPVILDWRIPNSSFGELERDESSKFTSTSHCESDE----------G  266

Query  691  TYWSCSCKFLEYGNAYLPNGCQ  756
              + CSCK   +GN Y  +GCQ
Sbjct  267  GLFRCSCKEKYHGNPYFLHGCQ  288



>ref|XP_010273357.1| PREDICTED: wall-associated receptor kinase 2-like [Nelumbo nucifera]
Length=749

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 59/195 (30%), Positives = 88/195 (45%), Gaps = 26/195 (13%)
 Frame = +1

Query  211  KLSGTPFFYSSSYNRFMFYGCGGAVLTTP--GQEFTMAGCKLSCSSNNTTAAPKFAYDCN  384
            K++  PF +S + NRF   GC      T   G+ FT +GC + C   N   +      C+
Sbjct  115  KVNSRPFTFSDTRNRFTVIGCDNFARITGFNGRNFT-SGCSMIC---NDQQSGFINGSCS  170

Query  385  GINCCDLS-------FDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQR  543
            GI CC  S       F   +N+Y  + TD  +V N C YAF +   D      S   L  
Sbjct  171  GIGCCQTSIPKGFKSFKLYINSYH-NHTDV-LVFNPCAYAFLV---DSEWYNFSVSDLGG  225

Query  544  ISNLLPEDKLVVPVVWRWSV---TRDDLSYLPPTYSRDCDRYEKIF-PPQLRGTYWSCSC  711
              +    ++  VP+V  W++   T + +S + P+Y+  C    + F  P  RG  + C+C
Sbjct  226  YMDFYNRNRENVPMVLDWAIENYTCETVSRIDPSYA--CRSNSQCFNSPNGRG--YLCNC  281

Query  712  KFLEYGNAYLPNGCQ  756
                 GN YL +GCQ
Sbjct  282  SLGYQGNPYLDDGCQ  296



>ref|XP_008229721.1| PREDICTED: wall-associated receptor kinase-like 6 [Prunus mume]
Length=794

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/210 (27%), Positives = 93/210 (44%), Gaps = 33/210 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I+C +S+     KPFL           E+L+IS +  ++ +K   SP+  T  G   G
Sbjct  73   FQIDCNESTG---HKPFLRRVQ------MEVLNIS-IDGTLQVK---SPV--TFFGGCKG  117

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
                       L+G+PF Y    N F    C G + T    E  + GC  +C   +T +A
Sbjct  118  KETHQA---PNLTGSPFVYLDRKNMFTAVSC-GRLATMRSDENVVQGCNSTCDDQSTDSA  173

Query  361  PKFAYDC--NGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLS  534
               AY C  +G NCC  +   +++ +  +I     + + CNYAF +         SS  +
Sbjct  174  ---AYRCGTSGTNCCQTTIPPNISVFTAEIQPRDQI-DGCNYAFLVDQDWFLKNLSSYRA  229

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSY  624
            +Q + +        VPVV  W+++ D+ S+
Sbjct  230  IQGMDS--------VPVVLEWNISLDNTSH  251



>ref|XP_009411366.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Musa 
acuminata subsp. malaccensis]
Length=748

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 70/265 (26%), Positives = 107/265 (40%), Gaps = 39/265 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C  ++ DG+EK F S+         EI +IS       M    S  C+  + +++ 
Sbjct  55   FSLDCN-TTDDGLEKLFFSNV--------EITNISLPLGQARMLNEISWQCYNVSNNSLD  105

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             N  S+     L GTP+ +S  +NRF   GC    L   G   +    +  C S     A
Sbjct  106  YNFWSL----NLVGTPYRFSDVHNRFTVIGC--ETLAYIGDFQSADSYQSGCVSVCHNEA  159

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQI----DITDSSIVN-NACNYAFFLATGDDFTTTSS  525
                  C+GI CC  S   D+  Y++    +   SSI N + C+YA  L        TS 
Sbjct  160  SLVNSSCSGIGCCQTSIPKDLTYYEVWFDSNFNSSSIWNFSDCSYAVLLEANQFEFLTSY  219

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDCDRYEKIFPPQ  681
              + Q +SN         P+V  W++         RD  SY   +   +C          
Sbjct  220  ITTNQFLSN----SNSKAPLVVDWAIGNETCEVAQRDTTSYACISEHSECLNSSN-----  270

Query  682  LRGTYWSCSCKFLEYGNAYLPNGCQ  756
              G  + C+C    +GN Y+ +GCQ
Sbjct  271  --GPGYLCNCSSGYHGNPYVAHGCQ  293



>ref|XP_008803200.1| PREDICTED: wall-associated receptor kinase 2-like [Phoenix dactylifera]
Length=774

 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 48/183 (26%), Positives = 74/183 (40%), Gaps = 25/183 (14%)
 Frame = +1

Query  235  YSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYD--CNGINCCDLS  408
            +S ++N+F+  GC         +E    GC   C++ +      F  D  C+GI CC+ S
Sbjct  154  FSDTHNKFVAIGCDTVGYLVDMEERFSTGCISLCTNKS------FVTDGTCSGIGCCETS  207

Query  409  FDYDVNAYQIDITDSSIVNNA-------CNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
               D++A+++++T  S  N+        C+YAF +        TS+ LS         ED
Sbjct  208  IPKDLSAFKVELT--SYYNHTYCSSFSPCSYAFLITNTSFSFNTSNFLSF--------ED  257

Query  568  KLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPN  747
              +VPV   W+V               C            G  + C C     GN YLP 
Sbjct  258  VEMVPVTLEWAVGNKTCEEARKEKDSACVAIHSECHDSTIGLGYRCKCSQGYQGNPYLPG  317

Query  748  GCQ  756
            GC+
Sbjct  318  GCE  320



>ref|XP_010237016.1| PREDICTED: wall-associated receptor kinase 5-like isoform X3 
[Brachypodium distachyon]
Length=764

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 96/227 (42%), Gaps = 17/227 (7%)
 Frame = +1

Query  94   LSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGC  273
            +S+ +    +++  S+  +C T++ +   +NN ++     L  TPF  S   NRFM  GC
Sbjct  89   ISLEHGELRVLVPVSY--ICFTSSATVSATNNDTV--RFSLENTPFLPSPGRNRFMVIGC  144

Query  274  GGAVLTTPGQEFT---MAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQI--  438
                L    +  T   +AGC   C  + T+ A      C G  CC+ S   ++  + +  
Sbjct  145  NTLGLIGGFRGETSQYLAGCYSYC--DGTSGASDDGAPCTGTGCCEASIPTNLTTFNVAF  202

Query  439  DITDSSIVN-NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDD  615
             I  SS+   N C YA     G  + +   R  + ++  +  + K   PV+  W+V R+ 
Sbjct  203  PINSSSVWGFNPCFYAMIAEVG--WYSFQRRDLVGQLGFVNEKAKNGAPVIVNWAV-RNG  259

Query  616  LSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                P  Y+  C            G  + C C     GNAYL NGCQ
Sbjct  260  SCSEPRNYA--CVSANSFCQTAGNGPGYLCQCSPGYEGNAYLHNGCQ  304



>ref|XP_010237017.1| PREDICTED: wall-associated receptor kinase 5-like isoform X4 
[Brachypodium distachyon]
Length=762

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 96/227 (42%), Gaps = 17/227 (7%)
 Frame = +1

Query  94   LSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGC  273
            +S+ +    +++  S+  +C T++ +   +NN ++     L  TPF  S   NRFM  GC
Sbjct  87   ISLEHGELRVLVPVSY--ICFTSSATVSATNNDTV--RFSLENTPFLPSPGRNRFMVIGC  142

Query  274  GGAVLTTPGQEFT---MAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQI--  438
                L    +  T   +AGC   C  + T+ A      C G  CC+ S   ++  + +  
Sbjct  143  NTLGLIGGFRGETSQYLAGCYSYC--DGTSGASDDGAPCTGTGCCEASIPTNLTTFNVAF  200

Query  439  DITDSSIVN-NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDD  615
             I  SS+   N C YA     G  + +   R  + ++  +  + K   PV+  W+V R+ 
Sbjct  201  PINSSSVWGFNPCFYAMIAEVG--WYSFQRRDLVGQLGFVNEKAKNGAPVIVNWAV-RNG  257

Query  616  LSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                P  Y+  C            G  + C C     GNAYL NGCQ
Sbjct  258  SCSEPRNYA--CVSANSFCQTAGNGPGYLCQCSPGYEGNAYLHNGCQ  302



>ref|XP_007217680.1| hypothetical protein PRUPE_ppa021669mg, partial [Prunus persica]
 gb|EMJ18879.1| hypothetical protein PRUPE_ppa021669mg, partial [Prunus persica]
Length=612

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/155 (28%), Positives = 62/155 (40%), Gaps = 16/155 (10%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L+G+PF YS  YNR     C G  L     E  + GC  +C  N  +      Y C GIN
Sbjct  90   LTGSPFVYSERYNRLTAVSC-GFFLVVRSDENVVGGCMSTCDKNYHSRG---NYGCIGIN  145

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATG-------DD----FTTTSSRLSLQ  540
            CC  +    + A  I++   +      N    + TG       DD    F        + 
Sbjct  146  CCQTTLPAYLTAITIELQAENEEATGGNDHMGMGTGTRTGMGMDDYNYAFMVDRDWFEIN  205

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLS-YLPPTYS  642
              +    +DK  VPVV  WS++ D L  + PP + 
Sbjct  206  FSNFTFVKDKGSVPVVLEWSLSLDKLKCFCPPGFE  240



>gb|AAU90275.1| calcium binding EGF domain containing protein [Oryza sativa Japonica 
Group]
 gb|ABF97847.1| Calcium binding EGF domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1096

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 68/243 (28%), Positives = 92/243 (38%), Gaps = 33/243 (14%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            E+L I+  R  I +    S +C+T++ S+  S    I     + GT    S S N+    
Sbjct  390  EVLDITLERGEIRLTGFLSYVCYTSSNSSYASLPGGIF----VGGTQLRVSPSRNQLTVI  445

Query  268  GC-------GGAVL--TTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYD  420
            GC       GGA    +  G E+   GC   C+S N+T A      C G  CC      D
Sbjct  446  GCRALGLLVGGAHAGGSGDGDEYA-TGCYTYCASLNSTDAD--GAPCAGTGCCQAPISSD  502

Query  421  V----NAYQIDITDSSIVNNACNYAFFLATG-DDFTTTSSRLSLQRISNLLPEDKLVVPV  585
            +      +  + T+S    N C YA     G   F        L  ++   P D   +PV
Sbjct  503  LAYVGGTFPSNWTNSGWRFNPCFYALIAEVGWYSFRRRHLAGVLGFVNETKPSD---IPV  559

Query  586  VWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLR------GTYWSCSCKFLEYGNAYLPN  747
            V  W+  RD   + P T      R                G  +SCSC     GN YL N
Sbjct  560  VLDWA-ARD--GWCPATAEEKARRKYACVSGNSHCVNSSNGMGYSCSCNQGYEGNPYLDN  616

Query  748  GCQ  756
            GCQ
Sbjct  617  GCQ  619



>ref|XP_010237014.1| PREDICTED: wall-associated receptor kinase 5-like isoform X2 
[Brachypodium distachyon]
 ref|XP_010237015.1| PREDICTED: wall-associated receptor kinase 5-like isoform X2 
[Brachypodium distachyon]
Length=770

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 87/209 (42%), Gaps = 15/209 (7%)
 Frame = +1

Query  148  LCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT---MA  318
            +C T++ +   +NN ++     L  TPF  S   NRFM  GC    L    +  T   +A
Sbjct  111  ICFTSSATVSATNNDTV--RFSLENTPFLPSPGRNRFMVIGCNTLGLIGGFRGETSQYLA  168

Query  319  GCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQID--ITDSSIVN-NACNYAFF  489
            GC   C  + T+ A      C G  CC+ S   ++  + +   I  SS+   N C YA  
Sbjct  169  GCYSYC--DGTSGASDDGAPCTGTGCCEASIPTNLTTFNVAFPINSSSVWGFNPCFYAMI  226

Query  490  LATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKI  669
               G  + +   R  + ++  +  + K   PV+  W+V R+     P  Y+  C      
Sbjct  227  AEVG--WYSFQRRDLVGQLGFVNEKAKNGAPVIVNWAV-RNGSCSEPRNYA--CVSANSF  281

Query  670  FPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                  G  + C C     GNAYL NGCQ
Sbjct  282  CQTAGNGPGYLCQCSPGYEGNAYLHNGCQ  310



>ref|XP_006416321.1| hypothetical protein EUTSA_v10006905mg [Eutrema salsugineum]
 gb|ESQ34674.1| hypothetical protein EUTSA_v10006905mg [Eutrema salsugineum]
Length=746

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 52/184 (28%), Positives = 77/184 (42%), Gaps = 31/184 (17%)
 Frame = +1

Query  250  NRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVN  426
            N+F   GC   A+LTT G +    GC   C   N+  AP     CNG  CC+ S   D  
Sbjct  118  NKFTLVGCNAYALLTTFGDQSYSTGCMSLC---NSRPAPTRV--CNGQGCCETSIPLDKE  172

Query  427  AYQ------------IDITDSSIVN-NACNYAFFLATGD-DFTTTSSRLSLQRISNLLPE  564
             ++              +T S + + N C YAF +  G  +F++T    +L+ +++    
Sbjct  173  VFRTRSLKFRTSSKRFAMTTSVLYDFNPCTYAFLVEDGKFNFSSTEDLRNLRNVTDF---  229

Query  565  DKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLP  744
                 PVV  WS+       +     R C    + F    RG  + C C     GN YLP
Sbjct  230  -----PVVLDWSIGNQTCEQVVG--RRICGENTECFNST-RGIGYQCRCTEGFEGNPYLP  281

Query  745  NGCQ  756
            +GC+
Sbjct  282  DGCK  285



>dbj|BAB40010.1| putative wall-associated kinase 4 [Oryza sativa Japonica Group]
Length=725

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 61/256 (24%), Positives = 109/256 (43%), Gaps = 31/256 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F+I C K++ DG  KPFL +         E+L+IS +        + S  C+     ++ 
Sbjct  51   FVIYCNKTA-DGSMKPFLINV--------EVLNISLLHGQTRALNALSTYCYNDVTKSME  101

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            S+  S+      S  P+ +S+ +N+F+  GC        G E+T A C   C+   T  +
Sbjct  102  SSRWSL----DFSTWPYRFSNLHNKFVVIGCNTLSYIYNG-EYTTA-CASVCAKAPTNDS  155

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDI-----TDSSIVNNACNYAFFLATGDDFTTTSS  525
                  C+G+ CC  +    +N+Y +         S++ +N C+YA  + T D F   + 
Sbjct  156  ------CDGVGCCQNNIAKGLNSYNVTFFTVYNDSSNLQSNPCSYAALVET-DTFRFKTE  208

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSC  705
             ++  + +      +   PVV  W++ +        T S  C          + G  + C
Sbjct  209  YVTTMKFNETYNGQQ---PVVLDWAIGKVGCKEANMT-SYACRSKHSECVDSINGPGYLC  264

Query  706  SCKFLEYGNAYLPNGC  753
            +C    +GN Y+ +GC
Sbjct  265  NCTLGYHGNPYITDGC  280



>ref|XP_010038774.1| PREDICTED: wall-associated receptor kinase-like 22 [Eucalyptus 
grandis]
Length=691

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 76/190 (40%), Gaps = 25/190 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLT----TPGQEFTMAGCKLSCSSNNTTAAPKFAYDC  381
            L G+ F +S S+N F   GC          + G  FT  GC+  C   NT  +  ++  C
Sbjct  83   LEGSKFVFSQSWNFFTLVGCDAEATVISEESTGIVFTSTGCRSKCDGTNTNIS--WSSAC  140

Query  382  NGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            +G + CC  +   ++ A+ +DI         C YAF        T+  S+  +  + +L 
Sbjct  141  SGRDGCCQTTIPLNLQAFSVDIKGEG-KQQGCKYAFLAD-----TSWFSKSDVTGLYDLR  194

Query  559  PEDKLVVPVVWRWSVTRD-DLSYLPPTYSRDCDR---YEKIFPPQLRGTYWSCSCKFLEY  726
              D   VPVV +W +  D D S      S   D    Y    P      Y  C C    +
Sbjct  195  VND--TVPVVLQWGIQNDTDYSLALQNQSMSSDAVSCYISSLP------YVECWCLSGYH  246

Query  727  GNAYLPNGCQ  756
            GN Y   GCQ
Sbjct  247  GNPYFIGGCQ  256



>ref|XP_002442540.1| hypothetical protein SORBIDRAFT_08g021540 [Sorghum bicolor]
 gb|EES16378.1| hypothetical protein SORBIDRAFT_08g021540 [Sorghum bicolor]
Length=725

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 81/190 (43%), Gaps = 18/190 (9%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA--APKFAYDCN  384
            L GTP   SS+ NRFM  GC    ++     E ++AGC   C   N T+  AP     C+
Sbjct  129  LEGTPLILSSTRNRFMAIGCSALGLIGASDPEPSVAGCFSYCEGINQTSDGAP-----CS  183

Query  385  GINCCDLSFDYDVNAYQIDITDSSIVN--NACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            G  CC+ +   ++ A+Q  + + +++   N C YA  +  G  + +   +  +  +  + 
Sbjct  184  GKGCCETAISPNLTAFQAAVANVTLLPSFNPCIYAMLVQVG--WYSFRRQDLVGHLGFVN  241

Query  559  PEDKLVVPVVWRWSVTR----DDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEY  726
                  VPV+  W++       +   +P  Y+  C            G  + CSC     
Sbjct  242  ERASRGVPVISDWAIRNGSCPKEGRVVPQDYA--CISTNSYCTNASNGPGYLCSCSKGYK  299

Query  727  GNAYLPNGCQ  756
            GN YL  GCQ
Sbjct  300  GNPYLREGCQ  309



>gb|KCW47710.1| hypothetical protein EUGRSUZ_K01452 [Eucalyptus grandis]
Length=759

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 75/190 (39%), Gaps = 25/190 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLT----TPGQEFTMAGCKLSCSSNNTTAAPKFAYDC  381
            L G+ F +S S+N F   GC          + G  FT  GC+  C   NT  +  ++  C
Sbjct  151  LEGSKFVFSQSWNFFTLVGCDAEATVISEESTGIVFTSTGCRSKCDGTNTNIS--WSSAC  208

Query  382  NGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            +G + CC  +   ++ A+ +DI         C YAF   T     +  + L   R+++  
Sbjct  209  SGRDGCCQTTIPLNLQAFSVDIKGEG-KQQGCKYAFLADTSWFSKSDVTGLYDLRVND--  265

Query  559  PEDKLVVPVVWRWSVTRD-DLSYLPPTYSRDCDR---YEKIFPPQLRGTYWSCSCKFLEY  726
                  VPVV +W +  D D S      S   D    Y    P      Y  C C    +
Sbjct  266  -----TVPVVLQWGIQNDTDYSLALQNQSMSSDAVSCYISSLP------YVECWCLSGYH  314

Query  727  GNAYLPNGCQ  756
            GN Y   GCQ
Sbjct  315  GNPYFIGGCQ  324



>ref|XP_006597672.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
10-like [Glycine max]
Length=580

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 62/255 (24%), Positives = 92/255 (36%), Gaps = 21/255 (8%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSA-----VGSNNLSIISN  207
            +PF       KNG +    I+   + I ++  +  L + T G        G +N S  + 
Sbjct  68   EPFEIECRHNKNGSQGEKLIAPYLKYINLEVMYIDLEYGTVGIKNPIFHPGCDNTS--TG  125

Query  208  TKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNG  387
              L G PF YS  YN F+  GC  A L     +  +  C   C  +   A       C G
Sbjct  126  INLEGGPFVYSQDYNSFVTVGCQNAALLL-SNDTILTACVSVCYDDPKNANMMDVSSCRG  184

Query  388  INCCDLSFDYDVNAYQIDITDSSI---VNNACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
              CC+ S    + AY + +    +   +   C Y    A    F       +       L
Sbjct  185  KYCCETSLPPYLQAYNVSVGTVEVKSEIKPECGYGLIKADYFQFNYVYDEYNSSYWVPTL  244

Query  559  PEDKLV--VPVVWRWSVTRDDLSYLPPTYSRDCDRYE-------KIFPPQLRGTYWSCSC  711
               K V  VP V +W +     +   P +  D D Y         +   Q +   W C+C
Sbjct  245  GNLKKVKDVPAVLQWEIPIHMPNNSFPEFRTDADSYANYNCSYTNVTSAQSKSG-WRCTC  303

Query  712  KFLEYGNAYLPNGCQ  756
            K+   GN YL  GC+
Sbjct  304  KYGFKGNPYLDQGCK  318



>ref|XP_011017593.1| PREDICTED: wall-associated receptor kinase-like 10 [Populus euphratica]
Length=737

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 82/188 (44%), Gaps = 21/188 (11%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L  TPF +S+  NRF+  GC    L +   E T+ GC   C+ +++ A+      CNGIN
Sbjct  113  LEDTPFSFSTE-NRFIAVGCNNLALLSRN-EATVGGCMSICNVSSSDASANGTI-CNGIN  169

Query  394  CCDLSFDYDVNAYQIDI-TDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
            CC+ +    ++ +   +      V + C YA+ +          +  +L+  +N+   D 
Sbjct  170  CCETTIPSGLDFFNATLQVVGDKVKDGCKYAYLV--------DQNWFNLRLDNNISVIDM  221

Query  571  LVVPVVWRWSVTRDDLS-YLPPTYSRDCDRYEKIFPP-----QLRGTYWSCSCKFLEYGN  732
              VPVV  W   R DL  Y   T +    R   +            T+  CSC     GN
Sbjct  222  DYVPVVLNW---RIDLGLYENMTLNGSAYRVTNLTSSGTSRCSQNSTFLRCSCSSGFQGN  278

Query  733  AYLPNGCQ  756
             Y+P+GCQ
Sbjct  279  PYIPDGCQ  286



>ref|XP_010237013.1| PREDICTED: wall-associated receptor kinase 5-like isoform X1 
[Brachypodium distachyon]
Length=806

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 58/209 (28%), Positives = 86/209 (41%), Gaps = 15/209 (7%)
 Frame = +1

Query  148  LCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT---MA  318
            +C T++ +   +NN ++     L  TPF  S   NRFM  GC    L    +  T   +A
Sbjct  147  ICFTSSATVSATNNDTV--RFSLENTPFLPSPGRNRFMVIGCNTLGLIGGFRGETSQYLA  204

