BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c71967_g1_i1 len=112 path=[1:0-111]

Length=112
                                                                      Score     E

emb|CDP20205.1|  unnamed protein product                              65.1    2e-11   
emb|CAA09896.1|  RNA-directed RNA polymerase                          65.5    8e-11   Petunia x hybrida [garden petunia]
emb|CDP05599.1|  unnamed protein product                              65.5    8e-11   
gb|ABO92977.1|  putative RNA-dependent RNA-polymerase                 64.7    2e-10   Solanum tuberosum [potatoes]
ref|NP_001234319.1|  RNA-directed RNA polymerase                      64.7    2e-10   
ref|XP_006366108.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   64.3    2e-10   
ref|XP_009781107.1|  PREDICTED: probable RNA-dependent RNA polyme...  64.3    2e-10   
gb|ABV24845.1|  RNA-dependent RNA polymerase                          63.9    3e-10   Nicotiana glutinosa
gb|AAT38699.2|  RNA dependent RNA polymerase family protein           63.9    3e-10   Solanum demissum
gb|AAT38687.2|  RNA-directed RNA polymerase, putative                 63.9    3e-10   Solanum demissum
gb|AAT38751.2|  RNA-directed RNA polymerase, putative                 63.9    3e-10   Solanum demissum
ref|XP_009623376.1|  PREDICTED: probable RNA-dependent RNA polyme...  63.5    3e-10   
emb|CAA09697.1|  RNA-directed RNA polymerase                          63.5    3e-10   Nicotiana tabacum [American tobacco]
gb|EYU28878.1|  hypothetical protein MIMGU_mgv1a000505mg              63.2    5e-10   
ref|XP_011024314.1|  PREDICTED: RNA-dependent RNA polymerase 1-li...  62.4    1e-09   
ref|XP_011024307.1|  PREDICTED: RNA-dependent RNA polymerase 1-li...  62.4    1e-09   
gb|KHG26498.1|  RNA-dependent RNA polymerase 1 -like protein          61.6    2e-09   
ref|XP_011075687.1|  PREDICTED: probable RNA-dependent RNA polyme...  61.6    2e-09   
gb|ABQ45352.1|  RNA-dependent RNA polymerase                          61.6    2e-09   Gossypium hirsutum [American cotton]
gb|ABE01124.1|  RNA-dependent RNA polymerase                          61.2    2e-09   Gossypium hirsutum [American cotton]
emb|CDP05596.1|  unnamed protein product                              60.8    4e-09   
ref|XP_006469266.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   58.9    4e-09   
ref|XP_002311536.1|  RNA-directed RNA Polymerase family protein       60.5    4e-09   Populus trichocarpa [western balsam poplar]
gb|ABI34311.1|  RNA dependent RNA polymerase family protein           60.1    5e-09   Solanum demissum
gb|ABI34378.1|  RNA-directed RNA polymerase, putative                 60.1    5e-09   Solanum tuberosum [potatoes]
gb|AAT38754.2|  RNA-directed RNA polymerase, putative                 60.1    6e-09   Solanum demissum
emb|CDP05598.1|  unnamed protein product                              60.1    6e-09   
ref|XP_010236147.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...  59.7    8e-09   
ref|XP_002311535.2|  hypothetical protein POPTR_0008s13520g           59.3    1e-08   Populus trichocarpa [western balsam poplar]
ref|XP_011021756.1|  PREDICTED: probable RNA-dependent RNA polyme...  59.3    1e-08   
ref|XP_011028096.1|  PREDICTED: probable RNA-dependent RNA polyme...  59.3    1e-08   
gb|KDO60789.1|  hypothetical protein CISIN_1g0025861mg                57.8    1e-08   
ref|XP_006366109.1|  PREDICTED: RNA-dependent RNA polymerase 1-li...  58.9    1e-08   
ref|XP_010917515.1|  PREDICTED: probable RNA-dependent RNA polyme...  58.9    1e-08   
ref|XP_010917517.1|  PREDICTED: probable RNA-dependent RNA polyme...  58.9    2e-08   
gb|ABO93006.1|  putative RNA-dependent RNA-polymerase                 58.5    2e-08   Solanum tuberosum [potatoes]
ref|XP_006469265.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   58.5    2e-08   
gb|ABL68088.1|  putative RNA-directed RNA polymerase 1                58.5    2e-08   Nicotiana attenuata
gb|AHL27584.1|  RNA-dependent RNA polymerase 1                        58.5    2e-08   
gb|EMT27792.1|  Putative RNA-dependent RNA polymerase 1               58.2    3e-08   
gb|EMS59066.1|  putative RNA-dependent RNA polymerase 1               57.8    3e-08   
gb|EMS66194.1|  RNA-dependent RNA polymerase 1                        57.8    4e-08   
ref|XP_002315849.2|  hypothetical protein POPTR_0010s11560g           57.8    4e-08   Populus trichocarpa [western balsam poplar]
gb|AHL27585.1|  RNA-dependent RNA polymerase 2                        57.8    4e-08   
dbj|BAL63010.1|  RNA-dependent RNA polymerase 1                       57.8    4e-08   
ref|XP_004498236.1|  PREDICTED: RNA-dependent RNA polymerase 1-li...  57.8    4e-08   
ref|XP_004297425.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   57.8    4e-08   
ref|NP_001267682.1|  RNA-dependent RNA polymerase 1-like              57.8    4e-08   
gb|EPS70289.1|  hypothetical protein M569_04468                       57.4    5e-08   
ref|XP_004498237.1|  PREDICTED: RNA-dependent RNA polymerase 1-li...  57.4    5e-08   
gb|KEH40645.1|  RNA-directed RNA polymerase                           57.4    5e-08   
gb|KFK24634.1|  hypothetical protein AALP_AA8G005100                  55.8    5e-08   
ref|XP_002454320.1|  hypothetical protein SORBIDRAFT_04g028630        57.4    5e-08   Sorghum bicolor [broomcorn]
ref|XP_008381760.1|  PREDICTED: probable RNA-dependent RNA polyme...  57.4    6e-08   
ref|XP_006388173.1|  hypothetical protein POPTR_0303s002201g          56.6    9e-08   
ref|XP_007225261.1|  hypothetical protein PRUPE_ppa001524mg           56.2    1e-07   
ref|XP_006849794.1|  hypothetical protein AMTR_s00176p00039530        56.6    1e-07   
ref|XP_010275353.1|  PREDICTED: probable RNA-dependent RNA polyme...  56.2    1e-07   
ref|XP_008812977.1|  PREDICTED: probable RNA-dependent RNA polyme...  56.2    1e-07   
gb|ACH53360.1|  RNA-directed RNA polymerase 1a                        56.2    1e-07   Hordeum vulgare [barley]
emb|CAN82339.1|  hypothetical protein VITISV_039922                   55.8    2e-07   Vitis vinifera
ref|XP_009351561.1|  PREDICTED: probable RNA-dependent RNA polyme...  55.8    2e-07   
ref|XP_008220919.1|  PREDICTED: probable RNA-dependent RNA polyme...  55.8    2e-07   
ref|XP_002284914.1|  PREDICTED: probable RNA-dependent RNA polyme...  55.8    2e-07   Vitis vinifera
ref|NP_001267692.1|  RNA-dependent RNA polymerase 1-like              55.8    2e-07   
gb|KGN50761.1|  hypothetical protein Csa_5G239140                     55.8    2e-07   
ref|XP_007045555.1|  Rna-dependent RNA polymerase, putative           55.8    2e-07   
emb|CBI26820.3|  unnamed protein product                              55.5    2e-07   
dbj|BAK07758.1|  predicted protein                                    55.1    3e-07   
sp|Q0DXS3.2|RDR1_ORYSJ  RecName: Full=Probable RNA-dependent RNA ...  55.1    3e-07   Oryza sativa Japonica Group [Japonica rice]
dbj|BAC84970.1|  RNA-directed RNA Polymerase                          53.5    3e-07   Vigna unguiculata
gb|EEE57765.1|  hypothetical protein OsJ_08301                        55.1    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|EAY87440.1|  hypothetical protein OsI_08849                        55.1    3e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_010670368.1|  PREDICTED: RNA-dependent RNA polymerase 1        55.1    3e-07   
gb|AAR91037.1|  RNA-directed RNA polymerase 2                         55.1    3e-07   Hordeum vulgare subsp. vulgare [barley]
ref|XP_008465250.1|  PREDICTED: RNA-dependent RNA polymerase 1        55.1    3e-07   
ref|XP_009356261.1|  PREDICTED: LOW QUALITY PROTEIN: probable RNA...  55.1    4e-07   
ref|XP_004953848.1|  PREDICTED: probable RNA-dependent RNA polyme...  54.7    4e-07   
gb|EMT03978.1|  Putative RNA-dependent RNA polymerase 1               54.3    5e-07   
ref|XP_007045552.1|  RNA-dependent RNA polymerase 1 isoform 1         54.3    5e-07   
gb|ACH53361.1|  RNA-directed RNA polymerase 1b                        54.3    6e-07   Hordeum vulgare [barley]
gb|AAR91036.1|  RNA-directed RNA polymerase 1                         54.3    6e-07   Hordeum vulgare subsp. vulgare [barley]
emb|CDP05597.1|  unnamed protein product                              54.3    6e-07   
ref|NP_001183933.1|  putative RNA-dependent RNA polymerase            54.3    6e-07   
gb|AFW73307.1|  putative RNA-dependent RNA polymerase                 53.9    7e-07   
ref|XP_008644240.1|  PREDICTED: putative RNA-dependent RNA polyme...  53.9    8e-07   
gb|ADU77017.1|  RNA-dependent RNA polymerase 1c                       53.1    9e-07   
ref|XP_006416969.1|  hypothetical protein EUTSA_v10006629mg           53.5    1e-06   
ref|XP_010476552.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   53.5    1e-06   
ref|XP_010496542.1|  PREDICTED: RNA-dependent RNA polymerase 1        53.5    1e-06   
ref|XP_008367010.1|  PREDICTED: probable RNA-dependent RNA polyme...  53.5    1e-06   
emb|CDY41107.1|  BnaC05g10980D                                        53.5    1e-06   
gb|EXX67774.1|  hypothetical protein RirG_111310                      53.5    1e-06   
gb|KEH40649.1|  RNA-directed RNA polymerase                           53.5    1e-06   
ref|XP_010546021.1|  PREDICTED: RNA-dependent RNA polymerase 2        53.5    1e-06   
ref|XP_009148868.1|  PREDICTED: RNA-dependent RNA polymerase 1        53.1    1e-06   
emb|CDY45290.1|  BnaA06g09600D                                        53.1    1e-06   
gb|ADN33705.1|  RNA-dependent RNA polymerase                          53.1    1e-06   
gb|ESA12284.1|  hypothetical protein GLOINDRAFT_50177                 53.1    1e-06   
gb|ESA19789.1|  hypothetical protein GLOINDRAFT_75401                 53.1    1e-06   
gb|KGN51474.1|  hypothetical protein Csa_5G564290                     53.1    1e-06   
