BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7177_g2_i1 len=434 path=[738:0-433]

Length=434
                                                                      Score     E

gb|EYU34780.1|  hypothetical protein MIMGU_mgv1a009577mg                238   1e-74   
sp|P26519.1|G3PC_PETCR  RecName: Full=Glyceraldehyde-3-phosphate ...    236   2e-74   Petroselinum crispum
ref|XP_011097322.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   4e-74   
ref|XP_011098828.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    236   7e-74   
ref|XP_009789769.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    234   2e-73   
gb|AHB86970.1|  glyceraldehyde 3-phosphate dehydrogenase                233   4e-73   
ref|XP_009586920.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    233   6e-73   
emb|CDP16658.1|  unnamed protein product                                233   6e-73   
gb|AFH88395.1|  glyceraldehyde-3-phosphate dehydrogenase                228   2e-72   
gb|AFE48357.1|  glyceraldehyde-3-phosphate dehydrogenase                230   2e-72   
ref|XP_006355964.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    231   6e-72   
gb|ADP37980.1|  glyceraldehyde-3-phosphate dehydrogenase                224   7e-72   
gb|EYU23146.1|  hypothetical protein MIMGU_mgv1a009579mg                230   9e-72   
ref|XP_010320598.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   1e-71   
dbj|BAJ10476.1|  glyceradehyde-3-phosphate dehydrogenase                224   1e-71   
dbj|BAD94800.1|  putative glyceraldehyde-3-phosphate dehydrogenase      224   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AEO45785.1|  glyceraldehyde-3-phosphate dehydrogenase C              229   2e-71   
ref|XP_002270414.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   2e-71   Vitis vinifera
ref|XP_004239353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   2e-71   
dbj|BAH59031.1|  glyceraldehyde-3-phosphate dehydrogenase               224   2e-71   Tulipa gesneriana
dbj|BAJ10716.1|  glyceraldehyde-3-phosphate dehydrogenase               229   2e-71   
emb|CBI27549.3|  unnamed protein product                                230   2e-71   
dbj|BAN45709.1|  putative glycelaldehyde-3-phosphate dehydrogenase      229   3e-71   
gb|AFY06645.1|  glyceraldehyde-3-phosphate dehydrogenase                227   3e-71   
ref|XP_010524280.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    229   3e-71   
ref|XP_007137942.1|  hypothetical protein PHAVU_009G1684001g            224   3e-71   
sp|P34783.1|G3P_ATRNU  RecName: Full=Glyceraldehyde-3-phosphate d...    229   3e-71   Atriplex nummularia
dbj|BAN89461.1|  glyceraldehyde-3-phosphate dehydrogenase C             229   3e-71   
gb|AGL44431.1|  glyceraldehyde-3-phosphate dehydrogenase C2             223   3e-71   
gb|ACY39483.1|  glyceraldehyde-3-phosphate dehydrogenase                224   4e-71   Panax ginseng [Chinese ginseng]
sp|P09094.1|G3PC_TOBAC  RecName: Full=Glyceraldehyde-3-phosphate ...    228   4e-71   Nicotiana tabacum [American tobacco]
gb|ACY39484.1|  glyceraldehyde-3-phosphate dehydrogenase                224   5e-71   Panax ginseng [Chinese ginseng]
ref|XP_007137946.1|  hypothetical protein PHAVU_009G1685001g            224   5e-71   
ref|XP_008353451.1|  PREDICTED: LOW QUALITY PROTEIN: glyceraldehy...    226   6e-71   
ref|XP_007137944.1|  hypothetical protein PHAVU_009G1685001g            224   7e-71   
ref|XP_009606469.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    228   8e-71   
gb|KHN30499.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     228   9e-71   
gb|AGZ90155.1|  glyceraldehyde-3-phosphate dehydrogenase                221   9e-71   
dbj|BAC80257.1|  glyceraldehyde-3-phosphate dehydrogenase               223   1e-70   Houttuynia cordata [chameleon-plant]
ref|XP_003553883.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    227   1e-70   
gb|AFG28406.1|  glyceraldehyde-3-phosphate dehydrogenase C1             227   1e-70   
gb|AAZ05899.1|  glyceraldehyde-3-phosphate dehydrogenase                221   1e-70   Brassica napus [oilseed rape]
gb|ACJ83968.1|  unknown                                                 223   1e-70   Medicago truncatula
gb|ADQ43814.1|  glyceraldehyde-3-phosphate dehydrogenase                227   2e-70   
gb|AIL56405.1|  glyceraldehyde-3-phosphate dehydrogenase                227   2e-70   
ref|XP_009787576.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    227   2e-70   
emb|CAB39974.1|  glyceraldehyde-3-phosphate dehydrogenase               227   2e-70   Nicotiana tabacum [American tobacco]
ref|XP_009616068.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    227   2e-70   
ref|XP_003524483.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   2e-70   
dbj|BAJ34243.1|  unnamed protein product                                225   3e-70   
emb|CAC80385.1|  glyceraldehyde-3-phosphate dehydrogenase               226   3e-70   Marchantia polymorpha
ref|XP_008341346.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   3e-70   
gb|ABV02033.1|  glyceraldehyde 3-phosphate dehydrogenase                226   3e-70   Nicotiana langsdorffii x Nicotiana sanderae
ref|NP_001266254.1|  glyceraldehyde-3-phosphate dehydrogenase           225   3e-70   
gb|AAA33465.1|  glyceraldehyde-3-phosphate dehydrogenase                223   3e-70   Zea mays [maize]
ref|XP_010033372.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   3e-70   
ref|XP_010025353.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   3e-70   
ref|XP_010242342.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   4e-70   
gb|AAM92008.1|AF527779_1  glyceraldehyde 3-phosphate dehydrogenase      226   4e-70   Solanum tuberosum [potatoes]
gb|AGW24628.1|  glyceraldehyde 3-phosphate dehydrogenase                226   5e-70   
ref|XP_004138468.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   5e-70   
ref|NP_001275344.1|  glyceraldehyde-3-phosphate dehydrogenase           226   5e-70   
gb|ABR25332.1|  glyceraldehyde-3-phosphate dehydrogenase                222   5e-70   Oryza sativa Indica Group [Indian rice]
gb|ACS68203.1|  glyceraldehyde-3-phosphate dehydrogenase 2              226   5e-70   
ref|XP_009117998.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    226   5e-70   
ref|XP_007151566.1|  hypothetical protein PHAVU_004G057600g             225   6e-70   
ref|XP_004138467.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   7e-70   
ref|XP_010554228.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   7e-70   
ref|XP_004169444.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   7e-70   
ref|XP_002265988.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   7e-70   Vitis vinifera
gb|AAQ57193.1|  glyceraldehyde-3-phosphate dehydrogenase                224   8e-70   Panax ginseng [Chinese ginseng]
gb|AFO68184.1|  glyceraldehyde-3-phosphate dehydrogenase                221   8e-70   
ref|XP_009402724.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   8e-70   
ref|XP_010554090.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    225   9e-70   
gb|AAR84410.2|  glyceraldehyde 3-phosphate dehydrogenase                225   9e-70   Daucus carota [carrots]
gb|AIX10772.1|  glyceraldehyde-3-phosphate dehydrogenase                225   9e-70   
gb|AFP44108.1|  GAPDH                                                   223   9e-70   
sp|Q39769.1|G3PC_GINBI  RecName: Full=Glyceraldehyde-3-phosphate ...    225   9e-70   Ginkgo biloba [ginkgo]
ref|XP_007044989.1|  Glyceraldehyde-3-phosphate dehydrogenase C2 ...    225   1e-69   
ref|XP_006417122.1|  hypothetical protein EUTSA_v10008131mg             225   1e-69   
gb|AGL44432.1|  glyceraldehyde-3-phosphate dehydrogenase C2             219   1e-69   
emb|CAA06030.1|  glyeraldehyde-3-phosphate dehydrogenase                226   1e-69   Marsilea quadrifolia
gb|ACV86035.1|  glyceraldehyde-3-phosphate dehydrogenase 2              224   1e-69   Festuca arundinacea [tall fescue]
ref|XP_009124017.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   1e-69   
gb|KFK37847.1|  hypothetical protein AALP_AA3G036600                    224   1e-69   
ref|XP_010320554.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   1e-69   
ref|XP_006408221.1|  hypothetical protein EUTSA_v10021083mg             224   1e-69   
ref|XP_007151567.1|  hypothetical protein PHAVU_004G057700g             224   1e-69   
ref|XP_010248875.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   1e-69   
gb|ABI96175.1|  glyceraldehyde-3 phosphate dehydrogenase                224   1e-69   Knorringia sibirica
emb|CDY30032.1|  BnaC05g09880D                                          226   1e-69   
dbj|BAJ10477.1|  glyceraldehyde-3-phosphate dehydrogenase               223   1e-69   
dbj|BAJ33926.1|  unnamed protein product                                224   1e-69   
emb|CDY16090.1|  BnaC08g40330D                                          227   1e-69   
gb|ABR25980.1|  glyceraldehyde-3-phosphate dehydrogenase, cytosolic     220   1e-69   Oryza sativa Indica Group [Indian rice]
gb|KCW61990.1|  hypothetical protein EUGRSUZ_H04673                     227   2e-69   
ref|XP_008441373.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   2e-69   
ref|XP_008340167.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   2e-69   
ref|XP_002535536.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    220   2e-69   Ricinus communis
gb|KFK43602.1|  hypothetical protein AALP_AA1G147800                    224   2e-69   
emb|CDY49358.1|  BnaA05g33200D                                          224   2e-69   
emb|CAI83772.1|  glyceraldehyde-3-phosphate-dehydrogenase               223   2e-69   Lupinus albus
emb|CDY42906.1|  BnaC05g47450D                                          224   2e-69   
gb|ADB98096.1|  glyceraldehyde 3-phosphate dehydrogenase                224   2e-69   Phyllostachys edulis [kikko-chiku]
ref|XP_011073006.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   2e-69   
gb|KHG04670.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...    218   2e-69   
ref|XP_006652435.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   2e-69   
ref|XP_008379147.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-69   
sp|P25861.1|G3PC_ANTMA  RecName: Full=Glyceraldehyde-3-phosphate ...    224   3e-69   Antirrhinum majus [garden snapdragon]
gb|KEH35270.1|  glyceraldehyde-3-phosphate dehydrogenase                222   3e-69   
emb|CAA42103.1|  glycolytic glyceraldehyde 3-phosphate dehydrogenase    224   3e-69   Antirrhinum majus [garden snapdragon]
ref|XP_004310041.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    224   3e-69   
gb|KCW83195.1|  hypothetical protein EUGRSUZ_B00144                     224   3e-69   
ref|XP_009134751.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   3e-69   
ref|XP_010682871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   3e-69   
gb|KDP46338.1|  hypothetical protein JCGZ_10178                         223   3e-69   
ref|XP_009110581.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   4e-69   
gb|KDP26768.1|  hypothetical protein JCGZ_17926                         223   4e-69   
ref|NP_001077530.1|  glyceraldehyde 3-phosphate dehydrogenase GAPC2     223   4e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AFW62861.1|  glyceraldehyde-3-phosphate dehydrogenase3               222   4e-69   
dbj|BAJ10715.1|  glyceraldehyde-3-phosphate dehydrogenase               223   4e-69   
ref|XP_010930058.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   4e-69   
ref|XP_010026741.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   4e-69   
dbj|BAJ83629.1|  glyceraldehyde 3-phosphate dehydrogenase (GAPDH)...    218   4e-69   
ref|XP_010528059.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   4e-69   
gb|EYU22566.1|  hypothetical protein MIMGU_mgv1a009585mg                222   5e-69   
emb|CDX92059.1|  BnaC03g33610D                                          223   5e-69   
gb|ACJ85452.1|  unknown                                                 219   5e-69   Medicago truncatula
ref|XP_006297911.1|  hypothetical protein CARUB_v10013953mg             224   5e-69   
sp|P17878.1|G3PC_MESCR  RecName: Full=Glyceraldehyde-3-phosphate ...    223   5e-69   Mesembryanthemum crystallinum
ref|XP_002509572.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    221   5e-69   Ricinus communis
emb|CAZ76054.1|  glyceraldehyde-3-phosphate dehydrogenase               223   5e-69   Triticum aestivum [Canadian hard winter wheat]
emb|CDY50169.1|  BnaC08g15900D                                          224   5e-69   
dbj|BAJ17660.1|  glyceraldehyde 3-phosphate dehydrogenase               223   6e-69   
gb|ACG36109.1|  glyceraldehyde-3-phosphate dehydrogenase, cytosol...    223   6e-69   Zea mays [maize]
gb|KDO82022.1|  hypothetical protein CISIN_1g019445mg                   222   6e-69   
ref|XP_010495303.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   6e-69   
gb|ACS68202.1|  glyceraldehyde-3-phosphate dehydrogenase 1              223   6e-69   
ref|XP_010458793.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   6e-69   
gb|AGV54709.1|  glyceraldehyde-3-dehydrogenase C subunit                223   6e-69   
ref|XP_006305287.1|  hypothetical protein CARUB_v10009662mg             223   6e-69   
emb|CDY21098.1|  BnaA08g24270D                                          224   6e-69   
ref|XP_010476339.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   6e-69   
gb|AGV54256.1|  glyceraldehyde-3-phosphate dehydrogenase                223   6e-69   
ref|XP_002882331.1|  glyceraldehyde-3-phosphate dehydrogenase C s...    223   6e-69   
ref|XP_007222474.1|  hypothetical protein PRUPE_ppa008227mg             223   6e-69   
gb|AGK63074.1|  glyceraldehyde-3-phosphate dehydrogenase                223   6e-69   
gb|ABK24012.1|  unknown                                                 223   6e-69   Picea sitchensis
ref|XP_003573318.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   6e-69   
gb|AGY80450.1|  glyceraldehyde-3-phosphate                              223   7e-69   
gb|AEP31954.1|  glyceraldehyde-3-phosphate dehydrogenase                223   7e-69   
sp|P26517.1|G3PC1_HORVU  RecName: Full=Glyceraldehyde-3-phosphate...    223   7e-69   Hordeum vulgare [barley]
ref|XP_011086733.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   7e-69   
ref|XP_008222039.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   7e-69   
emb|CDX74199.1|  BnaA03g28480D                                          223   7e-69   
gb|AGN95066.1|  putative glyceraldehyde-3-phosphate dehydrogenase...    223   7e-69   
ref|XP_007217558.1|  hypothetical protein PRUPE_ppa022368mg             223   7e-69   
ref|NP_187062.1|  glyceraldehyde-3-phosphate dehydrogenase C subu...    223   7e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172801.1|  glyceraldehyde 3-phosphate dehydrogenase GAPC2        223   8e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010518444.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   8e-69   
ref|XP_010911739.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    223   8e-69   