Query  319  GCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQI--DITDSSIVN-NACNYAFF  489
            GC   C  + T+ A      C G  CC+ S   ++  + +   I  SS+   N C YA  
Sbjct  205  GCYSYC--DGTSGASDDGAPCTGTGCCEASIPTNLTTFNVAFPINSSSVWGFNPCFYAMI  262

Query  490  LATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKI  669
               G  + +   R  + ++  +  + K   PV+  W+V     S  P  Y+  C      
Sbjct  263  AEVG--WYSFQRRDLVGQLGFVNEKAKNGAPVIVNWAVRNGSCSE-PRNYA--CVSANSF  317

Query  670  FPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                  G  + C C     GNAYL NGCQ
Sbjct  318  CQTAGNGPGYLCQCSPGYEGNAYLHNGCQ  346



>ref|XP_010051379.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=982

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 51/195 (26%), Positives = 83/195 (43%), Gaps = 36/195 (18%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L G+ F +S   N F   GC   A++ T    F  AGC+  C++ NT+ +  +  +C+  
Sbjct  113  LKGSQFVFSQKRNVFTLVGCNTLAIVDTTKSAF--AGCRSRCAAPNTSIS--WNGNCSRR  168

Query  391  N-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
            + CC      ++  +++D  + S  +  C YAF  +   DFT          + +L   +
Sbjct  169  DDCCQTRLPLNLQGFRVDFKEES-GHQGCKYAFLRS---DFTA---------LYDLKVNE  215

Query  568  KLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGT---------YWSCSCKFL  720
               VPVV  W +  D        Y R+  R  K + P +  T         +  C C + 
Sbjct  216  --TVPVVLEWGIAND------TNYGRELIRQSKTYYPSVCSTRNVDNSEMLFTQCYCTWE  267

Query  721  EYGNAYLPNGCQGTS  765
              GN YL  GC+G +
Sbjct  268  YGGNPYLMEGCKGDA  282



>ref|XP_009356568.1| PREDICTED: wall-associated receptor kinase-like 1 [Pyrus x bretschneideri]
Length=744

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 92/211 (44%), Gaps = 35/211 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I+C K++ +    P L   S       E+L+IS    +I +K   +  C        G
Sbjct  60   FEISCNKTTGN---VPVLRQTS------LEVLNISIAEGTIQVKNPVTFFC--------G  102

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             N+    +N  L GTPF YS  +NRF    CG  VL     ++ + GC+  C        
Sbjct  103  GNSSRQPAN--LKGTPFVYSERHNRFTAVSCGYLVLVG-SDKYVVGGCRSVCEGTGINYG  159

Query  361  PKFAYDCN-GINCCDLSFDYDVNAYQIDI-TDSSIVNNACNYAF-FLATGDDFTTTSSRL  531
                 +C  GINCC  +    ++A  + I T      + CN A+ FL   + F + +S  
Sbjct  160  -----NCEVGINCCQTTIPPHLSAISMHIDTGIRARGDDCNNAYAFLVDKNWFRSIAS--  212

Query  532  SLQRISNL-LPEDKLVVPVVWRWSVTRDDLS  621
                +SN  + E +  VPVV +WS+  D  S
Sbjct  213  ----VSNFSVNEYQENVPVVLKWSLNFDHTS  239



>ref|XP_007147591.1| hypothetical protein PHAVU_006G137500g [Phaseolus vulgaris]
 gb|ESW19585.1| hypothetical protein PHAVU_006G137500g [Phaseolus vulgaris]
Length=714

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 51/193 (26%), Positives = 78/193 (40%), Gaps = 15/193 (8%)
 Frame = +1

Query  205  NTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA----APKF  369
            N  L G+PF YS   N+F+  GC   A+L   G E  ++GC  +C+ N            
Sbjct  112  NQSLEGSPFVYSQERNKFVAAGCNSIAILKLNGSE--VSGCVSTCNENYKVGDIGNIELR  169

Query  370  AYDCNGINCCDLSFDYDVNAYQIDIT--DSSIVNNACNYAFFLATGDDFTTTSSRLSLQR  543
              DCNG +CC+ S    +  Y I+I        ++ C+YA  +     ++      +  R
Sbjct  170  ESDCNGTSCCESSLPSYLKEYSIEIKGLKEKESSHECSYAMVVQQNPYYSYRYYSYNAPR  229

Query  544  I---SNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCK  714
                 N + ED  VVP V  W +  +    LP     +C     +   + + +   C C 
Sbjct  230  SYFPVNGVMEDLDVVPAVLEWEIVNNLNLTLPLDPLSECID-TNVTSSRYKRSGQRCYC-  287

Query  715  FLEYGNAYLPNGC  753
                GN Y   GC
Sbjct  288  -FGSGNPYFEGGC  299



>ref|XP_008791610.1| PREDICTED: wall-associated receptor kinase 3-like [Phoenix dactylifera]
Length=751

 Score = 54.7 bits (130),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 63/258 (24%), Positives = 112/258 (43%), Gaps = 28/258 (11%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C   ++ GV KP++ S         E+++IS +     +    S  C+        
Sbjct  65   FNLSCNDDNASGVPKPYIGSV--------ELINISLLSAQARIYNDISWQCYFRT-----  111

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            S+++S    +     P+ +S + N+F   GC   +    G+    + C+ +CSS ++   
Sbjct  112  SHDMSYKLGSLNFAYPYRFSDAENKFTVVGCD-TLAYIRGKNQKASFCESTCSSFDSLTN  170

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQI----DITDSSIVN-NACNYAFFLATGDDFTTTSS  525
                  C+GI CC  +    +N Y +    D+ +S + + N C+YA  LA  + F  +++
Sbjct  171  GS----CSGIGCCQTTIPKGINYYAVTFDGDLKNSRVWDFNPCSYAV-LAEVNWFNFSTT  225

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPP-TYSRDCDRYEKIFPPQLRGTYWS  702
             L+    ++LL  D    PVV  W++  +        T S  C            G  + 
Sbjct  226  YLT---TADLLDTDGGRAPVVLDWAIGDEPCEVAQRNTASYACRSEHSYCFNTSNGPGYL  282

Query  703  CSCKFLEYGNAYLPNGCQ  756
            C+C     GN YLP+GCQ
Sbjct  283  CNCSRGYEGNPYLPDGCQ  300



>ref|XP_007216176.1| hypothetical protein PRUPE_ppa015763mg, partial [Prunus persica]
 gb|EMJ17375.1| hypothetical protein PRUPE_ppa015763mg, partial [Prunus persica]
Length=664

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 63/139 (45%), Gaps = 11/139 (8%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L+G+PF YS  YNR     C G  L     E  + GC  +C   +T    +  Y C GIN
Sbjct  98   LTGSPFVYSWRYNRLTAVSC-GIFLAVMLDETVVGGCMSTC---DTGHFRRKNYGCIGIN  153

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATG---DDFTTTSSRLSLQRISNLLPE  564
            CC  +   D++   I++   S +         + TG   DD+            +NL  +
Sbjct  154  CCQTTLPSDLSVITIELQPESEMGTRMQ----MRTGTRMDDYNYAFIVDQEWFENNLDVK  209

Query  565  DKLVVPVVWRWSVTRDDLS  621
            DK  VPVV  WS++ D+++
Sbjct  210  DKGSVPVVLEWSLSLDNMN  228



>ref|XP_010920488.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Elaeis 
guineensis]
Length=718

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 88/200 (44%), Gaps = 38/200 (19%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAV---LTTPGQEFTMAGCKLSCS--SNNTTAAPKFAYD  378
            L G+PF +S + N+F   GC       +++P + +   GC  +C   S+ T  +      
Sbjct  94   LRGSPFTFSDTRNKFTAVGCHTLAYMSMSSPEKTYE-TGCLATCHDPSDVTNGS------  146

Query  379  CNGINCCDLSFDYDVNAYQ----IDITDSSIVN-NACNYAFFLATGDDFTTTSSRLSLQR  543
            C+GI CC +     +N Y+     +   S +   N C+YAF L   D +   ++ +    
Sbjct  147  CSGIGCCQIPIPKGLNYYEPIFDRNFNHSQVYQFNPCSYAF-LVDEDRYQFNAADI----  201

Query  544  IS-NLLPEDKLVVPVVWRWSVTRDDL--------SYLPPTYSRDCDRYEKIFPPQLRGTY  696
            IS N L   +++VP+V  WS+  +          SY   +   DC    K       G  
Sbjct  202  ISDNFLDRTEMLVPLVLDWSIGYEKCDEAKLNKSSYACRSEHSDCIDSSK-------GPG  254

Query  697  WSCSCKFLEYGNAYLPNGCQ  756
            + C+C    +GN YL NGCQ
Sbjct  255  YVCNCSSGYHGNPYLSNGCQ  274



>gb|EEC83830.1| hypothetical protein OsI_29775 [Oryza sativa Indica Group]
Length=316

 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 56/238 (24%), Positives = 94/238 (39%), Gaps = 21/238 (9%)
 Frame = +1

Query  76   NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNT---KLSGTPFFYSSS  246
            +G  E+L IS    ++ +  S      T++    GS N +   +T      G PFF S  
Sbjct  76   DGSVEVLEISIPSGTVRINSSSIVPVSTSSAVGTGSVNKTGKYHTWGGLRKGGPFFISPY  135

Query  247  YNRFMFYGCGGA-VLTTPGQEFTMAGCKLSCSSNNTTAAP---KFAYDCNGINCCDLSFD  414
             N+F+   C    VL   G   T+  C   C        P       +C+GI CC  +  
Sbjct  136  KNKFLVLSCSNVQVLLLGGDNSTVNACATYCPPAPKKGQPFQFPMRNECSGIGCCSAAIP  195

Query  415  YDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWR  594
                +Y I I  ++ ++   +   F+   ++ +  ++RL  + +S L        P +  
Sbjct  196  KGYTSYSIQIQPANEISEF-DAESFVYIAEEGSYNATRLIFETVSAL--------PALLD  246

Query  595  WSVTRD----DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            W+++        S  P    R  + Y + +   +   Y  C C     GN Y+PNGCQ
Sbjct  247  WAISNSTCGTKPSAAPAPACRSSNSYCQNYTSYVYNGY-QCRCNAGYQGNPYIPNGCQ  303



>emb|CDY04608.1| BnaC05g16460D [Brassica napus]
Length=734

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 65/236 (28%), Positives = 97/236 (41%), Gaps = 35/236 (15%)
 Frame = +1

Query  79   GVREILSISNVRQSIIMKESFSPLCHTTAGSAVGS-NNLSIISNTKLSGTPFFYSSSYNR  255
            G  E+++IS+  +  ++  + S +C+   G+  G  N  S + N   S          NR
Sbjct  69   GGNEVINISHSGELRVLN-TRSYVCYDRQGNETGRINRWSSLGNLTFS--------DKNR  119

Query  256  FMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFD-----Y  417
            F+  GC   A L T G      GC  +C+S   T        C G  CC  S       +
Sbjct  120  FVAVGCNTYAFLNTDGVGNYSTGCMSTCTSPRETNG-----SCTGGGCCQTSLPRGSHYF  174

Query  418  DVNAYQIDITDSSIVNNACNYAFFLATGD-DFTTTSSRLSLQRISNLLPEDKLVVPVVWR  594
             V+ Y      S    N C+YAF +  G  +F ++   ++L+ I           PVV  
Sbjct  175  MVSPYSFSNHTSVYSFNPCSYAFLVEDGKYNFRSSEDLMNLRNIERF--------PVVLD  226

Query  595  WSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL--PNGCQ  756
            WS+ +D   Y+      +  R   +    +RGT + C CK    GN YL   NGCQ
Sbjct  227  WSIGQDSCEYVGRG---NICRGNSMCSNSVRGTGYICRCKEGFDGNPYLSNENGCQ  279



>ref|XP_010497736.1| PREDICTED: wall-associated receptor kinase-like 8 [Camelina sativa]
Length=736

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 77/279 (28%), Positives = 106/279 (38%), Gaps = 64/279 (23%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSIS-----------NVRQSIIMKESFSP  147
            F + C+ +SSD V  PFL S        RE+LS             + + + I     SP
Sbjct  58   FEVVCS-NSSDQVSVPFLLSIR------REVLSFDLGSYYSIDGRFHYQSNKI--HILSP  108

Query  148  LCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCK  327
            L HT  G + GS   S  S+  L+G+PFF S S N+F   GC    L   GQ   + GC+
Sbjct  109  LKHT--GCSNGSVGDS--SSLNLTGSPFFISDS-NKFTAIGCNNKALMK-GQGSQIVGCE  162

Query  328  LSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDD  507
             +C+  N TA       C G  CC       +  +   +         C  A+       
Sbjct  163  ATCTYENDTAR-----GCVGYKCCQTQIPSGLQVFDATVEKMIPGQAGCQVAYL------  211

Query  508  FTTTSSRLS-LQRISNLLPEDKLVVPVVWRWSV---------------TRDDLSYLPPTY  639
               T  +LS     S  LPE    V +  +W++                      L P  
Sbjct  212  ---THFQLSPFMFKSPQLPEYSNYVMMELQWALDGFPIPSEGSTTVLCAESTKGELTPIT  268

Query  640  SRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            S D      ++PP    T + C CK    GN Y+P GCQ
Sbjct  269  SADL----YLYPP----TGYQCWCKHGYQGNPYIPGGCQ  299



>ref|XP_004251441.2| PREDICTED: wall-associated receptor kinase 3-like [Solanum lycopersicum]
Length=765

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 95/233 (41%), Gaps = 27/233 (12%)
 Frame = +1

Query  85   REILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMF  264
            ++I  +  +   I++K +    C+  AG+ +  +++    N  L  T F +S   N  M 
Sbjct  86   KDIEVVDILDDHILVKNNVGSRCYDQAGALINDDSI----NFSLGSTSFSFSD-LNSLMV  140

Query  265  YGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQI  438
             GC     +L   G+ FT +GC   CS           Y C+GI CC  S    + ++ +
Sbjct  141  VGCDDLALILGYEGRNFT-SGCISLCSKKEDIID---GY-CSGIGCCQTSIPTGLKSF-V  194

Query  439  DITDSSIVNNA--------CNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWR  594
             +T S  +NN         C YAF L   D F   SS LS     N + E+   VPVV  
Sbjct  195  SLTRS--LNNHTNVSSFNPCGYAF-LGEPDKFIFKSSDLSNSTFRNKVIEE---VPVVID  248

Query  595  WSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGC  753
            W +  D  +    +    C         +     + CSCK    GN Y+  GC
Sbjct  249  WIIGNDSCTVAKKSADYACGENSVCVDSKTGLGGYRCSCKPGYQGNPYISPGC  301



>ref|XP_010059387.1| PREDICTED: wall-associated receptor kinase 2-like [Eucalyptus 
grandis]
Length=1057

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 76/271 (28%), Positives = 110/271 (41%), Gaps = 57/271 (21%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C    +D  + P    +S  K+    +L IS     I +    +  C+ ++G+++ 
Sbjct  71   FLIFC----NDSTDPPTSHMYS--KDSYFRVLDISMESHEISVTVFVAKDCYNSSGTSLY  124

Query  181  SNNLSIISNTKLSGTPFFY------SSSYNRFMFYGCGGAVLTTPGQEFT-MAGCKLSCS  339
            +N+            P+FY      SS+ N+F+  GC      +  QE T + GC  SC 
Sbjct  125  NND------------PYFYLPIFPISSAKNKFIAVGCDTYATFSARQESTSVTGCLSSCD  172

Query  340  SNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDIT----DSSIVN-NACNYAFFLATGD  504
            S     +      C+GI CC+ S   DV  Y I +T       I + N C YAF     D
Sbjct  173  S----ISDVINGSCSGIGCCETSIPRDVYRYNISLTSYNNHRGISDFNPCGYAF--VAQD  226

Query  505  DFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV---TRDDLSYLPPTY----SRDCDRYE  663
             F + S+        NL      +VP+V  W +   T DD      TY    + +C   E
Sbjct  227  GFFSFST-------DNLREPPFDMVPLVVHWLIPNQTCDDAKKNATTYMCRENSNCTDAE  279

Query  664  KIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                    G  + C C     GN YL NGCQ
Sbjct  280  N-------GNGYQCHCLKGFQGNPYLQNGCQ  303



>ref|XP_007019259.1| Wall-associated kinase 2, putative [Theobroma cacao]
 gb|EOY16484.1| Wall-associated kinase 2, putative [Theobroma cacao]
Length=819

 Score = 54.3 bits (129),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 96/238 (40%), Gaps = 32/238 (13%)
 Frame = +1

Query  85   REILSISNVRQSIIMKESFSPL-------CHTTAGSAVGSNNLSIISNTKLSGTPFFYSS  243
            R  L  SN+    I  E   P+       C+  +GS V +N+        LS + F  S 
Sbjct  146  RAFLRRSNIEVKNITLEGKLPIMQFIAHDCYNKSGSPVANND------PFLSLSRFIISD  199

Query  244  SYNRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDY  417
            + N F+  GC     +    G++    GC   C S +  A     Y C+GI CC  S   
Sbjct  200  TDNIFVAVGCDTEATIQGIQGEKGYTTGCISKCDSIDYVAN----YTCSGIGCCQTSIAK  255

Query  418  DVNAYQIDITDSSIVN-----NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVP  582
             V+ + I +   +  N     N C+YAF +   + F  TSS L      +L   D  ++P
Sbjct  256  GVSYFNISVGSYNNHNDVWEFNPCSYAFVVEK-NKFNFTSSYLR-----DL--HDVEMLP  307

Query  583  VVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            +V  WS+  +    +     R   +          G+ + C C     GN YLP+GCQ
Sbjct  308  MVLDWSIGNETCKTVEAKIMRYACQGNSTCYDVDNGSGYRCKCFEGYQGNPYLPSGCQ  365



>ref|XP_010023309.1| PREDICTED: wall-associated receptor kinase-like 2 [Eucalyptus 
grandis]
Length=689

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 54/193 (28%), Positives = 73/193 (38%), Gaps = 44/193 (23%)
 Frame = +1

Query  229  FFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDC-NGINCCDL  405
            FFYS   N F+  GC    L    +   + GC  +CSS + ++       C NG  CC  
Sbjct  131  FFYSRHRNYFVAKGCDSLALMVSAE--AVVGC--NCSSKSESSR------CFNGTTCCFT  180

Query  406  SFDYDVNAYQIDITDS-----SIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
            S    + +Y ++         +     C+YAF +     F T           +LLP   
Sbjct  181  SIPNQITSYSVEFQTPYGRAIATRGAGCSYAFLVEEAWWFNTD--------FYSLLPS--  230

Query  571  LVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS-------CSCKFLEYG  729
              VPVV  W +  DD   L            +       G +W        CSC     G
Sbjct  231  -AVPVVLEWGINSDDFELLS----------NRNHTGNSGGCFWDLSPMTVYCSCNEGYKG  279

Query  730  NAYLPNGCQGTST  768
            N YLP+GCQG ST
Sbjct  280  NYYLPDGCQGVST  292



>ref|XP_010039741.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Eucalyptus 
grandis]
Length=683

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 69/239 (29%), Positives = 98/239 (41%), Gaps = 30/239 (13%)
 Frame = +1

Query  70   GKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSY  249
            GK+   +IL+IS     I +K   +  C+ ++G  + +N+ S+I    L   P   SS+ 
Sbjct  87   GKSSNIQILNISFENHEITVKVFVARDCYNSSGGFLYNNDPSLI----LPDFPI--SSAK  140

Query  250  NRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNA  429
            N+F+  GC     T  G  + + GC  SC +     +      C+GI CC+ S   D   
Sbjct  141  NKFIAVGCD-TYATFSGSTY-VTGCLSSCGN----ISDVINGSCSGIGCCETSIPRDAYR  194

Query  430  YQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV--  603
            Y I +T     NN      F   G  F       S  +  NL      +VP+V  W +  
Sbjct  195  YNISVTS---YNNHVGIWEFNPCGYAFVAEDGFFSFSK-DNLHEPPFDMVPIVVDWLIPD  250

Query  604  -TRDDLSYLPPTY----SRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQGTS  765
             T DD      TY    + +C   E        G  + C C     GN YL NGCQG S
Sbjct  251  QTCDDAKKNTTTYMCQENSNCTDAEN-------GNGYQCRCLEGFQGNPYLQNGCQGVS  302



>ref|XP_010273350.1| PREDICTED: uncharacterized protein LOC104608921 [Nelumbo nucifera]
Length=1510

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 60/235 (26%), Positives = 101/235 (43%), Gaps = 32/235 (14%)
 Frame = +1

Query  88    EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
             EIL IS     + +       C+  +GS   S    +     +   P+ +S ++NRF   
Sbjct  855   EILEISPSLTQLRIYGFMGHDCYNRSGSKTESWYYWV----NIDNLPYTFSDTHNRFTTI  910

Query  268   GCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSF-----DYDVN  426
             GC     +  + G+ FT +GC ++CS   +         C GI CC  S       ++VN
Sbjct  911   GCDTWSQITGSEGRNFT-SGCYMACSDKESVINGS----CTGIGCCQTSIPKGFKKFNVN  965

Query  427   AYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV-  603
              +  +   S    N C+YAF +    D+     R S+  +S+        +P+V  W++ 
Sbjct  966   VWSYENHTSVWNFNPCSYAFLV----DYDWY--RFSVDDLSHFYERYGDRLPLVLDWAIE  1019

Query  604   --TRDDLSYLPPTYS--RDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
               T + +S + P+Y+  ++ D Y         G  + C+C     GN YL +GCQ
Sbjct  1020  NETCETVSRIYPSYACGKNSDCYNSP-----NGLGYLCNCSQGYQGNPYLEDGCQ  1069



>gb|KHN14302.1| Wall-associated receptor kinase-like 9 [Glycine soja]
Length=647

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 49/193 (25%), Positives = 69/193 (36%), Gaps = 14/193 (7%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G PF YS  YN F+  GC  A L     +  +  C   C  +   A       C G  
Sbjct  70   LEGGPFVYSQDYNSFVTVGCQNAALLL-SNDTILTACVSVCYDDPKNANMMDVSSCRGKY  128

Query  394  CCDLSFDYDVNAYQIDITDSSI---VNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPE  564
            CC+ S    + AY + +    +   +   C Y    A    F       +       L  
Sbjct  129  CCETSLPPYLQAYNVSVGTVEVKSEIKPECGYGLIKADYFQFNYVYDEYNSSYWVPTLGN  188

Query  565  DKLV--VPVVWRWSVTRDDLSYLPPTYSRDCDRYE-------KIFPPQLRGTYWSCSCKF  717
             K V  VP V +W +     +   P +  D D Y         +   Q +   W C+CK+
Sbjct  189  LKKVKDVPAVLQWEIPIHMPNNSFPEFRTDADSYANYNCSYTNVTSAQSKSG-WRCTCKY  247