gb|KEH40642.1|  RNA-directed RNA polymerase                           53.1    1e-06   
gb|EXX68450.1|  hypothetical protein RirG_105120                      53.1    2e-06   
gb|KEH40641.1|  RNA-directed RNA polymerase                           53.1    2e-06   
ref|XP_002892830.1|  RNA-dependent RNA polymerase 1                   53.1    2e-06   
ref|XP_004151456.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   52.4    2e-06   
ref|XP_008389159.1|  PREDICTED: probable RNA-dependent RNA polyme...  53.1    2e-06   
ref|XP_006306626.1|  hypothetical protein CARUB_v10008144mg           52.8    2e-06   
ref|XP_002870481.1|  RNA-dependent RNA polymerase 1                   52.8    2e-06   
emb|CCD74482.1|  RNA-dependent RNA polymerase 1                       52.8    2e-06   
ref|XP_008437690.1|  PREDICTED: probable RNA-dependent RNA polyme...  52.8    2e-06   
ref|XP_010462708.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   52.8    2e-06   
ref|XP_010043968.1|  PREDICTED: probable RNA-dependent RNA polyme...  52.8    2e-06   
ref|XP_008367057.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   52.4    2e-06   
ref|XP_006647856.1|  PREDICTED: probable RNA-dependent RNA polyme...  52.8    2e-06   
ref|XP_010043971.1|  PREDICTED: probable RNA-dependent RNA polyme...  52.4    2e-06   
gb|KEH40648.1|  RNA-dependent RNA polymerase family protein           52.0    3e-06   
ref|XP_010066563.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   52.4    3e-06   
ref|XP_010093320.1|  RNA-dependent RNA polymerase 1                   52.0    4e-06   
ref|XP_001774552.1|  RNA-directed RNA polymerase                      52.0    4e-06   
gb|KGN51434.1|  hypothetical protein Csa_5G544050                     51.6    5e-06   
ref|XP_009381445.1|  PREDICTED: probable RNA-dependent RNA polyme...  51.6    5e-06   
ref|XP_003518619.1|  PREDICTED: RNA-dependent RNA polymerase 1-li...  51.6    5e-06   
ref|XP_010068689.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   51.2    6e-06   
gb|KCW64478.1|  hypothetical protein EUGRSUZ_G020872                  50.4    7e-06   
gb|KCW44299.1|  hypothetical protein EUGRSUZ_L022601                  50.1    7e-06   
ref|XP_010041515.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   50.4    9e-06   
ref|XP_008437692.1|  PREDICTED: probable RNA-dependent RNA polyme...  50.8    9e-06   
ref|XP_010271369.1|  PREDICTED: probable RNA-dependent RNA polyme...  50.8    1e-05   
ref|XP_007153213.1|  hypothetical protein PHAVU_003G016600g           50.8    1e-05   
emb|CAA09895.1|  RNA-directed RNA polymerase                          47.8    1e-05   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007153214.1|  hypothetical protein PHAVU_003G016600g           50.4    1e-05   
ref|XP_010527810.1|  PREDICTED: RNA-dependent RNA polymerase 1        50.4    1e-05   
ref|XP_010068690.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   50.1    2e-05   
ref|XP_010066561.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   50.1    2e-05   
ref|XP_002974914.1|  hypothetical protein SELMODRAFT_150191           49.3    3e-05   
ref|XP_006477873.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   48.1    3e-05   
gb|EMT03668.1|  hypothetical protein F775_11670                       48.5    4e-05   
gb|EEE61147.1|  hypothetical protein OsJ_15104                        48.1    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001053027.1|  Os04g0465700                                     48.1    4e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010043973.1|  PREDICTED: probable RNA-dependent RNA polyme...  48.9    5e-05   
gb|AAN64409.1|  RNA-dependent RNA polymerase 1                        48.5    5e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172932.1|  RNA-dependent RNA polymerase 1                      48.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KDP31126.1|  hypothetical protein JCGZ_11502                       48.5    6e-05   
ref|XP_010435459.1|  PREDICTED: RNA-dependent RNA polymerase 2-li...  48.5    6e-05   
ref|XP_010435450.1|  PREDICTED: RNA-dependent RNA polymerase 2-li...  48.5    6e-05   
ref|XP_010455516.1|  PREDICTED: RNA-dependent RNA polymerase 2-like   48.5    6e-05   
ref|XP_010422054.1|  PREDICTED: RNA-dependent RNA polymerase 2 is...  48.5    7e-05   
ref|XP_007036161.1|  RNA-dependent RNA polymerase 2 isoform 1         48.5    7e-05   
ref|XP_010043975.1|  PREDICTED: probable RNA-dependent RNA polyme...  48.1    7e-05   
ref|XP_010043974.1|  PREDICTED: probable RNA-dependent RNA polyme...  48.1    7e-05   
ref|XP_002988931.1|  hypothetical protein SELMODRAFT_235652           47.8    8e-05   
ref|XP_010093336.1|  RNA-dependent RNA polymerase 1                   48.1    8e-05   
gb|KDO51480.1|  hypothetical protein CISIN_1g0037891mg                47.0    8e-05   
gb|EAY94464.1|  hypothetical protein OsI_16234                        47.8    1e-04   Oryza sativa Indica Group [Indian rice]
sp|Q7XM31.1|RDR2_ORYSJ  RecName: Full=Probable RNA-dependent RNA ...  47.8    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006477872.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   47.8    1e-04   
ref|XP_010107450.1|  RNA-dependent RNA polymerase 2                   47.8    1e-04   
ref|XP_002281315.1|  PREDICTED: probable RNA-dependent RNA polyme...  47.8    1e-04   Vitis vinifera
emb|CBI26821.3|  unnamed protein product                              47.4    1e-04   
ref|XP_003560510.1|  PREDICTED: probable RNA-dependent RNA polyme...  47.4    1e-04   
gb|ADU04140.1|  hypothetical protein                                  47.4    1e-04   
ref|XP_011028594.1|  PREDICTED: RNA-dependent RNA polymerase 2        47.4    1e-04   
ref|XP_002321582.1|  hypothetical protein POPTR_0015s08500g           47.4    1e-04   Populus trichocarpa [western balsam poplar]
emb|CAN82568.1|  hypothetical protein VITISV_040047                   47.4    1e-04   Vitis vinifera
ref|XP_006653498.1|  PREDICTED: probable RNA-dependent RNA polyme...  47.4    1e-04   
ref|XP_010093335.1|  RNA-dependent RNA polymerase 1                   47.4    2e-04   
ref|XP_002511431.1|  RNA-dependent RNA polymerase, putative           47.4    2e-04   Ricinus communis
ref|XP_003579930.1|  PREDICTED: probable RNA-dependent RNA polyme...  47.4    2e-04   
gb|EMS53588.1|  putative RNA-dependent RNA polymerase 2               47.0    2e-04   
ref|XP_004498314.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   47.0    2e-04   
ref|XP_004978058.1|  PREDICTED: probable RNA-dependent RNA polyme...  47.0    2e-04   
emb|CAA09894.1|  RNA-directed RNA polymerase                          46.6    2e-04   Arabidopsis thaliana [mouse-ear cress]
gb|EMS60434.1|  putative RNA-dependent RNA polymerase 2               46.2    2e-04   
ref|XP_003528344.1|  PREDICTED: RNA-dependent RNA polymerase 1-like   47.0    2e-04   
ref|XP_007153218.1|  hypothetical protein PHAVU_003G016800g           47.0    2e-04   
gb|KHN34545.1|  RNA-dependent RNA polymerase 1                        47.0    2e-04   
ref|XP_001785643.1|  RNA-directed RNA polymerase                      46.6    3e-04   
gb|KEF58006.1|  hypothetical protein A1O9_05929                       46.6    3e-04   
gb|ABF82437.1|  putative RNA-dependent RNA polymerase 6               46.6    3e-04   
ref|XP_002446635.1|  hypothetical protein SORBIDRAFT_06g019330        46.6    3e-04   Sorghum bicolor [broomcorn]
gb|KHG14638.1|  RNA-dependent RNA polymerase 2 -like protein          46.6    3e-04   
gb|KEH40639.1|  RNA-directed RNA polymerase                           46.2    3e-04   
ref|XP_007750563.1|  hypothetical protein A1O5_11803                  46.2    4e-04   
ref|XP_007731848.1|  hypothetical protein A1O3_03522                  46.2    4e-04   
ref|XP_009381640.1|  PREDICTED: probable RNA-dependent RNA polyme...  46.2    4e-04   
gb|EMT21060.1|  hypothetical protein F775_12206                       46.2    4e-04   
ref|XP_008711139.1|  hypothetical protein HMPREF1541_00611            45.8    4e-04   
ref|XP_010271987.1|  PREDICTED: RNA-dependent RNA polymerase 2        45.8    5e-04   
ref|XP_003608944.1|  Rna-dependent RNA polymerase                     45.8    5e-04   
gb|EMT05613.1|  hypothetical protein F775_19527                       45.8    5e-04   
dbj|BAJ85295.1|  predicted protein                                    45.8    5e-04   
gb|AES91141.2|  RNA-dependent RNA polymerase family protein           45.8    5e-04   
gb|KEH31853.1|  RNA-dependent RNA polymerase family protein           45.8    5e-04   
ref|XP_002872551.1|  RNA-dependent RNA polymerase 2                   45.4    6e-04   
gb|EMT07612.1|  hypothetical protein F775_11614                       45.4    6e-04   
ref|NP_192851.1|  RNA-dependent RNA polymerase 2                      45.4    6e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44224.1|  rna-dependent rna polymerase 2                        45.4    6e-04   
ref|XP_006286933.1|  hypothetical protein CARUB_v10000076mg           45.4    7e-04   
ref|XP_006396953.1|  hypothetical protein EUTSA_v10028370mg           45.4    7e-04   
gb|ERZ99499.1|  hypothetical protein GLOINDRAFT_9434                  45.4    7e-04   
gb|EXX63767.1|  hypothetical protein RirG_149260                      45.4    7e-04   
emb|CBN78124.1|  RNA-dependent RNA polymerase 1                       45.4    7e-04   
ref|XP_010037577.1|  PREDICTED: RNA-dependent RNA polymerase 2        45.4    7e-04   
gb|ACR38600.1|  unknown                                               45.1    8e-04   Zea mays [maize]
gb|EJK56264.1|  hypothetical protein THAOC_23889                      43.9    9e-04   
ref|XP_008668575.1|  PREDICTED: RNA-dependent DNA polymerase isof...  45.1    9e-04   
ref|NP_001183867.1|  RNA-dependent DNA polymerase                     45.1    0.001   