ref|XP_010318401.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    222   9e-69   
ref|NP_001234803.1|  glyceraldehyde 3-phosphate dehydrogenase           221   9e-69   
ref|NP_001275277.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    222   1e-68   
sp|P04796.2|G3PC_SINAL  RecName: Full=Glyceraldehyde-3-phosphate ...    222   1e-68   Sinapis alba [bai jie]
ref|XP_003601828.1|  Glyceraldehyde 3-phosphate dehydrogenase           222   1e-68   
ref|XP_002452401.1|  hypothetical protein SORBIDRAFT_04g025120          222   1e-68   Sorghum bicolor [broomcorn]
dbj|BAH20011.1|  AT1G13440                                              222   1e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011045198.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-68   
ref|XP_003573324.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-68   
ref|XP_010103177.1|  Glyceraldehyde-3-phosphate dehydrogenase           222   1e-68   
ref|XP_002298594.1|  glyceraldehyde 3-phosphate dehydrogenase fam...    222   1e-68   Populus trichocarpa [western balsam poplar]
gb|AFV52793.1|  glyceraldehyde 3-phosphate dehydrogenase                222   1e-68   
gb|AAP83583.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      216   1e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010248871.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-68   
ref|XP_008389804.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   1e-68   
ref|XP_010910395.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   1e-68   
gb|EYU25940.1|  hypothetical protein MIMGU_mgv1a009608mg                222   2e-68   
gb|ACF87912.1|  unknown                                                 222   2e-68   Zea mays [maize]
gb|AHW48354.1|  glyceraldehyde-3-phosphate dehydrogenase C2-like ...    222   2e-68   
ref|XP_010677936.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    222   2e-68   
ref|NP_001105385.1|  glyceraldehyde-3-phosphate dehydrogenase 3, ...    222   2e-68   Zea mays [maize]
ref|NP_001105951.1|  LOC100037774                                       222   2e-68   Zea mays [maize]
gb|AFW72189.1|  cytosolic glyceroldehyde-3-phosphate dehydrogenas...    221   2e-68   
ref|XP_007163725.1|  hypothetical protein PHAVU_001G259000g             222   2e-68   
gb|EYU22565.1|  hypothetical protein MIMGU_mgv1a009585mg                221   2e-68   
gb|AAB59010.1|  glyceraldehyde-3-phosphate-dehydrogenase                221   2e-68   Selaginella lepidophylla
ref|XP_002263145.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   2e-68   Vitis vinifera
ref|XP_009597424.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   2e-68   
emb|CBI14856.3|  unnamed protein product                                221   2e-68   
ref|XP_002892749.1|  GAPC-2                                             221   2e-68   
gb|AAM65189.1|  glyceraldehyde-3-phosphate dehydrogenase C subuni...    221   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240046.1|  uncharacterized protein LOC100782924               221   2e-68   
ref|XP_003573317.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   2e-68   
gb|AAA32794.1|  cystolic glyceraldehyde-3-phosphate dehydrogenase       221   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009382908.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   3e-68   
ref|XP_004502328.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-68   
ref|NP_001241184.1|  uncharacterized protein LOC100807342               221   3e-68   
gb|AFK45399.1|  unknown                                                 221   3e-68   
ref|XP_004489569.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-68   
gb|AAV70659.1|  glyceraldehyde-3-phosphate dehydrogenase                221   3e-68   Musa acuminata [banana]
ref|NP_001053139.1|  Os04g0486600                                       221   3e-68   Oryza sativa Japonica Group [Japonica rice]
gb|ABK00054.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      221   3e-68   Marchantia polymorpha
ref|XP_006484037.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-68   
gb|ADZ75465.1|  glyceraldehyde-3-phosphate dehydrogenase                220   3e-68   
ref|XP_004953003.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   3e-68   
ref|XP_006438114.1|  hypothetical protein CICLE_v10032014mg             221   3e-68   
sp|Q41595.1|G3PC_TAXBA  RecName: Full=Glyceraldehyde-3-phosphate ...    221   4e-68   Taxus baccata
gb|AAA33466.1|  glyceraldehyde-3-phosphate dehydrogenase                218   4e-68   Zea mays [maize]
gb|AFD62802.1|  GAPDH2                                                  221   4e-68   
ref|XP_002312644.2|  glyceraldehyde 3-phosphate dehydrogenase fam...    221   4e-68   Populus trichocarpa [western balsam poplar]
gb|AID52923.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      221   4e-68   
ref|XP_009792011.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   4e-68   
ref|XP_006440049.1|  hypothetical protein CICLE_v10021037mg             221   4e-68   
ref|XP_008439417.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    221   4e-68   
gb|AGY14240.1|  glyceraldehyde 3-phosphate dehydrogenase                221   5e-68   
ref|XP_003523131.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   5e-68   
ref|XP_006578692.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   5e-68   
gb|ACJ85080.1|  unknown                                                 220   5e-68   Medicago truncatula
ref|XP_011024076.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   6e-68   
ref|NP_001236129.1|  glyceraldehyde-3-phosphate dehydrogenase           220   7e-68   
ref|XP_010910405.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   7e-68   
ref|NP_001237544.1|  glyceraldehyde-3-dehydrogenase C subunit           220   7e-68   
gb|KHN31916.1|  Glyceraldehyde-3-phosphate dehydrogenase                221   8e-68   
dbj|BAN45710.1|  putative glycelaldehyde-3-phosphate dehydrogenase      220   8e-68   
ref|XP_009387502.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    220   9e-68   
gb|ACX30668.1|  glyceraldehyde-3-phosphate dehydrogenase                220   9e-68   Tamarix hispida
gb|EAY94607.1|  hypothetical protein OsI_16384                          221   1e-67   Oryza sativa Indica Group [Indian rice]
dbj|BAH28852.1|  glyceraldehyde-3-phosphate dehydrogenase               219   1e-67   Ipomoea nil [qian niu]
gb|AFK44506.1|  unknown                                                 218   1e-67   
ref|XP_010907760.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   1e-67   
ref|NP_001060897.1|  Os08g0126300                                       219   1e-67   Oryza sativa Japonica Group [Japonica rice]
gb|AFM93782.1|  glyceraldehyde 3-phosphate dehydrogenase                219   1e-67   
ref|XP_010907761.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   1e-67   
gb|AAA82047.1|  glyceraldehyde-3-phosphate dehydrogenase                219   1e-67   Oryza sativa Indica Group [Indian rice]
pdb|3E6A|O  Chain O, Crystal Structure And Functional Analysis Of...    219   1e-67   
gb|AEQ75490.1|  glyeraldehyde 3-phosphate dehydrogenase                 219   1e-67   
ref|XP_006476982.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-67   
ref|XP_009384257.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-67   
sp|P34921.1|G3PC_DIACA  RecName: Full=Glyceraldehyde-3-phosphate ...    219   2e-67   Dianthus caryophyllus [carnation]
gb|ABR25770.1|  glyceraldehyde-3-phosphate dehydrogenase                213   2e-67   Oryza sativa Indica Group [Indian rice]
sp|P34924.1|G3PC_PINSY  RecName: Full=Glyceraldehyde-3-phosphate ...    219   2e-67   Pinus sylvestris [Scotch pine]
gb|KHG23352.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...    216   2e-67   
ref|XP_004241503.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   2e-67   
ref|WP_036936905.1|  glyceraldehyde-3-phosphate dehydrogenase           219   2e-67   
gb|ACG32987.1|  hypothetical protein                                    217   2e-67   Zea mays [maize]
gb|AFK35824.1|  unknown                                                 219   2e-67   
gb|KHG04963.1|  Glyceraldehyde-3-phosphate dehydrogenase                217   2e-67   
gb|AGZ15367.1|  glyceraldehyde-3-dehydrogenase C subunit                223   2e-67   
ref|NP_001267672.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    219   2e-67   
ref|NP_001291329.1|  glyceraldehyde-3-phosphate dehydrogenase           219   2e-67   
gb|AFW61321.1|  glyceraldehyde-3-phosphate dehydrogenase1 isoform 1     217   3e-67   
ref|XP_003608875.1|  Glyceraldehyde-3-phosphate dehydrogenase           218   3e-67   
ref|XP_008439408.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   3e-67   
gb|AAF64241.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenas...    215   3e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004152516.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   3e-67   
ref|XP_003526975.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   3e-67   
ref|XP_009416004.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   3e-67   
ref|NP_001047348.1|  Os02g0601300                                       218   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105413.1|  glyceraldehyde-3-phosphate dehydrogenase 1, ...    218   4e-67   Zea mays [maize]
gb|ACF84509.1|  unknown                                                 217   4e-67   Zea mays [maize]
gb|EEC73541.1|  hypothetical protein OsI_07948                          219   4e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001289219.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    218   4e-67   
dbj|BAO45907.1|  glyceraldehyde-3 phosphate dehydrogenase               218   4e-67   
ref|XP_004972973.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   4e-67   
gb|ACV86034.1|  glyceraldehyde-3-phosphate dehydrogenase 1              218   4e-67   Festuca arundinacea [tall fescue]
ref|XP_002511235.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    218   4e-67   Ricinus communis
gb|ACZ51445.1|  glyceraldehyde 3-phosphate dehydrogenase                218   5e-67   
ref|XP_002318114.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    218   5e-67   Populus trichocarpa [western balsam poplar]
gb|ACJ11752.1|  glyceraldehyde-3-phosphate dehydrogenase C subunit      218   5e-67   Gossypium hirsutum [American cotton]
ref|XP_002315632.1|  glyceraldehyde 3-phosphate dehydrogenase fam...    218   7e-67   Populus trichocarpa [western balsam poplar]
gb|ACV69976.1|  NAD-dependent glyceraldehyde 3-P dehydrogenase          218   7e-67   Solanum chacoense
ref|XP_004972972.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   7e-67   
ref|XP_006347401.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    218   7e-67   
sp|P26521.1|G3PC_RANAC  RecName: Full=Glyceraldehyde-3-phosphate ...    218   7e-67   Ranunculus acris [cmmon buttercup]
gb|ABA03227.1|  glyceraldehyde-3-phosphate dehydrogenase                218   8e-67   Populus maximowiczii x Populus nigra
emb|CAA09040.1|  glyceraldehyde 3-phosphate dehydrogenase, cytosolic    213   9e-67   Cicer arietinum [garbanzo]
sp|P08477.1|G3PC2_HORVU  RecName: Full=Glyceraldehyde-3-phosphate...    216   9e-67   Hordeum vulgare [barley]
sp|P08735.2|G3PC1_MAIZE  RecName: Full=Glyceraldehyde-3-phosphate...    217   9e-67   Zea mays [maize]
ref|XP_008800944.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    217   1e-66   
gb|EPS61158.1|  hypothetical protein M569_13641                         217   1e-66   
gb|ACR38628.1|  unknown                                                 217   1e-66   
dbj|BAP90376.1|  glyceraldehyde-3 phosphate dehydrogenase               217   1e-66   
gb|AFS33113.1|  glyceraldehyde-3-phosphate dehydrogenase                217   1e-66   
gb|ABK21508.1|  unknown                                                 213   1e-66   
sp|P34922.1|G3PC_PEA  RecName: Full=Glyceraldehyde-3-phosphate de...    217   1e-66   
ref|XP_008677789.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    217   1e-66   
ref|XP_006648814.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    219   1e-66   
gb|AEO72143.1|  glyceraldehyde-3-phosphate dehydrogenase                217   1e-66   
ref|NP_001105700.1|  glyceraldehyde-3-phosphate dehydrogenase 2, ...    217   1e-66   
gb|AFW74419.1|  glyceraldehyde-3-phosphate dehydrogenase2               217   1e-66   
gb|ABK96222.1|  unknown                                                 216   2e-66   
ref|XP_009383337.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-66   
dbj|BAO57271.1|  glyceraldehyde-3-phosphate dehydrogenase               216   2e-66   
ref|XP_010556366.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-66   
ref|XP_011041572.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-66   
ref|XP_010105174.1|  Glyceraldehyde-3-phosphate dehydrogenase           217   2e-66   
ref|WP_014254442.1|  glyceraldehyde-3-phosphate dehydrogenase [         216   2e-66   
ref|XP_011016293.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-66   
dbj|BAJ90709.1|  predicted protein                                      216   2e-66   
ref|XP_009336547.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   3e-66   
gb|AFW61325.1|  glyceraldehyde-3-phosphate dehydrogenase1 isoform 1     217   3e-66   
ref|XP_001783115.1|  predicted protein                                  216   3e-66   
ref|XP_009125005.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   4e-66   
sp|Q42671.1|G3PC_CRAPL  RecName: Full=Glyceraldehyde-3-phosphate ...    216   4e-66   
ref|XP_008239422.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   4e-66   
sp|P26520.1|G3PC_PETHY  RecName: Full=Glyceraldehyde-3-phosphate ...    215   4e-66   
ref|XP_008779385.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    215   4e-66   
ref|XP_011041571.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   5e-66   
gb|ACN59434.1|  glyceraldehyde-3-phosphate dehydrogenase                215   5e-66   
gb|EMT25216.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosol...    216   5e-66   
ref|XP_004515830.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    215   6e-66   
ref|XP_002321679.1|  glyceraldehyde-3-phosphate dehydrogenase fam...    215   6e-66   
sp|P26518.1|G3PC_MAGLI  RecName: Full=Glyceraldehyde-3-phosphate ...    215   6e-66   
gb|KHG15503.1|  Glyceraldehyde-3-phosphate dehydrogenase-2C cytos...    214   6e-66   
emb|CAA04942.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    216   6e-66   
gb|AFD62268.1|  glyceraldehyde-3-phosphate dehydrogenase                215   6e-66   
ref|XP_007210523.1|  hypothetical protein PRUPE_ppa008250mg             215   7e-66   
gb|AFK37585.1|  unknown                                                 211   7e-66   
emb|CAJ38378.1|  glyceraldehyde-3-phosphate dehydrogenase               207   7e-66   
dbj|BAJ04691.1|  glyceraldehyde-3-phosphate dehydrogenase               214   8e-66   
gb|EWM26684.1|  glyceraldehyde-3-phosphate dehydrogenase                213   1e-65   
ref|XP_010240502.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   1e-65   