Query  718  LEYGNAYLPNGCQ  756
               GN YL  GC+
Sbjct  248  GFKGNPYLDQGCK  260



>ref|XP_010680013.1| PREDICTED: wall-associated receptor kinase 2-like [Beta vulgaris 
subsp. vulgaris]
Length=772

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/141 (33%), Positives = 65/141 (46%), Gaps = 13/141 (9%)
 Frame = +1

Query  223  TPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCC  399
            +PF +S + N+F+  GC   A++T        +GC  +CSS  T    K+   C+GI+CC
Sbjct  135  SPFMFSDTENKFIVIGCDHMALITDDINSRYSSGCIATCSSQETVI--KYNGSCSGISCC  192

Query  400  DLSFDYDVNAYQIDI----TDSSIVN--NACNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
              S    V   Q+D+     + S V   N C +A FL     FT   + LS     N   
Sbjct  193  QTSIPKGVTFLQMDVFSISANHSTVTKFNPCGHA-FLGELSKFTFNVADLSDPTFMN-RT  250

Query  562  EDKLVVPVVWRWSVTRDDLSY  624
             DK  VP+V  W V  D+  Y
Sbjct  251  RDK--VPIVLEWVVGNDEYCY  269



>ref|XP_008358012.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
1 [Malus domestica]
 ref|XP_008365609.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
1 [Malus domestica]
Length=742

 Score = 53.9 bits (128),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 55/202 (27%), Positives = 84/202 (42%), Gaps = 35/202 (17%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTMA-GCKLSCSSNNTTAAPKFAYDCNG  387
            L G+PF YS+  N F   GCG  A +T+    ++++ GCK  C  +   +       CNG
Sbjct  115  LEGSPFAYSTK-NVFTAVGCGFMATITSNSNGYSISSGCKSECDISINKSNGTRHNVCNG  173

Query  388  INCCDLSFDYDVNAYQIDIT-DSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPE  564
            ++CC  +    ++A+      D     ++CNYAF +   D         +L  IS +   
Sbjct  174  VDCCQTAIPSFLSAFNTSFQRDDDKTRSSCNYAFLV---DRXWFQGYANNLTNISAISDR  230

Query  565  DKLVVPVVWRW------------------SVTRDDLSYLPPTYSRDCDRYEKIFPPQLRG  690
            D   +PVV  W                  +V RDD S L  +Y+ +   Y          
Sbjct  231  DN--IPVVLEWNMFHSTTEVFGTFLXVNATVWRDDQSGLHDSYNDNSSVY--------GS  280

Query  691  TYWSCSCKFLEYGNAYLPNGCQ  756
            +   C+C     GN YL +GCQ
Sbjct  281  SRLECTCGGGSEGNPYLLDGCQ  302



>gb|KCW81882.1| hypothetical protein EUGRSUZ_C03245 [Eucalyptus grandis]
Length=550

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/199 (26%), Positives = 84/199 (42%), Gaps = 36/199 (18%)
 Frame = +1

Query  202  SNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYD  378
            +   L G+ F +S   N F   GC   A++ T    F  AGC+  C++ NT+ +  +  +
Sbjct  109  AGVSLKGSQFVFSQKRNVFTLVGCNTLAIVDTTKSAF--AGCRSRCAAPNTSIS--WNGN  164

Query  379  CNGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNL  555
            C+  + CC      ++  +++D  + S  +  C YAF  +   DFT          + +L
Sbjct  165  CSRRDDCCQTRLPLNLQGFRVDFKEES-GHQGCKYAFLRS---DFTA---------LYDL  211

Query  556  LPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGT---------YWSCS  708
               +   VPVV  W +  D        Y R+  R  K + P +  T         +  C 
Sbjct  212  KVNE--TVPVVLEWGIAND------TNYGRELIRQSKTYYPSVCSTRNVDNSEMLFTQCY  263

Query  709  CKFLEYGNAYLPNGCQGTS  765
            C +   GN YL  GC+G +
Sbjct  264  CTWEYGGNPYLMEGCKGDA  282



>ref|XP_007212989.1| hypothetical protein PRUPE_ppa022572mg [Prunus persica]
 gb|EMJ14188.1| hypothetical protein PRUPE_ppa022572mg [Prunus persica]
Length=736

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 48/186 (26%), Positives = 76/186 (41%), Gaps = 21/186 (11%)
 Frame = +1

Query  226  PFFYSSSYNRFMFYGCGGAVL---TTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINC  396
            P+  S + N+FM  GC            QE  + GC   C S N+         C+GI C
Sbjct  99   PYTISGTKNKFMAVGCDTYATFRGYRANQERFITGCMSLCDSLNSVEQDS----CSGIGC  154

Query  397  CDLSFDYDVNAYQIDIT---DSSIVN--NACNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            C  S    +    + +    + + +   N C+YAF +  G       S+ S Q++++   
Sbjct  155  CQTSIPDGLKNRTVTLRSYYNHTYIRSFNPCSYAFVVQEGH---FRFSKTSFQQVNHTEQ  211

Query  562  EDKLVVPVVWRWSVTRDDL-SYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAY  738
                 +P++  W +  +   +    T +  C  + K   P  R T + C C     GN Y
Sbjct  212  -----LPMILNWEIGNEPCDAAQEATQNSLCKAHSKCVKPNNRSTGYICQCLPGYEGNPY  266

Query  739  LPNGCQ  756
            LPNGCQ
Sbjct  267  LPNGCQ  272



>ref|XP_007147589.1| hypothetical protein PHAVU_006G137300g [Phaseolus vulgaris]
 gb|ESW19583.1| hypothetical protein PHAVU_006G137300g [Phaseolus vulgaris]
Length=704

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 76/187 (41%), Gaps = 19/187 (10%)
 Frame = +1

Query  205  NTKLSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDC  381
            N  L G+PF YS  YN+F+  GC   A L   G   + +GC   C  +          +C
Sbjct  116  NQSLEGSPFVYSRKYNKFVAAGCNIMAFLQLNG---SGSGCVSICDEDYKVGDA----NC  168

Query  382  NGINCCDLSFDYDVNAYQ--IDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNL  555
            NG +CC+ S    +  Y   I     +  ++ C+YA  +         S R       N 
Sbjct  169  NGKSCCESSLPLYLTQYSTVIKALKDNETSHGCSYAMVVE-----KVLSYRYYFP--VNG  221

Query  556  LPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNA  735
            + +D  VVP V  W +       LP  +   CD    +     + +   CSC+F  +GN 
Sbjct  222  VMKDLAVVPAVLEWEIVNSLNLTLPLDHLSYCDD-TNVTSSLYKRSGQRCSCRF-TFGNP  279

Query  736  YLPNGCQ  756
            Y   GC+
Sbjct  280  YFVGGCK  286



>ref|XP_010273252.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Nelumbo 
nucifera]
Length=751

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 77/187 (41%), Gaps = 21/187 (11%)
 Frame = +1

Query  226  PFFYSSSYNRFMFYGCGGAVLTT--PGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCC  399
            P+ +S S NRF   GC      T   G+ FT +GC + CS   +         C+GI CC
Sbjct  122  PYTFSDSRNRFTTLGCDTYTYVTGSKGRNFT-SGCAMVCSDQQSVVNGS----CSGIGCC  176

Query  400  DLSF-----DYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPE  564
              S       +DV  +  D        N CNYAF +    D+   +  +S     N   E
Sbjct  177  QTSIPKGFKKFDVELHSFDNHTKVWNFNRCNYAFLV----DYEWYNFTVSDLLEYNFYYE  232

Query  565  DKLVVPVVWRWSVTRD---DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNA  735
            +   VP+V  W++      D+S    T S  C +  + F     G  + C C     GN 
Sbjct  233  NGGSVPLVLDWAIENQSCKDVSRRNST-SYICGKNSECFDSP-NGLGYLCKCSQGYQGNP  290

Query  736  YLPNGCQ  756
            YL +GCQ
Sbjct  291  YLDDGCQ  297



>ref|NP_001173559.1| Os03g0643250 [Oryza sativa Japonica Group]
 dbj|BAH92287.1| Os03g0643250 [Oryza sativa Japonica Group]
Length=553

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 70/244 (29%), Positives = 93/244 (38%), Gaps = 31/244 (13%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            E+L I+  R  I +    S +C+T++ S+  S    I     + GT    S S N+    
Sbjct  307  EVLDITLERGEIRLTGFLSYVCYTSSNSSYASLPGGIF----VGGTQLRVSPSRNQLTVI  362

Query  268  GC-------GGAVLTTPGQEFTMA-GCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDV  423
            GC       GGA     G     A GC   C+S N+T A      C G  CC      D+
Sbjct  363  GCRALGLLVGGAHAGGSGDGDEYATGCYTYCASLNSTDAD--GAPCAGTGCCQAPISSDL  420

Query  424  ----NAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLV-VPVV  588
                  +  + T+S    N C YA     G     +  R  L  +   + E K   +PVV
Sbjct  421  AYVGGTFPSNWTNSGWRFNPCFYALIAEVG---WYSFRRRHLAGVLGFVNETKPSDIPVV  477

Query  589  WRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLR------GTYWSCSCKFLEYGNAYLPNG  750
              W+  RD   + P T      R                G  +SCSC     GN YL NG
Sbjct  478  LDWA-ARD--GWCPATAEEKARRKYACVSGNSHCVNSSNGMGYSCSCNQGYEGNPYLDNG  534

Query  751  CQGT  762
            CQGT
Sbjct  535  CQGT  538



>ref|XP_006653300.1| PREDICTED: wall-associated receptor kinase 2-like [Oryza brachyantha]
Length=727

 Score = 53.5 bits (127),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 59/241 (24%), Positives = 102/241 (42%), Gaps = 25/241 (10%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            E+LSIS     + MK   S  C+ T    +   +     +  L GTPF +S + N+F+ +
Sbjct  86   EVLSISLPLGQVRMKMDMSYDCYNTTRHEIDCVDRV---DLNLKGTPFTFSDAANKFIVF  142

Query  268  GCGGAVLTTPGQEFTMA-----GCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAY  432
            GC       PG++  +      GC  +C   +   A   A  C+GI CC  +    +  Y
Sbjct  143  GCRMLAYLGPGEQNDIGSDLTIGCAATCGVGDDLVAINSA-GCSGIGCCQTNIPRGIQYY  201

Query  433  QI----DITDSSIVN-NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRW  597
            ++        + I N + C YA  L     F+ +    +L R+++ L       P V  W
Sbjct  202  KVWFDGRYNTTGIYNWSRCTYA-ALVEASSFSFSEVYHALSRVNSNLGSQP---PFVVDW  257

Query  598  SV---TRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL--PNGCQGT  762
            ++   T ++      +Y+  C   + +      G  + C+C+    GN Y+   +GCQG 
Sbjct  258  AIGNMTCEEAQRNGDSYA--CVSGDSVCLDSRNGPGYICNCRSGFQGNPYINDSHGCQGI  315

Query  763  S  765
            +
Sbjct  316  A  316



>gb|KCW47714.1| hypothetical protein EUGRSUZ_K01462 [Eucalyptus grandis]
Length=690

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 56/202 (28%), Positives = 84/202 (42%), Gaps = 41/202 (20%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+ F +S ++N F+  GC    +     E  + GC+ SC+  NT+ +   A  C+G +
Sbjct  116  LEGSQFIFSQTWNVFISVGCNTLAIVN-STESDVVGCRSSCAGTNTSVSMYNA--CSGRD  172

Query  394  -CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
             CC  +  +++  + +   D       C YAF LA    F  ++       I++L   D 
Sbjct  173  GCCQSTLPFNLQFFSVVFKDERGPQEGCKYAF-LADRTWFLRSN-------ITDLSFND-  223

Query  571  LVVPVVWRWSVTR------------DDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS----  702
             +VPVV  W ++             +   YL P     C RY       L G+Y S    
Sbjct  224  -MVPVVLEWGISNKTEYGLKLFQQANGSGYLDPF---RCTRY------NLYGSYTSEMPF  273

Query  703  --CSCKFLEYGNAYLPNGCQGT  762
              C C     GN YL  GCQG 
Sbjct  274  VQCFCSSGYRGNPYLTEGCQGV  295



>gb|EAZ43241.1| hypothetical protein OsJ_27840 [Oryza sativa Japonica Group]
Length=696

 Score = 53.1 bits (126),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 59/242 (24%), Positives = 94/242 (39%), Gaps = 23/242 (10%)
 Frame = +1

Query  76   NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNT---KLSGTPFFYSSS  246
            +G  E+L IS    ++ +  S      T++    GS N +   +T      G PFF S  
Sbjct  70   DGSVEVLEISIPSGTVRINSSSIVPVSTSSAVGTGSVNKTGKYHTWGGLRKGGPFFISPY  129

Query  247  YNRFMFYGCGGA-VLTTPGQEFTMAGCKLSCSSNNTTAAP---KFAYDCNGINCCDLSFD  414
             N+F+   C    VL   G   T+  C   C        P       +C+GI CC  +  
Sbjct  130  KNKFLVLSCSNVQVLLLGGDNSTVNACATYCPPAPKKGQPFQFPMRNECSGIGCCSAAIP  189

Query  415  YDVNAYQIDITDSSIVNN-ACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVW  591
                +Y I I  ++ ++      + ++A    +  T  RL  + +S L        P + 
Sbjct  190  KGYTSYSIQIQPANEISEFDAESSVYIAEEGSYNAT--RLIFETVSAL--------PALL  239

Query  592  RWSVTRD----DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQG  759
             W+++        S  P    R  + Y + +   +   Y  C C     GN Y+PNGCQG
Sbjct  240  DWAISNSTCGTKPSAAPAPACRSSNSYCQNYTSYVYNGY-QCRCNAGYQGNPYIPNGCQG  298

Query  760  TS  765
             S
Sbjct  299  LS  300



>ref|XP_008779714.1| PREDICTED: wall-associated receptor kinase 2-like, partial [Phoenix 
dactylifera]
Length=468

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 62/262 (24%), Positives = 111/262 (42%), Gaps = 32/262 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K ++ GV+KPF+ +         E+++IS +     +    S  C+      V 
Sbjct  75   FNLSCNKDNATGVQKPFIYNI--------ELINISLLPAQARVHNQISWQCYNAKYHNVS  126

Query  181  SNN--LSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTM-AGCKLSCSSNN  348
             +   L+ I++      P+ +S + N+F   GC   A +    Q+ +   GC   C S+ 
Sbjct  127  RSQWYLNFIND------PYRFSDADNKFTVVGCDTLAYIRGLNQKASYDGGCVTVCDSSK  180

Query  349  TTAAPKFAYDCNGINCCDLSFDYDVNAYQI----DITDSSIVN-NACNYAFFLATGDDFT  513
            +         C+GI CC  S    +N Y++    +  +S +   N C+YA  LA  + F 
Sbjct  181  SLTNG----SCSGIGCCQTSIPKGINYYEVTFDRNFNNSRVWKFNPCSYA-VLAEANWFY  235

Query  514  TTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPP-TYSRDCDRYEKIFPPQLRG  690
             T++ ++   ++     ++   P+V  W++  D        T S  C            G
Sbjct  236  FTTTYINSHELNK---TNRGRAPIVLDWAIGNDTCEVAKRNTTSYACRSERSDCFNSSNG  292

Query  691  TYWSCSCKFLEYGNAYLPNGCQ  756
              + C+C     GN YLP+GC 
Sbjct  293  PGYICNCSRGYEGNPYLPDGCH  314



>gb|EMT30697.1| Wall-associated receptor kinase 3 [Aegilops tauschii]
Length=757

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 65/242 (27%), Positives = 100/242 (41%), Gaps = 32/242 (13%)
 Frame = +1

Query  79   GVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRF  258
            G+ EI+ IS  R  + +    S  C T+  + + +      S   L GTPF  S++ NRF
Sbjct  80   GLSEIIDISLERAEMRVYGPVSYNCFTSNTTVMDN----YTSGFNLVGTPFIPSTTRNRF  135

Query  259  MFYGC------GGAVLTTPGQEFTMAGCKLSCSSNNTTA--APKFAYDCNGINCCDLSFD  414
            M  GC      GG + + P  +  +AGC   C   N+T+  AP     C G  CC+ +  
Sbjct  136  MVIGCNTMGIIGGYLHSNP--DLYVAGCYSYCQGINSTSNGAP-----CTGKGCCETTIT  188

Query  415  YDVN--AYQIDITDSSIVN-NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPV  585
             ++   A  + I  SS+   N C YA     G  + +   +  +  +  +    K  VPV
Sbjct  189  PNLTDFAALLIINQSSVWTFNPCFYAMLAEVG--WYSFRQQDLVGHLGFINKRAKRGVPV  246

Query  586  VWRWSVT-----RDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNG  750
            +  W++      +D  + L       C            G  + C+C     GN YLP G
Sbjct  247  ISDWAIRNGSCPKDGATAL---MGYACVSSNSYCVGATNGPGYMCNCSEGYEGNPYLPRG  303

Query  751  CQ  756
            CQ
Sbjct  304  CQ  305



>ref|XP_007019265.1| Wall-associated kinase 2, putative [Theobroma cacao]
 gb|EOY16490.1| Wall-associated kinase 2, putative [Theobroma cacao]
Length=629

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 69/250 (28%), Positives = 102/250 (41%), Gaps = 40/250 (16%)
 Frame = +1

Query  43   KPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSG  222
            KPFL       N    +L+IS +   + +  S +  C+  +G  V   +      ++L  
Sbjct  10   KPFLGQ----GNASAPVLNIS-LDGELRVSSSIARQCYNASGLIVEDRS------SRLVL  58

Query  223  TPFFYSSSYNRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINC  396
            T F  S++ NRF   GC    A+  T GQ FT  GC   C   +  A       C GI C
Sbjct  59   TKFPISNTRNRFTVVGCDTFAAIARTRGQNFT-TGCLSLCDQIDNVANG----SCAGIGC  113

Query  397  CDL-------SFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNL  555
            C         +F   V + +   T SS   N C++AF +  G    +T+  + L+   ++
Sbjct  114  CQTMIPRGMRNFGAAVGSLENHTTVSSF--NPCSFAFLVEEGFYNFSTADLIDLRNKDDM  171

Query  556  LPEDKLVVPVVWRWSV---TRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEY  726
                    PVV  W+V   T  +      TY+  C   +        G  + C CK    
Sbjct  172  --------PVVLDWAVGNVTCQEAQNNLTTYA--CQAADSECSNSSNGPGYRCRCKTGFQ  221

Query  727  GNAYLPNGCQ  756
            GNAYL +GCQ
Sbjct  222  GNAYLVDGCQ  231



>ref|XP_006431622.1| hypothetical protein CICLE_v10000464mg [Citrus clementina]
 gb|ESR44862.1| hypothetical protein CICLE_v10000464mg [Citrus clementina]
Length=697

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 53/202 (26%), Positives = 75/202 (37%), Gaps = 48/202 (24%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L   PF++S   N F   GC   A +++   +F + GC   C   N T        CNGI
Sbjct  111  LEKLPFYFSYYDNIFSGIGCNNLASMSSADHDFILGGCFSICDPRNKTDDD----SCNGI  166

Query  391  NCCDLSFDYDVNAYQIDITDSSIVNNA------------CNYAFFLATGDDFTTTSSRLS  534
             CC     + + ++ I I   S +NNA            C YAF +      +   S  +
Sbjct  167  ACCKAGVPWALKSFNISI---SSINNAASSRSSSQEEGKCKYAFMVEKEWFESNLKSAEA  223

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGT-------  693
            +Q        D   VPV+  W +       L           EK   P+ R T       
Sbjct  224  VQ--------DWNQVPVILDWRIPNSSFGEL-----------EKDKSPEFRSTSHCRSDE  264

Query  694  --YWSCSCKFLEYGNAYLPNGC  753
               + CSCK   +GN Y  +GC
Sbjct  265  SGLFGCSCKEKYHGNPYFLHGC  286



>gb|EMT28345.1| Wall-associated receptor kinase 2 [Aegilops tauschii]
Length=955

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 54/222 (24%), Positives = 91/222 (41%), Gaps = 30/222 (14%)
 Frame = +1

Query  175  VGSNNLSIISNTKLSGTPFFYSSSYNRFMFYG----------------CGG-AVLTTPGQ  303
            V +N L    +   S TP+++    N F+FYG                C   A+L   G 
Sbjct  362  VRTNALIRRGDNSTSATPWYWPLIGNPFLFYGEEPYSLSTSNELVVTGCNTQAMLFGHGD  421

Query  304  EFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDIT----DSSIVNNA  471
               ++GC   CS N+T         C G+ CC       ++    ++     D+ +  + 
Sbjct  422  PAIISGCASFCSHNDTHITFGSGKYCYGMGCCQARITESIDGMPKELLFKWLDAYVAEDL  481

Query  472  CNYAFFLATGD----DFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTY  639
                 F+   +    D  + + +L +++   L     + VP++ RW V  + LS  P   
Sbjct  482  IPLPAFVFIAEEGWFDQKSVAGKL-MRKDRELTSAAAMEVPILLRWEVLHNGLS--PKVS  538

Query  640  SR-DCDRYE-KIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQG  759
            SR D D  + K    +L    ++C C   + GN Y+PNGC+G
Sbjct  539  SRPDGDLCKSKHSQCKLGNRGYTCHCNDDDGGNPYVPNGCKG  580



>ref|XP_010273347.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Nelumbo 
nucifera]
Length=743

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 60/239 (25%), Positives = 105/239 (44%), Gaps = 27/239 (11%)
 Frame = +1

Query  70   GKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSY  249
            G NG  E+L IS+   S+ +K      C+ T+  +  S     + +  L   P+ +S + 
Sbjct  73   GTNGNVEVLEISS-SGSLRVKTYIGYRCYNTSTKSYWS-----LPSLDLKIRPYSFSDTR  126

Query  250  NRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDV  423
            NRF   GC     +  + G+ FT +GC + CS   +         C+GI CC  S     
Sbjct  127  NRFTVIGCDTYAYIDGSKGRNFT-SGCSMVCSDQQS----PINGSCSGIGCCQTSIPKGF  181

Query  424  NAYQIDI----TDSSIVN-NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVV  588
              ++++I      + + + N C+YAF +   D      S   L         ++ +VPV+
Sbjct  182  KRFEVEIYSFKNHTQVWDFNPCSYAFLV---DSDWYNFSVPDLLGYKEFFYRNEEMVPVI  238

Query  589  WRWSV---TRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
              W++   T +++S   P+Y+  C    + +     G  + C C    +GN YL +GC+
Sbjct  239  LDWAIENYTCENVSRNDPSYA--CGNNSECYNSP-NGLGYLCKCSPGYHGNPYLQDGCK  294