>emb|CDP20205.1| unnamed protein product [Coffea canephora]
Length=305

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A+SEPCL+LA LFSIAVDFPKT VPAEIPS L
Sbjct  56   PLKARSEPCLELAQLFSIAVDFPKTSVPAEIPSHL  90



>emb|CAA09896.1| RNA-directed RNA polymerase [Petunia x hybrida]
Length=775

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC++LA LFSIAVDFPKTGVPAEIPS LR
Sbjct  564  PNMAMSDPCIELAQLFSIAVDFPKTGVPAEIPSQLR  599



>emb|CDP05599.1| unnamed protein product [Coffea canephora]
Length=1113

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+SEPCL+LA L SIAVDFPKTGVPAEIPS LR
Sbjct  871  PLKARSEPCLELAELHSIAVDFPKTGVPAEIPSHLR  906



>gb|ABO92977.1| putative RNA-dependent RNA-polymerase [Solanum tuberosum]
Length=1115

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA LFSIAVDFPKTGVPAEIPS LR
Sbjct  871  PDMAMSDPCKKLAELFSIAVDFPKTGVPAEIPSQLR  906



>ref|NP_001234319.1| RNA-directed RNA polymerase [Solanum lycopersicum]
 emb|CAA71421.1| RNA-directed RNA polymerase [Solanum lycopersicum]
Length=1114

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA LFSIAVDFPKTGVPAEIPS LR
Sbjct  871  PDMAMSDPCKKLAELFSIAVDFPKTGVPAEIPSQLR  906



>ref|XP_006366108.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Solanum tuberosum]
Length=1115

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA LFSIAVDFPKTGVPAEIPS LR
Sbjct  871  PDMAMSDPCKKLAELFSIAVDFPKTGVPAEIPSQLR  906



>ref|XP_009781107.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
sylvestris]
 ref|XP_009781108.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
sylvestris]
 ref|XP_009781109.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
sylvestris]
Length=1116

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC +LA LFSIAVDFPKTGVPAEIPS LR
Sbjct  873  PDMAMSDPCKQLAQLFSIAVDFPKTGVPAEIPSQLR  908



>gb|ABV24845.1| RNA-dependent RNA polymerase [Nicotiana glutinosa]
 gb|ACI46982.1| RNA-dependent RNA polymerase [Nicotiana glutinosa]
Length=1117

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC +LA LFSIAVDFPKTGVPAEIPS LR
Sbjct  874  PDMAMSDPCKQLAQLFSIAVDFPKTGVPAEIPSQLR  909



>gb|AAT38699.2| RNA dependent RNA polymerase family protein [Solanum demissum]
Length=963

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA LFSIAVDFPKTGVPAEIPS LR
Sbjct  719  PDMAMSDPCKKLAELFSIAVDFPKTGVPAEIPSQLR  754



>gb|AAT38687.2| RNA-directed RNA polymerase, putative [Solanum demissum]
Length=1139

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA LFSIAVDFPKTGVPAEIPS LR
Sbjct  896  PDMAMSDPCKKLAELFSIAVDFPKTGVPAEIPSQLR  931



>gb|AAT38751.2| RNA-directed RNA polymerase, putative [Solanum demissum]
Length=1180

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 30/36 (83%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA LFSIAVDFPKTGVPAEIPS LR
Sbjct  937  PDMAMSDPCKKLAELFSIAVDFPKTGVPAEIPSQLR  972



>ref|XP_009623376.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009623378.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009623379.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009623380.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nicotiana 
tomentosiformis]
Length=1116

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC +LA LFSIAVDFPKTGVPAEIPS LR
Sbjct  873  PDMAMSDPCKQLAQLFSIAVDFPKTGVPAEIPSQLR  908



>emb|CAA09697.1| RNA-directed RNA polymerase [Nicotiana tabacum]
Length=1116

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC +LA LFSIAVDFPKTGVPAEIPS LR
Sbjct  873  PDMAMSDPCKQLAQLFSIAVDFPKTGVPAEIPSQLR  908



>gb|EYU28878.1| hypothetical protein MIMGU_mgv1a000505mg [Erythranthe guttata]
Length=1110

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PLMA SEPCL+LA LFSIAVDF KTG+PAEIP  LR
Sbjct  870  PLMALSEPCLELARLFSIAVDFNKTGIPAEIPPHLR  905



>ref|XP_011024314.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X2 [Populus 
euphratica]
Length=1132

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            L A SEPCL+LA  FSIAVDFPKTGVPAEIPS+LR
Sbjct  885  LKAMSEPCLELARKFSIAVDFPKTGVPAEIPSNLR  919



>ref|XP_011024307.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X1 [Populus 
euphratica]
Length=1132

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/35 (83%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            L A SEPCL+LA  FSIAVDFPKTGVPAEIPS+LR
Sbjct  885  LKAMSEPCLELARKFSIAVDFPKTGVPAEIPSNLR  919



>gb|KHG26498.1| RNA-dependent RNA polymerase 1 -like protein [Gossypium arboreum]
 gb|KHG29625.1| RNA-dependent RNA polymerase 1 -like protein [Gossypium arboreum]
Length=1110

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S PCL+LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  862  PGKAMSRPCLELAKLFSIAVDFPKTGVPAEIPQELR  897



>ref|XP_011075687.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Sesamum indicum]
 ref|XP_011075688.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Sesamum indicum]
 ref|XP_011075689.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Sesamum indicum]
Length=1115

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/34 (85%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  9    MAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            MA SE CL+LA LFSIAVDFPKTGVPAEIPS LR
Sbjct  876  MALSESCLELARLFSIAVDFPKTGVPAEIPSHLR  909



>gb|ABQ45352.1| RNA-dependent RNA polymerase [Gossypium hirsutum]
Length=1110

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S PCL+LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  862  PDKAMSRPCLELAKLFSIAVDFPKTGVPAEIPQELR  897



>gb|ABE01124.1| RNA-dependent RNA polymerase [Gossypium hirsutum]
Length=1110

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S PCL+LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  862  PGKAMSRPCLELAKLFSIAVDFPKTGVPAEIPQELR  897



>emb|CDP05596.1| unnamed protein product [Coffea canephora]
Length=1112

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            L A+S+PCL+LA LFSIAVDFPKTGVPAEI S LR
Sbjct  871  LKARSKPCLELARLFSIAVDFPKTGVPAEITSHLR  905



>ref|XP_006469266.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Citrus sinensis]
Length=292

 Score = 58.9 bits (141),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A+SEPCL+LA  FSIAVDFPKTGVPAEIP  L
Sbjct  48   PHKARSEPCLQLAEKFSIAVDFPKTGVPAEIPPHL  82



>ref|XP_002311536.1| RNA-directed RNA Polymerase family protein [Populus trichocarpa]
 gb|EEE88903.1| RNA-directed RNA Polymerase family protein [Populus trichocarpa]
Length=1133

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/35 (80%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            L A SEPC++LA  FSIAVDFPKTGVPAEIPS+LR
Sbjct  885  LKAMSEPCVELARKFSIAVDFPKTGVPAEIPSNLR  919



>gb|ABI34311.1| RNA dependent RNA polymerase family protein [Solanum demissum]
Length=963

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA L SIAVDFPKTGVPAEIPS LR
Sbjct  719  PDMAMSDPCKKLAELCSIAVDFPKTGVPAEIPSQLR  754



>gb|ABI34378.1| RNA-directed RNA polymerase, putative [Solanum tuberosum]
Length=1050

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA L SIAVDFPKTGVPAEIPS LR
Sbjct  806  PDMAMSDPCKKLAELCSIAVDFPKTGVPAEIPSQLR  841



>gb|AAT38754.2| RNA-directed RNA polymerase, putative [Solanum demissum]
Length=1021

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA L SIAVDFPKTGVPAEIPS LR
Sbjct  777  PDMAMSDPCKKLAELCSIAVDFPKTGVPAEIPSQLR  812



>emb|CDP05598.1| unnamed protein product [Coffea canephora]
Length=1131

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+PCLKLA L SIAVD+PKTGVPAEIPS LR
Sbjct  870  PQKARSKPCLKLAMLHSIAVDYPKTGVPAEIPSHLR  905



>ref|XP_010236147.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA-dependent RNA polymerase 
1 [Brachypodium distachyon]
Length=1117

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PCL LA LFSIAVD+PKTGVPA+IPSDL
Sbjct  869  LKAESAPCLMLAELFSIAVDYPKTGVPAQIPSDL  902



>ref|XP_002311535.2| hypothetical protein POPTR_0008s13520g [Populus trichocarpa]
 gb|EEE88902.2| hypothetical protein POPTR_0008s13520g [Populus trichocarpa]
Length=1139

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PLMA+S+ C++LA L SIAVDFPKTGVPA+IP +LR
Sbjct  893  PLMARSKECIELARLSSIAVDFPKTGVPAKIPRELR  928



>ref|XP_011021756.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Populus euphratica]
Length=1119

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MAKSE C+KLA L S+AVDFPKTGVPA+IP +LR
Sbjct  875  PDMAKSEKCIKLAQLCSLAVDFPKTGVPAKIPKELR  910



>ref|XP_011028096.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Populus euphratica]
Length=1144

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PLMA+S+ C++LA L SIAVDFPKTGVPA+IP +LR
Sbjct  900  PLMARSKECIELARLSSIAVDFPKTGVPAKIPRELR  935



>gb|KDO60789.1| hypothetical protein CISIN_1g0025861mg, partial [Citrus sinensis]
Length=324

 Score = 57.8 bits (138),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A+SEPCL+LA  FSIAVDFPKTGVPAEIP  L
Sbjct  80   PRKARSEPCLQLAEKFSIAVDFPKTGVPAEIPPHL  114



>ref|XP_006366109.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006366110.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X2 [Solanum 
tuberosum]
Length=1115

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA L SIAVDFPKTGVPAEIP  LR
Sbjct  871  PDMAMSDPCKKLAELCSIAVDFPKTGVPAEIPPQLR  906



>ref|XP_010917515.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X1 
[Elaeis guineensis]
 ref|XP_010917516.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X1 
[Elaeis guineensis]
Length=1129

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A+SE C +LA LFSIAVDFPKTGVPAEIP+ L
Sbjct  883  PLKAESEECTELARLFSIAVDFPKTGVPAEIPTHL  917



>ref|XP_010917517.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X2 
[Elaeis guineensis]
 ref|XP_010917518.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X2 
[Elaeis guineensis]
Length=1075

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A+SE C +LA LFSIAVDFPKTGVPAEIP+ L
Sbjct  829  PLKAESEECTELARLFSIAVDFPKTGVPAEIPTHL  863



>gb|ABO93006.1| putative RNA-dependent RNA-polymerase [Solanum tuberosum]
Length=1065

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S+PC KLA L SIAVDFPKTGVPAEIPS  R
Sbjct  870  PDMAMSDPCKKLAELCSIAVDFPKTGVPAEIPSQWR  905



>ref|XP_006469265.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Citrus sinensis]
Length=1132

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A+SEPCL+LA  FSIAVDFPKTGVPAEIP  L
Sbjct  888  PHKARSEPCLQLAEKFSIAVDFPKTGVPAEIPPHL  922



>gb|ABL68088.1| putative RNA-directed RNA polymerase 1 [Nicotiana attenuata]
Length=1044

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S PC +LA LFSIAV FPKTGVPA IPS LR
Sbjct  801  PAMAMSAPCKQLAQLFSIAVAFPKTGVPAGIPSQLR  836



>gb|AHL27584.1| RNA-dependent RNA polymerase 1 [Salvia miltiorrhiza]
Length=1118

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA S PCL+LA L S+AVDFPKTGVPA+IP  LR
Sbjct  811  PSMALSSPCLELAQLHSVAVDFPKTGVPAQIPPKLR  846