gb|ADZ55283.1|  glyceraldehyde-3-phosphate dehydrogenase                214   1e-65   
ref|WP_026903012.1|  glyceraldehyde-3-phosphate dehydrogenase           214   1e-65   
ref|XP_006374556.1|  hypothetical protein POPTR_0015s10330g             215   1e-65   
gb|ABQ81648.1|  glyceraldehyde-3-phosphate dehydrogenase                214   1e-65   
ref|WP_039453301.1|  glyceraldehyde-3-phosphate dehydrogenase           214   1e-65   
ref|XP_006656350.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    216   1e-65   
ref|NP_001058309.1|  Os06g0666600                                       216   1e-65   
ref|XP_009766349.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    216   2e-65   
gb|ACJ11728.1|  glyceraldehyde-3-phosphate dehydrogenase                214   2e-65   
gb|AAD10215.1|  glyceraldehyde-3-phosphate dehydrogenase                216   2e-65   
gb|ADB27993.1|  glyceraldehyde-3-phosphate dehydrogenase                209   2e-65   
gb|AAD10214.1|  glyceraldehyde-3-phosphate dehydrogenase                216   2e-65   
gb|AIZ74327.1|  NAD+-dependent glyceraldehyde-3-phosphate dehydro...    216   2e-65   
ref|WP_013444893.1|  glyceraldehyde-3-phosphate dehydrogenase           213   2e-65   
ref|XP_002975979.1|  hypothetical protein SELMODRAFT_175430             214   2e-65   
gb|ABD58899.1|  glyceraldehyde-3-phosphate dehydrogenase                207   2e-65   
ref|XP_001752151.1|  predicted protein                                  214   3e-65   
ref|XP_003323419.2|  glyceraldehyde-3-phosphate dehydrogenase           213   3e-65   
gb|ADD64896.1|  glyceraldehyde-3-phosphate dehydrogenase-like pro...    207   3e-65   
gb|ACL54292.1|  unknown                                                 215   4e-65   
ref|XP_008809607.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   4e-65   
ref|NP_001149357.1|  LOC100282981                                       215   4e-65   
emb|CDL60759.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    209   4e-65   
ref|WP_027622718.1|  glyceraldehyde-3-phosphate dehydrogenase [         213   4e-65   
gb|KDP30962.1|  hypothetical protein JCGZ_11338                         213   4e-65   
ref|XP_009593112.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    215   5e-65   
ref|XP_009414498.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    215   6e-65   
ref|XP_002451619.1|  hypothetical protein SORBIDRAFT_04g004750          214   6e-65   
ref|XP_006659081.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   6e-65   
gb|AEK51009.1|  glyceraldehyde-3-phosphate dehydrogenase                213   6e-65   
ref|XP_004304013.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   7e-65   
gb|KHN31915.1|  Glyceraldehyde-3-phosphate dehydrogenase                212   7e-65   
gb|EIQ80026.1|  glyceraldehyde-3-phosphate dehydrogenase A              208   8e-65   
ref|XP_008799964.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   8e-65   
gb|ABC47829.1|  glyceraldehyde-3-phosphate dehydrogenase                212   9e-65   
sp|Q8NK47.1|G3P_RHIMI  RecName: Full=Glyceraldehyde-3-phosphate d...    212   9e-65   
ref|WP_018335837.1|  glyceraldehyde-3-phosphate dehydrogenase           212   1e-64   
ref|WP_020815601.1|  glyceraldehyde-3-phosphate dehydrogenase [         212   1e-64   
ref|XP_006854435.1|  hypothetical protein AMTR_s00039p00217390          214   1e-64   
ref|WP_015925704.1|  glyceraldehyde-3-phosphate dehydrogenase [         212   1e-64   
gb|EIQ80640.1|  glyceraldehyde 3-phosphate dehydrogenase, C-termi...    206   1e-64   
ref|XP_010941678.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   1e-64   
ref|NP_178071.1|  glyceraldehyde-3-phosphate dehydrogenase GAPCP1       214   1e-64   
gb|AAT10174.1|  putative glyceraldehyde-3-phosphate dehydrogenase       207   1e-64   
ref|XP_002968506.1|  hypothetical protein SELMODRAFT_169833             212   2e-64   
gb|AEB98919.1|  glyceraldehyde-3-phosphate dehydrogenase                211   2e-64   
ref|XP_008800947.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   2e-64   
ref|NP_001046031.1|  Os02g0171100                                       213   2e-64   
ref|WP_004033988.1|  glyceraldehyde-3-phosphate dehydrogenase 2         211   2e-64   
ref|WP_027984341.1|  glyceraldehyde-3-phosphate dehydrogenase           211   2e-64   
ref|WP_024833550.1|  glyceraldehyde-3-phosphate dehydrogenase [         211   2e-64   
ref|XP_006646946.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    213   2e-64   
ref|XP_007037904.1|  Glyceraldehyde-3-phosphate dehydrogenase C s...    211   2e-64   
ref|NP_001130796.1|  glyceraldehyde-3-phosphate dehydrogenase, cy...    213   2e-64   
ref|WP_027627070.1|  glyceraldehyde-3-phosphate dehydrogenase [         211   2e-64   
ref|WP_014314238.1|  glyceraldehyde-3-phosphate dehydrogenase           211   2e-64   
ref|WP_004630008.1|  glyceraldehyde-3-phosphate dehydrogenase, ty...    211   2e-64   
ref|XP_010914235.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    214   2e-64   
gb|ACN40575.1|  unknown                                                 213   2e-64   
ref|XP_010693410.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   2e-64   
ref|WP_004616627.1|  glyceraldehyde-3-phosphate dehydrogenase [         211   2e-64   
ref|XP_011016312.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   2e-64   
gb|ELU44274.1|  glyceraldehyde-3-phosphate dehydrogenase                210   3e-64   
ref|XP_010064086.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   3e-64   
gb|EGV99678.1|  Glyceraldehyde-3-phosphate dehydrogenase                205   4e-64   
ref|XP_002315071.2|  hypothetical protein POPTR_0010s17930g             213   4e-64   
ref|XP_004304011.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   4e-64   
gb|AGH55663.1|  glyceraldehyde-3-phosphate dehydrogenase                209   4e-64   
ref|XP_001781685.1|  predicted protein                                  213   4e-64   
gb|EHC56973.1|  NAD-dependent glyceraldehyde-3-phosphate dehydrog...    204   4e-64   
ref|XP_010429843.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   4e-64   
gb|AEK81537.1|  glyceraldehyde-3-phosphate dehydrogenase                210   5e-64   
emb|CAC80386.1|  glyceraldehyde-3-phosphate dehydrogenase               213   5e-64   
gb|ETM55579.1|  glyceraldehyde-3-phosphate dehydrogenase, cytosolic     204   5e-64   
ref|XP_004248314.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   5e-64   
gb|ABK24753.1|  unknown                                                 213   5e-64   
gb|AGG40757.1|  glyceraldehyde-3-phosphate dehydrogenase                203   5e-64   
emb|CCF46579.1|  glyceraldehyde 3-phosphate dehydrogenase               204   5e-64   
ref|XP_009399260.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   5e-64   
ref|XP_010472812.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    213   5e-64   
emb|CBY85305.1|  glyceraldehyde-3-phosphate dehydrogenase               206   6e-64   
gb|AEK51007.1|  glyceraldehyde-3-phosphate dehydrogenase                210   6e-64   
ref|WP_013632878.1|  glyceraldehyde-3-phosphate dehydrogenase           209   6e-64   
ref|XP_011013977.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   6e-64   
ref|XP_003547755.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    212   7e-64   
gb|ABK96988.1|  glyceraldehyde-3-phosphate dehydrogenase                208   7e-64   
ref|XP_002889251.1|  GAPCP-1                                            212   7e-64   
ref|WP_021987512.1|  glyceraldehyde-3-phosphate dehydrogenase type I    210   7e-64   
gb|ABI97977.1|  glyceraldehyde-3-phosphate dehydrogenase                209   8e-64   
gb|EMI36904.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        208   8e-64   
ref|WP_027199762.1|  glyceraldehyde-3-phosphate dehydrogenase           209   9e-64   
gb|EHC63611.1|  NAD-dependent glyceraldehyde-3-phosphate dehydrog...    203   9e-64   
gb|ABY50087.1|  glyceraldehyde-3-phosphate dehydrogenase                204   9e-64   
ref|XP_008776392.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   9e-64   
gb|EHD03078.1|  NAD-dependent glyceraldehyde-3-phosphate dehydrog...    203   9e-64   
ref|WP_000441847.1|  hypothetical protein                               203   9e-64   
ref|XP_002513328.1|  glyceraldehyde 3-phosphate dehydrogenase, pu...    212   9e-64   
ref|XP_001781691.1|  predicted protein                                  212   9e-64   
ref|XP_010276220.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    212   9e-64   
ref|XP_007149305.1|  hypothetical protein PHAVU_005G059200g             212   1e-63   
gb|EHC71150.1|  NAD-dependent glyceraldehyde-3-phosphate dehydrog...    202   1e-63   
ref|XP_001507900.2|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    204   1e-63   
ref|WP_010251552.1|  glyceraldehyde-3-phosphate dehydrogenase           209   1e-63   
gb|ETK95906.1|  glyceraldehyde-3-phosphate dehydrogenase, cytosolic     204   1e-63   
gb|EHC87899.1|  NAD-dependent glyceraldehyde-3-phosphate dehydrog...    202   1e-63   
gb|KHN22160.1|  Glyceraldehyde-3-phosphate dehydrogenase, cytosolic     211   1e-63   
gb|AEK51006.1|  glyceraldehyde-3-phosphate dehydrogenase                209   1e-63   
ref|WP_022062987.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    209   1e-63   
ref|WP_000310938.1|  hypothetical protein                               202   1e-63   
gb|KEL82383.1|  glyceraldehyde-3-phosphate dehydrogenase, type I        207   1e-63   
ref|WP_013097053.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    209   1e-63   
ref|WP_017372953.1|  glyceraldehyde-3-phosphate dehydrogenase           209   2e-63   
gb|EYU33796.1|  hypothetical protein MIMGU_mgv1a006939mg                211   2e-63   
ref|XP_011095736.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   2e-63   
ref|WP_027361406.1|  glyceraldehyde-3-phosphate dehydrogenase           209   2e-63   
ref|WP_012132666.1|  glyceraldehyde-3-phosphate dehydrogenase           209   2e-63   
gb|EQB56736.1|  glyceraldehyde-3-phosphate dehydrogenase                209   2e-63   
ref|XP_004951761.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    211   2e-63   
gb|AEK51005.1|  glyceraldehyde-3-phosphate dehydrogenase                209   2e-63   
ref|XP_006352588.1|  PREDICTED: glyceraldehyde 3-phosphate dehydr...    211   2e-63   
gb|KDF05605.1|  glyceraldehyde-3-phosphate dehydrogenase A              208   2e-63   
ref|XP_007273614.1|  glyceraldehyde-3-phosphate dehydrogenase           209   2e-63   
dbj|GAL48860.1|  glyceraldehyde-3-phosphate dehydrogenase A             208   2e-63   
ref|WP_038154402.1|  glyceraldehyde-3-phosphate dehydrogenase           208   2e-63   
emb|CCJ96432.1|  NAD-dependent glyceraldehyde-3-phosphate dehydro...    205   2e-63   
gb|ADB23414.1|  glyceraldehyde-3-phosphate dehydrogenase                203   2e-63   
ref|XP_010531997.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    209   2e-63   
gb|ADJ96634.1|  glyceraldehyde-3-phosphate dehydrogenase                211   2e-63   
dbj|BAJ86344.1|  predicted protein                                      211   2e-63   
ref|XP_006691026.1|  glyceraldehyde-3-phosphate dehydrogenase-lik...    208   2e-63   
ref|WP_003512173.1|  glyceraldehyde-3-phosphate dehydrogenase           208   2e-63   
ref|XP_003596039.1|  Glyceraldehyde-3-phosphate dehydrogenase           210   2e-63   
ref|XP_010417618.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   2e-63   
sp|P53430.3|G3P_MONPU  RecName: Full=Glyceraldehyde-3-phosphate d...    208   2e-63   
ref|WP_031626243.1|  hypothetical protein                               202   2e-63   
ref|XP_006302200.1|  hypothetical protein CARUB_v10020208mg             212   2e-63   
gb|ABK00063.1|  cytosolic glyceraldehyde-3-phosphate dehydrogenase      208   2e-63   
dbj|BAC76899.1|  glyceraldehyde 3-phosphate dehydrogenase               206   2e-63   
ref|XP_004154566.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   2e-63   
ref|XP_002312235.1|  glyceraldehyde 3-phosphate dehydrogenase 1 f...    211   2e-63   
ref|XP_006307603.1|  hypothetical protein CARUB_v10009227mg             211   3e-63   
gb|EPS34987.1|  hypothetical protein PDE_09952                          208   3e-63   
ref|XP_004139839.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    211   3e-63   
ref|WP_006174810.1|  glyceraldehyde-3-phosphate dehydrogenase           208   3e-63   
ref|WP_008807628.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    208   3e-63   
gb|EFB16500.1|  hypothetical protein PANDA_013435                       205   3e-63   
ref|XP_006416830.1|  hypothetical protein EUTSA_v10007716mg             211   3e-63   
gb|AEK51003.1|  glyceraldehyde-3-phosphate dehydrogenase                208   3e-63   
ref|WP_020884442.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    208   3e-63   
ref|WP_004203784.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    208   3e-63   
ref|WP_014169641.1|  glyceraldehyde-3-phosphate dehydrogenase           208   3e-63   
ref|WP_014831506.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    208   3e-63   
gb|ESG13378.1|  glyceraldehyde-3-phosphate dehydrogenase A              203   3e-63   
gb|AFK39182.1|  unknown                                                 209   3e-63   
ref|WP_002901243.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    207   3e-63   
gb|AAK15537.1|AF339926_1  glyceraldehyde-3-phosphate dehydrogenase      208   4e-63   
dbj|BAC06416.1|  glyceraldehyde-3-phosphate dehydrogenase               208   4e-63   
ref|XP_010476736.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    210   4e-63   
ref|WP_039058166.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
dbj|GAB50099.1|  glyceraldehyde-3-phosphate dehydrogenase A             208   4e-63   
ref|WP_041145107.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|WP_004220357.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|WP_006819573.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|NP_001080567.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|WP_021312945.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|WP_004101269.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    207   4e-63   
ref|WP_004860805.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    207   4e-63   
ref|WP_015874677.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|XP_002924160.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    205   4e-63   
ref|WP_023311257.1|  MULTISPECIES: glyceraldehyde-3-phosphate deh...    207   4e-63   
ref|XP_006751428.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    204   4e-63   
ref|WP_029093496.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
ref|WP_040459475.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
gb|AFU25707.1|  glyceraldehyde-3-phosphate dehydrogenase                206   4e-63   
ref|XP_008371994.1|  PREDICTED: glyceraldehyde-3-phosphate dehydr...    210   4e-63   
ref|WP_035894601.1|  glyceraldehyde-3-phosphate dehydrogenase           207   4e-63   
emb|CDY25342.1|  BnaC01g30110D                                          210   4e-63   