>ref|XP_002454747.1| hypothetical protein SORBIDRAFT_04g036600 [Sorghum bicolor]
 gb|EES07723.1| hypothetical protein SORBIDRAFT_04g036600 [Sorghum bicolor]
Length=773

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 53/221 (24%), Positives = 86/221 (39%), Gaps = 36/221 (16%)
 Frame = +1

Query  151  CHTTAGSAVGSNNLSIISNTKLSG-TPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCK  327
            C  + G  VG    + +S     G +PFF+S + NR +  GC         + + ++GC 
Sbjct  117  CFNSTGGYVGGRPGAYMSLGGSPGASPFFFSPAKNRLVAIGCPNLGYFVDDKGYYVSGCM  176

Query  328  LSCSSNNTTAAPKFAYDCNGINCCDLSFD---YDVNAYQIDIT----DSSIVNN--ACNY  480
              C  +      + +  C G+ CC  +     Y    +QI+      D +  +N   C+Y
Sbjct  177  SVCRPSQYNIPGQGS--CTGVGCCQSAIPPAVYFYEPHQINFQQGQGDPAFASNVTTCHY  234

Query  481  AFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV---------TRDDLSYLPP  633
             F + T  ++ + S R+ L R       D   VPVV  W +          R+   Y   
Sbjct  235  VFLVET--EWFSYSDRVFLNRT------DDFDVPVVLDWGIRNAGNCSAAKRNMTDYACR  286

Query  634  TYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            + + DC            G  + C+C     GN YL  GC+
Sbjct  287  SANSDC-------VTSTNGAGYRCNCSKGYEGNPYLDGGCR  320



>ref|XP_008222638.1| PREDICTED: wall-associated receptor kinase-like 1 [Prunus mume]
Length=672

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 84/191 (44%), Gaps = 24/191 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF +S   NRF    CGG  L T     T+AGC   C   +T+        C G+N
Sbjct  96   LEGSPFVFSQK-NRFTSLSCGGVALMTSLDGSTIAGCLSICDYTSTSYLR--TKSCIGMN  152

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNA----CNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            CC  +    + ++       +++ NA    C YA FL   D FT+ S+      +S +  
Sbjct  153  CCQTTITPYLRSFSTSF--GALLLNADRQTCKYA-FLVEHDWFTSNST-----NVSAIGE  204

Query  562  EDKLVVPVVWRWSVTRDDLSYLPP-TYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAY  738
             D   VP+V  W V   DL+Y     Y  +  R +K        +   C C    +GN Y
Sbjct  205  MD--YVPMVLEWHVF--DLNYTKSDIYGTNNWRDDK----STECSSSQCFCSKGHHGNPY  256

Query  739  LPNGCQGTSTL  771
            L +GCQ  S++
Sbjct  257  LLHGCQVPSSV  267



>ref|XP_010247760.1| PREDICTED: wall-associated receptor kinase 2-like [Nelumbo nucifera]
Length=308

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 54/190 (28%), Positives = 82/190 (43%), Gaps = 21/190 (11%)
 Frame = +1

Query  229  FFYSSSYNRFMFYGCGGAVLTTP----GQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINC  396
            F +SS+  +F   GC      +     G  F  +GC   C+S+ T         C+GI C
Sbjct  121  FSFSSTRTKFTAIGCDTKAYMSSSLLSGDSFA-SGCISFCTSDETLINGS----CSGIGC  175

Query  397  CDLSFDYDVNAYQIDITD-----SSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            C  S    ++ + + ++       S+  N C+YAF LA  D F  +SS   ++ + + LP
Sbjct  176  CQTSIPNGLHTFNVSLSSFYNHTDSLGFNPCSYAF-LADQDWFNFSSS--DVRDLRSRLP  232

Query  562  ---EDKLVVPVVWRWSVTRDDLSY-LPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYG  729
               +   V PVV  W +  D+ +Y +    S  C               ++C CK    G
Sbjct  233  VRYDGATVTPVVLDWVIPDDNCTYAIKNRTSYACGENTYCSDSSNPTGGYNCHCKQGYRG  292

Query  730  NAYLPNGCQG  759
            N YLP GCQG
Sbjct  293  NPYLPQGCQG  302



>ref|XP_011077656.1| PREDICTED: wall-associated receptor kinase 2-like [Sesamum indicum]
Length=759

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 72/258 (28%), Positives = 106/258 (41%), Gaps = 31/258 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F +NC  S +    +PF+ +      G  EIL IS    ++ +K   +  C+   G+   
Sbjct  64   FDVNCNTSFTP--PRPFIGT------GNLEILDIS--ANTLKIKNWVASRCYNQFGNITQ  113

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLT--TPGQEFTMAGCKLSCSSNNTT  354
             N +S+     L+ TPF +S   N+F   GC    L   + G+ FT +GC   CSSN   
Sbjct  114  DNKVSV----DLATTPFTFSD-INKFSVLGCDEFALIAGSEGRNFT-SGCVSVCSSNRDL  167

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDI-TDSSIVN----NACNYAFFLATGDDFTTT  519
                   DC+GI CC  +    +  +  ++ T  S +N      C YA FL   D F  +
Sbjct  168  ----IDGDCSGIGCCQTAIPKGLKRFNTNLGTLYSHLNIWSFAPCGYA-FLGDPDSFRFS  222

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYW  699
             S L+     N   E+   VPVV  W +   + S    +    C +             +
Sbjct  223  VSDLNDTAFQNRTIEN---VPVVLDWVIGTQNCSEAQGSSDFACLQNSYCVDSDTGLGGY  279

Query  700  SCSCKFLEYGNAYLPNGC  753
             CSC     GN YL  GC
Sbjct  280  RCSCSEGYEGNPYLSLGC  297



>ref|XP_004309275.1| PREDICTED: wall-associated receptor kinase 2-like, partial [Fragaria 
vesca subsp. vesca]
Length=274

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 78/187 (42%), Gaps = 20/187 (11%)
 Frame = +1

Query  223  TPFFYSSSYNRFMFYGCGGAVL--TTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINC  396
            TP+  S + N+F+  GC    L     G E    GC   C+ N  +A       C+GI C
Sbjct  39   TPYTISDTKNKFIVVGCDALALFQGHRGDENYTTGCMSICNDNVGSANAS----CSGIGC  94

Query  397  CDLSFDYDVNAYQIDIT---DSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
            C  S    + +  + ++   + S + + C YA  +   D FT + ++     I++LL  +
Sbjct  95   CQTSIPSGLQSLGMKVSSFYNHSYITSHCGYALIVQE-DQFTYSGNK----SITDLLGIE  149

Query  568  KLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLR----GTYWSCSCKFLEYGNA  735
            +L  P+V  W +  +            C +  +     +      + + C C     GN 
Sbjct  150  QL--PMVVNWGIGDEPCDAAEKKLDYSCKKNSECVNRTITIGSGSSGYFCQCLPGYEGNP  207

Query  736  YLPNGCQ  756
            YLP+GCQ
Sbjct  208  YLPDGCQ  214



>ref|XP_008229613.1| PREDICTED: wall-associated receptor kinase-like 1 isoform X1 
[Prunus mume]
Length=782

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 77/293 (26%), Positives = 115/293 (39%), Gaps = 70/293 (24%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I+C KS+     KPFL      +    E+L IS +  ++ +    + LC+T  G++  
Sbjct  66   FQIDCNKSTG---HKPFL------RRAQLEVLDIS-INGTLRVNSPITFLCNTKKGNS--  113

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMA--------GCKLSC  336
              +  +++N  L+G+ F +S  +N F    CG   + T   +  M         GC+  C
Sbjct  114  --SHQLLAN--LTGSFFVFSQRHNIFTAVSCGFLAVVTSSNDDDMVAVADKIIGGCRSIC  169

Query  337  SSNNTTAAPKFAYD-CNGINCCDLSFDYDV----------NAYQIDITD----SSIVNNA  471
             S       +  YD C+GINCC  +   ++          NA  ID TD      I    
Sbjct  170  DS---FQKGRSNYDGCDGINCCQTTIPPNLTSVTTHILYANASAIDCTDYPPTDYIYEKN  226

Query  472  CNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRD----DLSYL----  627
             NYA FL   + F  TSSR ++Q +          VPVV  W++  D    DL +     
Sbjct  227  INYA-FLVDREWFDNTSSR-AVQAMEK--------VPVVLEWALQYDNNVTDLLFTSFIH  276

Query  628  ----------PPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                      P  Y    +     F P+     + C C     GN YL   C 
Sbjct  277  GERNRSRRHDPTPYCEVDETSTYSFSPRHMAASFYCHCPEGFEGNPYLRQSCH  329



>ref|XP_003534747.2| PREDICTED: wall-associated receptor kinase-like 22-like [Glycine 
max]
Length=772

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 68/278 (24%), Positives = 106/278 (38%), Gaps = 45/278 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESF--SPLCHTTAGSA  174
            F I C  S+     +P+L S   G     E+LS    R ++ +      S  C T     
Sbjct  79   FEIECRNST-----RPYLKSIGLGV----EVLSFDVNRGTVDINNPIYRSNNCGTKTTKH  129

Query  175  VGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTT  354
               NN+S      L G+PF YS   N+F+  GC        G+   ++GC   C +++  
Sbjct  130  PAVNNIS------LEGSPFVYSQRNNKFVAAGCNNIAFLK-GKGSAVSGCVSICDNDDDV  182

Query  355  AAPKFA-YDCNGINCCDLSFDYDVNAYQIDIT--DSSIVNNACNYAFFLATG--------  501
                    +CNG +CC+ S    ++ Y  +I   + +   N C+YA  +           
Sbjct  183  GNTNLGTIECNGESCCENSLPMYLSEYTPEIKGLNENKKGNHCSYAMIVQNQPNPDPYQY  242

Query  502  ---DDFTTTSSRLSLQRISNLLPEDKL----VVPVVWRWSVTRDDLSYLPPTYSRDCDRY  660
               + +            SNLL   KL     VP V  W +    L  LP +   DC + 
Sbjct  243  QCRNGYRYPYPYQYQYGYSNLLGVGKLKDIDFVPAVLEWEIVNATLK-LPTSPYVDC-KG  300

Query  661  EKIFPPQLRGTYWSCSCKFLEY-------GNAYLPNGC  753
              I   +   +   CSC++  Y        N Y+ +GC
Sbjct  301  TNITSSRYNYSGRRCSCRYEAYYYITPSPRNPYIADGC  338



>ref|XP_008225630.1| PREDICTED: wall-associated receptor kinase 2-like [Prunus mume]
Length=749

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 67/270 (25%), Positives = 111/270 (41%), Gaps = 48/270 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC++S++     P ++   +G      + +IS  +  + ++   +  C+   G    
Sbjct  52   FFINCSQSTN-----PPIAYLGEGN---LPVTNISLEKGELQIQMLITKDCYDQQGEQ--  101

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGC------GGAVLTTPGQEFTMAGCKLSCSS  342
            +N+    S+ K++   F  S++ NRFM  GC      GG   T    E  M+GC   C S
Sbjct  102  TNDSQAFSSIKMA--EFTISATKNRFMAVGCDTNAIFGGYRET----EQYMSGCTSFCQS  155

Query  343  NNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATG  501
                  P     C+GI CC       +     +IT  S  N       N C++AF +  G
Sbjct  156  -----IPSVNDSCSGIGCCQTYIPSGLTNQ--NITLESFYNHKYSWNFNPCSFAFVVENG  208

Query  502  DDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLP-----PTYSRDCDRYEK  666
                T S   S Q +SN        +P++  W +  +  S        P +++     ++
Sbjct  209  Q--FTFSGETSFQVLSNTKR-----LPMILNWEIGNESCSAAKKRVDYPCHNKTTKCVDR  261

Query  667  IFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            I   +   + + C C     GN YLP+GCQ
Sbjct  262  IIHNKPASSGYFCQCLPGYQGNPYLPDGCQ  291



>ref|XP_002462203.1| hypothetical protein SORBIDRAFT_02g021500 [Sorghum bicolor]
 gb|EER98724.1| hypothetical protein SORBIDRAFT_02g021500 [Sorghum bicolor]
Length=681

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 112/282 (40%), Gaps = 48/282 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLC-----HTTA  165
            F + C +  ++G+ KPF+        G  E+L IS    +I +    +  C     H  +
Sbjct  24   FDVTC-QQDTNGISKPFI--------GGHELLDISLTNSTIRVLNPITTYCYNDTWHNNS  74

Query  166  GSAVGSNNLS-----IISNTKLSGTPFFYSSSYNRFMFYGC-GGAVLTTPGQEFTMAGCK  327
               V   N S     ++S+   +  PF +S ++N+F   GC     +     E+T  GC 
Sbjct  75   SMVVQQQNDSSSGYLVVSDFVRNYPPFRFSDTHNKFTVIGCITVGYIGNNVSEYT-TGCV  133

Query  328  LSCSSNNTTAAPKFAYDCNGINCC--------DLSFDYDVNAYQIDITDSSIVNN----A  471
             +C  N +  +      C+G+ CC        DL FD ++     ++   +  N      
Sbjct  134  STCGWNMSDGS-----SCSGMGCCQTPIPKGMDL-FDINLQVITPNVDKKNQTNRFGGLQ  187

Query  472  CNYAFFL-ATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRD--DLSYLPPTYS  642
            CNYA  + A    F+TT         +     D    PVV  WS+  D   ++ +  T +
Sbjct  188  CNYAVLMEAAAFSFSTTYVN-----TTKFFDMDAGQAPVVLDWSIRNDTCQVAQMNLTGT  242

Query  643  RDCDRYEKIFPPQLRGT-YWSCSCKFLEYGNAYLPNGCQGTS  765
              C            G+  + C+C     GN YLP GCQG +
Sbjct  243  YACLSTNSKCVDSTSGSPGYVCNCSLGYEGNPYLPGGCQGVT  284



>ref|XP_010273358.1| PREDICTED: wall-associated receptor kinase 2-like [Nelumbo nucifera]
Length=1257

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 63/248 (25%), Positives = 103/248 (42%), Gaps = 45/248 (18%)
 Frame = +1

Query  70   GKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSY  249
            G NG  E++ IS +  S+ ++      C+  +G    S N   +    L   P+ +S  +
Sbjct  74   GTNGTVEVIDISPL-GSLRVRNFVGYDCYNRSGGH--SRNRPWMD---LKMKPYSFSDVH  127

Query  250  NRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSF----  411
            NRF   GC     +  + G+ FT +GC + CS   +         C+GI CC  S     
Sbjct  128  NRFTSIGCDIYTYISGSKGRNFT-SGCSMVCSDQQSLVNG----SCSGIGCCQTSIPKGF  182

Query  412  -DYDVNAYQIDITDSSIVNNACNYAFFL-------ATGDDFTTTSSRLSLQRISNLLPED  567
             +YDV  +        +  N C+Y F +       + GD F             +    +
Sbjct  183  KEYDVEVHSFHNHTRVMDYNPCSYGFLVDAEWYKFSVGDLFGYM----------DFYNRN  232

Query  568  KLVVPVVWRWSV---TRDDLSYLPPTYS--RDCDRYEKIFPPQLRGTYWSCSCKFLEYGN  732
               VPVV  W++   T +++S   P+Y+  ++ D Y         G  + C+C    +GN
Sbjct  233  DEKVPVVLDWAIENYTCENVSRSDPSYACGKNSDCYNSP-----NGLGYLCNCSQGYHGN  287

Query  733  AYLPNGCQ  756
             YL +GCQ
Sbjct  288  PYLEDGCQ  295



>ref|XP_010476729.1| PREDICTED: wall-associated receptor kinase-like 8 [Camelina sativa]
Length=738

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 73/272 (27%), Positives = 111/272 (41%), Gaps = 49/272 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILS--ISNVRQSIIMKESF--------SPL  150
            F + C+ +SSD V  PFL S        RE+LS  + +   SI  +  +        SPL
Sbjct  59   FEVVCS-NSSDQVSVPFLLSIR------REVLSFDLGSYSNSIYGRSRYQSNKIRILSPL  111

Query  151  CHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKL  330
             HT  G + GS   S  S+  L+G+PFF S S N+F   GC    L   G+   + GC+ 
Sbjct  112  KHT--GCSNGSIGDS--SSLNLTGSPFFISDS-NKFTAIGCNNKALMK-GKGSQIVGCEA  165

Query  331  SCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAF---FLATG  501
            +C+  N TA       C G  CC       +  +   +         C  A+   F  + 
Sbjct  166  TCTYENDTAR-----GCVGYKCCQTQIPSGLQVFDATVEKMIPGQAGCQVAYLTHFELSP  220

Query  502  DDFTTTSSR-------LSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRY  660
              FT+   +       + L+ + ++ P        V     T+  L+ +        + Y
Sbjct  221  SMFTSPQLQEYGKYVMMELEWVLDVFPIPSEGSTTVLCAESTKGALASIISA-----NLY  275

Query  661  EKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
              ++PP    T + C CK    GN Y+P GCQ
Sbjct  276  --LYPP----TGYQCWCKHGYQGNPYIPGGCQ  301



>ref|XP_008441592.1| PREDICTED: wall-associated receptor kinase 2-like [Cucumis melo]
Length=739

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 68/271 (25%), Positives = 111/271 (41%), Gaps = 54/271 (20%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I C K+      KPFL      ++   EI +IS ++  + +K+  +  C+T  G +  
Sbjct  57   FSITCNKTYHP--PKPFL------QDSNIEITNISIIQGQLHIKQFVARDCYTKNGPSES  108

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTT  354
            +    ++ N       F  S++ N+F+  GC     +      E   +GC   C +NNT 
Sbjct  109  NTRPFLLLNK------FRISNTDNKFIVIGCDTYAYIYGEIEGESYKSGCMALCGNNNTK  162

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDI----TDSSIVN-NACNYAFFLATGDDFTTT  519
                 +  C+G  CC L     +   ++++      S ++  N C YAF +   D FT  
Sbjct  163  IIKDGS--CSGNGCCQLQIPKGLKILELEVRSFDNHSEVLKFNPCGYAFVIQQ-DKFT--  217

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEK--------IFP  675
                S + I N   E+   VP+V  W +         PT +  C + E         +  
Sbjct  218  ---FSKKYIYNFTQEE---VPLVLDWGI---------PT-NTSCSKGENKGNCSICGLNA  261

Query  676  PQLR----GTYWSCSCKFLEYGNAYLPNGCQ  756
             ++R    G+ + C C     GN YLP GCQ
Sbjct  262  ERIRFLDDGSEYRCQCLEGFEGNPYLPQGCQ  292



>gb|KCW81763.1| hypothetical protein EUGRSUZ_C03129 [Eucalyptus grandis]
Length=958

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 81/205 (40%), Gaps = 44/205 (21%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF +S   N F   GC   +LT  G+E  + GC+  C+  N T +   A  C+G +
Sbjct  347  LKGSPFVFSQKRNIFTVVGCN-TLLTANGKESAVFGCQSKCAGTNFTISKYSA--CSGED  403

Query  394  -CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
             CC  S   ++  + +D  + S  +  C YAF          + S +   R+S+      
Sbjct  404  ECCQSSLPLNLQGFGVDFEEES-GDEGCKYAFL--------GSHSGVYDLRLSD------  448

Query  571  LVVPVVWRWSVTRDDLSYLPPTY--------SRDCDRYEKIFPPQLRGTYW---------  699
              VP V  W +  +    L   Y        S  C R+ K    +  G  +         
Sbjct  449  -TVPGVLEWGIANNTTYALDLIYQGYYRMNESFTCTRF-KSLSSEGEGIIYRYRNSSVDS  506

Query  700  ------SCSCKFLEYGNAYLPNGCQ  756
                   C C+   +GNAYL  GC+
Sbjct  507  GEILSAQCRCRTGYHGNAYLIGGCK  531



>gb|KCW81737.1| hypothetical protein EUGRSUZ_C03090 [Eucalyptus grandis]
Length=637

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 81/203 (40%), Gaps = 42/203 (21%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF +S   N F   GC   +L   G+E  + GC+  C+  N T++ K++       
Sbjct  26   LKGSPFVFSQKTNIFTVVGC-NTLLIANGKESAVFGCQSKCAGANFTSS-KYSACSEREG  83

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKL  573
            CC  S   ++  + +D  + S  +  C YAF    G D            + +L P DK 
Sbjct  84   CCQSSVPLNLQGFGVDFEEES-GDEGCKYAFL---GSD----------SGVYDLRPSDK-  128

Query  574  VVPVVWRWSVTRDDLSYLPPTYSRD-------CDRYEKIFPPQLRGTYW-----------  699
             VP +  W +  ++  Y      R        C ++ K    ++ G  +           
Sbjct  129  -VPGMLEWGIA-NNTKYALDLQGRGRYNESFYCTKF-KSLSSEVEGIIYRYRSYSVNSGE  185

Query  700  ----SCSCKFLEYGNAYLPNGCQ  756
                 C C+   +GNAYL  GC+
Sbjct  186  ILSAQCYCRKGYHGNAYLSGGCE  208



>ref|XP_006657321.1| PREDICTED: wall-associated receptor kinase 3-like [Oryza brachyantha]
Length=748

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/234 (24%), Positives = 95/234 (41%), Gaps = 19/234 (8%)
 Frame = +1

Query  82   VREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGT--PFFYSSSYNR  255
            V ++L I  +R  I    + S  C T  G A     L   S T L+ T  P+ +S   NR
Sbjct  76   VVKVLRIDLLRGKIRTTNTISWQC-TEKGGATAGARLQNSSWTGLNATALPYRFSDEDNR  134

Query  256  FMFYGCGGAVL----TTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDV  423
            F   GC   V      +   +  ++GC  +C  N +         C+GI CC+++    +
Sbjct  135  FFTLGCNALVFLNGEASGIDDPILSGCISTCFGNASIRNGT----CSGIGCCEMAIPRGL  190

Query  424  NAYQIDIT----DSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVW  591
            N+Y ++ T    +SS  N+ C YA  + +       S  ++         ++   VP++ 
Sbjct  191  NSYSLEFTGPLVNSSSNNDWCIYAALMES----AGFSFEVAYATTDMFYRKNNGTVPLLL  246

Query  592  RWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGC  753
             + V  +       +    C     +    + G  + C+C     GN YLP+GC
Sbjct  247  NFVVGNETCKEAQASGGYACAGDHSVCVDAVDGPGYVCNCSQGYTGNPYLPDGC  300



>ref|XP_010051321.1| PREDICTED: wall-associated receptor kinase-like 5 [Eucalyptus 
grandis]
Length=984