>gb|EMT27792.1| Putative RNA-dependent RNA polymerase 1 [Aegilops tauschii]
Length=1144

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC+KLA LFSIAVD+PKTGVPA+IP +L
Sbjct  901  LKAESTPCIKLAELFSIAVDYPKTGVPAQIPPEL  934



>gb|EMS59066.1| putative RNA-dependent RNA polymerase 1 [Triticum urartu]
Length=947

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC+KLA LFS+AVD+PKTGVPA+IP +L
Sbjct  679  LKAESTPCIKLAELFSVAVDYPKTGVPAQIPGEL  712



>gb|EMS66194.1| RNA-dependent RNA polymerase 1 [Triticum urartu]
Length=1252

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC+KLA LFSIAVD+PKTGVPA+IP +L
Sbjct  908  LKAESTPCIKLAELFSIAVDYPKTGVPAQIPPEL  941



>ref|XP_002315849.2| hypothetical protein POPTR_0010s11560g [Populus trichocarpa]
 gb|EEF02020.2| hypothetical protein POPTR_0010s11560g [Populus trichocarpa]
Length=1119

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA+SE C++LA L SIAVDFPKTGVPA+IP +LR
Sbjct  879  PDMARSEKCIELAQLSSIAVDFPKTGVPAKIPKELR  914



>gb|AHL27585.1| RNA-dependent RNA polymerase 2 [Salvia miltiorrhiza]
Length=1101

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S PCL+LA LFS+AVDFPKTG+PAEIP  LR
Sbjct  870  ALSSPCLELAQLFSVAVDFPKTGIPAEIPPHLR  902



>dbj|BAL63010.1| RNA-dependent RNA polymerase 1 [Cucumis sativus]
Length=1115

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S PC++LA LFSIAVDFPKTGVPA IP++LR
Sbjct  881  PKKAMSNPCIQLAKLFSIAVDFPKTGVPALIPANLR  916



>ref|XP_004498236.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X1 [Cicer 
arietinum]
Length=1126

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  AK+EPC++LA LFSIAVDFPKTG+PA IP  L
Sbjct  880  PAKAKAEPCIELAKLFSIAVDFPKTGIPAVIPPHL  914



>ref|XP_004297425.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Fragaria vesca 
subsp. vesca]
Length=1119

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            A S PCL+LA LFSIAVDFPKTGVPAEIP +L
Sbjct  876  AMSHPCLQLAKLFSIAVDFPKTGVPAEIPPEL  907



>ref|NP_001267682.1| RNA-dependent RNA polymerase 1-like [Cucumis sativus]
 gb|ADU77016.1| RNA-dependent RNA polymerase 1b [Cucumis sativus]
 gb|KGN50762.1| hypothetical protein Csa_5G239640 [Cucumis sativus]
Length=1115

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S PC++LA LFSIAVDFPKTGVPA IP++LR
Sbjct  881  PKKAMSNPCIQLAKLFSIAVDFPKTGVPALIPANLR  916



>gb|EPS70289.1| hypothetical protein M569_04468, partial [Genlisea aurea]
Length=1095

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A+S PCL+LA LFS+AVDFPKTGVPA IP +LR
Sbjct  869  ARSPPCLELAKLFSVAVDFPKTGVPANIPYNLR  901



>ref|XP_004498237.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X2 [Cicer 
arietinum]
Length=1100

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  AK+EPC++LA LFSIAVDFPKTG+PA IP  L
Sbjct  854  PAKAKAEPCIELAKLFSIAVDFPKTGIPAVIPPHL  888



>gb|KEH40645.1| RNA-directed RNA polymerase [Medicago truncatula]
Length=1114

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A SEPC++LA LFSIAVDFPKTG+PA IP +L
Sbjct  869  PAKAMSEPCIELAKLFSIAVDFPKTGIPAVIPREL  903



>gb|KFK24634.1| hypothetical protein AALP_AA8G005100, partial [Arabis alpina]
Length=280

 Score = 55.8 bits (133),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  38   PLKAFSDPCIQLAQKFSIAVDFPKTGVAAEIPQHL  72



>ref|XP_002454320.1| hypothetical protein SORBIDRAFT_04g028630 [Sorghum bicolor]
 gb|EES07296.1| hypothetical protein SORBIDRAFT_04g028630 [Sorghum bicolor]
Length=1114

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/34 (79%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L AKS PCL+LA LFSIAVDFPKTGVPA IP +L
Sbjct  875  LKAKSRPCLELAKLFSIAVDFPKTGVPALIPPEL  908



>ref|XP_008381760.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Malus domestica]
 ref|XP_008381761.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Malus domestica]
Length=1114

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 27/35 (77%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A SEPC +LA LFSIAVDFPKTGVPA IP+ L
Sbjct  866  PLKAMSEPCKELAKLFSIAVDFPKTGVPAVIPAHL  900



>ref|XP_006388173.1| hypothetical protein POPTR_0303s002201g, partial [Populus trichocarpa]
 gb|ERP47087.1| hypothetical protein POPTR_0303s002201g, partial [Populus trichocarpa]
Length=642

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA+SE C++LA L SIAVDFPKTGVPA+IP +LR
Sbjct  398  PDMARSEKCIELAQLSSIAVDFPKTGVPAKIPKELR  433



>ref|XP_007225261.1| hypothetical protein PRUPE_ppa001524mg [Prunus persica]
 gb|EMJ26460.1| hypothetical protein PRUPE_ppa001524mg [Prunus persica]
Length=808

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S+PC++LA LFSIAVDFPKTGVPA IP  LR
Sbjct  560  PSKAMSKPCIELAKLFSIAVDFPKTGVPAIIPQHLR  595



>ref|XP_006849794.1| hypothetical protein AMTR_s00176p00039530 [Amborella trichopoda]
 gb|ERN11375.1| hypothetical protein AMTR_s00176p00039530 [Amborella trichopoda]
Length=1210

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P+ A S PC+ LA+LFS+AVDFPKTGVPA+IP  L
Sbjct  956  PMKADSTPCVDLANLFSVAVDFPKTGVPADIPQHL  990



>ref|XP_010275353.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
 ref|XP_010275424.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
 ref|XP_010275500.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
 ref|XP_010275583.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
 ref|XP_010275643.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
 ref|XP_010275710.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
Length=1136

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A+S+ CL+LA LFSIAVDFPKTGVPAEIP  L
Sbjct  887  PKKAESDACLQLAKLFSIAVDFPKTGVPAEIPQHL  921



>ref|XP_008812977.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Phoenix dactylifera]
 ref|XP_008812978.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Phoenix dactylifera]
Length=1131

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A+SE C++LA LFSIAVDFPKTGVPAEIP+ L
Sbjct  883  PRKAESESCIELARLFSIAVDFPKTGVPAEIPTHL  917



>gb|ACH53360.1| RNA-directed RNA polymerase 1a [Hordeum vulgare]
Length=1114

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S  C+KLA LFSIAVD+PKTGVPA+IPS+L
Sbjct  873  LKAESTQCIKLAELFSIAVDYPKTGVPAQIPSEL  906



>emb|CAN82339.1| hypothetical protein VITISV_039922 [Vitis vinifera]
Length=654

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A  +PC +LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  410  AYCDPCTELAKLFSIAVDFPKTGVPAEIPRNLR  442



>ref|XP_009351561.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Pyrus x bretschneideri]
 ref|XP_009351562.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Pyrus x bretschneideri]
Length=1116

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A SEPC++LA LFSIAVDFPKTGVPA IP+ L
Sbjct  869  LKAMSEPCIELAKLFSIAVDFPKTGVPAVIPAHL  902



>ref|XP_008220919.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Prunus mume]
Length=1123

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S+PC++LA LFSIAVDFPKTGVPA IP  LR
Sbjct  875  PSKAMSKPCIELAKLFSIAVDFPKTGVPAIIPQHLR  910



>ref|XP_002284914.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Vitis vinifera]
Length=1121

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A  +PC +LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  877  AYCDPCTELAKLFSIAVDFPKTGVPAEIPRNLR  909



>ref|NP_001267692.1| RNA-dependent RNA polymerase 1-like [Cucumis sativus]
 gb|ADU77015.1| RNA-dependent RNA polymerase 1a [Cucumis sativus]
Length=1130

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            A+S PCL+LA LFS+AVDFPKTGVPA IPS L
Sbjct  884  ARSSPCLELAKLFSVAVDFPKTGVPAIIPSHL  915



>gb|KGN50761.1| hypothetical protein Csa_5G239140 [Cucumis sativus]
Length=1172

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            A+S PCL+LA LFS+AVDFPKTGVPA IPS L
Sbjct  926  ARSSPCLELAKLFSVAVDFPKTGVPAIIPSHL  957



>ref|XP_007045555.1| Rna-dependent RNA polymerase, putative [Theobroma cacao]
 gb|EOY01387.1| Rna-dependent RNA polymerase, putative [Theobroma cacao]
Length=1125

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A SEPC++LA L SIAVDFPKTGVPA+IP  LR
Sbjct  870  PTKALSEPCIELAKLSSIAVDFPKTGVPAKIPHRLR  905



>emb|CBI26820.3| unnamed protein product [Vitis vinifera]
Length=919

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A  +PC +LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  675  AYCDPCTELAKLFSIAVDFPKTGVPAEIPRNLR  707



>dbj|BAK07758.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S  C+KLA LFSIAVD+PKTGVPA+IPS+L
Sbjct  355  LKAESTQCIKLAELFSIAVDYPKTGVPAQIPSEL  388



>sp|Q0DXS3.2|RDR1_ORYSJ RecName: Full=Probable RNA-dependent RNA polymerase 1; Short=OsRDR1 
[Oryza sativa Japonica Group]
Length=740

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC++LA LFSIAVDFPKTGVPA IP +L
Sbjct  500  LKAESSPCIELAKLFSIAVDFPKTGVPALIPPEL  533



>dbj|BAC84970.1| RNA-directed RNA Polymerase [Vigna unguiculata]
Length=257

 Score = 53.5 bits (127),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/32 (78%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +3

Query  3   PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIP  98
           P  A SE CLKLA LFS AVDFPKTGVPA IP
Sbjct  29  PRKAMSEECLKLAKLFSTAVDFPKTGVPAVIP  60



>gb|EEE57765.1| hypothetical protein OsJ_08301 [Oryza sativa Japonica Group]
Length=1027

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC++LA LFSIAVDFPKTGVPA IP +L
Sbjct  787  LKAESSPCIELAKLFSIAVDFPKTGVPALIPPEL  820



>gb|EAY87440.1| hypothetical protein OsI_08849 [Oryza sativa Indica Group]
Length=1067

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC++LA LFSIAVDFPKTGVPA IP +L
Sbjct  827  LKAESSPCIELAKLFSIAVDFPKTGVPALIPPEL  860



>ref|XP_010670368.1| PREDICTED: RNA-dependent RNA polymerase 1 [Beta vulgaris subsp. 
vulgaris]
Length=1132

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA LFSIAVDFPKTGVPA  P  L
Sbjct  886  PLKAMSDPCIQLAQLFSIAVDFPKTGVPAVTPPAL  920