>gb|EYU34780.1| hypothetical protein MIMGU_mgv1a009577mg [Erythranthe guttata]
Length=337

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLT R+ KAASYD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTVRLSKAASYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E SMKGILGYTEDDVVSTDFVGD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  269  ETSMKGILGYTEDDVVSTDFVGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  328

Query  74   LIRHMASSA  48
            LIRHMAS A
Sbjct  329  LIRHMASVA  337



>sp|P26519.1|G3PC_PETCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Petroselinum crispum]
 emb|CAA42902.1| glyceraldehyde 3-phosphate dehydrogenase [Petroselinum crispum]
Length=336

 Score =   236 bits (603),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLTAR+EKAA+YD+IK AIK ES
Sbjct  208  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTARLEKAATYDEIKAAIKHES  267

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E S+KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  268  ETSLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  327

Query  74   LIRHMASSA  48
            LIRHMAS A
Sbjct  328  LIRHMASVA  336



>ref|XP_011097322.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sesamum indicum]
Length=337

 Score =   236 bits (602),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 122/129 (95%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLTAR+EKAASYD+IK AIK+ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTARLEKAASYDEIKAAIKKES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E ++KGILGYTEDDVVSTDFVGD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRVVD
Sbjct  269  ETNLKGILGYTEDDVVSTDFVGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASSA  48
            LIRHMAS A
Sbjct  329  LIRHMASVA  337



>ref|XP_011098828.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Sesamum indicum]
Length=337

 Score =   236 bits (601),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/129 (88%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLTAR+EKAA+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTARLEKAATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E +MKGILGYTEDDVVSTDFVGD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRVVD
Sbjct  269  ETNMKGILGYTEDDVVSTDFVGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASSA  48
            LIRHMA  A
Sbjct  329  LIRHMAKVA  337



>ref|XP_009789769.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana sylvestris]
Length=337

 Score =   234 bits (597),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/129 (87%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLTAR+EKAA+YD+IK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTARLEKAATYDEIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVS+DFVGD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  269  EGKMKGILGYTEDDVVSSDFVGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  328

Query  74   LIRHMASSA  48
            LIRHMA+ A
Sbjct  329  LIRHMATVA  337



>gb|AHB86970.1| glyceraldehyde 3-phosphate dehydrogenase [Sedum alfredii]
Length=337

 Score =   233 bits (595),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/128 (87%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAA+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGALKGILGYTEDDVVSTDFLGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  329  LISHMAST  336



>ref|XP_009586920.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana tomentosiformis]
Length=337

 Score =   233 bits (594),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLTAR++KAA+YD+IK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTARLQKAATYDEIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVS+DFVGD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  269  EGKMKGILGYTEDDVVSSDFVGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  328

Query  74   LIRHMASSA  48
            LIRHMA+ A
Sbjct  329  LIRHMATVA  337



>emb|CDP16658.1| unnamed protein product [Coffea canephora]
Length=337

 Score =   233 bits (594),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 112/128 (88%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLTAR+EKAA+YD+IK A+KEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTARLEKAATYDEIKAAMKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E ++KGILGYTEDDVVS+DFVGDS SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRVVD
Sbjct  269  ETNLKGILGYTEDDVVSSDFVGDSRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA S
Sbjct  329  LIRHMAKS  336



>gb|AFH88395.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Eriobotrya 
japonica]
Length=223

 Score =   228 bits (581),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKEES
Sbjct  95   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKGASYDQIKAAIKEES  154

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  155  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  214

Query  74   LIRHMASSA  48
            LI H+AS+ 
Sbjct  215  LIVHVASTC  223



>gb|AFE48357.1| glyceraldehyde-3-phosphate dehydrogenase [Cuscuta pentagona]
Length=296

 Score =   230 bits (587),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT RIEK A+YDD+K AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRIEKKATYDDVKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGYTE+DVVS+DFVGDS SSIFDAKAGIALN NF+KF++WYDNEWGYS+RV+D
Sbjct  227  EGSLKGILGYTEEDVVSSDFVGDSRSSIFDAKAGIALNDNFLKFVAWYDNEWGYSSRVID  286

Query  74   LIRHMASSA  48
            LIRHM S A
Sbjct  287  LIRHMHSVA  295



>ref|XP_006355964.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Solanum tuberosum]
Length=337

 Score =   231 bits (588),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLTARI+K+A+YD+IK A+K ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTARIQKSATYDEIKAALKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG+MKGILGYTEDDVVS+DF+GD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  269  EGNMKGILGYTEDDVVSSDFIGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  328

Query  74   LIRHMAS  54
            LIRHM++
Sbjct  329  LIRHMST  335



>gb|ADP37980.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica napus]
Length=145

 Score =   224 bits (570),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  18   IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  77

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  78   EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  137

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  138  LIVHMSKA  145



>gb|EYU23146.1| hypothetical protein MIMGU_mgv1a009579mg [Erythranthe guttata]
Length=337

 Score =   230 bits (586),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGNLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI+H+A++
Sbjct  329  LIKHIAAT  336



>ref|XP_010320598.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
isoform X2 [Solanum lycopersicum]
Length=309

 Score =   229 bits (584),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLTARI+K+A+YD+IK A+K ES
Sbjct  181  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTARIQKSATYDEIKAALKAES  240

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            +G+MKGILGYTEDDVVS+DF+GD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  241  QGNMKGILGYTEDDVVSSDFIGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  300

Query  74   LIRHMAS  54
            LIRHM++
Sbjct  301  LIRHMST  307



>dbj|BAJ10476.1| glyceradehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=160

 Score =   224 bits (570),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  33   IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  92

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  93   EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  152

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  153  LIIHMSKA  160



>dbj|BAD94800.1| putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
Length=160

 Score =   224 bits (570),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  33   IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  92

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  93   EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  152

Query  74   LIRHMA  57
            LI HM+
Sbjct  153  LIVHMS  158



>gb|AEO45785.1| glyceraldehyde-3-phosphate dehydrogenase C [Scoparia dulcis]
Length=337

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGNLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNENFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+H+AS
Sbjct  329  LIKHIAS  335



>ref|XP_002270414.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Vitis vinifera]
Length=339

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD++K AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEVKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNANFLKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  332  LIRHMAS  338



>ref|XP_004239353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
isoform X1 [Solanum lycopersicum]
Length=337

 Score =   229 bits (585),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLTARI+K+A+YD+IK A+K ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTARIQKSATYDEIKAALKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            +G+MKGILGYTEDDVVS+DF+GD  SSIFDAKAGIALNGNF+K +SWYDNEWGYSNRV+D
Sbjct  269  QGNMKGILGYTEDDVVSSDFIGDCRSSIFDAKAGIALNGNFVKVVSWYDNEWGYSNRVID  328

Query  74   LIRHMAS  54
            LIRHM++
Sbjct  329  LIRHMST  335



>dbj|BAH59031.1| glyceraldehyde-3-phosphate dehydrogenase [Tulipa gesneriana]
Length=195

 Score =   224 bits (572),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+ IK AIKEES
Sbjct  67   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEQIKAAIKEES  126

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY EDD+VS+DFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  127  EGKLKGILGYVEDDLVSSDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  186

Query  74   LIRHMASS  51
            LIRH+A++
Sbjct  187  LIRHIAAT  194



>dbj|BAJ10716.1| glyceraldehyde-3-phosphate dehydrogenase [Cladopus doianus]
Length=337

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK+A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKMKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNSNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  329  LIVHMAST  336



>emb|CBI27549.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   230 bits (587),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD++K AIKEES
Sbjct  253  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEVKAAIKEES  312

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  313  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNANFLKLVSWYDNEWGYSSRVID  372

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  373  LIRHMAS  379



>dbj|BAN45709.1| putative glycelaldehyde-3-phosphate dehydrogenase, partial [Pyrus 
pyrifolia var. culta]
Length=334