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/205 (26%), Positives = 81/205 (40%), Gaps = 44/205 (21%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF +S   N F   GC   +LT  G+E  + GC+  C+  N T +   A  C+G +
Sbjct  373  LKGSPFVFSQKRNIFTVVGCN-TLLTANGKESAVFGCQSKCAGTNFTISKYSA--CSGED  429

Query  394  -CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
             CC  S   ++  + +D  + S  +  C YAF          + S +   R+S+      
Sbjct  430  ECCQSSLPLNLQGFGVDFEEES-GDEGCKYAFL--------GSHSGVYDLRLSD------  474

Query  571  LVVPVVWRWSVTRDDLSYLPPTY--------SRDCDRYEKIFPPQLRGTYW---------  699
              VP V  W +  +    L   Y        S  C R+ K    +  G  +         
Sbjct  475  -TVPGVLEWGIANNTTYALDLIYQGYYRMNESFTCTRF-KSLSSEGEGIIYRYRNSSVDS  532

Query  700  ------SCSCKFLEYGNAYLPNGCQ  756
                   C C+   +GNAYL  GC+
Sbjct  533  GEILSAQCRCRTGYHGNAYLIGGCK  557



>emb|CBI18947.3| unnamed protein product [Vitis vinifera]
Length=1170

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/186 (25%), Positives = 73/186 (39%), Gaps = 20/186 (11%)
 Frame = +1

Query  220  GTPFFYSSSYNRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            G+ +  S   N+F+  GC     V    G+E    GC   C S     +      C+GI 
Sbjct  95   GSGYTISGKRNKFIAVGCDTYAIVRAYKGEERYTTGCMSVCDSITNVKSGS----CSGIG  150

Query  394  CCDLSFDYDVNAYQIDITD-----SSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            CC+ S       + + ++      S    N C+YAF +        T  + S  +  +L 
Sbjct  151  CCETSIPEGTTNFTVKLSSYNNHRSVWAFNPCSYAFVVEE------THFKFSSNQFRDLN  204

Query  559  PEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAY  738
              + L  PVV  W + ++       T +  C    + + P     Y  C C    +GN Y
Sbjct  205  NTENL--PVVLDWRIGKERCKAARKTETYACKGKSECYEPDDWSGYL-CKCLDGYHGNPY  261

Query  739  LPNGCQ  756
            LP+GCQ
Sbjct  262  LPDGCQ  267



>ref|XP_008229723.1| PREDICTED: wall-associated receptor kinase-like 8 [Prunus mume]
Length=765

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 70/274 (26%), Positives = 107/274 (39%), Gaps = 58/274 (21%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F + C KS+ D   KPFL      +    E+LSIS ++  +  K   +        +   
Sbjct  70   FQLECNKSTGD---KPFL------RLAQLEVLSIS-IKGMLQFKYPVTFFSCKGKETRQA  119

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSC--SSNNTT  354
             N         L+G+PF YS ++N F    C G + T   ++    GC+ +C  S+NNT 
Sbjct  120  PN---------LTGSPFLYSVTHNIFTAVTC-GHLATVRSEKHVFHGCESTCDWSTNNTN  169

Query  355  AAPKFAYDCN-GINCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRL  531
                    C+  INCC  +   +++ +  +I      N  C YAF +         SS  
Sbjct  170  R-------CDIEINCCQTNIPPNLSVFTTEI-QGRYQNGGCGYAFLVDQDWFVNNLSSYR  221

Query  532  SLQRISNLLPEDKLVVPVVWRWSVTRDDLSY---------------LPPTYSRDCDRYEK  666
            ++Q + +        VPVV  W ++ D+ S                    Y  D   Y +
Sbjct  222  AIQGMDS--------VPVVLDWKISLDNTSLRSFKGFIGTEPDYYDFERNYIIDSTPYCE  273

Query  667  IFPPQLRGTY----WSCSCKFLEYGNAYLPNGCQ  756
            I+      TY      CSC     GN YL + CQ
Sbjct  274  IYNATTSSTYNKSSLHCSCPAGFEGNPYLLHPCQ  307



>ref|XP_010664149.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Vitis 
vinifera]
Length=736

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 73/187 (39%), Gaps = 22/187 (12%)
 Frame = +1

Query  220  GTPFFYSSSYNRFMFYGCG--GAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            G+ +  S   N+F+  GC     V    G+E    GC   C S     +      C+GI 
Sbjct  115  GSGYTISGKRNKFIAVGCDTYAIVRAYKGEERYTTGCMSVCDSITNVKSG----SCSGIG  170

Query  394  CCDLSFDYDVNAYQIDITD-----SSIVNNACNYAFFLA-TGDDFTTTSSRLSLQRISNL  555
            CC+ S       + + ++      S    N C+YAF +  T   F++   R  L    NL
Sbjct  171  CCETSIPEGTTNFTVKLSSYNNHRSVWAFNPCSYAFVVEETHFKFSSNQFR-DLNNTENL  229

Query  556  LPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNA  735
                    PVV  W + ++       T +  C    + + P     Y  C C    +GN 
Sbjct  230  --------PVVLDWRIGKERCKAARKTETYACKGKSECYEPDDWSGYL-CKCLDGYHGNP  280

Query  736  YLPNGCQ  756
            YLP+GCQ
Sbjct  281  YLPDGCQ  287



>ref|XP_006492575.1| PREDICTED: wall-associated receptor kinase-like 1-like isoform 
X2 [Citrus sinensis]
Length=606

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 71/187 (38%), Gaps = 21/187 (11%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L   PF++S   N F   GC   A +++   +F + GC   C   N T        CNGI
Sbjct  23   LEKLPFYFSYYDNIFSGIGCNNLASMSSADHDFILGGCFSICDPRNKTDDD----SCNGI  78

Query  391  NCCDLSFDYDVNAYQIDITDSSIV------NNACNYAFFLATGDDFTTTSSRLSLQRISN  552
             CC     + + ++ I I +++           C YAF +      +   S  ++Q    
Sbjct  79   ACCKAGVPWALKSFNISINNAASSRSSSQEEGKCKYAFMVEKEWFESNFKSAEAVQ----  134

Query  553  LLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGN  732
                D   VPV+  W +       L    S +        P +     + CSCK   +GN
Sbjct  135  ----DWNQVPVILDWRIPNSSFGKLEKDKSPEFTSTSHCRPDE--SGLFGCSCKEKYHGN  188

Query  733  AYLPNGC  753
             Y  +GC
Sbjct  189  PYFLHGC  195



>gb|EAY86751.1| hypothetical protein OsI_08131 [Oryza sativa Indica Group]
Length=546

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 61/245 (25%), Positives = 102/245 (42%), Gaps = 40/245 (16%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAV-GSNNLSIISNTKLSGTPFFYSSSYNRFMF  264
            E++ +S  R  + +  + +P C+  + SA+ G +N        +S T F  + + NRF  
Sbjct  55   EVVDVSVRRGQLRIYSAINPWCYNGSTSAMNGQSNWWY----DMSITNFRINDALNRFTV  110

Query  265  YGCGG-AVLTTP----GQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNA  429
             GC   A + +P    G +  M GC   C         K    C G+ CC  +    +N 
Sbjct  111  VGCNSLAYILSPNGTAGADRYMTGCMAMCPGAGRL--EKENGSCAGVGCCQTAIPAGLNG  168

Query  430  YQIDITD----SSIVN-NACNYAFFL-ATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVW  591
            YQ+   +    S+I   + C+YA  + A+  DF     R S       +  +   +P+V 
Sbjct  169  YQVSFEEKFNTSAIAGFSRCSYAVLVEASAFDF-----RASYVTTDEFMASNGGQLPLVL  223

Query  592  RWSV--------TRDDLSYLPPTYSRDC--DRYEKIFPPQLRGTYWSCSCKFLEYGNAYL  741
             W++         R+  +Y   + + +C   RY        RG  + C+C     GN YL
Sbjct  224  DWAIGNKTCEEAKRNASAYACVSANSECVDSRYG-------RGRGYLCNCSAGYDGNPYL  276

Query  742  PNGCQ  756
             +GCQ
Sbjct  277  LDGCQ  281



>ref|XP_002890435.1| wall-associated kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66694.1| wall-associated kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/180 (29%), Positives = 71/180 (39%), Gaps = 25/180 (14%)
 Frame = +1

Query  241  SSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLS---  408
            S +N+F   GC   A L T G E    GC   C S      P     C+G  CC  S   
Sbjct  114  SEHNKFTVVGCNSYAFLRTSGVEKYSTGCISLCDS-----VPSKKGSCSGEGCCQTSVPR  168

Query  409  --FDYDVNAYQIDITDSSIVNNACNYAFFLATGD-DFTTTSSRLSLQRISNLLPEDKLVV  579
              +   V  +  D   +  + N C YAF +  G  DF       +L+ ++          
Sbjct  169  GSYFVRVKPHSFDNHTTVHLFNPCTYAFLVEDGKFDFYALEDLNNLRYVTTF--------  220

Query  580  PVVWRWSVTRDDLSYLPPTYSRD-CDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            PVV  WS+  +    +     R+ C      F    RGT ++C C     GN YLPNGCQ
Sbjct  221  PVVLDWSIGNETCEQV---VGRNICGGNSTCFNST-RGTGYNCKCLEGFEGNPYLPNGCQ  276



>emb|CAN64180.1| hypothetical protein VITISV_007798 [Vitis vinifera]
Length=264

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 42/150 (28%), Positives = 64/150 (43%), Gaps = 16/150 (11%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  S+      PF   F+       ++ SIS   Q+++++ +    C         
Sbjct  56   FSINCNHST------PF---FTHPNLNGSQVSSISLEGQTVVVQIATVDFCKLPE-----  101

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
            S +  ++    L G PF +S   N     GCG   L +  Q+  +AGC   C + +T A 
Sbjct  102  SQHTQVLDRVDLEGNPFLFSKKGNAVSVSGCGNVSLLS-RQDKVLAGCSTICDNTSTAAV  160

Query  361  PKFAY-DCNGINCCDLSFDYDVNAYQIDIT  447
              FA   C GINCC  +    +N Y +  T
Sbjct  161  YPFANGSCTGINCCRTTPPSPLNFYHLKTT  190



>ref|XP_006303914.1| hypothetical protein CARUB_v10008422mg [Capsella rubella]
 gb|EOA36812.1| hypothetical protein CARUB_v10008422mg [Capsella rubella]
Length=734

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/182 (28%), Positives = 78/182 (43%), Gaps = 27/182 (15%)
 Frame = +1

Query  241  SSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDY  417
            S+ N+F   GC   A+L+T G +    GC   C S   ++ P     CNG+ CC      
Sbjct  117  STKNKFTLVGCNAWALLSTFGLQNYSTGCLSLCDS---SSVPN--NKCNGVGCCRTDVSV  171

Query  418  DVNAYQIDITDSSIVN-------NACNYAFFLATGD-DFTTTSSRLSLQRISNLLPEDKL  573
             +++ ++++  +   N       N C YAFF+  G  +F++T    +L+ +         
Sbjct  172  PLDSNRLEMQPARFENMTSVKHFNPCVYAFFVEDGMFNFSSTEDLENLRNVRQF------  225

Query  574  VVPVVWRWSVTRDDLSYLPPTYSRD-CDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNG  750
              PVV  WS+       +     RD C      F    RG  ++C C     GN YL NG
Sbjct  226  --PVVLDWSIGNHTCEQV---VGRDICGGNSTCFDST-RGKGYNCKCLQGFEGNPYLSNG  279

Query  751  CQ  756
            CQ
Sbjct  280  CQ  281



>ref|XP_008791611.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Phoenix 
dactylifera]
Length=760

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 64/261 (25%), Positives = 109/261 (42%), Gaps = 30/261 (11%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C  +  +GV KPF ++         EI++I  +     +    S  C+      V 
Sbjct  77   FALSCNHTG-NGVHKPFHNNI--------EIINIDLLAAQASIYYPISWQCYNATTHIVS  127

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTP--GQEFTMAG-CKLSCSSNNT  351
             +   +    K+  +PF +S   N+F   GC      T    +E T +G C   C+S+ +
Sbjct  128  RSQWYL----KIINSPFRFSDEKNKFFVVGCDTLAYITGINKKEITYSGGCVTVCNSSES  183

Query  352  TAAPKFAYDCNGINCCDLSFDYDVNAYQI----DITDSSIVN-NACNYAFFLATGDDFTT  516
              +      C+GI CC  +    +N YQ+    +  +S + N N C+YA  LA  + F  
Sbjct  184  LTSG----SCSGIGCCQTTIPKGINYYQVIFDRNFNNSRVWNFNPCSYAV-LAEVNWFNF  238

Query  517  TSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFP-PQLRGT  693
            T++ ++    S L   +    P V  W++  +         +    R E  +      G 
Sbjct  239  TTAYVT---TSELNETNGGQAPAVLDWAIGDEPCEVAQRNIASYACRSEHSYCFNSSNGL  295

Query  694  YWSCSCKFLEYGNAYLPNGCQ  756
             + C+C     GN YLP+GCQ
Sbjct  296  GYLCNCSSGYEGNPYLPDGCQ  316



>ref|XP_006492574.1| PREDICTED: wall-associated receptor kinase-like 1-like isoform 
X1 [Citrus sinensis]
Length=694

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 46/187 (25%), Positives = 71/187 (38%), Gaps = 21/187 (11%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L   PF++S   N F   GC   A +++   +F + GC   C   N T        CNGI
Sbjct  111  LEKLPFYFSYYDNIFSGIGCNNLASMSSADHDFILGGCFSICDPRNKTDDD----SCNGI  166

Query  391  NCCDLSFDYDVNAYQIDITDSSIV------NNACNYAFFLATGDDFTTTSSRLSLQRISN  552
             CC     + + ++ I I +++           C YAF +      +   S  ++Q    
Sbjct  167  ACCKAGVPWALKSFNISINNAASSRSSSQEEGKCKYAFMVEKEWFESNFKSAEAVQ----  222

Query  553  LLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGN  732
                D   VPV+  W +       L    S +        P +     + CSCK   +GN
Sbjct  223  ----DWNQVPVILDWRIPNSSFGKLEKDKSPEFTSTSHCRPDE--SGLFGCSCKEKYHGN  276

Query  733  AYLPNGC  753
             Y  +GC
Sbjct  277  PYFLHGC  283



>gb|KCW47708.1| hypothetical protein EUGRSUZ_K01448 [Eucalyptus grandis]
Length=328

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 49/186 (26%), Positives = 74/186 (40%), Gaps = 19/186 (10%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L+G+ F +S S N     GC  AVL     + ++ GCK SC  +           C+G +
Sbjct  116  LNGSHFIFSESRNVLAAVGCNIAVLLD--NQKSIIGCKSSCKDDKVVRK----MTCSGSD  169

Query  394  -CCDLSFDYDVNAYQIDIT-DSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPED  567
             CC  +   D+ A+ I    D     N C YAF    GD    TSS +   ++     + 
Sbjct  170  GCCHTTITPDLQAFTITFNPDKDSPMNQCEYAFL---GDRSKFTSSTMDFNKL-----KA  221

Query  568  KLVVPVVWRWSVTRDDLSYLPPTYSRD---CDRYEKIFPPQLRGTYWSCSCKFLEYGNAY  738
                PVV  W + +   +        D   C  +    P      +  CSC+    GN Y
Sbjct  222  SGHFPVVLEWGIAKSSRAASEIYKHGDSYHCSNFSFNSPYPKEMPFLQCSCRGGFTGNPY  281

Query  739  LPNGCQ  756
            + +GC+
Sbjct  282  IKSGCE  287



>ref|XP_008225752.1| PREDICTED: putative wall-associated receptor kinase-like 16 [Prunus 
mume]
Length=772

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 63/268 (24%), Positives = 102/268 (38%), Gaps = 40/268 (15%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INCT   S    +P +  +      +   +S+      I+  +  +  C+   G+   
Sbjct  60   FFINCTHDES---REPQIVPYWGNSGIIVSNISLEEAELQIL--QFVAKDCYNQLGNQTY  114

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTP------GQEFTMAGCKLSCSS  342
            +NN         S  PF  S + N+F+  GC    +          QE  +AGC   C S
Sbjct  115  NNN------PWFSVPPFTISQAKNKFIAVGCDTIAIFQGYRAFPNNQESYLAGCMSLCDS  168

Query  343  NNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA--------CNYAFFLAT  498
             ++    ++   C+GI CC  +    +    + +T SS  N+         C+YAF +  
Sbjct  169  LDSI---EYQDSCSGIGCCQTNIPSGLQ--NLTVTLSSTYNHTKLVGDLTNCSYAFLVEE  223

Query  499  GDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRD--CDRYEKIF  672
                 + SS   L+ I+ L        P V  W++  D          +D  C    K  
Sbjct  224  TQFKFSNSSFQQLESITEL--------PAVLNWAIGEDPDPCNKAQKRKDFACKANSKCV  275

Query  673  PPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                R   + C C    +GN YLP+GC+
Sbjct  276  NLVGRSAGYICQCLQGYHGNPYLPDGCE  303



>ref|XP_002457827.1| hypothetical protein SORBIDRAFT_03g014450 [Sorghum bicolor]
 gb|EES02947.1| hypothetical protein SORBIDRAFT_03g014450 [Sorghum bicolor]
Length=732

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 65/260 (25%), Positives = 108/260 (42%), Gaps = 32/260 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F INC  ++S G++KPF+        G  E+L+IS  R         S  C+    + + 
Sbjct  51   FKINCNTTAS-GIKKPFI--------GNVEVLNISVSRGKTRALNKMSTYCYDHTTTKME  101

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             N    +     S  P+ +S++ NRFM  GC            T  G   +C+S    A+
Sbjct  102  EN----LWWLDFSKWPYRFSNTDNRFMVIGCNTLAYIYNINNRT--GYTTACAS--VCAS  153

Query  361  PKFAYD--CNGINCCDLSF-----DYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTT  519
            P+   +  C G+ CC          YDV  Y +     S   N C+YA  L   + F  +
Sbjct  154  PRALTNGSCLGVGCCQNDIPNGLTRYDVQFYSVYNDSDSWRFNPCSYAA-LVESETFNFS  212

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSVTRD--DLSYLPPTYSRDCDRYEKIFPPQLRGT  693
            S  ++  + +      +   P+V  W++     D++   P+Y+  C   + +    + G 
Sbjct  213  SEYITTMKFNETYGGHQ---PLVLDWAIGNVTCDVARSLPSYA--CRDRQSLCVDSVNGP  267

Query  694  YWSCSCKFLEYGNAYLPNGC  753
             + C+C     GN YL +GC
Sbjct  268  GYLCTCPKGYKGNPYLSDGC  287



>gb|KDP42930.1| hypothetical protein JCGZ_23872 [Jatropha curcas]
Length=635

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 58/191 (30%), Positives = 78/191 (41%), Gaps = 21/191 (11%)
 Frame = +1

Query  217  SGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINC  396
            SG P  +S + N+F   GC    L   G+    +GC   C SN T         C+G  C
Sbjct  117  SGPPVRFSDTRNKFTVVGCDTLALFEDGEMSFASGCISWCGSNVTQNG-----SCSGRGC  171

Query  397  CDLSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFTTTSSRLSLQRISNL  555
            C      ++ A  I+I  SSI N       N C +A FLA    F  ++ +LS    S  
Sbjct  172  CQTPLPRNLTA--INIGVSSIFNHSGVWQFNPCEFA-FLADESTFNFSNLQLSSHPYSR-  227

Query  556  LPEDKLVVPVVWRWSVTRD--DLSYLP--PTYSRDCDRYEKIFPPQLRGTYWSCSCKFLE  723
              +      VV  W+V  +  D +  P  P     C +    F  +  G Y  C+C    
Sbjct  228  ETKKYFESDVVIEWAVREETCDEAKSPSNPDKKYACGQNTDCFFSENVGGY-RCNCTDGF  286

Query  724  YGNAYLPNGCQ  756
             GN YLP GCQ
Sbjct  287  TGNPYLPQGCQ  297



>ref|XP_006368666.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
 gb|ERP65235.1| hypothetical protein POPTR_0001s07550g [Populus trichocarpa]
Length=701

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 74/263 (28%), Positives = 111/263 (42%), Gaps = 46/263 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C K+++D   + FLS  +       E+L IS +R    M    SP+  ++  S  G
Sbjct  31   FSVDCNKTTADSPSRAFLSRIN------MEVLEIS-IRDMSNMVRVNSPII-SSGCSGRG  82

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTT--  354
            +N     S   ++G+PF +SSS N F   GC    L   G E  + GC  +C +NN T  
Sbjct  83   AN-----SAINMTGSPFAFSSS-NIFTAMGCNNRALLN-GIEPEIVGCTSTCGANNLTSN  135

Query  355  --AAPKFAYDCNGINCCDLSFDYDVNAYQIDI-TDSSIVN----NACNYAFFLATGDDFT  513
              A  K    C+G NCC  +    +  +   + T    +N    N C  AF +   + F 
Sbjct  136  SSAEGKENSYCSGNNCCQTTIPSSLQVFNASLGTPDHPINDQGRNECKVAFIVEE-EWFR  194

Query  514  TTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLP--PTYSRDCDRYEKIFPPQLR  687
               S       S  + +D   VPV+  W     D+ Y    P   ++ D     +     
Sbjct  195  NNIS-------SPEVVKDMQYVPVILDW-----DMYYGTDIPEGVKNSDANTVTY-----  237

Query  688  GTYWSCSCKFLEY-GNAYLPNGC  753
                +C C F  Y GN YLP+GC
Sbjct  238  SNSTTCWC-FPGYDGNPYLPDGC  259



>ref|XP_011027426.1| PREDICTED: putative wall-associated receptor kinase-like 16 isoform 
X1 [Populus euphratica]
 ref|XP_011027427.1| PREDICTED: putative wall-associated receptor kinase-like 16 isoform 
X2 [Populus euphratica]
Length=747

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 67/265 (25%), Positives = 106/265 (40%), Gaps = 42/265 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C  + +     P  +    G   V EI     +R    + +  +  C+  AG+   
Sbjct  58   FLITCNHTFN-----PPKAFLGKGNLSVAEITLDGKLR----LMQYIAKDCYDRAGARKT  108

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAV----LTTPGQEFTMAGCKLSCSSNN  348
             N   I  N  + G P+ +S + N  +  GC        +     +  M GC   CS   
Sbjct  109  RNRPWI--NLPVQG-PYVFSDTDNMLVAIGCDTFAEMRGIREDKNDTYMVGCVSKCSDKK  165

Query  349  TTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDD  507
                      C+GI CC  S    +  +  D++ SS  N       N C++AF +     
Sbjct  166  YVPNT-----CSGIGCCHTSIAKGIKYF--DVSLSSYNNHMGIWEFNPCSFAFIIEE-KQ  217