>gb|AAR91037.1| RNA-directed RNA polymerase 2 [Hordeum vulgare subsp. vulgare]
Length=1115

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S  C+KLA LFSIAVD+PKTGVPA+IPS L
Sbjct  873  LKAESTQCIKLAELFSIAVDYPKTGVPAQIPSKL  906



>ref|XP_008465250.1| PREDICTED: RNA-dependent RNA polymerase 1 [Cucumis melo]
 ref|XP_008465251.1| PREDICTED: RNA-dependent RNA polymerase 1 [Cucumis melo]
 ref|XP_008465252.1| PREDICTED: RNA-dependent RNA polymerase 1 [Cucumis melo]
 ref|XP_008465253.1| PREDICTED: RNA-dependent RNA polymerase 1 [Cucumis melo]
 ref|XP_008465254.1| PREDICTED: RNA-dependent RNA polymerase 1 [Cucumis melo]
Length=1129

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A+S PC++LA  FSIAVDFPKTGVPA IPS L
Sbjct  880  PFKARSSPCVELAKQFSIAVDFPKTGVPAIIPSHL  914



>ref|XP_009356261.1| PREDICTED: LOW QUALITY PROTEIN: probable RNA-dependent RNA polymerase 
1 [Pyrus x bretschneideri]
Length=1112

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A SE C++LA LFSIAVDFPKTGVPA IP  L
Sbjct  868  PLKAMSEECIELAKLFSIAVDFPKTGVPAVIPPQL  902



>ref|XP_004953848.1| PREDICTED: probable RNA-dependent RNA polymerase 1-like [Setaria 
italica]
Length=1123

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/34 (74%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC+KLA LFS+AVDFPKTGVPA IP +L
Sbjct  877  LKAESLPCIKLAKLFSVAVDFPKTGVPALIPPEL  910



>gb|EMT03978.1| Putative RNA-dependent RNA polymerase 1 [Aegilops tauschii]
Length=1056

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S  C+KLA LFSIAVD+PKTGVPA+IP +L
Sbjct  810  LKAESTQCIKLAELFSIAVDYPKTGVPAQIPPEL  843



>ref|XP_007045552.1| RNA-dependent RNA polymerase 1 isoform 1 [Theobroma cacao]
 ref|XP_007045553.1| RNA-dependent RNA polymerase 1 isoform 1 [Theobroma cacao]
 ref|XP_007045554.1| RNA-dependent RNA polymerase 1 isoform 1 [Theobroma cacao]
 gb|EOY01384.1| RNA-dependent RNA polymerase 1 isoform 1 [Theobroma cacao]
 gb|EOY01385.1| RNA-dependent RNA polymerase 1 isoform 1 [Theobroma cacao]
 gb|EOY01386.1| RNA-dependent RNA polymerase 1 isoform 1 [Theobroma cacao]
Length=1109

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/36 (72%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S  C  LA LFSIAVDFPKTGVPAEIP +LR
Sbjct  862  PRKAMSSECKWLAKLFSIAVDFPKTGVPAEIPQELR  897



>gb|ACH53361.1| RNA-directed RNA polymerase 1b [Hordeum vulgare]
Length=1115

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S  C+KLA LFSIAVD+PKTGVPA+IP +L
Sbjct  872  LKAESTQCIKLAELFSIAVDYPKTGVPAQIPHEL  905



>gb|AAR91036.1| RNA-directed RNA polymerase 1 [Hordeum vulgare subsp. vulgare]
Length=1115

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S  C+KLA LFSIAVD+PKTGVPA+IP +L
Sbjct  872  LKAESTQCIKLAELFSIAVDYPKTGVPAQIPHEL  905



>emb|CDP05597.1| unnamed protein product [Coffea canephora]
Length=1187

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CL+LA L SIAVD+PKTGVPAE+PS LR
Sbjct  929  PQKARSNRCLELAKLHSIAVDYPKTGVPAEVPSHLR  964



>ref|NP_001183933.1| putative RNA-dependent RNA polymerase [Zea mays]
 gb|ACT83377.1| putative RNA-dependent RNA polymerase [Zea mays]
Length=1108

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            + A+S PC++LA LFSIAVDFPKTGVPA IP +L
Sbjct  875  MKAESPPCVQLAKLFSIAVDFPKTGVPALIPHEL  908



>gb|AFW73307.1| putative RNA-dependent RNA polymerase [Zea mays]
Length=933

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            + A+S PC++LA LFSIAVDFPKTGVPA IP +L
Sbjct  700  MKAESPPCVQLAKLFSIAVDFPKTGVPALIPHEL  733



>ref|XP_008644240.1| PREDICTED: putative RNA-dependent RNA polymerase isoform X1 [Zea 
mays]
 ref|XP_008644241.1| PREDICTED: putative RNA-dependent RNA polymerase isoform X1 [Zea 
mays]
 ref|XP_008644242.1| PREDICTED: putative RNA-dependent RNA polymerase isoform X1 [Zea 
mays]
Length=1108

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            + A+S PC++LA LFSIAVDFPKTGVPA IP +L
Sbjct  875  MKAESPPCVQLAKLFSIAVDFPKTGVPALIPHEL  908



>gb|ADU77017.1| RNA-dependent RNA polymerase 1c [Cucumis sativus]
Length=400

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S  C+KLA LFSIAVDFPKTGVPA +P +LR
Sbjct  158  AMSAECIKLAKLFSIAVDFPKTGVPANLPRNLR  190



>ref|XP_006416969.1| hypothetical protein EUTSA_v10006629mg [Eutrema salsugineum]
 gb|ESQ35322.1| hypothetical protein EUTSA_v10006629mg [Eutrema salsugineum]
Length=1108

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  866  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  900



>ref|XP_010476552.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Camelina sativa]
Length=1109

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  867  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  901



>ref|XP_010496542.1| PREDICTED: RNA-dependent RNA polymerase 1 [Camelina sativa]
Length=1109

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  867  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  901



>ref|XP_008367010.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Malus domestica]
Length=1113

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+ C++LA LFSIAVDFPKTGVPA IP  L
Sbjct  868  PLKAMSKECIELAKLFSIAVDFPKTGVPAVIPPQL  902



>emb|CDY41107.1| BnaC05g10980D [Brassica napus]
Length=1093

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  851  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  885



>gb|EXX67774.1| hypothetical protein RirG_111310 [Rhizophagus irregularis DAOM 
197198w]
Length=1068

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  AK E C+KLAHL S AVDFPKTG+PA  P +LR
Sbjct  794  PEGAKHESCIKLAHLHSDAVDFPKTGIPASFPLNLR  829



>gb|KEH40649.1| RNA-directed RNA polymerase [Medicago truncatula]
Length=1726

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3     PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
             P  A +EPC++LA LFS+AVDFPKTG+PA IP  L
Sbjct  1481  PGKAMAEPCIELAKLFSVAVDFPKTGIPAVIPPHL  1515



>ref|XP_010546021.1| PREDICTED: RNA-dependent RNA polymerase 2 [Tarenaya hassleriana]
Length=1120

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+SE CL+LA+L S+AVDF KTGVPAE+P DL+
Sbjct  897  PEKARSEKCLQLANLHSMAVDFAKTGVPAEMPFDLK  932



>ref|XP_009148868.1| PREDICTED: RNA-dependent RNA polymerase 1 [Brassica rapa]
Length=1110

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  868  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  902



>emb|CDY45290.1| BnaA06g09600D [Brassica napus]
Length=1109

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  868  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  902



>gb|ADN33705.1| RNA-dependent RNA polymerase [Cucumis melo subsp. melo]
Length=1137

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S  C+KLA LFSIAVDFPKTGVPA +P +LR
Sbjct  891  AMSAECIKLAKLFSIAVDFPKTGVPANLPRNLR  923



>gb|ESA12284.1| hypothetical protein GLOINDRAFT_50177, partial [Rhizophagus irregularis 
DAOM 181602]
Length=806

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  AK E C+KLAHL S AVDFPKTG+PA  P +LR
Sbjct  575  PEGAKHESCIKLAHLHSDAVDFPKTGIPASFPLNLR  610



>gb|ESA19789.1| hypothetical protein GLOINDRAFT_75401 [Rhizophagus irregularis 
DAOM 181602]
Length=870

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  AK E C+KLAHL S AVDFPKTG+PA  P+ LR
Sbjct  580  PEGAKHESCIKLAHLHSDAVDFPKTGIPAVFPTKLR  615



>gb|KGN51474.1| hypothetical protein Csa_5G564290 [Cucumis sativus]
Length=1156

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S  C+KLA LFSIAVDFPKTGVPA +P +LR
Sbjct  874  AMSVECIKLAKLFSIAVDFPKTGVPANLPRNLR  906



>gb|KEH40642.1| RNA-directed RNA polymerase [Medicago truncatula]
Length=1117

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A ++PC++LA LFS AVDFPKTG+PAEIP  L
Sbjct  872  PGKAMADPCVELAKLFSTAVDFPKTGIPAEIPRGL  906



>gb|EXX68450.1| hypothetical protein RirG_105120 [Rhizophagus irregularis DAOM 
197198w]
Length=1087

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  AK E C+KLAHL S AVDFPKTG+PA  P+ LR
Sbjct  797  PEGAKHESCIKLAHLHSDAVDFPKTGIPAVFPTKLR  832



>gb|KEH40641.1| RNA-directed RNA polymerase [Medicago truncatula]
Length=1054

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A ++PC++LA LFS AVDFPKTG+PAEIP  L
Sbjct  809  PGKAMADPCVELAKLFSTAVDFPKTGIPAEIPRGL  843



>ref|XP_002892830.1| RNA-dependent RNA polymerase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69089.1| RNA-dependent RNA polymerase 1 [Arabidopsis lyrata subsp. lyrata]
Length=1107

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FS+AVDFPKTGV AEIP  L
Sbjct  868  PLKAFSDPCIELARKFSVAVDFPKTGVAAEIPQHL  902



>ref|XP_004151456.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Cucumis sativus]
Length=401

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S  C+KLA LFSIAVDFPKTGVPA +P +LR
Sbjct  159  AMSVECIKLAKLFSIAVDFPKTGVPANLPRNLR  191



>ref|XP_008389159.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Malus domestica]
Length=1114

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S  C++LA LFSIAVDFPKTGVPA IP  L
Sbjct  870  PLKAMSXECIELAKLFSIAVDFPKTGVPAVIPPXL  904



>ref|XP_006306626.1| hypothetical protein CARUB_v10008144mg [Capsella rubella]
 gb|EOA39524.1| hypothetical protein CARUB_v10008144mg [Capsella rubella]
Length=1107

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTG+ AEIP  L
Sbjct  867  PLKAFSDPCIELARKFSIAVDFPKTGIAAEIPQHL  901



>ref|XP_002870481.1| RNA-dependent RNA polymerase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46740.1| RNA-dependent RNA polymerase 1 [Arabidopsis lyrata subsp. lyrata]
Length=1097

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FS+AVDFPKTGV AEIP  L
Sbjct  858  PLKAFSDPCIELARKFSVAVDFPKTGVAAEIPQHL  892