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASYD IK AIKEES
Sbjct  206  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYDQIKAAIKEES  265

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  266  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  325

Query  74   LIRHMASSA  48
            LI H+AS+ 
Sbjct  326  LIVHVASTC  334



>gb|AFY06645.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Carica papaya]
Length=272

 Score =   227 bits (578),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD +K AIKE S
Sbjct  144  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDQVKAAIKEAS  203

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  204  EGSLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFLKLVSWYDNEWGYSSRVVD  263

Query  74   LIRHMAS  54
            LIR++AS
Sbjct  264  LIRYIAS  270



>ref|XP_010524280.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Tarenaya hassleriana]
Length=338

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK ASYD++K AIKEE+
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYDEVKNAIKEEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGRLKGIVGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFLKLVSWYDNEWGYSCRVVD  328

Query  74   LIRHMASSA  48
            LIRHMAS+A
Sbjct  329  LIRHMASAA  337



>ref|XP_007137942.1| hypothetical protein PHAVU_009G1684001g, partial [Phaseolus vulgaris]
 gb|ESW09936.1| hypothetical protein PHAVU_009G1684001g, partial [Phaseolus vulgaris]
Length=185

 Score =   224 bits (570),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+DIKKAIKEES
Sbjct  56   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEDIKKAIKEES  115

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K + WYDNEWGYS+RV+D
Sbjct  116  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVMWYDNEWGYSSRVID  175

Query  74   LIRHMA  57
            L+ H+A
Sbjct  176  LLVHVA  181



>sp|P34783.1|G3P_ATRNU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase; Short=GAPDH 
[Atriplex nummularia]
 gb|AAA03442.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia]
 emb|CAA53269.1| glyceraldehyde-3-phosphate dehydrogenase [Atriplex nummularia]
Length=360

 Score =   229 bits (585),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGI LNGNF+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGICLNGNFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LIRHM+ +
Sbjct  329  LIRHMSKT  336



>dbj|BAN89461.1| glyceraldehyde-3-phosphate dehydrogenase C [Shorea beccariana]
Length=341

 Score =   229 bits (583),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKGATYEDIKTAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  332  LIVHMAS  338



>gb|AGL44431.1| glyceraldehyde-3-phosphate dehydrogenase C2 [Arachis hypogaea]
Length=186

 Score =   223 bits (569),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK+AIKEES
Sbjct  59   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKPATYDEIKQAIKEES  118

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  119  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKIVSWYDNEWGYSTRVVD  178

Query  74   LIRHMA  57
            LI H+A
Sbjct  179  LIVHIA  184



>gb|ACY39483.1| glyceraldehyde-3-phosphate dehydrogenase [Panax ginseng]
 gb|ACY39485.1| glyceraldehyde-3-phosphate dehydrogenase [Panax ginseng]
 gb|ACY39486.1| glyceraldehyde-3-phosphate dehydrogenase [Panax ginseng]
 gb|ACY39487.1| glyceraldehyde-3-phosphate dehydrogenase [Panax ginseng]
Length=217

 Score =   224 bits (572),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASY++IK  IKEES
Sbjct  89   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYEEIKAVIKEES  148

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYS RVVD
Sbjct  149  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNENFVKLVTWYDNEWGYSTRVVD  208

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  209  LIVHIAS  215



>sp|P09094.1|G3PC_TOBAC RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic, 
partial [Nicotiana tabacum]
 gb|AAA34077.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Nicotiana 
tabacum]
Length=326

 Score =   228 bits (581),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYDDIK AIKEES
Sbjct  198  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDDIKAAIKEES  257

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILG+TEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  258  EGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  317

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  318  LICHMASVA  326



>gb|ACY39484.1| glyceraldehyde-3-phosphate dehydrogenase [Panax ginseng]
Length=217

 Score =   224 bits (571),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASY++IK  IKEES
Sbjct  89   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYEEIKAVIKEES  148

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYS RVVD
Sbjct  149  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNENFVKLVTWYDNEWGYSTRVVD  208

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  209  LIVHIAS  215



>ref|XP_007137946.1| hypothetical protein PHAVU_009G1685001g [Phaseolus vulgaris]
 gb|ESW09940.1| hypothetical protein PHAVU_009G1685001g [Phaseolus vulgaris]
Length=207

 Score =   224 bits (570),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+DIKKAIKEES
Sbjct  78   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEDIKKAIKEES  137

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K + WYDNEWGYS+RV+D
Sbjct  138  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVMWYDNEWGYSSRVID  197

Query  74   LIRHMA  57
            L+ H+A
Sbjct  198  LLVHVA  203



>ref|XP_008353451.1| PREDICTED: LOW QUALITY PROTEIN: glyceraldehyde-3-phosphate dehydrogenase 
2, cytosolic-like [Malus domestica]
Length=296

 Score =   226 bits (577),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIK+ES
Sbjct  168  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDEIKNAIKKES  227

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYT++DVVSTDFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  228  EGSMKGILGYTDEDVVSTDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  287

Query  74   LIRHMAS  54
            LIRH+AS
Sbjct  288  LIRHIAS  294



>ref|XP_007137944.1| hypothetical protein PHAVU_009G1685001g, partial [Phaseolus vulgaris]
 ref|XP_007137945.1| hypothetical protein PHAVU_009G1685001g, partial [Phaseolus vulgaris]
 gb|ESW09938.1| hypothetical protein PHAVU_009G1685001g, partial [Phaseolus vulgaris]
 gb|ESW09939.1| hypothetical protein PHAVU_009G1685001g, partial [Phaseolus vulgaris]
Length=218

 Score =   224 bits (570),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+DIKKAIKEES
Sbjct  89   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEDIKKAIKEES  148

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K + WYDNEWGYS+RV+D
Sbjct  149  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVMWYDNEWGYSSRVID  208

Query  74   LIRHMA  57
            L+ H+A
Sbjct  209  LLVHVA  214



>ref|XP_009606469.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana tomentosiformis]
 ref|XP_009780356.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana sylvestris]
Length=340

 Score =   228 bits (580),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/129 (86%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYDDIK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDDIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILG+TEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  332  LICHMASVA  340



>gb|KHN30499.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=338

 Score =   228 bits (580),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LN KLTGM+FRVPT DVSVVDLT R+EK ASYD+IK AIKE S
Sbjct  211  IPSSTGAAKAVGKVLPSLNNKLTGMSFRVPTVDVSVVDLTVRLEKGASYDEIKAAIKEAS  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVSTDFVGD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGSMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGISLNNNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  331  LIRHMAS  337



>gb|AGZ90155.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Litsea cubeba]
Length=158

 Score =   221 bits (564),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKE S
Sbjct  30   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDEIKGAIKEAS  89

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVS+DFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  90   EGKLKGILGYTEDDVVSSDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  149

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  150  LICHMAST  157



>dbj|BAC80257.1| glyceraldehyde-3-phosphate dehydrogenase [Houttuynia cordata]
Length=223

 Score =   223 bits (569),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT R+EK ASY+ IK AIKEES
Sbjct  96   IPSSTGAAKAVGKVLPQLNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYEQIKAAIKEES  155

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDF+GD  SSIFDAKAGIALN NF+K +SWYDNEWGYS+ V+D
Sbjct  156  EGKMKGILGYTEDDVVSTDFIGDKRSSIFDAKAGIALNDNFVKVVSWYDNEWGYSSXVID  215

Query  74   LIRHMAS  54
            LIRH+AS
Sbjct  216  LIRHIAS  222



>ref|XP_003553883.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Glycine max]
Length=337

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LN KLTGM+FRVPT DVSVVDLT R+EK ASYD+IK AIKE S
Sbjct  210  IPSSTGAAKAVGKVLPSLNNKLTGMSFRVPTVDVSVVDLTVRLEKGASYDEIKAAIKEAS  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVSTDFVGD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  270  EGSMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGISLNNNFVKLVSWYDNEWGYSTRVVD  329

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  330  LIRHMAS  336



>gb|AFG28406.1| glyceraldehyde-3-phosphate dehydrogenase C1 [Pyrus x bretschneideri]
Length=341

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKEES
Sbjct  213  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPASYDQIKAAIKEES  272

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  273  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  332

Query  74   LIRHMASSA  48
            LI H+AS+ 
Sbjct  333  LIVHVASTC  341



>gb|AAZ05899.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica napus]
Length=163

 Score =   221 bits (563),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+I+KAIKEES
Sbjct  35   IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIEKAIKEES  94

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E  +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  95   EDKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  154

Query  74   LIRHMASSA  48
            LI HM+ +A
Sbjct  155  LIIHMSKAA  163



>gb|ACJ83968.1| unknown [Medicago truncatula]
 gb|AFK33402.1| unknown [Medicago truncatula]
Length=206

 Score =   223 bits (567),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  78   IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEEIKAAIKEES  137

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  138  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVID  197

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  198  LIVHIASVA  206



>gb|ADQ43814.1| glyceraldehyde-3-phosphate dehydrogenase [Ananas comosus]
Length=337

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASYD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGY ++D+VS+DFVGDS SSIFDAKAGIALN NF+KF+SWYDNEWGYS+RVVD
Sbjct  269  EGNLKGILGYVDEDLVSSDFVGDSRSSIFDAKAGIALNDNFVKFVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMNST  336



>gb|AIL56405.1| glyceraldehyde-3-phosphate dehydrogenase [Chrysanthemum x morifolium]
Length=341

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGNLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMAS  54
            LIRH+AS
Sbjct  332  LIRHIAS  338



>ref|XP_009787576.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana sylvestris]
Length=337

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+HMAS
Sbjct  329  LIKHMAS  335



>emb|CAB39974.1| glyceraldehyde-3-phosphate dehydrogenase [Nicotiana tabacum]
Length=337

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+HMAS
Sbjct  329  LIKHMAS  335



>ref|XP_009616068.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nicotiana tomentosiformis]
Length=337

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+HMAS
Sbjct  329  LIKHMAS  335



>ref|XP_003524483.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Glycine max]
 gb|KHN27622.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=337

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LN KLTGM+FRVPT DVSVVDLT R+EK ASYD+IK A+KE S
Sbjct  210  IPSSTGAAKAVGKVLPSLNNKLTGMSFRVPTVDVSVVDLTVRLEKGASYDEIKAAVKEAS  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVSTDFVGD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  270  EGSMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGISLNNNFVKLVSWYDNEWGYSTRVVD  329

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  330  LIRHMAS  336



>dbj|BAJ34243.1| unnamed protein product [Thellungiella halophila]
Length=294

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  167  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  227  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSENFVKLVSWYDNEWGYSTRVVD  286

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  287  LIVHMSKA  294



>emb|CAC80385.1| glyceraldehyde-3-phosphate dehydrogenase [Marchantia polymorpha]
Length=348

 Score =   226 bits (577),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPTADVSVVDLT R EK A+Y+++K AIK ES
Sbjct  220  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTADVSVVDLTVRTEKKATYEEVKAAIKAES  279

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGI+GYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYSNRVVD
Sbjct  280  EGEMKGIMGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFMKLVSWYDNEWGYSNRVVD  339

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  340  LILHMAST  347



>ref|XP_008341346.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Malus domestica]
Length=337

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIK+ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDEIKNAIKKES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYT++DVVSTDFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGSMKGILGYTDEDVVSTDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LIRH+AS
Sbjct  329  LIRHIAS  335



>gb|ABV02033.1| glyceraldehyde 3-phosphate dehydrogenase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=340

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDEIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILG+TEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGFTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  332  LICHMASVA  340



>ref|NP_001266254.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum lycopersicum]
 gb|AAB54003.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum lycopersicum]
Length=294

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPTADVSVVDLT R+EK ASY+DIK AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPQLNGKLTGMAFRVPTADVSVVDLTVRLEKEASYEDIKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  227  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKVVSWYDNEWGYSSRVID  286

Query  74   LIRHMASS  51
            L+ HMA +
Sbjct  287  LVCHMAKA  294



>gb|AAA33465.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Zea mays]
Length=234

 Score =   223 bits (567),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  106  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  165

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  166  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  225

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  226  LIRHMNST  233



>ref|XP_010033372.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Eucalyptus grandis]
 gb|KCW52989.1| hypothetical protein EUGRSUZ_J02288 [Eucalyptus grandis]
Length=337

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASYD+IK+AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYDEIKEAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYT++DVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGNLKGILGYTDEDVVSTDFVGDNRSSIFDAKAGIALSSNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  329  LICHMAST  336



>ref|XP_010025353.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Eucalyptus grandis]
Length=337

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  329  LIVHMASCA  337



>ref|XP_010242342.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Nelumbo nucifera]
Length=337

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASY++IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYEEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFLGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  329  LILHMAST  336



>gb|AAM92008.1|AF527779_1 glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]
 gb|ABB55366.1| glyceraldehyde 3-phosphate dehydrogenase-like [Solanum tuberosum]
Length=338

 Score =   226 bits (575),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPTADVSVVDLT R+EK ASY+DIK AIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTADVSVVDLTVRLEKEASYEDIKAAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  330