Query  508  FTTTSSRLS-LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTY-SRDCDRYEKIFPPQ  681
            F+ + S LS L ++S        ++P++  WS+ R++   L     S  C    K   P+
Sbjct  218  FSFSPSNLSDLVKVS--------LLPIIVDWSIGRNNCETLEKNKTSNACQGQSKCHDPE  269

Query  682  LRGTYWSCSCKFLEYGNAYLPNGCQ  756
              G+ + C C     GN YLPNGC+
Sbjct  270  -NGSGYICKCLDGYQGNPYLPNGCR  293



>emb|CAN82289.1| hypothetical protein VITISV_028339 [Vitis vinifera]
Length=352

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 66/266 (25%), Positives = 106/266 (40%), Gaps = 35/266 (13%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F + C  S    + KPFL   +       E+L++S  R +I +    +P+    +G A  
Sbjct  108  FEVTCNNSIHPHIPKPFLKRLN------LEVLNVSLDRGTIQVN---NPVLFDCSGKA--  156

Query  181  SNNLSIISN--TKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTT  354
             +N ++  N   +  G PF +S +Y RF   GC  +VL    Q   +AG  +S    N T
Sbjct  157  -SNFTVTPNFTVRWEGGPFSFSETYTRFTAVGC--SVLAYIEQSEAIAGGCMSFCKPNET  213

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA---CNYAFFLATGDDFTTTSS  525
            A    +  C G+ CC       + ++   +      N+    C  AF +   D     S 
Sbjct  214  AVKNGS--CYGLECCQTQVPPALRSFTAYLDSFPSGNDEQLPCKSAFMV---DQEWFISK  268

Query  526  RLSLQRISNLLPEDKLVVPVVWRWSV-----TRDDLSYLPPTYSRDCDRYEKIFPPQLRG  690
                +++     +D   VP V  W +          +    T + +C     I     +G
Sbjct  269  GQDPEKV-----KDMKYVPAVLDWRIYNATCNASTSTLDTSTITVNCGN-NTICSSTNQG  322

Query  691  TYWSCSCKFLEYGNAYLPNGCQGTST  768
            +  +C C     GN YLP GCQGT +
Sbjct  323  SSVTCDCLQGYEGNPYLPQGCQGTQS  348



>emb|CDY01329.1| BnaA07g11020D [Brassica napus]
Length=713

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 64/238 (27%), Positives = 102/238 (43%), Gaps = 39/238 (16%)
 Frame = +1

Query  79   GVREILSIS-NVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNR  255
            G  E+++I+ N    +++  S+  +C+ + G+  G +N      T+L    F   S  NR
Sbjct  68   GGNEVINITHNGELRVLVTRSY--VCYNSQGNQTGRSNRW----TRLGNLTF---SDKNR  118

Query  256  FMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAY  432
            F   GC   A L T G      GC  +C+S   T        C+G  CC  S     N +
Sbjct  119  FTAVGCNTYAFLNTNGVGNYSVGCMSTCNSPRETNGT-----CSGGGCCQTSLPRRNNYF  173

Query  433  QI-------DITDSSIVNNACNYAFFLATGD-DFTTTSSRLSLQRISNLLPEDKLVVPVV  588
            ++        I+  S   N C+YAF +  G  +F ++   ++L+ I+          PVV
Sbjct  174  RVRPYSFSNHISVHSF--NPCSYAFLVEDGMFNFRSSEDLMNLRNITRF--------PVV  223

Query  589  WRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPN--GCQ  756
              WS+ +     +    S +   +  +    +RGT + C CK    GN YL N  GCQ
Sbjct  224  LDWSIGKHSCQQVG---SANICGFNSVCSNSVRGTGYICKCKNGFDGNPYLSNEHGCQ  278



>gb|EMS58067.1| Wall-associated receptor kinase 5 [Triticum urartu]
Length=742

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 65/229 (28%), Positives = 89/229 (39%), Gaps = 17/229 (7%)
 Frame = +1

Query  91   ILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYG  270
            +  IS  R  + +    S +C T++ +   SNN ++     L  TPF  S   NRFM  G
Sbjct  97   VADISLERGEMRVLIPVSYICFTSSATVSASNNNTV--GFGLEDTPFLPSPGRNRFMVIG  154

Query  271  CGGAVLT---TPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQID  441
            C    L      G    +AGC   C  +  + A      C G  CC+ S   ++ A+ + 
Sbjct  155  CNTLGLVGGFRGGTSQYLAGCYSYC--DGASGASDDGAPCTGTGCCEASIPTNLTAFNVA  212

Query  442  --ITDSSIVN-NACNYAFFLATG-DDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTR  609
              I  SS+   N C YA     G   F        L  I+N     K   PV+  W+V R
Sbjct  213  FPINSSSVWGFNPCFYAMVAEVGWYRFQRRDLAGELGFINN---RAKDGAPVIVNWAV-R  268

Query  610  DDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            +        Y+  C            G  + C C     GNAYL NGCQ
Sbjct  269  NGSCLEQRNYA--CVSANSYCESASNGPGYLCHCSPGYEGNAYLNNGCQ  315



>ref|XP_010477387.1| PREDICTED: wall-associated receptor kinase 3-like [Camelina sativa]
Length=747

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/192 (29%), Positives = 76/192 (40%), Gaps = 32/192 (17%)
 Frame = +1

Query  232  FYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCC--D  402
            F  S+ N+F   GC   A+L+T G++    GC   C+     A P    +CNG+ CC  D
Sbjct  118  FSLSATNKFYLVGCNALALLSTFGKQNYSTGCLSLCN-----APPVENGECNGVGCCRTD  172

Query  403  LSFDYDVNAYQI--------------DITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQ  540
            ++   D N +Q                   S    N C YAF +  G  F  +SS+  L+
Sbjct  173  VTVRSDSNIFQYGSDRFVNQFNASEGQFKTSVYQFNPCTYAFLVENGQ-FNFSSSK-DLK  230

Query  541  RISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFL  720
             + NL        PV   WS+          T      R         RG  ++C C   
Sbjct  231  NLRNLTS-----FPVSLDWSIGNKTCKQAGST---SICRENSGCIDSTRGKGYNCKCLEG  282

Query  721  EYGNAYLPNGCQ  756
              GN YLPNGCQ
Sbjct  283  FDGNPYLPNGCQ  294



>gb|AFW85650.1| hypothetical protein ZEAMMB73_166927 [Zea mays]
Length=405

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/279 (24%), Positives = 105/279 (38%), Gaps = 40/279 (14%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C +S S    +   + FSDG   V  +  I  +   + +  S + +C         
Sbjct  76   FELHCNESQSQDGRRSSTAYFSDGDLPV--LADILLLHGQVRVMSSVASMC---------  124

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQE--FTMAGCKLSCSSNNTT  354
             NN S      LSGTPF  +   N F   G     L    ++    + GC L+ S+   T
Sbjct  125  PNNRSTTYLLNLSGTPFTLAEKENMFTVIGVDAIGLMAGSRQSAIYVIGC-LTQSAAPET  183

Query  355  AAPKFAYDCNGINCCDLSFD-----YDVNAYQID------------ITDSSIVNNACNYA  483
              P     C G+ CC ++       +D++  + D            I D       C YA
Sbjct  184  LTPAAQDGCTGVGCCQVALSSKLSYHDISVKEGDTSDDKNSTTSATIDDDDDTRQRCRYA  243

Query  484  FFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV---TRDDLSYLPPTYSRDCD  654
              +  G  F   ++ L+    +    E    VP +  W+V   T D       +Y+  C 
Sbjct  244  MVVEAGR-FKFHAAYLN---STTFWDERDGHVPTILNWAVGNTTCDVARQDAASYA--CR  297

Query  655  RYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQGTSTL  771
              + +      G  + C+C     GN YL +GCQG S +
Sbjct  298  SSDSVCVGSATGLGYLCNCSQGYRGNPYLVDGCQGPSNV  336



>gb|EEE60836.1| hypothetical protein OsJ_14457 [Oryza sativa Japonica Group]
Length=711

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/267 (25%), Positives = 109/267 (41%), Gaps = 32/267 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C  ++ +GV+KPFL        G  E+LSI        ++   S  C+  +   + 
Sbjct  74   FEVDCN-NTGNGVQKPFL--------GYVELLSIDVQLSQARVRTRISSSCYNISTREMN  124

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT--MAGCKLSCSSNNTT  354
             ++L  +    L  TP+ +S S N+F   GC          +    M+GC   C     T
Sbjct  125  FDDLWYVD---LKDTPYRFSDSANKFTIIGCRTLAYIADQDDVGKYMSGCVSVCRRGELT  181

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQI----DITDSSIVNNA-CNYAFFLATGDDFTTT  519
            +       C+G  CC  +    ++ YQ+     +  S I N   C+YA  +   +   +T
Sbjct  182  SL--INGTCSGKGCCQTAIPKGLDYYQVWFEQSMNTSGIYNRTPCSYAVLMEASNFSFST  239

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSV----TRDDLSYLPPTYSRDCDRYEKIFPPQLR  687
            +   S    +N    +    PVV  W++    T ++      +Y+   D  + I      
Sbjct  240  TYLTSPFEFNNTYGGE---APVVLDWAINTANTCEEAMGNLTSYACKSDNAKCINSSDTT  296

Query  688  GTYWSCSCKFLEYGNAYL--PNGCQGT  762
            G  + C C+    GN YL  PNGCQG 
Sbjct  297  G--YICRCQEGYQGNPYLKGPNGCQGV  321



>ref|XP_009618525.1| PREDICTED: wall-associated receptor kinase 1-like [Nicotiana 
tomentosiformis]
Length=747

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 66/245 (27%), Positives = 99/245 (40%), Gaps = 42/245 (17%)
 Frame = +1

Query  79   GVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF-YSSSYNR  255
            G  E+L IS     I +K +F+  C+   G       + I +     G PFF  S   NR
Sbjct  72   GGMEVLDIST--SQIRVKNTFTGSCYEQNGELAERKTMRIDT-----GVPFFTLSDKDNR  124

Query  256  FMFYGCGGAVLTT-----PGQEFTMAGCKLSCS-----SNNTTAAPKFAYDCNGINCCDL  405
                GC    L +      G+ F++ GC  SCS     SN T         C+GI CC  
Sbjct  125  LTLVGCDDLALASGLSLYEGRNFSI-GCITSCSRSVDVSNGT---------CSGIGCCQA  174

Query  406  SFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFT-TTSSRLSLQRISNLLP  561
            +    +  +   +T  S++N       N C YAF L   + FT   +S L+     + + 
Sbjct  175  AIPKGLMTFWGIVT--SMLNHTKVWSFNPCGYAF-LGEHEKFTFRGASDLTDPNFVSRIV  231

Query  562  EDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL  741
            +D   VPVV  W++     S +  + +  C  +      +     + C C+    GN YL
Sbjct  232  KD---VPVVIDWAIGNQSCSEVRNSTAYACKEHSLCIDSESGRGGYRCICEEGYDGNPYL  288

Query  742  PNGCQ  756
              GCQ
Sbjct  289  TPGCQ  293



>ref|XP_010051299.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=856

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/203 (25%), Positives = 81/203 (40%), Gaps = 42/203 (21%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF +S   N F   GC   +L   G+E  + GC+  C+  N T++ K++       
Sbjct  245  LKGSPFVFSQKTNIFTVVGC-NTLLIANGKESAVFGCQSKCAGANFTSS-KYSACSEREG  302

Query  394  CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKL  573
            CC  S   ++  + +D  + S  +  C YAF    G D            + +L P DK 
Sbjct  303  CCQSSVPLNLQGFGVDFEEES-GDEGCKYAFL---GSD----------SGVYDLRPSDK-  347

Query  574  VVPVVWRWSVTRDDLSYLPPTYSRD-------CDRYEKIFPPQLRGTYW-----------  699
             VP +  W +  ++  Y      R        C ++ K    ++ G  +           
Sbjct  348  -VPGMLEWGIA-NNTKYALDLQGRGRYNESFYCTKF-KSLSSEVEGIIYRYRSYSVNSGE  404

Query  700  ----SCSCKFLEYGNAYLPNGCQ  756
                 C C+   +GNAYL  GC+
Sbjct  405  ILSAQCYCRKGYHGNAYLSGGCE  427



>ref|XP_004305856.1| PREDICTED: wall-associated receptor kinase-like 22-like [Fragaria 
vesca subsp. vesca]
Length=756

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 68/265 (26%), Positives = 118/265 (45%), Gaps = 46/265 (17%)
 Frame = +1

Query  25   SSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIIS  204
            +S G  +P+L    +G N   E+L+IS V  ++ ++   +P+   T  +  G  N   ++
Sbjct  70   NSTGSPRPYL----NGTN--LEVLNISVVEGTLRVR---NPI---TFSNCSGKPNRQAVN  117

Query  205  NTKLSGTPFFYSSSYNRFMFYGCG-GAVLTTPGQEFTM-AGCKLSC----SSNNTTAAPK  366
               L G+PF + S  N F   GCG  A +T+     T+ AGC+  C     S N++ +P 
Sbjct  118  ---LEGSPFTFFSQKNMFTAVGCGVMATITSNSNGVTISAGCRSECYASVDSTNSSTSPN  174

Query  367  FAYDCNGINCCDLSFDYDVNAYQIDITDS--SIVNNACNYAFFLATG--DDFTTTSSRLS  534
                CNG++CC       + A+      +  ++  ++C+YAF +     + F  +S+ +S
Sbjct  175  ---TCNGVDCCQTVIPSSLCAFNTSFQQANDNLTKSSCSYAFLVDRDWFESFAKSSTNIS  231

Query  535  LQRISNLLPEDKLVVPVVWRWSV---TRDDL-SYLPPTYSRD----CDRY---EKIFPPQ  681
                      D   VP+V RW++   T D   +++    +RD     D Y          
Sbjct  232  ATG-------DMDQVPIVLRWNLYHSTTDVFGTFIAENVTRDYYDVLDGYCESYSDSSSL  284

Query  682  LRGTYWSCSCKFLEYGNAYLPNGCQ  756
               +   C C++   GN YL  GC+
Sbjct  285  YGSSRLECFCRWGSEGNPYLLQGCR  309



>ref|XP_002302209.2| hypothetical protein POPTR_0002s07670g [Populus trichocarpa]
 gb|EEE81482.2| hypothetical protein POPTR_0002s07670g [Populus trichocarpa]
Length=737

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 60/215 (28%), Positives = 89/215 (41%), Gaps = 33/215 (15%)
 Frame = +1

Query  151  CHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT----MA  318
            C+  AG+   SN   I  N    G P+ +S + N F+  GC         +E      + 
Sbjct  100  CYNRAGAPTESNTPWI--NLPPQG-PYVFSDTDNMFVAIGCDTYAELQGFREDKNDTYVV  156

Query  319  GCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-------NACN  477
            GC   CS  N    P     C+GI CC  S    +  +++ +  SS  N       N C+
Sbjct  157  GCISKCS--NEKYVPN---TCSGIGCCQTSIAKGIKYFEVSL--SSYTNHTGIWEFNPCS  209

Query  478  YAFFLATGDDFTTTSSRLS-LQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPP-TYSRDC  651
            +AF +     F+   S LS L+ +S         VP++  WS+  ++   L     S  C
Sbjct  210  FAFIIEE-KQFSFFPSNLSDLKEVSE--------VPIIVDWSIGHNNCETLEKNKMSNAC  260

Query  652  DRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                K   P+  G+ + C C     GN YLPNGC+
Sbjct  261  QGQSKCHDPE-NGSGYICKCLDGFQGNPYLPNGCR  294



>gb|EAZ23864.1| hypothetical protein OsJ_07580 [Oryza sativa Japonica Group]
Length=725

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 67/274 (24%), Positives = 115/274 (42%), Gaps = 49/274 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAV-  177
            F+++C +S+ DG  + +        N   E++ +S  R  + +  + +P C+  + SA+ 
Sbjct  35   FVLSCNRSA-DGRLRVY--------NYEIEVVDVSVRRGQLRIYSAINPWCYNGSTSAMN  85

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTP----GQEFTMAGCKLSCSS  342
            G +N        +S T F  + + NRF   GC   A + +P    G +  M GC   C  
Sbjct  86   GQSNWWY----DMSITNFRINDALNRFTVVGCNSLAYILSPNGTAGADRYMTGCMAMCPG  141

Query  343  NNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITD----SSIVN-NACNYAFFL-ATGD  504
                   K    C G+ CC  +    +N YQ+   +    S+I   + C+YA  + A+  
Sbjct  142  AGRL--EKENGSCAGVGCCQTAIPAGLNGYQVSFEEKFNTSAIAGFSRCSYAVLVEASAF  199

Query  505  DFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDC--D  654
            DF     R S       +  +   +P+V  W++         R+  +Y   + + +C   
Sbjct  200  DF-----RASYVTTDEFMASNGGQLPLVLDWAIGNKTCEEAKRNASAYACVSANSECVDS  254

Query  655  RYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
            RY        RG  + C+C     GN YL +GCQ
Sbjct  255  RYG-------RGRGYLCNCSAGYDGNPYLLDGCQ  281



>ref|XP_006372237.1| hypothetical protein POPTR_0018s14510g [Populus trichocarpa]
 gb|ERP50034.1| hypothetical protein POPTR_0018s14510g [Populus trichocarpa]
Length=738

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 49/185 (26%), Positives = 80/185 (43%), Gaps = 15/185 (8%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L  TPF +S+  NRF+  GC    L +   E T+ GC   C+ +++ A+      CNGIN
Sbjct  113  LEDTPFSFSTE-NRFVAAGCNNLALLSR-NEATVGGCMSICNVSSSDASADGTI-CNGIN  169

Query  394  CCDLSFDYDVNAYQIDI-TDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
            CC+ +    ++ +   +      V + C YA+ +          +  +L+  +N+   D 
Sbjct  170  CCETTIPSGLDFFNATLQVVGDKVKDGCKYAYLV--------DQNWFNLRLDNNISVIDM  221

Query  571  LVVPVVWRWSVTR---DDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL  741
              VPVV  W +     ++++     YS                T   CSC     GN Y+
Sbjct  222  DYVPVVLNWRINLGLYENMTLNGSAYSVTNLTSSGTSGCIQNSTVLLCSCSSGFEGNPYI  281

Query  742  PNGCQ  756
            P+GCQ
Sbjct  282  PDGCQ  286



>ref|XP_007226334.1| hypothetical protein PRUPE_ppa022257mg, partial [Prunus persica]
 gb|EMJ27533.1| hypothetical protein PRUPE_ppa022257mg, partial [Prunus persica]
Length=663

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 59/191 (31%), Positives = 84/191 (44%), Gaps = 25/191 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+PF +S   NRF    CG   L T     T+AGC   C  ++T+        C G+N
Sbjct  117  LEGSPFVFSMK-NRFTSLSCGEIALMTSLDGSTIAGCLSICDDSSTSYLR--TKSCIGMN  173

Query  394  CCDLSFDYDVNAYQIDITDSSIVNN----ACNYAFFLATGDDFTTTSSRLSLQRISNLLP  561
            CC  +    + ++    T   +V N    AC YA FL   D FT+ S+      +S +  
Sbjct  174  CCQTTITPYLRSFN---TSFGVVLNADRKACKYA-FLVEHDWFTSNST-----NVSAIGE  224

Query  562  EDKLVVPVVWRWSVTRDDLSYLP-PTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAY  738
             D   VP+V  W V   DL+Y     Y  +  R +K        +   C C    +GN Y
Sbjct  225  MD--YVPMVLEWHVL--DLNYTKFDIYGTNNWRDDK----STDCSSSQCFCSKGHHGNPY  276

Query  739  LPNGCQGTSTL  771
            L +GCQ  S++
Sbjct  277  LLHGCQVPSSV  287



>ref|XP_010539154.1| PREDICTED: wall-associated receptor kinase 2-like [Tarenaya hassleriana]
Length=742

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 70/258 (27%), Positives = 111/258 (43%), Gaps = 35/258 (14%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C ++     +K FL      + G  ++L+IS+     ++ E  S LC+        
Sbjct  55   FLITCNETE----QKAFL------RGGNIQVLNISHDGGLRVLLEK-SSLCNNC------  97

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA  357
            + N +++   +     F  S + N+F   GC   A LT  G +    GC   C+S+N   
Sbjct  98   NTNTTLLHRFEFFLASFTLSYTKNKFTAVGCDTYAYLTGTGDDDYSTGCMSVCNSDNAFQ  157

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDI----TDSSIVN-NACNYAFFLATGDDFTTTS  522
                +  C+GI CC +     VN ++I        S++ N N C+YAF +  G  F   +
Sbjct  158  VQNGS--CSGIGCCQIPIPRKVNRFRILPRSFNNHSTVCNFNPCSYAFIVEDG-FFNFWA  214

Query  523  SRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS  702
            SR  L+ + N+        PVV  WS+       +  T    C +  K      RG  ++
Sbjct  215  SR-DLKDLGNVTE-----FPVVLDWSIGNKTCDNVGDTSL--CSQNSKCVNSA-RGQGYT  265

Query  703  CSCKFLEYGNAYLPNGCQ  756
            C C     GN YL +GC+
Sbjct  266  CQCLPGFDGNPYLHSGCK  283



>ref|XP_010049240.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=729

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 56/212 (26%), Positives = 82/212 (39%), Gaps = 30/212 (14%)
 Frame = +1

Query  145  PLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGC  324
            P+ ++TA S  G    +++S   L G+PF +S + N F   GC   V T    +  + GC
Sbjct  111  PVFYSTA-SGRGDGRRAMVS---LIGSPFVFSQTRNIFTVVGCNAQV-TVKSTKSAVFGC  165

Query  325  KLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGD  504
            +  C   N T +  ++       CC  S  +++  + +D  + S  +  C YAF    G 
Sbjct  166  RSKCVGANFTNS-NYSACSESEGCCQSSLPFNLQGFDVDFKEES-GDEGCKYAFL---GS  220

Query  505  DFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRD-----DL---SYLPPTYSRDCDRY  660
            D      R S              VP V  W++  +     DL    Y     S  C RY
Sbjct  221  DSAVYDLRSS------------DTVPGVLEWAIANNTDYALDLFKQGYYIVNKSFSCTRY  268

Query  661  EKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                       Y  C C     GNAYL  GC+
Sbjct  269  RSDSLGSGEILYAQCHCGTGYRGNAYLIGGCK  300



>gb|EAZ25016.1| hypothetical protein OsJ_08797 [Oryza sativa Japonica Group]
Length=735

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 94/237 (40%), Gaps = 34/237 (14%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            E LS+++    I    S S   H+T G  V +N++  +   +    P+ +SS+ NRF+  
Sbjct  70   ESLSLADGEARIYNNASRSLYNHST-GDLVRTNDVVYLFLGREG--PYRFSSAKNRFVAL  126