>emb|CCD74482.1| RNA-dependent RNA polymerase 1 [Arabidopsis halleri subsp. halleri]
Length=1107

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FS+AVDFPKTGV AEIP  L
Sbjct  868  PLKAFSDPCIELARKFSVAVDFPKTGVAAEIPQHL  902



>ref|XP_008437690.1| PREDICTED: probable RNA-dependent RNA polymerase 1, partial [Cucumis 
melo]
Length=939

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S  C+KLA LFSIAVDFPKTGVPA +P +LR
Sbjct  693  AMSAECIKLAKLFSIAVDFPKTGVPANLPRNLR  725



>ref|XP_010462708.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Camelina sativa]
Length=1000

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FSIAVDFPKTGV AEIP  L
Sbjct  867  PLKAFSDPCIELARKFSIAVDFPKTGVAAEIPQHL  901



>ref|XP_010043968.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Eucalyptus 
grandis]
Length=1115

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S+ C +LA LFSIAVDFPKTGVPA+IP  LR
Sbjct  879  PRKACSKSCTELAELFSIAVDFPKTGVPAKIPCHLR  914



>ref|XP_008367057.1| PREDICTED: RNA-dependent RNA polymerase 1-like, partial [Malus 
domestica]
Length=683

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S  C++LA LFSIAVDFPKTGVPA IP  L
Sbjct  439  PLKAMSAECIELAKLFSIAVDFPKTGVPAVIPPHL  473



>ref|XP_006647856.1| PREDICTED: probable RNA-dependent RNA polymerase 1-like [Oryza 
brachyantha]
Length=1113

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S PC++LA LFSIAVDFPKTGVPA+I  +L
Sbjct  872  LKAESSPCIELAKLFSIAVDFPKTGVPAQIRPEL  905



>ref|XP_010043971.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Eucalyptus 
grandis]
Length=1115

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S+ C +LA LFSIAVDFPKTGVPA+IP  LR
Sbjct  879  PSKACSKSCTELAELFSIAVDFPKTGVPAKIPCHLR  914



>gb|KEH40648.1| RNA-dependent RNA polymerase family protein [Medicago truncatula]
Length=554

 Score = 52.0 bits (123),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIP  98
            P  A SEPC++LA LFSIAVDFPKTG+PA IP
Sbjct  309  PAKAMSEPCIELAKLFSIAVDFPKTGIPAVIP  340



>ref|XP_010066563.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Eucalyptus grandis]
 gb|KCW64487.1| hypothetical protein EUGRSUZ_G02093 [Eucalyptus grandis]
Length=1137

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFSIAVDFPKTGVPA IP +L
Sbjct  883  PGKAMSPECLELARLFSIAVDFPKTGVPAVIPPNL  917



>ref|XP_010093320.1| RNA-dependent RNA polymerase 1 [Morus notabilis]
 gb|EXB53859.1| RNA-dependent RNA polymerase 1 [Morus notabilis]
Length=1133

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  C++LA LFSIAVDFPKTGVPA IP +L
Sbjct  885  PSKAMSPSCIELARLFSIAVDFPKTGVPAVIPQEL  919



>ref|XP_001774552.1| RNA-directed RNA polymerase [Physcomitrella patens]
 gb|EDQ60620.1| RNA-directed RNA polymerase [Physcomitrella patens]
Length=843

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P MA+S  C +LA L S+AVDFPKTGVPA IP +LR
Sbjct  615  PAMARSTACQELAKLVSLAVDFPKTGVPAIIPQNLR  650



>gb|KGN51434.1| hypothetical protein Csa_5G544050 [Cucumis sativus]
Length=646

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S  C+KLA LFSIAVDFPKTGVPA +P +LR
Sbjct  404  AMSVECIKLAKLFSIAVDFPKTGVPANLPRNLR  436



>ref|XP_009381445.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Musa acuminata 
subsp. malaccensis]
Length=1134

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/32 (75%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            A+S  C++LA LFSIAVDFPKTGVPAEIP  L
Sbjct  888  AESMECIELAKLFSIAVDFPKTGVPAEIPPRL  919



>ref|XP_003518619.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X1 [Glycine 
max]
 ref|XP_006574822.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X2 [Glycine 
max]
 ref|XP_006574823.1| PREDICTED: RNA-dependent RNA polymerase 1-like isoform X3 [Glycine 
max]
 gb|KHN15461.1| RNA-dependent RNA polymerase 1 [Glycine soja]
Length=1125

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A S+ C+KLA LFS AVDFPKTGVPA IP +L
Sbjct  882  LKAMSDQCVKLARLFSTAVDFPKTGVPAVIPPEL  915



>ref|XP_010068689.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Eucalyptus grandis]
Length=844

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFSIAVDFPKTGVPA IP +L
Sbjct  590  PGKAMSPECLELARLFSIAVDFPKTGVPAVIPPNL  624



>gb|KCW64478.1| hypothetical protein EUGRSUZ_G020872, partial [Eucalyptus grandis]
Length=334

 Score = 50.4 bits (119),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFSIAVDFPKTGVPA IP +L
Sbjct  80   PGKAMSPECLELARLFSIAVDFPKTGVPAVIPPNL  114



>gb|KCW44299.1| hypothetical protein EUGRSUZ_L022601, partial [Eucalyptus grandis]
Length=316

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFSIAVDFPKTGVPA IP +L
Sbjct  80   PGKAMSPECLELARLFSIAVDFPKTGVPAVIPPNL  114



>ref|XP_010041515.1| PREDICTED: RNA-dependent RNA polymerase 1-like, partial [Eucalyptus 
grandis]
Length=463

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFSIAVDFPKTGVPA IP +L
Sbjct  182  PGKAMSPECLELARLFSIAVDFPKTGVPAVIPPNL  216



>ref|XP_008437692.1| PREDICTED: probable RNA-dependent RNA polymerase 1, partial [Cucumis 
melo]
Length=938

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S  C+KLA LFSIAVDF KTGVPA +P +LR
Sbjct  691  PKKAMSAECIKLAKLFSIAVDFSKTGVPANLPRNLR  726



>ref|XP_010271369.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Nelumbo nucifera]
Length=1134

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            L A+S+ CL+LA LFSIAVDF KTG+PA IPS L
Sbjct  890  LKAESDECLELAKLFSIAVDFNKTGIPARIPSRL  923



>ref|XP_007153213.1| hypothetical protein PHAVU_003G016600g [Phaseolus vulgaris]
 gb|ESW25207.1| hypothetical protein PHAVU_003G016600g [Phaseolus vulgaris]
Length=1145

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFS AVDFPKTGVPA IP +L
Sbjct  907  PGKAMSAQCLQLAKLFSTAVDFPKTGVPAVIPREL  941



>emb|CAA09895.1| RNA-directed RNA polymerase [Triticum aestivum]
Length=107

 Score = 47.8 bits (112),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVP  86
            L A+S PC+KLA LFSIAVDFPKTGVP
Sbjct  81   LKAESTPCIKLAELFSIAVDFPKTGVP  107



>ref|XP_007153214.1| hypothetical protein PHAVU_003G016600g [Phaseolus vulgaris]
 ref|XP_007153215.1| hypothetical protein PHAVU_003G016600g [Phaseolus vulgaris]
 gb|ESW25208.1| hypothetical protein PHAVU_003G016600g [Phaseolus vulgaris]
 gb|ESW25209.1| hypothetical protein PHAVU_003G016600g [Phaseolus vulgaris]
Length=1122

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  CL+LA LFS AVDFPKTGVPA IP +L
Sbjct  884  PGKAMSAQCLQLAKLFSTAVDFPKTGVPAVIPREL  918



>ref|XP_010527810.1| PREDICTED: RNA-dependent RNA polymerase 1 [Tarenaya hassleriana]
Length=1109

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  C++LAH FSIAVDFPKTGV AEIP  L
Sbjct  867  PAKAFSSQCIELAHKFSIAVDFPKTGVAAEIPPHL  901



>ref|XP_010068690.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Eucalyptus grandis]
Length=1093

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A    CL LA LFSIAVDFPKTGVPA IP +L
Sbjct  884  PEKAMCPECLDLARLFSIAVDFPKTGVPAVIPPNL  918



>ref|XP_010066561.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Eucalyptus grandis]
Length=1130

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A    CL LA LFSIAVDFPKTGVPA IP +L
Sbjct  884  PEKAMCPECLDLARLFSIAVDFPKTGVPAVIPPNL  918



>ref|XP_002974914.1| hypothetical protein SELMODRAFT_150191 [Selaginella moellendorffii]
 gb|EFJ23699.1| hypothetical protein SELMODRAFT_150191 [Selaginella moellendorffii]
Length=834

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            L A+   C++LA L+S+AVDFPKTGVPA +P +LR
Sbjct  615  LQARDPKCMELARLYSVAVDFPKTGVPAVMPPELR  649



>ref|XP_006477873.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Citrus sinensis]
 ref|XP_006477874.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Citrus sinensis]
Length=277

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CL+LA L SIAVDF KTGV A IPS LR
Sbjct  48   PDKARSSKCLELAKLSSIAVDFSKTGVAATIPSGLR  83



>gb|EMT03668.1| hypothetical protein F775_11670 [Aegilops tauschii]
Length=363

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  31   PMKARSPECLQLAALHSMAVDFAKTGAPAEMPRSLR  66



>gb|EEE61147.1| hypothetical protein OsJ_15104 [Oryza sativa Japonica Group]
Length=335

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  93   PLKARSPECLQLATLHSMAVDFAKTGAPAEMPRTLR  128



>ref|NP_001053027.1| Os04g0465700 [Oryza sativa Japonica Group]
 dbj|BAF14941.1| Os04g0465700, partial [Oryza sativa Japonica Group]
Length=377

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  135  PLKARSPECLQLATLHSMAVDFAKTGAPAEMPRTLR  170



>ref|XP_010043973.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X1 
[Eucalyptus grandis]
Length=1114

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S+ C++LA L SIAVDFPKTGVPA++P  LR
Sbjct  881  ACSKSCIELAELHSIAVDFPKTGVPAKLPRHLR  913



>gb|AAN64409.1| RNA-dependent RNA polymerase 1 [Arabidopsis thaliana]
Length=1107

 Score = 48.5 bits (114),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FS AVDFPKTGV A IP  L
Sbjct  867  PLKAFSDPCIELAKKFSTAVDFPKTGVAAVIPQHL  901



>ref|NP_172932.1| RNA-dependent RNA polymerase 1 [Arabidopsis thaliana]
 sp|Q9LQV2.1|RDR1_ARATH RecName: Full=RNA-dependent RNA polymerase 1; Short=AtRDRP1; 
AltName: Full=RNA-directed RNA polymerase 1 [Arabidopsis thaliana]
 gb|AAF79241.1|AC006917_26 F10B6.19 [Arabidopsis thaliana]
 dbj|BAF00633.1| putative RNA-directed RNA polymerase [Arabidopsis thaliana]
 gb|AEE29226.1| RNA-dependent RNA polymerase 1 [Arabidopsis thaliana]
Length=1107

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FS AVDFPKTGV A IP  L
Sbjct  867  PLKAFSDPCIELAKKFSTAVDFPKTGVAAVIPQHL  901