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  331  LICHMAKA  338



>gb|AGW24628.1| glyceraldehyde 3-phosphate dehydrogenase [Salvia miltiorrhiza]
Length=337

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI+H+AS+
Sbjct  329  LIKHIAST  336



>ref|XP_004138468.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
2 [Cucumis sativus]
Length=309

 Score =   225 bits (573),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  181  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEDIKAAIKEES  240

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  241  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSTRVID  300

Query  74   LIRHMAS  54
            LIRH+ S
Sbjct  301  LIRHINS  307



>ref|NP_001275344.1| glyceraldehyde-3-phosphate dehydrogenase [Solanum tuberosum]
 gb|ABB72804.1| glyceraldehyde 3-phosphate dehydrogenase-like protein [Solanum 
tuberosum]
 gb|ABB87128.1| glyceraldehyde 3-phosphate dehydrogenase-like [Solanum tuberosum]
Length=338

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPTADVSVVDLT R+EK ASY+DIK AIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTADVSVVDLTVRLEKEASYEDIKAAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  330

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  331  LICHMAKA  338



>gb|ABR25332.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Indica 
Group]
Length=219

 Score =   222 bits (565),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKEES
Sbjct  91   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPASYDQIKAAIKEES  150

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDF GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  151  EGKLKGILGYVEEDLVSTDFQGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  210

Query  74   LIRHM  60
            LIRHM
Sbjct  211  LIRHM  215



>gb|ACS68203.1| glyceraldehyde-3-phosphate dehydrogenase 2 [Brassica napus]
Length=339

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASSA  48
            LI HM+ +A
Sbjct  331  LIIHMSKAA  339



>ref|XP_009117998.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Brassica rapa]
Length=338

 Score =   226 bits (575),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YDDIKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDDIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIIHMSKA  338



>ref|XP_007151566.1| hypothetical protein PHAVU_004G057600g [Phaseolus vulgaris]
 gb|ESW23560.1| hypothetical protein PHAVU_004G057600g [Phaseolus vulgaris]
Length=337

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LN KLTGM+FRVPT DVSVVDLT R+EK ASYD+IK A+KE S
Sbjct  210  IPSSTGAAKAVGKVLPSLNNKLTGMSFRVPTVDVSVVDLTVRLEKGASYDEIKAAMKEAS  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVSTDF+GD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  270  EGSMKGILGYTEDDVVSTDFIGDNRSSIFDAKAGISLNNNFVKLVSWYDNEWGYSTRVVD  329

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  330  LIRHMAS  336



>ref|XP_004138467.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
1 [Cucumis sativus]
 gb|KGN45728.1| hypothetical protein Csa_6G008590 [Cucumis sativus]
Length=337

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEDIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSTRVID  328

Query  74   LIRHMAS  54
            LIRH+ S
Sbjct  329  LIRHINS  335



>ref|XP_010554228.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Tarenaya hassleriana]
Length=338

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIAL+ NF+K ++WYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSENFVKLVTWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_004169444.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Cucumis 
sativus]
Length=337

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEDIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSTRVID  328

Query  74   LIRHMAS  54
            LIRH+ S
Sbjct  329  LIRHINS  335



>ref|XP_002265988.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Vitis vinifera]
 emb|CBI40083.3| unnamed protein product [Vitis vinifera]
Length=337

 Score =   225 bits (574),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/128 (86%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLT R EK ASYDDIK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTVRTEKKASYDDIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTED+VVS+DF+GDS SSIFDAKAGIALN NFIK +SWYDNEWGYS+RVVD
Sbjct  269  EGNLKGILGYTEDEVVSSDFLGDSRSSIFDAKAGIALNENFIKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LIRH+ S+
Sbjct  329  LIRHIDST  336



>gb|AAQ57193.1| glyceraldehyde-3-phosphate dehydrogenase [Panax ginseng]
Length=295

 Score =   224 bits (570),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+ K ASYD+IK AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLAKKASYDEIKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K ++WYDNEWGYS+RVVD
Sbjct  227  EGKLKGILGYTEDDVVSTDFLGDSRSSIFDAKAGIALNENFVKLVTWYDNEWGYSSRVVD  286

Query  74   LIRHMAS  54
            L+ HMAS
Sbjct  287  LVVHMAS  293



>gb|AFO68184.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Anthurium 
andraeanum]
Length=214

 Score =   221 bits (563),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  87   IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYDEIKAAIKEES  146

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+D+VS+DF+GDS SSIFDAKAGIALN +F+K ++WYDNEWGYS RV+D
Sbjct  147  EGKLKGILGYTEEDLVSSDFLGDSRSSIFDAKAGIALNDSFVKLVAWYDNEWGYSTRVID  206

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  207  LIRHMAS  213



>ref|XP_009402724.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Musa acuminata subsp. malaccensis]
Length=337

 Score =   225 bits (573),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASY+ IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYEQIKVAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYS+RVVD
Sbjct  269  EGKLKGILGYVEEDLVSTDFVGDSRSSIFDAKAGIALNENFVKVVAWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMACT  336



>ref|XP_010554090.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
[Tarenaya hassleriana]
Length=337

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT R+ K ASYD IK A+KE S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMAFRVPTVDVSVVDLTVRLSKNASYDSIKSALKEAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVS+DFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYSNRVVD
Sbjct  269  EGSMKGILGYTEDDVVSSDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSNRVVD  328

Query  74   LIRHMAS  54
            L+RH+AS
Sbjct  329  LVRHIAS  335



>gb|AAR84410.2| glyceraldehyde 3-phosphate dehydrogenase [Daucus carota]
Length=337

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  329  LIVHMAS  335



>gb|AIX10772.1| glyceraldehyde-3-phosphate dehydrogenase [Panax notoginseng]
Length=337

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASY++IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYEEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNENFVKLVTWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LIVHIAS  335



>gb|AFP44108.1| GAPDH, partial [Lycoris longituba]
Length=264

 Score =   223 bits (567),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIK ES
Sbjct  137  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDEIKAAIKAES  196

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGY ++D+VSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  197  EGSMKGILGYVDEDLVSTDFLGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  256

Query  74   LIRHMASS  51
            LIRHM+++
Sbjct  257  LIRHMSTT  264



>sp|Q39769.1|G3PC_GINBI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Ginkgo biloba]
 gb|AAA33352.1| glyceraldehyde-phosphate dehydrogenase [Ginkgo biloba]
Length=340

 Score =   225 bits (573),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTPDVSVVDLTVRLEKPASYDEIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  332  LIVHMAST  339



>ref|XP_007044989.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 1 [Theobroma 
cacao]
 gb|EOY00821.1| Glyceraldehyde-3-phosphate dehydrogenase C2 isoform 1 [Theobroma 
cacao]
Length=342

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+ K+ASYD+IK AI+EES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLAKSASYDEIKAAIREES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+DVVSTDFVGDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYIEEDVVSTDFVGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  332  LIVHMAST  339



>ref|XP_006417122.1| hypothetical protein EUTSA_v10008131mg [Eutrema salsugineum]
 gb|ESQ35475.1| hypothetical protein EUTSA_v10008131mg [Eutrema salsugineum]
Length=338

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSENFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>gb|AGL44432.1| glyceraldehyde-3-phosphate dehydrogenase C2 [Arachis hypogaea]
Length=186

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK+AIKEES
Sbjct  59   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKPATYDEIKQAIKEES  118

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +K ILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  119  EGKLKVILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKIVSWYDNEWGYSTRVVD  178

Query  74   LIRHMA  57
            L+ H+A
Sbjct  179  LVVHIA  184



>emb|CAA06030.1| glyeraldehyde-3-phosphate dehydrogenase, partial [Marsilea quadrifolia]
Length=368

 Score =   226 bits (575),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT +VSVVDLT R+EK ASYDD+K A+K  S
Sbjct  234  IPSSTGAAKAVGKVLPQLNGKLTGMAFRVPTPNVSVVDLTCRLEKGASYDDVKAAVKAAS  293

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NFIK ++WYDNEWGYSNRVVD
Sbjct  294  EGSMKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFIKMVTWYDNEWGYSNRVVD  353

Query  74   LIRHMAS  54
            LI H+A+
Sbjct  354  LISHIAA  360



>gb|ACV86035.1| glyceraldehyde-3-phosphate dehydrogenase 2 [Festuca arundinacea]
Length=337

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEKAASY+DIKKAIK  S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTLDVSVVDLTVRIEKAASYEDIKKAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGI+GY E+D+VSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYSNRVVD
Sbjct  269  EGNLKGIMGYVEEDLVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>ref|XP_009124017.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Brassica rapa]
Length=338

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+  
Sbjct  331  LIVHMSKC  338



>gb|KFK37847.1| hypothetical protein AALP_AA3G036600 [Arabis alpina]
Length=338

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_010320554.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase isoform X1 
[Solanum lycopersicum]
Length=338

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPTADVSVVDLT R+EK ASY+DIK AIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMAFRVPTADVSVVDLTVRLEKEASYEDIKAAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKVVSWYDNEWGYSSRVID  330

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  331  LICHMAKA  338



>ref|XP_006408221.1| hypothetical protein EUTSA_v10021083mg [Eutrema salsugineum]
 gb|ESQ49674.1| hypothetical protein EUTSA_v10021083mg [Eutrema salsugineum]
Length=338

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSENFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_007151567.1| hypothetical protein PHAVU_004G057700g [Phaseolus vulgaris]
 gb|ESW23561.1| hypothetical protein PHAVU_004G057700g [Phaseolus vulgaris]
Length=338

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LN KLTGM+FRVPT DVSVVDLT R+EK ASYD+IK A+KE S
Sbjct  210  IPSSTGAAKAVGKVLPSLNNKLTGMSFRVPTVDVSVVDLTVRLEKGASYDEIKAAMKEAS  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGYTEDDVVSTDFVGD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  270  EGSLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGISLNNNFVKLVSWYDNEWGYSTRVVD  329

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  330  LIRHMAS  336



>ref|XP_010248875.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nelumbo nucifera]
Length=337

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  329  LILHIAST  336



>gb|ABI96175.1| glyceraldehyde-3 phosphate dehydrogenase [Knorringia sibirica]
Length=337

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT R+EKAASY+DIK+AIKE S
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYEDIKRAIKEAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYT++D+VSTDFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKMKGILGYTDEDLVSTDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI HMA S
Sbjct  329  LICHMAKS  336



>emb|CDY30032.1| BnaC05g09880D [Brassica napus]
Length=393

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  265  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  324

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  325  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  384

Query  74   LIRHMASSA  48
            LI HM+ +A
Sbjct  385  LIIHMSKAA  393



>dbj|BAJ10477.1| glyceraldehyde-3-phosphate dehydrogenase [Brassica rapa subsp. 
chinensis]
Length=294

 Score =   223 bits (568),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  167  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  227  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  286

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  287  LIIHMSKA  294



>dbj|BAJ33926.1| unnamed protein product [Thellungiella halophila]
Length=338

 Score =   224 bits (572),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSENFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>emb|CDY16090.1| BnaC08g40330D [Brassica napus]
Length=430

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YDDIKKAIKEES
Sbjct  303  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDDIKKAIKEES  362

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  363  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  422

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  423  LIIHMSKA  430



>gb|ABR25980.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Oryza sativa 
Indica Group]
Length=211

 Score =   220 bits (561),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEKAASYD IK AIK  S
Sbjct  83   IPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSAS  142

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYSNRV+D
Sbjct  143  EGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVID  202

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  203  LIRHMAKT  210



>gb|KCW61990.1| hypothetical protein EUGRSUZ_H04673, partial [Eucalyptus grandis]
Length=433

 Score =   227 bits (579),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/129 (84%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IK AIKEES
Sbjct  305  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEES  364

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RVVD
Sbjct  365  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVVD  424

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  425  LIVHMASCA  433



>ref|XP_008441373.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase [Cucumis 
melo]
Length=337

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEDIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD  SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDCRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LIRH+ S
Sbjct  329  LIRHINS  335



>ref|XP_008340167.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Malus domestica]
Length=341

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+Y+ IK AIKEES
Sbjct  213  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYEQIKAAIKEES  272

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  273  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  332

Query  74   LIRHMASS  51
            LI H+ASS
Sbjct  333  LIVHVASS  340



>ref|XP_002535536.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF26847.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=206

 Score =   220 bits (560),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+ IK AIKEES
Sbjct  78   IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEQIKAAIKEES  137

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD  SSIFDAKAGIALN  F+K +SWYDNEWGYS RVVD
Sbjct  138  EGKLKGILGYTEDDVVSTDFIGDKRSSIFDAKAGIALNDKFVKLVSWYDNEWGYSTRVVD  197

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  198  LIVHVAS  204



>gb|KFK43602.1| hypothetical protein AALP_AA1G147800 [Arabis alpina]
Length=338

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>emb|CDY49358.1| BnaA05g33200D, partial [Brassica napus]
Length=336

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  209  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI HM+  
Sbjct  329  LIVHMSKC  336