Query  268  GCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDIT  447
            GC    L     E  + GC   C S+    +   A  C G+ CC  S    ++ Y ++  
Sbjct  127  GCPNLGLLLDATENYVTGCISLCRSSPLAVS---AGACAGVGCCQSSIPSGLHTYYVNQD  183

Query  448  DSSIVN----NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV----  603
                V      A +Y +      ++ +TS R    R  +        VPVV  W++    
Sbjct  184  KPKNVTLQYYAATDYRYVFLADAEWLSTSYRGDFNRTGD------FAVPVVLDWAIREVG  237

Query  604  -----TRDDLSYLPPTYSRDC-DRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                  R+   Y   + + DC D  E        G  + C+C     GN YL  GCQ
Sbjct  238  SCEAAMRNKADYACRSANSDCVDSTE--------GEGYRCNCSRGYEGNPYLDGGCQ  286



>ref|XP_010235726.1| PREDICTED: wall-associated receptor kinase 2-like [Brachypodium 
distachyon]
Length=756

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 61/257 (24%), Positives = 92/257 (36%), Gaps = 30/257 (12%)
 Frame = +1

Query  25   SSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIIS  204
            ++DG+ KPF           +EILS+S  R    ++    P C+     ++       I 
Sbjct  67   TADGIYKPFCYE--------QEILSVSVARGKARVRTDIQPWCYNGTSRSMDPQFAPWID  118

Query  205  NTKLSGTPFFYSSSYNRFMFYGCG--GAVLTTPGQEFT-----MAGCKLSCSSNNTTAAP  363
                S + F  S   NRF   GC     V +  G +FT     M GC  +C         
Sbjct  119  ---FSDSSFMLSDEENRFTVVGCNSLAYVSSMEGSQFTNGYEYMTGCMATCPGGGRVENG  175

Query  364  KFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNA----CNYAFFL-ATGDDFTTTSSR  528
                 C+G+ CC  +    VN YQ     S     +    C+YA  + A   DF T    
Sbjct  176  ----SCSGMGCCQAAIPRGVNTYQEKFNTSRAAAGSSSGPCSYAVLVEAAAFDFRT--GY  229

Query  529  LSLQRISNLLPEDKLVVPVVWRWSVTRDD-LSYLPPTYSRDCDRYEKIFPPQLRGTYWSC  705
            ++       +      VP+V  W V ++  L       +  C            G  + C
Sbjct  230  VAADGGGGFMESTGGTVPLVLDWVVGKETCLEAKRNASASACVSGNSACVDSRNGPGYLC  289

Query  706  SCKFLEYGNAYLPNGCQ  756
            +C     GN  L +GC+
Sbjct  290  NCSIGYRGNPCLLDGCR  306



>emb|CAD40714.2| OSJNBb0042I07.11 [Oryza sativa Japonica Group]
 emb|CAH66677.1| OSIGBa0107E14.7 [Oryza sativa Indica Group]
Length=771

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 66/266 (25%), Positives = 109/266 (41%), Gaps = 32/266 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F ++C  ++ +GV+KPFL        G  E+LSI        ++   S  C+  +   + 
Sbjct  74   FEVDCN-NTGNGVQKPFL--------GYVELLSIDVQLSQARVRTRISSSCYNISTREMN  124

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT--MAGCKLSCSSNNTT  354
             ++L  +    L  TP+ +S S N+F   GC          +    M+GC   C     T
Sbjct  125  FDDLWYVD---LKDTPYRFSDSANKFTIIGCRTLAYIADQDDVGKYMSGCVSVCRRGELT  181

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQI----DITDSSIVNNA-CNYAFFLATGDDFTTT  519
            +       C+G  CC  +    ++ YQ+     +  S I N   C+YA  +   +   +T
Sbjct  182  SL--INGTCSGKGCCQTAIPKGLDYYQVWFEQSMNTSGIYNRTPCSYAVLMEASNFSFST  239

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSV----TRDDLSYLPPTYSRDCDRYEKIFPPQLR  687
            +   S    +N    +    PVV  W++    T ++      +Y+   D  + I      
Sbjct  240  TYLTSPFEFNNTYGGE---APVVLDWAINTANTCEEAMGNLTSYACKSDNAKCINSSDTT  296

Query  688  GTYWSCSCKFLEYGNAYL--PNGCQG  759
            G  + C C+    GN YL  PNGCQG
Sbjct  297  G--YICRCQEGYQGNPYLKGPNGCQG  320



>gb|EAY83890.1| hypothetical protein OsI_39112 [Oryza sativa Indica Group]
Length=592

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 81/195 (42%), Gaps = 25/195 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGC------GGAVLTTPGQEFTMAGCKLSCSSNNTTA--APKF  369
            L GTPF  S++ NRFM  GC      GG + +       +AGC   C S N+T+  AP  
Sbjct  148  LEGTPFVPSTTRNRFMAIGCHTLGIIGGYMHSN--SNLYVAGCYSYCQSINSTSNGAP--  203

Query  370  AYDCNGINCCDLSFDYDVNAY-QIDITDSSIV--NNACNYAFFLATGDDFTTTSSRLSLQ  540
               C G+ CC+ +   D+  +  I + + S V   N C YA  +  G         +   
Sbjct  204  ---CTGMGCCETTIIPDLKDFAAILVMNQSAVWEFNPCFYAMLVEAGWYSFRQQDLVGHL  260

Query  541  RISNLLPEDKLVVPVVWRWSVTRD---DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSC  711
            R  N        VPV+  W++      +   +P  Y+      + +     +G  + C C
Sbjct  261  RFVN--GRANRGVPVIHDWAIRNGSCPEGKKVPKDYACVSSNSKCVQASNSQG--YLCKC  316

Query  712  KFLEYGNAYLPNGCQ  756
                 GN YLP GCQ
Sbjct  317  SEGYEGNPYLPKGCQ  331



>ref|XP_007217301.1| hypothetical protein PRUPE_ppa018696mg, partial [Prunus persica]
 gb|EMJ18500.1| hypothetical protein PRUPE_ppa018696mg, partial [Prunus persica]
Length=725

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/210 (26%), Positives = 88/210 (42%), Gaps = 33/210 (16%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F I+C +S+     KPFL      +    E+L+IS +  ++ +K   SP+   +     G
Sbjct  50   FQIDCNESTG---HKPFL------RRAQMEVLNIS-IDGTLQVK---SPVTFFS-----G  91

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
                       L+G+PF Y    N F    C G + T    E    GC  +C   +T +A
Sbjct  92   CKGKETRQAPNLTGSPFVYLDRKNMFTAVSC-GRLATMRSDENVFHGCNSTCDDQSTDSA  150

Query  361  PKFAYDCNGI--NCCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLS  534
                Y C  I  NCC  +   ++  +  +I     +   CNYAF +         SS  +
Sbjct  151  ---TYRCGTIGNNCCQTTIPPNIGVFTTEIQPRDQL-EGCNYAFLVDQDWFLKNLSSYRA  206

Query  535  LQRISNLLPEDKLVVPVVWRWSVTRDDLSY  624
            +Q + +        VPVV  W+++ D+ S+
Sbjct  207  IQGMDS--------VPVVLEWNISLDNTSH  228



>ref|XP_002527556.1| kinase, putative [Ricinus communis]
 gb|EEF34808.1| kinase, putative [Ricinus communis]
Length=739

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 73/191 (38%), Gaps = 20/191 (10%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L   PF +S S N+    GC    L    +E   +GC   CSS  T         C+G  
Sbjct  127  LGSGPFRFSDSRNKLTTIGCDTLALMEDKEETFGSGCISFCSSKITLEG-----SCSGFG  181

Query  394  CCDLSFDYDVNAYQIDIT----DSSIVN-NACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            CC       +    ID+      S ++N N C +AF LA    F  +  +LS    S  +
Sbjct  182  CCQTPIPKSIKTLSIDLQSPNNHSKVLNFNPCEFAF-LADERTFNVSDLQLSDIPFSAAI  240

Query  559  PEDKLVVPVVWRWSVTRD-----DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLE  723
             E  +   VV  W V  +       S  P  Y+  C            G  + CSCK   
Sbjct  241  NES-VKSDVVIEWVVREETCETAQSSSNPNGYA--CGSNTNCLYSD-NGNGYRCSCKDGF  296

Query  724  YGNAYLPNGCQ  756
             GN YLP GCQ
Sbjct  297  KGNPYLPQGCQ  307



>ref|XP_010277680.1| PREDICTED: wall-associated receptor kinase 2-like [Nelumbo nucifera]
Length=1088

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 54/187 (29%), Positives = 80/187 (43%), Gaps = 19/187 (10%)
 Frame = +1

Query  229  FFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDL  405
            + +S++ NRF   GC   AVLT  G  F + GC  SC      A       C+GI CC  
Sbjct  471  YRFSNTQNRFTVVGCNMLAVLTDYGDSFHI-GCITSCP----YAIESMKLPCDGIGCCQT  525

Query  406  SFDYDVNAYQIDI---------TDSSIVNNACNYAFFLATGDDFTTTSSRL-SLQRISNL  555
            +    +NA+ I +         TDSS ++  C  AF L+  + F++ +S L +L+     
Sbjct  526  AVPKGLNAFVIQLRMYDNRSSYTDSSKISR-CGLAF-LSDLEWFSSNASYLWNLKNNVEY  583

Query  556  LPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNA  735
            +     + PVV  W++               C +          G  + C C    +GN 
Sbjct  584  VINIGSLTPVVLDWAIRNKTCGEAQRMADYACGK-NTYCTNSTNGPGYLCHCIKGYHGNP  642

Query  736  YLPNGCQ  756
            YLPNGCQ
Sbjct  643  YLPNGCQ  649



>ref|XP_010050674.1| PREDICTED: wall-associated receptor kinase 2-like [Eucalyptus 
grandis]
Length=399

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 105/269 (39%), Gaps = 47/269 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C    +D  + P    +S   N    +L IS     I +    +  C+ ++G+   
Sbjct  71   FLIFC----NDSTDPPTPHMYSKDSN--FRVLDISMESHEISVTVFVAKDCYNSSGT---  121

Query  181  SNNLSIISNTKLSGTPFF-YSSSYNRFMFYGCGGAVLTTPGQEFT-MAGCKLSCSSNNTT  354
                SI +N      P F  SS+ N+F+  GC      +  Q  T M GC  SC +    
Sbjct  122  ----SIYNNDPEFALPIFPISSAKNKFIAVGCDTYATFSGRQGSTYMTGCVSSCDN----  173

Query  355  AAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSS----IVN-NACNYAFFLATGDDFTTT  519
                    C+GI CC+     D   Y I +T  +    I + N C YAF     D F + 
Sbjct  174  VLDVINGSCSGIGCCETGIPRDAYRYNISVTSYNNHLGITDFNPCGYAF--VAQDGFFSF  231

Query  520  SSRLSLQRISNLLPEDKLVVPVVWRWSV---TRDDLSYLPPTY----SRDCDRYEKIFPP  678
            S+        NL      +VP+V  W +   T DD      TY    + +C   E     
Sbjct  232  ST-------DNLREPPFDMVPLVVDWLIPNQTCDDAKKNATTYMCQENSNCTDAEN----  280

Query  679  QLRGTYWSCSCKFLEYGNAYLPNGCQGTS  765
               G  + C C     GN YL NGCQG S
Sbjct  281  ---GNGYQCHCLKGFQGNPYLQNGCQGMS  306



>dbj|BAD19239.1| putative wall-associated serine/threonine kinase [Oryza sativa 
Japonica Group]
 dbj|BAH01123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=756

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 60/237 (25%), Positives = 94/237 (40%), Gaps = 34/237 (14%)
 Frame = +1

Query  88   EILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFY  267
            E LS+++    I    S S   H+T G  V +N++  +   +    P+ +SS+ NRF+  
Sbjct  91   ESLSLADGEARIYNNASRSLYNHST-GDLVRTNDVVYLFLGREG--PYRFSSAKNRFVAL  147

Query  268  GCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDIT  447
            GC    L     E  + GC   C S+    +   A  C G+ CC  S    ++ Y ++  
Sbjct  148  GCPNLGLLLDATENYVTGCISLCRSSPLAVS---AGACAGVGCCQSSIPSGLHTYYVNQD  204

Query  448  DSSIVN----NACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV----  603
                V      A +Y +      ++ +TS R    R  +        VPVV  W++    
Sbjct  205  KPKNVTLQYYAATDYRYVFLADAEWLSTSYRGDFNRTGD------FAVPVVLDWAIREVG  258

Query  604  -----TRDDLSYLPPTYSRDC-DRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                  R+   Y   + + DC D  E        G  + C+C     GN YL  GCQ
Sbjct  259  SCEAAMRNKADYACRSANSDCVDSTE--------GEGYRCNCSRGYEGNPYLDGGCQ  307



>ref|XP_010038779.1| PREDICTED: wall-associated receptor kinase-like 1 [Eucalyptus 
grandis]
Length=724

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 55/200 (28%), Positives = 83/200 (42%), Gaps = 41/200 (21%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+ F +S ++N F+  GC    +     E  + GC+ SC+  NT+ +   A  C+G +
Sbjct  116  LEGSQFIFSQTWNVFISVGCNTLAIVN-STESDVVGCRSSCAGTNTSVSMYNA--CSGRD  172

Query  394  -CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
             CC  +  +++  + +   D       C YAF LA    F  ++       I++L   D 
Sbjct  173  GCCQSTLPFNLQFFSVVFKDERGPQEGCKYAF-LADRTWFLRSN-------ITDLSFND-  223

Query  571  LVVPVVWRWSVTR------------DDLSYLPPTYSRDCDRYEKIFPPQLRGTYWS----  702
             +VPVV  W ++             +   YL P     C RY       L G+Y S    
Sbjct  224  -MVPVVLEWGISNKTEYGLKLFQQANGSGYLDPF---RCTRY------NLYGSYTSEMPF  273

Query  703  --CSCKFLEYGNAYLPNGCQ  756
              C C     GN YL  GCQ
Sbjct  274  VQCFCSSGYRGNPYLTEGCQ  293



>ref|XP_006416836.1| hypothetical protein EUTSA_v10006974mg [Eutrema salsugineum]
 gb|ESQ35189.1| hypothetical protein EUTSA_v10006974mg [Eutrema salsugineum]
Length=692

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 81/211 (38%), Gaps = 29/211 (14%)
 Frame = +1

Query  139  FSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMA  318
             SPL H+   S V  ++ S      L+G+PFF S   N+F   GC    L   G    + 
Sbjct  72   LSPLKHSGCSSTVVGDSPSF----NLTGSPFFISDK-NKFTAVGCNNKALMK-GTGLQIV  125

Query  319  GCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAF---F  489
            GC+ +C +   +    +   C G  CC  S   ++  +   +       + C  A+   F
Sbjct  126  GCEATCRNETQSYQDDYG-GCLGYKCCQTSIPPNLQLFNATLEKLEPSKDGCQVAYLSQF  184

Query  490  LATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKI  669
               G  FT              LPE    + +   W   R DL  L  +    C   E I
Sbjct  185  NLQGYMFTAPQ-----------LPEYGAYMRMELEW---RSDL--LSSSSGASCWLSESI  228

Query  670  FPPQLRGTYWS--CSCKFLEYGNAYLPNGCQ  756
                LRG ++   CSC     GN Y+P GCQ
Sbjct  229  -NVALRGDHYMYLCSCDSGYEGNPYIPGGCQ  258



>ref|XP_006648849.1| PREDICTED: wall-associated receptor kinase 5-like [Oryza brachyantha]
Length=767

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 65/272 (24%), Positives = 109/272 (40%), Gaps = 47/272 (17%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAV-  177
            F+++C +S+ DG  + +        N   E++ +S  R  + +    +P C+  + +A+ 
Sbjct  64   FVLSCNRSA-DGRLRLY--------NYQIEVVDMSVRRGQLRIYSVINPWCYNASTAAMN  114

Query  178  GSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLT-----TPGQEFTMAGCKLSCSS  342
            G NN        +S T F  + + NRF   GC           T G E  M GC   C  
Sbjct  115  GQNNWWY----DMSITNFRINDALNRFTVVGCNSLAYILSLNDTAGAERYMTGCMAMCPG  170

Query  343  NNTTAAPKFAYDCNGINCCDLSFDYDVNAYQIDITD----SSIVN-NACNYAFFL-ATGD  504
                        C G+ CC  +    +N YQ+   +    S I   + C+YA  + A+  
Sbjct  171  VGRLENG----SCAGVGCCQTAIPGGLNGYQVSFEEKFNTSGIAGFSPCSYALLVEASAF  226

Query  505  DFTTTSSRLSLQRISNLLPEDKLVVPVVWRWSV--------TRDDLSYLPPTYSRDCDRY  660
            DF     R +      L+  +   +P+V  W++         RD  +Y   + + +C   
Sbjct  227  DF-----RTAYVTSDELMTANGGQLPLVLDWAIGNKTCAEAQRDASAYACVSANSEC---  278

Query  661  EKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
              +     RG  + C+C     GN YL +GCQ
Sbjct  279  --VDSKYGRGRGYLCNCSAGYDGNPYLLDGCQ  308



>ref|XP_010051290.1| PREDICTED: LOW QUALITY PROTEIN: wall-associated receptor kinase-like 
6 [Eucalyptus grandis]
Length=940

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/200 (25%), Positives = 79/200 (40%), Gaps = 38/200 (19%)
 Frame = +1

Query  202  SNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDC  381
            +   L G+ F +S   N F   GC   + T    +  + GC+  C+  NT+ +  +  DC
Sbjct  110  AGVSLKGSQFVFSQKRNVFTLVGCN-TLATVDTTKSAVVGCRSRCAGTNTSIS--WNGDC  166

Query  382  NGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            +  + CC      ++  + +D  + S  +  C YAF  +   DFT          + +L 
Sbjct  167  SRRDGCCQTELPINLQGFSVDFKEES-GHQGCKYAFLRS---DFTG---------LYDLK  213

Query  559  PEDKLVVPVVWRWSVTRD-----------DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSC  705
              +   VPVV  W +  D           D SY     +R+ D  E +F          C
Sbjct  214  VNE--TVPVVLEWGIANDTDYGRELIRQSDTSYPSVCSTRNVDNSEMLFT--------QC  263

Query  706  SCKFLEYGNAYLPNGCQGTS  765
             C     G+ YL  GC+G +
Sbjct  264  YCTREYGGSPYLMEGCKGAA  283



>gb|ABA99844.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ21218.1| hypothetical protein OsJ_36871 [Oryza sativa Japonica Group]
Length=783

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 81/195 (42%), Gaps = 25/195 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGC------GGAVLTTPGQEFTMAGCKLSCSSNNTTA--APKF  369
            L GTPF  S++ NRFM  GC      GG + +       +AGC   C S N+T+  AP  
Sbjct  148  LEGTPFVPSTTRNRFMAIGCHTLGIIGGYMHSN--SNLYVAGCYSYCQSINSTSNGAP--  203

Query  370  AYDCNGINCCDLSFDYDVNAY-QIDITDSSIV--NNACNYAFFLATGDDFTTTSSRLSLQ  540
               C G+ CC+ +   D+  +  I + + S V   N C YA  +  G         +   
Sbjct  204  ---CTGMGCCETTIIPDLKDFAAILVMNQSAVWEFNPCFYAMLVEAGWYSFRQQDLVGHL  260

Query  541  RISNLLPEDKLVVPVVWRWSVTRD---DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSC  711
            R  N        VPV+  W++      +   +P  Y+      + +     +G  + C C
Sbjct  261  RFVN--GRANRGVPVIHDWAIRNGSCPEGKKVPKDYACVSSNSKCVQASNSQG--YLCKC  316

Query  712  KFLEYGNAYLPNGCQ  756
                 GN YLP GCQ
Sbjct  317  SEGYEGNPYLPKGCQ  331



>ref|NP_001177061.1| Os12g0615000 [Oryza sativa Japonica Group]
 dbj|BAH95789.1| Os12g0615000 [Oryza sativa Japonica Group]
Length=748

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 55/195 (28%), Positives = 81/195 (42%), Gaps = 25/195 (13%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGC------GGAVLTTPGQEFTMAGCKLSCSSNNTTA--APKF  369
            L GTPF  S++ NRFM  GC      GG + +       +AGC   C S N+T+  AP  
Sbjct  113  LEGTPFVPSTTRNRFMAIGCHTLGIIGGYMHSN--SNLYVAGCYSYCQSINSTSNGAP--  168

Query  370  AYDCNGINCCDLSFDYDVNAY-QIDITDSSIV--NNACNYAFFLATGDDFTTTSSRLSLQ  540
               C G+ CC+ +   D+  +  I + + S V   N C YA  +  G         +   
Sbjct  169  ---CTGMGCCETTIIPDLKDFAAILVMNQSAVWEFNPCFYAMLVEAGWYSFRQQDLVGHL  225

Query  541  RISNLLPEDKLVVPVVWRWSVTRD---DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSC  711
            R  N        VPV+  W++      +   +P  Y+      + +     +G  + C C
Sbjct  226  RFVN--GRANRGVPVIHDWAIRNGSCPEGKKVPKDYACVSSNSKCVQASNSQG--YLCKC  281

Query  712  KFLEYGNAYLPNGCQ  756
                 GN YLP GCQ
Sbjct  282  SEGYEGNPYLPKGCQ  296



>emb|CBI31042.3| unnamed protein product [Vitis vinifera]
Length=893

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 49/184 (27%), Positives = 76/184 (41%), Gaps = 13/184 (7%)
 Frame = +1

Query  229  FFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDL  405
            F YS ++N F+  GC   A +T         GC   C+++N  AA   +  C+GI CC  
Sbjct  118  FSYSYTHNTFVAIGCDIFAYITGYNSTAYATGCASLCNTDNDIAAGFSSSACSGIGCCRT  177

Query  406  SFDYDVNAYQIDITDSSIV-----NNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
                D+  + + I   +++     +  C  AF      +F+T    L    +S+   +  
Sbjct  178  YLQTDIAHFYLRIRSINMITPTWSSEPCGLAFIAER--NFST----LEHFNLSSKFDKKL  231

Query  571  LVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNG  750
              VP V  WSV            +  C +        ++G  ++C C     GN YL NG
Sbjct  232  YFVPAVLDWSVGEVSCHEAIRRKNYACGQ-NTYCNNSIQGRGYNCHCLNGYQGNPYLANG  290

Query  751  CQGT  762
            CQGT
Sbjct  291  CQGT  294



>ref|NP_001062164.2| Os08g0501500 [Oryza sativa Japonica Group]
 dbj|BAF24078.2| Os08g0501500 [Oryza sativa Japonica Group]
Length=748