>gb|KDP31126.1| hypothetical protein JCGZ_11502 [Jatropha curcas]
Length=1122

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CLKLA L S+AVDF KTG PAE+P  L+
Sbjct  897  PDKARSRKCLKLAELHSMAVDFAKTGAPAEMPRALK  932



>ref|XP_010435459.1| PREDICTED: RNA-dependent RNA polymerase 2-like isoform X2 [Camelina 
sativa]
Length=1136

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LAHL S AVDF KTG PAE+P  L+
Sbjct  903  PEKARSQKCLELAHLHSRAVDFAKTGAPAEMPYALK  938



>ref|XP_010435450.1| PREDICTED: RNA-dependent RNA polymerase 2-like isoform X1 [Camelina 
sativa]
Length=1136

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LAHL S AVDF KTG PAE+P  L+
Sbjct  903  PEKARSQKCLELAHLHSRAVDFAKTGAPAEMPYALK  938



>ref|XP_010455516.1| PREDICTED: RNA-dependent RNA polymerase 2-like [Camelina sativa]
Length=1133

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LAHL S AVDF KTG PAE+P  L+
Sbjct  900  PEKARSQKCLELAHLHSRAVDFAKTGAPAEMPYALK  935



>ref|XP_010422054.1| PREDICTED: RNA-dependent RNA polymerase 2 isoform X1 [Camelina 
sativa]
 ref|XP_010422055.1| PREDICTED: RNA-dependent RNA polymerase 2 isoform X2 [Camelina 
sativa]
Length=1136

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LAHL S AVDF KTG PAE+P  L+
Sbjct  903  PEKARSQKCLELAHLHSRAVDFAKTGAPAEMPYALK  938



>ref|XP_007036161.1| RNA-dependent RNA polymerase 2 isoform 1 [Theobroma cacao]
 ref|XP_007036162.1| RNA-dependent RNA polymerase 2 isoform 1 [Theobroma cacao]
 gb|EOY20662.1| RNA-dependent RNA polymerase 2 isoform 1 [Theobroma cacao]
 gb|EOY20663.1| RNA-dependent RNA polymerase 2 isoform 1 [Theobroma cacao]
Length=1149

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+SE CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  900  PDKARSEKCLELATLHSMAVDFAKTGAPAEMPRSLK  935



>ref|XP_010043975.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X3 
[Eucalyptus grandis]
 gb|KCW85981.1| hypothetical protein EUGRSUZ_B02683 [Eucalyptus grandis]
Length=923

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S+ C++LA L SIAVDFPKTGVPA++P  LR
Sbjct  690  ACSKSCIELAELHSIAVDFPKTGVPAKLPRHLR  722



>ref|XP_010043974.1| PREDICTED: probable RNA-dependent RNA polymerase 1 isoform X2 
[Eucalyptus grandis]
Length=978

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A S+ C++LA L SIAVDFPKTGVPA++P  LR
Sbjct  745  ACSKSCIELAELHSIAVDFPKTGVPAKLPRHLR  777



>ref|XP_002988931.1| hypothetical protein SELMODRAFT_235652 [Selaginella moellendorffii]
 gb|EFJ09960.1| hypothetical protein SELMODRAFT_235652 [Selaginella moellendorffii]
Length=755

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +3

Query  6    LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            L  +   C++LA L+S+AVDFPKTGVPA +P +LR
Sbjct  539  LQTRDPKCMELARLYSVAVDFPKTGVPAVMPPELR  573



>ref|XP_010093336.1| RNA-dependent RNA polymerase 1 [Morus notabilis]
 gb|EXB53891.1| RNA-dependent RNA polymerase 1 [Morus notabilis]
Length=1118

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ C++LA L SIAVDFPKTGV A IP  LR
Sbjct  866  PKKARSKECIELAKLSSIAVDFPKTGVAAIIPPRLR  901



>gb|KDO51480.1| hypothetical protein CISIN_1g0037891mg, partial [Citrus sinensis]
Length=258

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CL+LA L +IAVDF KTGV A IPS LR
Sbjct  30   PDKARSNQCLELAKLSTIAVDFSKTGVAATIPSGLR  65



>gb|EAY94464.1| hypothetical protein OsI_16234 [Oryza sativa Indica Group]
Length=1136

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  894  PLKARSPECLQLATLHSMAVDFAKTGAPAEMPRTLR  929



>sp|Q7XM31.1|RDR2_ORYSJ RecName: Full=Probable RNA-dependent RNA polymerase 2; Short=OsRDR2 
[Oryza sativa Japonica Group]
 emb|CAE04828.1| OSJNBb0048E02.13 [Oryza sativa Japonica Group]
Length=1136

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  894  PLKARSPECLQLATLHSMAVDFAKTGAPAEMPRTLR  929



>ref|XP_006477872.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Citrus sinensis]
Length=1082

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  AKS  CL+LA L SIAVDF KTGV A IPS LR
Sbjct  854  PDKAKSNQCLELAKLSSIAVDFSKTGVAATIPSRLR  889



>ref|XP_010107450.1| RNA-dependent RNA polymerase 2 [Morus notabilis]
 gb|EXC16034.1| RNA-dependent RNA polymerase 2 [Morus notabilis]
Length=1115

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A SE CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  890  PEKAFSENCLQLATLHSMAVDFAKTGAPAEMPRALR  925



>ref|XP_002281315.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Vitis vinifera]
 ref|XP_010650995.1| PREDICTED: probable RNA-dependent RNA polymerase 1 [Vitis vinifera]
Length=1109

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  24   PCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PC +LA LFSIA++FPKTGVPAEIP  L
Sbjct  879  PCKELAKLFSIALEFPKTGVPAEIPFHL  906



>emb|CBI26821.3| unnamed protein product [Vitis vinifera]
Length=943

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  24   PCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PC +LA LFSIA++FPKTGVPAEIP  L
Sbjct  713  PCKELAKLFSIALEFPKTGVPAEIPFHL  740



>ref|XP_003560510.1| PREDICTED: probable RNA-dependent RNA polymerase 2 [Brachypodium 
distachyon]
Length=1138

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  890  PMKARSPECLRLAALHSMAVDFAKTGAPAELPRSLR  925



>gb|ADU04140.1| hypothetical protein [Gossypium hirsutum]
Length=1147

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+SE CL LA L S+AVDF KTG PAE+P  L+
Sbjct  892  PYKARSENCLALATLHSMAVDFAKTGAPAEMPRALK  927



>ref|XP_011028594.1| PREDICTED: RNA-dependent RNA polymerase 2 [Populus euphratica]
Length=1105

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+SE CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  887  PDKARSEKCLQLATLHSMAVDFAKTGAPAEMPLYLK  922



>ref|XP_002321582.1| hypothetical protein POPTR_0015s08500g [Populus trichocarpa]
 gb|EEF05709.1| hypothetical protein POPTR_0015s08500g [Populus trichocarpa]
Length=1110

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+SE CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  887  PDKARSEKCLQLATLHSMAVDFAKTGAPAEMPLYLK  922



>emb|CAN82568.1| hypothetical protein VITISV_040047 [Vitis vinifera]
Length=697

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  24   PCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PC +LA LFSIA++FPKTGVPAEIP  L
Sbjct  423  PCKELAKLFSIALEFPKTGVPAEIPFHL  450



>ref|XP_006653498.1| PREDICTED: probable RNA-dependent RNA polymerase 2-like [Oryza 
brachyantha]
Length=1055

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  843  PLKARSPECLQLATLHSMAVDFAKTGAPAEMPRALR  878



>ref|XP_010093335.1| RNA-dependent RNA polymerase 1 [Morus notabilis]
 gb|EXB53890.1| RNA-dependent RNA polymerase 1 [Morus notabilis]
Length=885

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ C++LA L SIAVD+PKTGV A IP  LR
Sbjct  688  PKKARSKECIELAKLSSIAVDYPKTGVAAIIPGHLR  723



>ref|XP_002511431.1| RNA-dependent RNA polymerase, putative [Ricinus communis]
 gb|EEF52033.1| RNA-dependent RNA polymerase, putative [Ricinus communis]
Length=983

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  742  PDKARSSKCLQLAELHSMAVDFAKTGAPAEMPKALK  777



>ref|XP_003579930.1| PREDICTED: probable RNA-dependent RNA polymerase 2 [Brachypodium 
distachyon]
Length=1140

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  893  PMKARSPECLQLAALHSMAVDFAKTGAPAELPRSLR  928



>gb|EMS53588.1| putative RNA-dependent RNA polymerase 2 [Triticum urartu]
Length=1089

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  860  PMKARSPECLQLAALHSMAVDFAKTGAPAEMPRSLR  895



>ref|XP_004498314.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Cicer arietinum]
Length=1135

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  C++LA L SIAVDF K+GVPAEIP  L
Sbjct  869  PEKAMSHSCIELAKLHSIAVDFAKSGVPAEIPQHL  903



>ref|XP_004978058.1| PREDICTED: probable RNA-dependent RNA polymerase 2-like [Setaria 
italica]
Length=1130

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  897  PLKARSPECLQLAALHSMAVDFAKTGAPAEMPRALR  932



>emb|CAA09894.1| RNA-directed RNA polymerase [Arabidopsis thaliana]
Length=513

 Score = 46.6 bits (109),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            PL A S+PC++LA  FS AVDFPKTGV A IP  L
Sbjct  389  PLKAFSDPCIELAKKFSTAVDFPKTGVAAVIPQHL  423



>gb|EMS60434.1| putative RNA-dependent RNA polymerase 2 [Triticum urartu]
Length=287

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF K+G PAE+P  LR
Sbjct  58   PMKARSPECLQLAALHSMAVDFAKSGAPAEMPRSLR  93



>ref|XP_003528344.1| PREDICTED: RNA-dependent RNA polymerase 1-like [Glycine max]
Length=1135

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S  C +LA L SIAVDF K+GVPAEIP  LR
Sbjct  875  PEKAMSPACTELAKLHSIAVDFAKSGVPAEIPQHLR  910



>ref|XP_007153218.1| hypothetical protein PHAVU_003G016800g [Phaseolus vulgaris]
 gb|ESW25212.1| hypothetical protein PHAVU_003G016800g [Phaseolus vulgaris]
Length=1139

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S  C++LA L S+AVDF K+GVPAE+P  LR
Sbjct  875  PQKAMSPACIELAKLHSVAVDFAKSGVPAEVPQHLR  910



>gb|KHN34545.1| RNA-dependent RNA polymerase 1 [Glycine soja]
Length=959

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A S  C +LA L SIAVDF K+GVPAEIP  LR
Sbjct  699  PEKAMSPACTELAKLHSIAVDFAKSGVPAEIPQHLR  734



>ref|XP_001785643.1| RNA-directed RNA polymerase [Physcomitrella patens]
 gb|EDQ49541.1| RNA-directed RNA polymerase [Physcomitrella patens]
Length=1049

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A    CL+LAHL SIAVDFPKTG  A +P DLR
Sbjct  800  PEGALDSDCLRLAHLASIAVDFPKTGKNATMPHDLR  835



>gb|KEF58006.1| hypothetical protein A1O9_05929 [Exophiala aquamarina CBS 119918]
Length=1396