>emb|CAI83772.1| glyceraldehyde-3-phosphate-dehydrogenase [Lupinus albus]
Length=295

 Score =   223 bits (568),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  167  IPSSTGAAKAVGKVLPVLNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN  ++K +SWYDNEWGYS RVVD
Sbjct  227  EGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNEKYVKLVSWYDNEWGYSTRVVD  286

Query  74   LIRHMASS  51
            LI H A +
Sbjct  287  LIAHFAKT  294



>emb|CDY42906.1| BnaC05g47450D [Brassica napus]
Length=353

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  226  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  285

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  286  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  345

Query  74   LIRHMASS  51
            LI HM+  
Sbjct  346  LIVHMSKC  353



>gb|ADB98096.1| glyceraldehyde 3-phosphate dehydrogenase [Phyllostachys edulis]
Length=337

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEKAASYDDIK AIK  S
Sbjct  209  IPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDDIKNAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYSNRVVD
Sbjct  269  EGKLKGIMGYVEEDLVSTDFIGDSRSSIFDAKAGIALNENFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>ref|XP_011073006.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Sesamum indicum]
Length=337

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASY++IK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYEEIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIALN  F+K +SWYDNEWGYS+RV+D
Sbjct  269  EGSLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNDKFVKIVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LI+H+AS
Sbjct  329  LIKHIAS  335



>gb|KHG04670.1| Glyceraldehyde-3-phosphate dehydrogenase-2C cytosolic [Gossypium 
arboreum]
Length=166

 Score =   218 bits (555),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASY+DIK AIK+ES
Sbjct  38   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYEDIKAAIKKES  97

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E ++KGILGY ++D+VSTDFVGDS SSIFDAKAGIAL+  F+K ++WYDNEWGYS RV+D
Sbjct  98   ETNLKGILGYVDEDLVSTDFVGDSRSSIFDAKAGIALSDKFVKLVAWYDNEWGYSTRVID  157

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  158  LIRHMAS  164



>ref|XP_006652435.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Oryza brachyantha]
Length=337

 Score =   224 bits (570),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAASYD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAASYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDF GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYVEEDLVSTDFQGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM  S
Sbjct  329  LIRHMYKS  336



>ref|XP_008379147.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Malus domestica]
 ref|XP_008365359.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Malus domestica]
Length=337

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD IK AIK+ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDXIKNAIKKES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGYT++DVVSTDFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGSLKGILGYTDEDVVSTDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LIRH+AS
Sbjct  329  LIRHIAS  335



>sp|P25861.1|G3PC_ANTMA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Antirrhinum majus]
Length=337

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  329  LIVHMAS  335



>gb|KEH35270.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=295

 Score =   222 bits (566),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEEIKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  227  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVID  286

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  287  LIVHIASVA  295



>emb|CAA42103.1| glycolytic glyceraldehyde 3-phosphate dehydrogenase [Antirrhinum 
majus]
Length=336

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  208  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  267

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  268  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  327

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  328  LIVHMAS  334



>ref|XP_004310041.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Fragaria 
vesca subsp. vesca]
Length=336

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKMKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNENFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI H+A +
Sbjct  329  LIVHIAKA  336



>gb|KCW83195.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=337

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK A+KEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKGATYEEIKAAMKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALNENFVKLVAWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI HMAS 
Sbjct  329  LILHMASC  336



>ref|XP_009134751.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X1 [Brassica rapa]
Length=338

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDQIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_010682871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Beta vulgaris subsp. vulgaris]
Length=340

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EK ASYDDIK AIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKEASYDDIKAAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  271  EGNLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  330

Query  74   LIRHMAS  54
            LI +MAS
Sbjct  331  LIVYMAS  337



>gb|KDP46338.1| hypothetical protein JCGZ_10178 [Jatropha curcas]
Length=337

 Score =   223 bits (569),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYEEIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGSMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LICHIAS  335



>ref|XP_009110581.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Brassica rapa]
Length=339

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  212  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  272  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  331

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  332  LIIHMSKA  339



>gb|KDP26768.1| hypothetical protein JCGZ_17926 [Jatropha curcas]
Length=337

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  208  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEDIKAAIKEES  267

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVS+DFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  268  EGKLKGILGYTEDDVVSSDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVLD  327

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  328  LIAHIAST  335



>ref|NP_001077530.1| glyceraldehyde 3-phosphate dehydrogenase GAPC2 [Arabidopsis thaliana]
 gb|AEE29017.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=310

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  183  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  242

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  243  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  302

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  303  LIVHMSKA  310



>gb|AFW62861.1| glyceraldehyde-3-phosphate dehydrogenase3 [Zea mays]
Length=295

 Score =   222 bits (565),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  167  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  227  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  286

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  287  LIRHMNST  294



>dbj|BAJ10715.1| glyceraldehyde-3-phosphate dehydrogenase [Hydrobryum japonicum]
Length=338

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EK A+YD+IK A+KEES
Sbjct  210  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKPATYDEIKAAVKEES  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGY EDDVVSTDF+GD  SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  270  EGKMKGILGYCEDDVVSTDFIGDKRSSIFDAKAGIALNSNFVKLVSWYDNEWGYSTRVVD  329

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  330  LIVHMASA  337



>ref|XP_010930058.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Elaeis guineensis]
Length=337

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK+A+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYDQIKDAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGY ++D+VSTDF+GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKMKGILGYVDEDLVSTDFLGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHM  60
            LIRH+
Sbjct  329  LIRHI  333



>ref|XP_010026741.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Eucalyptus grandis]
 gb|KCW83194.1| hypothetical protein EUGRSUZ_B00144 [Eucalyptus grandis]
Length=337

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK A+KEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKGATYEEIKAAMKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALNENFVKLVAWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI HMAS 
Sbjct  329  LILHMASC  336



>dbj|BAJ83629.1| glyceraldehyde 3-phosphate dehydrogenase (GAPDH) homolog [Cabomba 
caroliniana]
Length=182

 Score =   218 bits (555),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKE S
Sbjct  53   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKGASYDQIKAAIKEAS  112

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KG+LGYT++DVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  113  EGKLKGVLGYTDEDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  172

Query  74   LIRHM  60
            LI+H+
Sbjct  173  LIKHV  177



>ref|XP_010528059.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic-like 
[Tarenaya hassleriana]
Length=338

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YDDIKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDDIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNE GYS RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSQNFVKVVSWYDNEMGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>gb|EYU22566.1| hypothetical protein MIMGU_mgv1a009585mg [Erythranthe guttata]
Length=303

 Score =   222 bits (565),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK  IKEES
Sbjct  175  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKAVIKEES  234

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E  +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  235  ENKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVVD  294

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  295  LIVHMAS  301



>emb|CDX92059.1| BnaC03g33610D [Brassica napus]
Length=348

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD IKKAIKEES
Sbjct  221  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDQIKKAIKEES  280

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  281  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  340

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  341  LIVHMSKA  348



>gb|ACJ85452.1| unknown [Medicago truncatula]
Length=209

 Score =   219 bits (557),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/126 (83%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGK+LPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD IK AIKEES
Sbjct  81   IPSSTGAAKAVGKMLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPATYDQIKAAIKEES  140

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNE GYS RVVD
Sbjct  141  EGNLKGILGYTEDDVVSTDFIGDTRSSIFDAKAGIALNDNFVKLVSWYDNELGYSTRVVD  200

Query  74   LIRHMA  57
            LI H+A
Sbjct  201  LIVHIA  206



>ref|XP_006297911.1| hypothetical protein CARUB_v10013953mg [Capsella rubella]
 gb|EOA30809.1| hypothetical protein CARUB_v10013953mg [Capsella rubella]
Length=379

 Score =   224 bits (571),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YDDIKKAIKEES
Sbjct  252  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDDIKKAIKEES  311

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  312  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  371

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  372  LIVHMSKA  379



>sp|P17878.1|G3PC_MESCR RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Mesembryanthemum crystallinum]
 gb|AAA33031.1| NAD-glyceraldehyde-3-phosphate dehydrogenase [Mesembryanthemum 
crystallinum]
 gb|AAA33033.1| glyceraldehyde-3-phosphate dehydrogenase (EC 1.2.1.12) [Mesembryanthemum 
crystallinum]
Length=337

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEKAASY+ IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTCDVSVVDLTVRIEKAASYEQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDD+VSTDF+GD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDLVSTDFIGDNRSSIFDAKAGISLNDNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI H++  
Sbjct  329  LIMHISKC  336



>ref|XP_002509572.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
 gb|EEF50959.1| glyceraldehyde 3-phosphate dehydrogenase, putative [Ricinus communis]
Length=295

 Score =   221 bits (564),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y+DIK AIK ES
Sbjct  167  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYEDIKAAIKAES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYT++DVVS+DFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  227  EGKLKGILGYTDEDVVSSDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  286

Query  74   LIRHMAS  54
            LIRH+AS
Sbjct  287  LIRHIAS  293



>emb|CAZ76054.1| glyceraldehyde-3-phosphate dehydrogenase [Triticum aestivum]
 gb|EMT23312.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Aegilops 
tauschii]
Length=337

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R EKAASYDDIKKAIK  S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRTEKAASYDDIKKAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN +F+K +SWYDNEWGYSNRVVD
Sbjct  269  EGKLKGIMGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>emb|CDY50169.1| BnaC08g15900D [Brassica napus]
Length=372

 Score =   224 bits (570),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  245  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  304

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  305  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  364

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  365  LIIHMSKA  372



>dbj|BAJ17660.1| glyceraldehyde 3-phosphate dehydrogenase [Gynura bicolor]
Length=340

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGY E+DVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGNLKGILGYVEEDVVSTDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSSRVID  331

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  332  LICHMAS  338



>gb|ACG36109.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic 3 [Zea mays]
Length=337

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K ES
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMNST  336



>gb|KDO82022.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=306

 Score =   222 bits (565),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  177  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKNAIKEES  236

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  237  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  296

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  297  LIVHMAKT  304



>ref|XP_010495303.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic 
[Camelina sativa]
Length=338

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>gb|ACS68202.1| glyceraldehyde-3-phosphate dehydrogenase 1 [Brassica napus]
Length=339

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVS+VDLT R+EKAA+YD+IKKAIKEES
Sbjct  212  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSIVDLTVRLEKAATYDEIKKAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  272  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  331

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  332  LIIHMSKA  339



>ref|XP_010458793.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic-like 
[Camelina sativa]
Length=336

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  329  LIVHMSKA  336



>gb|AGV54709.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris]
Length=338

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+DIKKAIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEDIKKAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K + WYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVMWYDNEWGYSSRVID  328

Query  74   LIRHMA  57
            L+ H+A
Sbjct  329  LLVHVA  334



>ref|XP_006305287.1| hypothetical protein CARUB_v10009662mg [Capsella rubella]
 gb|EOA38185.1| hypothetical protein CARUB_v10009662mg [Capsella rubella]
Length=338

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>emb|CDY21098.1| BnaA08g24270D [Brassica napus]
Length=373

 Score =   224 bits (570),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  246  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  305

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  306  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  365

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  366  LIIHMSKA  373



>ref|XP_010476339.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC2, cytosolic-like 
[Camelina sativa]
Length=336

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  329  LIVHMSKA  336



>gb|AGV54256.1| glyceraldehyde-3-phosphate dehydrogenase [Phaseolus vulgaris]
Length=338

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+DIKKAIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEDIKKAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K + WYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVMWYDNEWGYSSRVID  328

Query  74   LIRHMA  57
            L+ H+A
Sbjct  329  LLVHVA  334



>ref|XP_002882331.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH58590.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis 
lyrata subsp. lyrata]
Length=338

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_007222474.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica]
 gb|EMJ23673.1| hypothetical protein PRUPE_ppa008227mg [Prunus persica]
Length=340

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT RIEK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPQLNGKLTGMAFRVPTVDVSVVDLTVRIEKKATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  331

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  332  LIVHVAST  339



>gb|AGK63074.1| glyceraldehyde-3-phosphate dehydrogenase [Eleutherococcus senticosus]
Length=340

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK  SY+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKTSYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI H+ASS
Sbjct  332  LIVHIASS  339



>gb|ABK24012.1| unknown [Picea sitchensis]
Length=340

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPTADVSVVDLT R+EK+A+YD+IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPVLNGKLTGMAFRVPTADVSVVDLTVRLEKSATYDEIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTED VVSTDF+GDS SSIFDA+AGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  272  EGKLKGILGYTEDAVVSTDFIGDSRSSIFDAQAGIALSDNFVKLVSWYDNEWGYSTRVVD  331

Query  74   LIRHMASS  51
            LI HMAS+
Sbjct  332  LIAHMAST  339



>ref|XP_003573318.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic-like 
[Brachypodium distachyon]
Length=337

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R EKAASY+DIKKAIK  S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRTEKAASYEDIKKAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGI+GY E+D+VSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYSNRVVD
Sbjct  269  EGNLKGIMGYVEEDLVSTDFLGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>gb|AGY80450.1| glyceraldehyde-3-phosphate [Dendrocalamus latiflorus]
Length=337