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 57/239 (24%), Positives = 92/239 (38%), Gaps = 23/239 (10%)
 Frame = +1

Query  76   NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNT---KLSGTPFFYSSS  246
            +G  E+L IS    ++ +  S      T++    GS N +   +T      G PFF S  
Sbjct  72   DGSVEVLEISIPSGTVRINSSSIVPVSTSSAVGTGSVNKTGKYHTWGGLRKGGPFFISPY  131

Query  247  YNRFMFYGCGGA-VLTTPGQEFTMAGCKLSCSSNNTTAAP---KFAYDCNGINCCDLSFD  414
             N+F+   C    VL   G   T+  C   C        P       +C+GI CC  +  
Sbjct  132  KNKFLVLSCSNVQVLLLGGDNSTVNACATYCPPAPKKGQPFQFPMRNECSGIGCCSAAIP  191

Query  415  YDVNAYQIDITDSSIVNN-ACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVW  591
                +Y I I  ++ ++      + ++A    +  T  RL  + +S L        P + 
Sbjct  192  KGYTSYSIQIQPANEISEFDAESSVYIAEEGSYNAT--RLIFETVSAL--------PALL  241

Query  592  RWSVTRD----DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
             W+++        S  P    R  + Y + +   +   Y  C C     GN Y+PNGCQ
Sbjct  242  DWAISNSTCGTKPSAAPAPACRSSNSYCQNYTSYVYNGY-QCRCNAGYQGNPYIPNGCQ  299



>dbj|BAD08904.1| putative wall-associated serine/threonine kinase [Oryza sativa 
Japonica Group]
Length=746

 Score = 50.8 bits (120),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 57/239 (24%), Positives = 92/239 (38%), Gaps = 23/239 (10%)
 Frame = +1

Query  76   NGVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNT---KLSGTPFFYSSS  246
            +G  E+L IS    ++ +  S      T++    GS N +   +T      G PFF S  
Sbjct  70   DGSVEVLEISIPSGTVRINSSSIVPVSTSSAVGTGSVNKTGKYHTWGGLRKGGPFFISPY  129

Query  247  YNRFMFYGCGGA-VLTTPGQEFTMAGCKLSCSSNNTTAAP---KFAYDCNGINCCDLSFD  414
             N+F+   C    VL   G   T+  C   C        P       +C+GI CC  +  
Sbjct  130  KNKFLVLSCSNVQVLLLGGDNSTVNACATYCPPAPKKGQPFQFPMRNECSGIGCCSAAIP  189

Query  415  YDVNAYQIDITDSSIVNN-ACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDKLVVPVVW  591
                +Y I I  ++ ++      + ++A    +  T  RL  + +S L        P + 
Sbjct  190  KGYTSYSIQIQPANEISEFDAESSVYIAEEGSYNAT--RLIFETVSAL--------PALL  239

Query  592  RWSVTRD----DLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
             W+++        S  P    R  + Y + +   +   Y  C C     GN Y+PNGCQ
Sbjct  240  DWAISNSTCGTKPSAAPAPACRSSNSYCQNYTSYVYNGY-QCRCNAGYQGNPYIPNGCQ  297



>ref|XP_010042183.1| PREDICTED: wall-associated receptor kinase 2-like, partial [Eucalyptus 
grandis]
Length=300

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 75/265 (28%), Positives = 105/265 (40%), Gaps = 48/265 (18%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            FLI C    +D  + P    +S   N    +L IS     I +    +  C+T++G+ + 
Sbjct  71   FLIFC----NDSTDPPTPRMYSKDSN--FRVLDISMENHEISVTVFVAKDCYTSSGTFLR  124

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAA  360
             N+         S   F  SS+ N+F+  GC     T  G  + + GC  SC S      
Sbjct  125  KNH------PHFSLPKFPISSAKNKFIAVGCD-TYATFSGSTY-VTGCLSSCHS----VL  172

Query  361  PKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-----NACNYAFFLATG-DDFTTTS  522
                  C+GI CC+ S   D   Y I +T  +        N C YAF    G  +F+T +
Sbjct  173  DVINGSCSGIGCCETSIPRDAYRYNISVTSYNNHRGISEFNPCGYAFVAQDGFFNFSTDN  232

Query  523  SRLSLQRISNLLPEDKLVVPVVWRWSV---TRDDLSYLPPTY----SRDCDRYEKIFPPQ  681
             R          P D  +VP+V  W +   T DD      TY    + +C   E      
Sbjct  233  LREP--------PFD--MVPLVVDWLIPNKTCDDAKKNTATYMCQENSNCTDAEN-----  277

Query  682  LRGTYWSCSCKFLEYGNAYLPNGCQ  756
              G  + C C     GNAYL NGCQ
Sbjct  278  --GKGYQCHCLKGFQGNAYLQNGCQ  300



>ref|XP_006416322.1| hypothetical protein EUTSA_v10009893mg, partial [Eutrema salsugineum]
 gb|ESQ34675.1| hypothetical protein EUTSA_v10009893mg, partial [Eutrema salsugineum]
Length=828

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 101/235 (43%), Gaps = 33/235 (14%)
 Frame = +1

Query  79   GVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFFYSSSYNRF  258
            G  E+++IS +   + +  + S +C+   G+ +   N      ++L    F   S  NRF
Sbjct  69   GGNEVINIS-LSGELRVLNTRSYVCYNIQGNQISRQN----RWSRLGNLTF---SDKNRF  120

Query  259  MFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGINCCDLSFDYDVNAYQ  435
               GC   A L T G      GC  +C+S   T        C+G  CC  S     N ++
Sbjct  121  TAVGCNTYAFLNTNGVGNYSTGCMSTCNSPRETNG-----SCSGGGCCQTSVPRGSNYFR  175

Query  436  ID---ITDSSIVN--NACNYAFFLATGD-DFTTTSSRLSLQRISNLLPEDKLVVPVVWRW  597
            +     ++ + V+  N C+YAF +  G  +F++T   ++L+ I+          PVV  W
Sbjct  176  VSPYSFSNHTSVHSFNPCSYAFLVEDGVFNFSSTEDLMNLRNITRF--------PVVLDW  227

Query  598  SVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL--PNGCQ  756
            S+ ++         +    R   +    +RGT + C CK    GN YL   NGCQ
Sbjct  228  SIGKESCE---QAGNASICRGNSVCSDSVRGTGYICKCKKGFDGNPYLSNENGCQ  279



>ref|XP_008225623.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103325247 
[Prunus mume]
Length=1493

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 81/203 (40%), Gaps = 34/203 (17%)
 Frame = +1

Query  205   NTKLSGTP-------FFYSSSYNRFMFYGCGGAVL--TTPGQEFTMAGCKLSCSSNNTTA  357
             +TKLS TP       +  S + N+F+  GC    +     G+E  + GC   C S  + +
Sbjct  842   DTKLSNTPRLKLFPPYTISGTKNKFIAVGCDTYAIFEGVRGKEKYITGCMTFCESLGSIS  901

Query  358   APKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFTT  516
                    C+GI CC  S    +    +  T SS  N       N C+Y+F +  G    +
Sbjct  902   E-----SCSGIGCCQTSIPSGLQVRTV--TMSSYYNHTFIWDFNPCSYSFIVEEGQFTFS  954

Query  517   TSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEK-IFPPQLRGT  693
             + S   L+ IS L        P+V  W++  +            C      + P  L G 
Sbjct  955   SKSFQELKSISRL--------PMVLNWAIGDEPCDAAQHRQDYACKGNSTCVNPLNLSGY  1006

Query  694   YWSCSCKFLEYGNAYLPNGCQGT  762
             +  C C     GN YLP+GCQ T
Sbjct  1007  F--CECLPGYEGNPYLPDGCQDT  1027



>ref|XP_009766020.1| PREDICTED: wall-associated receptor kinase 1-like [Nicotiana 
sylvestris]
Length=750

 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 65/245 (27%), Positives = 99/245 (40%), Gaps = 42/245 (17%)
 Frame = +1

Query  79   GVREILSISNVRQSIIMKESFSPLCHTTAGSAVGSNNLSIISNTKLSGTPFF-YSSSYNR  255
            G  E+L IS  +  I ++ +F+  C+   G       + I +     G PFF  S   NR
Sbjct  75   GGMEVLDISTSQ--IRVRNTFTGSCYEQNGELAERKTMRIDT-----GVPFFTLSDKDNR  127

Query  256  FMFYGCGGAVLTT-----PGQEFTMAGCKLSCS-----SNNTTAAPKFAYDCNGINCCDL  405
                GC    L +      G+ F++ GC  SCS     SN T         C+GI CC  
Sbjct  128  LTLVGCDDLALASGLSLYEGRNFSI-GCITSCSRSVDVSNGT---------CSGIGCCQA  177

Query  406  SFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFT-TTSSRLSLQRISNLLP  561
            +    +  +   +T  S++N       N C YAF L   + FT   +S L+     + + 
Sbjct  178  AIPKGLMTFWGIVT--SMLNHTKVWSFNPCGYAF-LGEHEKFTFRGASDLTDPNFVSRIV  234

Query  562  EDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLEYGNAYL  741
            +D   VPVV  W +     S +  + +  C  +      +     + C C+    GN YL
Sbjct  235  KD---VPVVIDWQIGNQSCSEVRNSTAYSCKEHSLCIDSESGRGGYRCICEEGYDGNPYL  291

Query  742  PNGCQ  756
              GCQ
Sbjct  292  TPGCQ  296



>ref|XP_004486489.1| PREDICTED: wall-associated receptor kinase-like 8-like [Cicer 
arietinum]
Length=725

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 63/263 (24%), Positives = 106/263 (40%), Gaps = 32/263 (12%)
 Frame = +1

Query  1    FLINCTKSSSDGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTAGSAVG  180
            F + C   ++  +EKP+L S +         L ++    +  + E  +P+ H+       
Sbjct  64   FEVECKLDNTSHIEKPYLKSLN---------LEVTLFDVNSALVEIMNPIYHSNCKKNNN  114

Query  181  SNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTA  357
            +NN   +    L  +PF YS  YN F+  GC   A L + G   T+ GC   C  NN   
Sbjct  115  NNNNKTVV-INLKDSPFIYSQQYNTFLAVGCNNLAFLQSNGT--TVGGCVSICEDNNNNF  171

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDIT---DSSIVNNACNYA-----FFLATGDDFT  513
              + +  CNG  CC+ S    +  Y   +      S  ++ C+YA     F+ +    F 
Sbjct  172  NLE-SRSCNGRYCCETSLPMHLAEYNATLQGLRKESSDHDECSYALIASDFWFSFDWSFM  230

Query  514  TTSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRY---EKIFPPQL  684
            T S    +++++NL  ++    P +  W +  +   ++  T+    D      K      
Sbjct  231  TDS---EIEKMNNL--KNMEYAPGILEWEILNE--MFVNSTFQIPSDSVCYDSKRTSLTN  283

Query  685  RGTYWSCSCKFLEYGNAYLPNGC  753
            R T   C C     GN Y+  GC
Sbjct  284  RTTGRRCDCPSGYNGNPYVLGGC  306



>gb|KCW81780.1| hypothetical protein EUGRSUZ_C031382, partial [Eucalyptus grandis]
Length=243

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 49/198 (25%), Positives = 76/198 (38%), Gaps = 34/198 (17%)
 Frame = +1

Query  202  SNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDC  381
            +   L G+ F +S   N F   GC   + T       + GC+  C+  NT+ +     DC
Sbjct  22   AGVSLEGSQFVFSQKGNVFTLVGCN-TLATVDTTNSAVVGCRSRCAGTNTSIS--LNGDC  78

Query  382  NGIN-CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            +G + CC      ++  +  D  +    +  C YAF  +   DFT+    L + +     
Sbjct  79   SGRDGCCQTMLPRNLQGFSADFKEEG-GHEGCKYAFLRS---DFTSLYD-LKVNK-----  128

Query  559  PEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTY---------WSCSC  711
                  VPVV +W +  D        Y R+  R  +   P +  TY           C C
Sbjct  129  -----TVPVVLQWGIANDT------DYGRELTRQSETSYPSICRTYSVDNSEMLFTQCYC  177

Query  712  KFLEYGNAYLPNGCQGTS  765
                 GN YL  GC+G +
Sbjct  178  TREYGGNPYLMEGCKGAA  195



>ref|XP_004979730.1| PREDICTED: wall-associated receptor kinase 5-like [Setaria italica]
Length=737

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 68/267 (25%), Positives = 111/267 (42%), Gaps = 43/267 (16%)
 Frame = +1

Query  10   NCTKSSS--------DGVEKPFLSSFSDGKNGVREILSISNVRQSIIMKESFSPLCHTTA  165
            NC+ SSS        DGV KPFL        G  E+L+IS  + +I +    S  C+  +
Sbjct  49   NCSLSSSFNVSCQIHDGVYKPFL--------GFVEVLNISLAQGTIRVLNQISTYCYNNS  100

Query  166  GSAVGSNNLSIISNTKLSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSS  342
               +  N   +     + G PF +S  +N+F   GC   A +        ++GC  +C +
Sbjct  101  SGQMEDNRWWL----DIRGGPFRFSDVHNKFTVIGCNTLAYIYDNTSTGYLSGCVSTCRN  156

Query  343  NNTTA-APKFAYDCNGINCCDLSFDYDVNAYQIDIT---DSSIVN--NACNYAFFL-ATG  501
             +  A  P     C+GI CC  +   ++  Y++  +   ++S V   + C+YA  + A  
Sbjct  157  LSDLADGP-----CSGIGCCQTAIPRNMGYYEVLFSRGFNTSKVQRFSPCSYAVLMEAEA  211

Query  502  DDFTTTSSRLSLQRISNLLPEDKLV--VPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFP  675
             +F+T       + IS     D  +   PVV  W+++      +  T +  C        
Sbjct  212  FNFST-------KYISTTTFNDTRIGRAPVVMDWAISNKTTCEVA-TGTYACLSTNSGCV  263

Query  676  PQLRGTYWSCSCKFLEYGNAYLPNGCQ  756
                G  + C+C     GN YL  GCQ
Sbjct  264  DSANGLGYLCNCSKGYQGNPYLQGGCQ  290



>ref|XP_010051317.1| PREDICTED: wall-associated receptor kinase-like 3 [Eucalyptus 
grandis]
Length=992

 Score = 50.4 bits (119),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 51/196 (26%), Positives = 78/196 (40%), Gaps = 38/196 (19%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            L G+ F +S + N F   GC   + T    +    GC+  C++ NT+ +   A  C+G +
Sbjct  114  LKGSQFVFSRTRNVFTLVGCN-TLATVNTTKSAFVGCRSRCAATNTSISRNSA--CSGRD  170

Query  394  -CCDLSFDYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQRISNLLPEDK  570
             CC      ++  + +D  +    +  C YAF  +   DFT          + +LL  + 
Sbjct  171  GCCQRMLRPNLQGFSVDFIEEG-GHQGCKYAFLRS---DFTG---------LYDLLLNE-  216

Query  571  LVVPVVWRWSVTR--DD---------LSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKF  717
              VPVV  W +    DD           YL    +   D  E +F          C C  
Sbjct  217  -TVPVVLEWGIANNTDDGRKLIQQSRTGYLSYCRTHSIDNSEMLFT--------QCYCTR  267

Query  718  LEYGNAYLPNGCQGTS  765
               GNAYL  GC+G +
Sbjct  268  EYGGNAYLMEGCKGAA  283



>ref|XP_007224001.1| hypothetical protein PRUPE_ppa014914mg [Prunus persica]
 gb|EMJ25200.1| hypothetical protein PRUPE_ppa014914mg [Prunus persica]
Length=669

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 60/197 (30%), Positives = 87/197 (44%), Gaps = 40/197 (20%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGG-AVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L G+PF +S   N+F    CGG A++T  G   T+ GC   C   +T+        C+G+
Sbjct  107  LEGSPFLFSRK-NKFTSMSCGGIALMTLHGS--TIGGCLSICDYYSTSVLQ--TKSCSGM  161

Query  391  NCCDLSFDYDVNAYQIDITDSSIVN----NACNYAFFLATGDDFTTTSSRLSLQRISNLL  558
            NCC  +  Y ++++    T    VN     AC +AF L   D FT+ S+      IS + 
Sbjct  162  NCCQTTLPYCLSSFN---TSFGAVNAESQKACKFAF-LVDNDWFTSNSTN-----ISAIG  212

Query  559  PEDKLVVPVVWRWSV---TRDDL---SYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFL  720
              D   VPVV  W V   T+ D+   +      S DC   +             C C   
Sbjct  213  EMD--YVPVVLEWYVVNYTKFDIYGTNNWKDDNSTDCSSSQ-------------CFCSKG  257

Query  721  EYGNAYLPNGCQGTSTL  771
             +GN YL +GCQ  S++
Sbjct  258  YHGNPYLLHGCQVPSSV  274



>ref|XP_004305857.1| PREDICTED: wall-associated receptor kinase-like 8-like [Fragaria 
vesca subsp. vesca]
Length=710

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 56/135 (41%), Gaps = 14/135 (10%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDCNGIN  393
            LSG+PF +S   NR    GCGG    T      +A C   C        P     CNGIN
Sbjct  117  LSGSPFVFSQK-NRLAVMGCGGTTWMTLDNGSRVASCPSVCGDGG--KLPDTLDRCNGIN  173

Query  394  CCDLSFDYDVNAYQIDITDSSIV---NNACNYAFFLATGDDFTTTSSRLSLQRISNLLPE  564
            CC ++   ++ A+      S+       +C YAF +   D  +       L  I N++  
Sbjct  174  CCQINTPPELTAFNYTFEASNKTTPGTESCKYAFLV---DQESWVYDSTGLSSIQNVMS-  229

Query  565  DKLVVPVVWRWSVTR  609
                +PV+  W++ R
Sbjct  230  ----IPVLLDWNLNR  240



>ref|XP_007212851.1| hypothetical protein PRUPE_ppa021436mg [Prunus persica]
 gb|EMJ14050.1| hypothetical protein PRUPE_ppa021436mg [Prunus persica]
Length=754

 Score = 50.4 bits (119),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 55/203 (27%), Positives = 81/203 (40%), Gaps = 34/203 (17%)
 Frame = +1

Query  205  NTKLSGTP-------FFYSSSYNRFMFYGCGGAVL--TTPGQEFTMAGCKLSCSSNNTTA  357
            +TKLS TP       +  S + N+F+  GC    +     G+E  + GC   C S  + +
Sbjct  103  DTKLSNTPRLKLFPPYTISGTKNKFIAVGCDTYAIFEGGRGKEKYITGCMTFCESLGSIS  162

Query  358  APKFAYDCNGINCCDLSFDYDVNAYQIDITDSSIVN-------NACNYAFFLATGDDFTT  516
                   C+GI CC  S    +      +T SS  N       N C+Y+F +  G    +
Sbjct  163  E-----SCSGIGCCQTSIPSGLQVR--TVTMSSYYNHTFIWDFNPCSYSFIVEEGQFTFS  215

Query  517  TSSRLSLQRISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEK-IFPPQLRGT  693
            + S   L+ IS L        P+V  W++  +            C      + P  L G 
Sbjct  216  SKSFQELKSISRL--------PMVLNWAIGDEPCDAAQHRQDYACKGNSTCVNPLNLSGY  267

Query  694  YWSCSCKFLEYGNAYLPNGCQGT  762
            +  C C     GN YLP+GCQ T
Sbjct  268  F--CECLPGYEGNPYLPDGCQDT  288



>gb|AAX95007.1| wall-associated protein kinase [Oryza sativa Japonica Group]
 gb|ABA95454.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
Length=737

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 54/200 (27%), Positives = 84/200 (42%), Gaps = 28/200 (14%)
 Frame = +1

Query  214  LSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFT-MAGCKLSCSSNNTTAAPKFAYDCNGI  390
            L+G+PF  S++ N+F   GC    +    ++ T   GC   C  +   AAP     C+G+
Sbjct  127  LAGSPFLISTTGNKFTAIGCNTLAMIIGKEDMTYFTGCISYCGGDVQKAAPD-GSPCSGL  185

Query  391  NCC------DLSF---DYDVNAYQIDITDSSIVNNACNYAFFLATGDDFTTTSSRLSLQR  543
             CC      +LSF    + V+ +  D T+S+   + C+YAF     D    +  R  L  
Sbjct  186  GCCQTELTPELSFLNVTWGVDGHN-DTTNSAWDYSPCSYAFI---ADKNWYSFKREDLVG  241

Query  544  ISNLLPEDKLVVPVVWRWSVTRDDLSYLPPT----------YSRDCDRYEKIFPPQLRGT  693
             +N    DK  +P+V  W++ R + S  P            Y      +         G 
Sbjct  242  NANYF--DKKGIPLVLDWAI-RSNGSSCPHESGKMANPVVPYGACVSSHSYCVNVTNNGH  298

Query  694  YWSCSCKFLEYGNAYLPNGC  753
             + C+C    +GN YLP GC
Sbjct  299  GYLCNCSDGYHGNPYLPEGC  318



>ref|NP_001148133.1| WAK53a - OsWAK receptor-like protein kinase precursor [Zea mays]
 gb|ACG29839.1| WAK53a - OsWAK receptor-like protein kinase [Zea mays]
Length=735

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 48/192 (25%), Positives = 74/192 (39%), Gaps = 18/192 (9%)
 Frame = +1

Query  202  SNTKLSGTPFFYSSSYNRFMFYGCGGAVLTTPGQEFTMAGCKLSCSSNNTTAAPKFAYDC  381
            S+  L GT F +S + N+F   GC    +   G      GC   CSS N          C
Sbjct  101  SSVNLEGTVFTFSDTRNKFTALGCNVVAMLLNGSTGYSGGCASFCSSRNNI----IDGSC  156

Query  382  NGINCCDLSFDYDVNAYQIDITDSSIVNNACNYAF------FLATGDDFTTTSSRLSLQR  543
            +G+ CC       +    ++ ++ +I N+  +Y +      F+   D +    S L L  
Sbjct  157  SGVTCCQAPVPKGLKKLDLEFSNINITNSGIDYDYWPCGQAFVVEQDSYVF--SVLDLNN  214

Query  544  ISNLLPEDKLVVPVVWRWSVTRDDLSYLPPTYSRDCDRYEKIFPPQLRGTYWSCSCKFLE  723
             +N  P+ +    VV  WS+          + S  C      +     G  + C+C    
Sbjct  215  TNNTRPQYR---HVVLEWSINGSSCEEAKLSGSYACAENAYCYNSS-NGIGYRCNCSSGF  270

Query  724  YGNAYL--PNGC  753
             GN YL  PNGC
Sbjct  271  EGNPYLQGPNGC  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1364606714424