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  15    KSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
             +S+ CL+L +L S+AVD+PKTGVPA++P DL
Sbjct  981   QSQQCLQLVNLHSMAVDYPKTGVPAQMPRDL  1011



>gb|ABF82437.1| putative RNA-dependent RNA polymerase 6 [Physcomitrella patens]
 gb|ABF82438.1| putative RNA-dependent RNA polymerase 6 [Physcomitrella patens]
Length=1152

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A    CL+LAHL SIAVDFPKTG  A +P DLR
Sbjct  893  PEGALDSDCLRLAHLASIAVDFPKTGKNATMPHDLR  928



>ref|XP_002446635.1| hypothetical protein SORBIDRAFT_06g019330 [Sorghum bicolor]
 gb|EES10963.1| hypothetical protein SORBIDRAFT_06g019330 [Sorghum bicolor]
Length=1128

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  CL+LA L S+AVDF KTG PAE+P  LR
Sbjct  895  PLKARSPECLQLAALHSMAVDFAKTGAPAEMPVALR  930



>gb|KHG14638.1| RNA-dependent RNA polymerase 2 -like protein [Gossypium arboreum]
Length=1147

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+SE CL LA L S+AVDF KTG PAE+P  L+
Sbjct  892  PDKARSENCLALATLHSMAVDFAKTGAPAEMPRALK  927



>gb|KEH40639.1| RNA-directed RNA polymerase [Medicago truncatula]
Length=1140

 Score = 46.2 bits (108),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            P  A S  C++LA L SIAVDF K+GVPAE+P  L
Sbjct  872  PEKAMSHSCIELAKLHSIAVDFAKSGVPAEVPQHL  906



>ref|XP_007750563.1| hypothetical protein A1O5_11803 [Cladophialophora psammophila 
CBS 110553]
 gb|EXJ61487.1| hypothetical protein A1O5_11803 [Cladophialophora psammophila 
CBS 110553]
Length=1412

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = +3

Query  15    KSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
             +SE CLKL  L S+AVD+PKTGVPAE+  DL
Sbjct  972   RSEQCLKLVELHSLAVDYPKTGVPAEMSRDL  1002



>ref|XP_007731848.1| hypothetical protein A1O3_03522 [Capronia epimyces CBS 606.96]
 gb|EXJ86569.1| hypothetical protein A1O3_03522 [Capronia epimyces CBS 606.96]
Length=1427

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 19/31 (61%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +3

Query  15   KSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
            +S+PCL+L +L S AVD+PKTGVP+E+P +L
Sbjct  968  RSQPCLELVNLHSKAVDYPKTGVPSEMPREL  998



>ref|XP_009381640.1| PREDICTED: probable RNA-dependent RNA polymerase 2 [Musa acuminata 
subsp. malaccensis]
Length=1106

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CL+LA+L S AVDF KTG PAE+P  LR
Sbjct  887  PTKARSPKCLELANLHSEAVDFAKTGAPAEMPRVLR  922



>gb|EMT21060.1| hypothetical protein F775_12206 [Aegilops tauschii]
Length=1246

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3     PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
             P+ A+S  CL+LA L S+AVDF K+G PAE+P  LR
Sbjct  987   PMKARSPECLQLAGLHSMAVDFAKSGAPAEMPRSLR  1022



>ref|XP_008711139.1| hypothetical protein HMPREF1541_00611 [Cyphellophora europaea 
CBS 101466]
 gb|ETN46427.1| hypothetical protein HMPREF1541_00611 [Cyphellophora europaea 
CBS 101466]
Length=1344

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/34 (59%), Positives = 25/34 (74%), Gaps = 0/34 (0%)
 Frame = +3

Query  6     LMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDL  107
             L  KS+ CL+L    S +VD+PKTGVPAE+P DL
Sbjct  973   LGVKSDDCLRLVQAHSTSVDYPKTGVPAELPRDL  1006



>ref|XP_010271987.1| PREDICTED: RNA-dependent RNA polymerase 2 [Nelumbo nucifera]
 ref|XP_010271988.1| PREDICTED: RNA-dependent RNA polymerase 2 [Nelumbo nucifera]
Length=1115

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S  CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  892  PSKARSPKCLQLAALHSMAVDFAKTGAPAEMPRVLK  927



>ref|XP_003608944.1| Rna-dependent RNA polymerase [Medicago truncatula]
Length=1308

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            AKS  CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  902  AKSRKCLELAELHSMAVDFAKTGAPAEMPRSLK  934



>gb|EMT05613.1| hypothetical protein F775_19527 [Aegilops tauschii]
Length=897

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF K+G PAE+P  LR
Sbjct  668  PMKARSPECLQLAALHSMAVDFAKSGAPAEMPRSLR  703



>dbj|BAJ85295.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1127

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF K+G PAE+P  LR
Sbjct  898  PMKARSPECLQLAALHSMAVDFAKSGAPAEMPRSLR  933



>gb|AES91141.2| RNA-dependent RNA polymerase family protein [Medicago truncatula]
Length=1277

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            AKS  CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  902  AKSRKCLELAELHSMAVDFAKTGAPAEMPRSLK  934



>gb|KEH31853.1| RNA-dependent RNA polymerase family protein [Medicago truncatula]
Length=1123

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            AKS  CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  902  AKSRKCLELAELHSMAVDFAKTGAPAEMPRSLK  934



>ref|XP_002872551.1| RNA-dependent RNA polymerase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48810.1| RNA-dependent RNA polymerase 2 [Arabidopsis lyrata subsp. lyrata]
Length=1134

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LA+L S AVDF KTG PAE+P  L+
Sbjct  901  PEKARSQKCLELANLHSRAVDFAKTGAPAEMPYALK  936



>gb|EMT07612.1| hypothetical protein F775_11614 [Aegilops tauschii]
Length=1160

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P+ A+S  CL+LA L S+AVDF K+G PAE+P  LR
Sbjct  921  PMKARSPECLQLAALHSMAVDFAKSGAPAEMPRSLR  956



>ref|NP_192851.1| RNA-dependent RNA polymerase 2 [Arabidopsis thaliana]
 sp|O82504.1|RDR2_ARATH RecName: Full=RNA-dependent RNA polymerase 2; Short=AtRDRP2; 
AltName: Full=Protein SILENCING MOVEMENT DEFICIENT 1; AltName: 
Full=RNA-directed RNA polymerase 2 [Arabidopsis thaliana]
 gb|AAC35535.1| similar to hypothetical proteins in Schizosaccharomyces pombe 
(GB:Z98533) and C. elegans (GB:Z48334 and Z78419) [Arabidopsis 
thaliana]
 emb|CAB43048.1| putative RNA-directed RNA polymerase [Arabidopsis thaliana]
 emb|CAB81214.1| putative RNA-directed RNA polymerase [Arabidopsis thaliana]
 gb|AEE82976.1| RNA-dependent RNA polymerase 2 [Arabidopsis thaliana]
Length=1133

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LA+L S AVDF KTG PAE+P  L+
Sbjct  900  PEKARSQKCLELANLHSRAVDFAKTGAPAEMPYALK  935



>gb|KFK44224.1| rna-dependent rna polymerase 2 [Arabis alpina]
Length=1134

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LA+L S AVDF KTG PAE+P  L+
Sbjct  899  PERARSQKCLELANLHSRAVDFAKTGAPAEMPYALK  934



>ref|XP_006286933.1| hypothetical protein CARUB_v10000076mg, partial [Capsella rubella]
 gb|EOA19831.1| hypothetical protein CARUB_v10000076mg, partial [Capsella rubella]
Length=1165

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LA+L S AVDF KTG PAE+P  L+
Sbjct  932  PEKARSQKCLELANLHSRAVDFAKTGAPAEMPYALK  967



>ref|XP_006396953.1| hypothetical protein EUTSA_v10028370mg [Eutrema salsugineum]
 gb|ESQ38406.1| hypothetical protein EUTSA_v10028370mg [Eutrema salsugineum]
Length=1124

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            P  A+S+ CL+LA+L S AVDF KTG PAE+P  L+
Sbjct  898  PEKARSQKCLELANLHSRAVDFAKTGAPAEMPYALK  933



>gb|ERZ99499.1| hypothetical protein GLOINDRAFT_9434 [Rhizophagus irregularis 
DAOM 181602]
Length=1004

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  27   CLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            C  LAHL S AVDFPKTG+PA +P +LR
Sbjct  795  CKALAHLHSDAVDFPKTGIPAIVPQELR  822



>gb|EXX63767.1| hypothetical protein RirG_149260 [Rhizophagus irregularis DAOM 
197198w]
Length=1015

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 19/28 (68%), Positives = 22/28 (79%), Gaps = 0/28 (0%)
 Frame = +3

Query  27   CLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            C  LAHL S AVDFPKTG+PA +P +LR
Sbjct  804  CKALAHLHSDAVDFPKTGIPAIVPQELR  831



>emb|CBN78124.1| RNA-dependent RNA polymerase 1 [Ectocarpus siliculosus]
Length=1102

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+ + CL+LA L S AVDFPK+GVPA  P +L+
Sbjct  791  PLGARCDECLQLAALHSKAVDFPKSGVPAVFPDELK  826



>ref|XP_010037577.1| PREDICTED: RNA-dependent RNA polymerase 2 [Eucalyptus grandis]
 gb|KCW49305.1| hypothetical protein EUGRSUZ_K02861 [Eucalyptus grandis]
Length=1130

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A+SE CL+LA L S+AVDF KTG PAE+P  L+
Sbjct  909  ARSEKCLQLATLHSMAVDFAKTGAPAEMPRVLK  941



>gb|ACR38600.1| unknown [Zea mays]
Length=525

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  C++LA L S+AVDF KTG PAE+P  LR
Sbjct  292  PLKARSPECVQLAALHSMAVDFAKTGAPAEMPLALR  327



>gb|EJK56264.1| hypothetical protein THAOC_23889, partial [Thalassiosira oceanica]
Length=225

 Score = 43.9 bits (102),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  12   AKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            A    C++LA L SIAVDFPK+G+PA +P DL+
Sbjct  79   AGCHECVRLAKLASIAVDFPKSGIPATLPDDLK  111



>ref|XP_008668575.1| PREDICTED: RNA-dependent DNA polymerase isoform X1 [Zea mays]
Length=1091

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  C++LA L S+AVDF KTG PAE+P  LR
Sbjct  858  PLKARSPECVQLAALHSMAVDFAKTGAPAEMPLALR  893



>ref|NP_001183867.1| RNA-dependent DNA polymerase [Zea mays]
 gb|ABD72708.1| RNA-dependent RNA polymerase [Zea mays]
 gb|AEZ01781.1| RNA-dependent DNA polymerase [Zea mays]
 tpg|DAA37405.1| TPA: mediator of paramutation1 [Zea mays]
Length=1127

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  3    PLMAKSEPCLKLAHLFSIAVDFPKTGVPAEIPSDLR  110
            PL A+S  C++LA L S+AVDF KTG PAE+P  LR
Sbjct  894  PLKARSPECVQLAALHSMAVDFAKTGAPAEMPLALR  929



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284