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEK+ASYDDIK AIK  S
Sbjct  209  IPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKSASYDDIKNAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYSNRVVD
Sbjct  269  EGKLKGIMGYVEEDLVSTDFIGDSRSSIFDAKAGIALNENFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>gb|AEP31954.1| glyceraldehyde-3-phosphate dehydrogenase [Aeluropus lagopoides]
Length=337

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT RIEKAASY+DIK AIK  S
Sbjct  209  IPSSTGAAKAVGKVLPDLNGKLTGMAFRVPTVDVSVVDLTVRIEKAASYEDIKNAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GYT++D+VSTDFVGDS SSIFDAKAGIALN +F+K +SWYDNEWGYSNRVVD
Sbjct  269  EGKLKGIMGYTDEDLVSTDFVGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>sp|P26517.1|G3PC1_HORVU RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
[Hordeum vulgare]
 emb|CAA42901.1| glyceraldehyde 3-phosphate dehydrogenase [Hordeum vulgare]
 dbj|BAJ86470.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=337

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R EKAASYDDIKKAIK  S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRTEKAASYDDIKKAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN +F+K +SWYDNEWGYSNRVVD
Sbjct  269  EGKLKGIMGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>ref|XP_011086733.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sesamum indicum]
Length=337

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E  +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  269  ENKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  329  LIVHMASVA  337



>ref|XP_008222039.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Prunus mume]
Length=340

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT RIEK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPQLNGKLTGMAFRVPTVDVSVVDLTVRIEKKATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  331

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  332  LIVHVAST  339



>emb|CDX74199.1| BnaA03g28480D [Brassica napus]
Length=352

 Score =   223 bits (568),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD IKKAIKEES
Sbjct  225  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDQIKKAIKEES  284

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  285  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  344

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  345  LIVHMSKA  352



>gb|AGN95066.1| putative glyceraldehyde-3-phosphate dehydrogenase C subunit-like 
protein [Physaria fendleri]
Length=338

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_007217558.1| hypothetical protein PRUPE_ppa022368mg [Prunus persica]
 gb|EMJ18757.1| hypothetical protein PRUPE_ppa022368mg [Prunus persica]
Length=337

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIK+ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDEIKDAIKKES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGSMKGILGYT++DVVSTDFVGD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGSMKGILGYTDEDVVSTDFVGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LICHIAS  335



>ref|NP_187062.1| glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Arabidopsis 
thaliana]
 sp|P25858.2|G3PC1_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPC1, 
cytosolic; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase C subunit 1 [Arabidopsis thaliana]
 gb|AAF26801.1|AC016829_25 glyceraldehyde-3-phosphate dehydrogenase C subunit (GapC) [Arabidopsis 
thaliana]
 gb|AAK97737.1| AT3g04120/T6K12_26 [Arabidopsis thaliana]
 gb|AAL31134.1| AT3g04120/T6K12_26 [Arabidopsis thaliana]
 gb|AAM98225.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE98901.1| glyceraldehyde-3-phosphate dehydrogenase C subunit [Arabidopsis 
thaliana]
 gb|AEE74039.1| glyceraldehyde-3-phosphate dehydrogenase C subunit 1 [Arabidopsis 
thaliana]
Length=338

 Score =   223 bits (567),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|NP_172801.1| glyceraldehyde 3-phosphate dehydrogenase GAPC2 [Arabidopsis thaliana]
 sp|Q9FX54.1|G3PC2_ARATH RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase GAPC2, 
cytosolic; AltName: Full=NAD-dependent glyceraldehydephosphate 
dehydrogenase C subunit 2 [Arabidopsis thaliana]
 gb|AAG09543.1|AC011810_2 Putative glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAK95257.1|AF410271_1 At1g13440/F13B4_8 [Arabidopsis thaliana]
 gb|AAK83601.1| At1g13440/F13B4_8 [Arabidopsis thaliana]
 gb|AAL90936.1| At1g13440/F13B4_8 [Arabidopsis thaliana]
 gb|AEE29016.1| glyceraldehyde 3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=338

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_010518444.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Camelina sativa]
 ref|XP_010463885.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Camelina sativa]
 ref|XP_010485781.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Camelina sativa]
Length=338

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_010911739.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Elaeis guineensis]
Length=337

 Score =   223 bits (567),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK+A+Y DIK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKSATYADIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+D+VSTDF+GDS SSIFDAKAGIALN NF+KF++WYDNEWGYS+RVVD
Sbjct  269  EGRLKGILGYTEEDLVSTDFLGDSRSSIFDAKAGIALNENFVKFVAWYDNEWGYSSRVVD  328

Query  74   LIRHMAS  54
            LIR M S
Sbjct  329  LIRTMDS  335



>ref|XP_010318401.1| PREDICTED: glyceraldehyde 3-phosphate dehydrogenase isoform X1 
[Solanum lycopersicum]
Length=337

 Score =   222 bits (566),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K ++WYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVAWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI HM+S
Sbjct  329  LIIHMSS  335



>ref|NP_001234803.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum lycopersicum]
 gb|AAB51592.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum lycopersicum]
Length=295

 Score =   221 bits (563),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+  SIFDAKAGIAL+ NF+K ++WYDNEWGYS RVVD
Sbjct  227  EGKLKGILGYTEDDVVSTDFVGDNRPSIFDAKAGIALSKNFVKLVAWYDNEWGYSTRVVD  286

Query  74   LIRHMAS  54
            LI HM+S
Sbjct  287  LIIHMSS  293



>ref|NP_001275277.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Solanum 
tuberosum]
 gb|AFX67011.1| glyceraldehyde 3-phosphate dehydrogenase [Solanum tuberosum]
Length=337

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K ++WYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVAWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI HM+S
Sbjct  329  LIIHMSS  335



>sp|P04796.2|G3PC_SINAL RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Sinapis alba]
 emb|CAA27844.1| unnamed protein product [Sinapis alba]
Length=338

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPQLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            +G +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNEWGYS RVVD
Sbjct  271  QGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDNFVKLVSWYDNEWGYSTRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIIHMSKA  338



>ref|XP_003601828.1| Glyceraldehyde 3-phosphate dehydrogenase [Medicago truncatula]
 gb|AES72079.1| glyceraldehyde-3-phosphate dehydrogenase [Medicago truncatula]
Length=340

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEEIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVID  331

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  332  LIVHIASVA  340



>ref|XP_002452401.1| hypothetical protein SORBIDRAFT_04g025120 [Sorghum bicolor]
 gb|EES05377.1| hypothetical protein SORBIDRAFT_04g025120 [Sorghum bicolor]
Length=337

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY ++D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGSLKGILGYVDEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM+S+
Sbjct  329  LIRHMSST  336



>dbj|BAH20011.1| AT1G13440 [Arabidopsis thaliana]
Length=338

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD++KKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEVKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKMKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_011045198.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Populus euphratica]
Length=337

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK A+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKKATYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E ++KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  ETNLKGILGYTEDDVVSTDFMGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LIIHIAS  335



>ref|XP_003573324.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic-like 
[Brachypodium distachyon]
Length=337

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R EKAASY+DIKKAIK  S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRTEKAASYEDIKKAIKAAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN +F+K +SWYDNEWGYSNRVVD
Sbjct  269  EGNLKGIMGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>ref|XP_010103177.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
 gb|EXB94963.1| Glyceraldehyde-3-phosphate dehydrogenase [Morus notabilis]
Length=341

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT RI+KAA+Y++IK AIKE S
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRIQKAATYEEIKDAIKEAS  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  272  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALNSNFVKLVSWYDNEWGYSSRVVD  331

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  332  LICHIAS  338



>ref|XP_002298594.1| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE83399.1| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=337

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK A+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKKATYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E ++KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  ETNLKGILGYTEDDVVSTDFMGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LIIHIAS  335



>gb|AFV52793.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium faberi]
Length=340

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK ASY++IK A+KEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKKASYEEIKAAVKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY ++D+VSTDF+GDS SSIFDAKAGIALN NF+K ++WYDNEWGYSNRVVD
Sbjct  272  EGKLKGIIGYVDEDLVSTDFLGDSRSSIFDAKAGIALNDNFVKVVAWYDNEWGYSNRVVD  331

Query  74   LIRHMASS  51
            LIRH+AS+
Sbjct  332  LIRHIAST  339



>gb|AAP83583.1| cytosolic glyceraldehyde-3-phosphate dehydrogenase [Triticum 
aestivum]
Length=168

 Score =   216 bits (550),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGMAFRVPT DVSVVDLT R+ K A+YD IK AIKEES
Sbjct  40   IPSSTGAAKAVGKVLPELNGKLTGMAFRVPTVDVSVVDLTVRLAKPATYDQIKAAIKEES  99

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGY ++D+VSTDF GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS RVVD
Sbjct  100  EGNLKGILGYVDEDLVSTDFQGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVVD  159

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  160  LIRHMHST  167



>ref|XP_010248871.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nelumbo nucifera]
Length=337

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  329  LILHIAST  336



>ref|XP_008389804.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Malus domestica]
Length=341

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+ K ASYD IK AIKEES
Sbjct  213  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLAKPASYDQIKAAIKEES  272

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN  F+K +SWYDNEWGYS RVVD
Sbjct  273  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDTFVKLVSWYDNEWGYSTRVVD  332

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  333  LIVHVAST  340



>ref|XP_010910395.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Elaeis guineensis]
 gb|ABB72846.1| glyceraldehyde 3-phosphate dehydrogenase [Elaeis guineensis]
Length=295

 Score =   220 bits (561),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK+A+Y DIK AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKSATYADIKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDD+VSTDF+GDS SSIFDAKAGIALN +F+K ++WYDNEWGYS+RVVD
Sbjct  227  EGRLKGILGYTEDDLVSTDFIGDSRSSIFDAKAGIALNDHFVKMVAWYDNEWGYSSRVVD  286

Query  74   LIRHMAS  54
            LIR M S
Sbjct  287  LIRAMDS  293



>gb|EYU25940.1| hypothetical protein MIMGU_mgv1a009608mg [Erythranthe guttata]
Length=337

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E  +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  269  ENKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            LI HMAS A
Sbjct  329  LIVHMASVA  337



>gb|ACF87912.1| unknown [Zea mays]
Length=337

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMNST  336



>gb|AHW48354.1| glyceraldehyde-3-phosphate dehydrogenase C2-like protein [Malus 
baccata]
Length=341

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+ K ASYD IK AIKEES
Sbjct  213  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLAKPASYDQIKAAIKEES  272

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN  F+K +SWYDNEWGYS RVVD
Sbjct  273  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDTFVKLVSWYDNEWGYSTRVVD  332

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  333  LIVHVAST  340



>ref|XP_010677936.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase [Beta vulgaris 
subsp. vulgaris]
 gb|ABN50381.1| glyceraldehyde-3-phosphate dehydogenase [Beta vulgaris]
Length=337

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAA+Y+DIK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYEDIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN +F K +SWYDNEWGYS+RVVD
Sbjct  269  EGKMKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNDHFAKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  329  LIVHMSKT  336



>ref|NP_001105385.1| glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic [Zea mays]
 ref|XP_008677788.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic 
isoform X1 [Zea mays]
 sp|Q43247.1|G3PC3_MAIZE RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic 
[Zea mays]
 gb|AAA87579.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC3 [Zea 
mays]
 gb|AFW62860.1| glyceraldehyde-3-phosphate dehydrogenase3 [Zea mays]
Length=337

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMNST  336



>ref|NP_001105951.1| LOC100037774 [Zea mays]
 gb|AAA87580.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC4 [Zea 
mays]
Length=337

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMNST  336



>gb|AFW72189.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC4 isoform 
1 [Zea mays]
 gb|AFW72190.1| cytosolic glyceroldehyde-3-phosphate dehydrogenase GAPC4 isoform 
2 [Zea mays]
Length=337

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK+A+YD+IK A+K E+
Sbjct  209  IPSSTGAAKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKSATYDEIKAAVKAEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EGS+KGILGY E+D+VSTDF GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS RVVD
Sbjct  269  EGSLKGILGYVEEDLVSTDFQGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMNST  336



>ref|XP_007163725.1| hypothetical protein PHAVU_001G259000g [Phaseolus vulgaris]
 gb|ESW35719.1| hypothetical protein PHAVU_001G259000g [Phaseolus vulgaris]
Length=340

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT RIEK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRIEKPATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGI+LN NF+K +SWYDNEWGYS RV+D
Sbjct  272  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGISLNENFVKLVSWYDNEWGYSTRVID  331

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  332  LIVHIASVA  340



>gb|EYU22565.1| hypothetical protein MIMGU_mgv1a009585mg [Erythranthe guttata]
Length=337

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK  IKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKAVIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E  +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  269  ENKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMAS  54
            LI HMAS
Sbjct  329  LIVHMAS  335



>gb|AAB59010.1| glyceraldehyde-3-phosphate-dehydrogenase [Selaginella lepidophylla]
Length=340

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLT R+EK ASY++IKKA+KEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTVRLEKPASYEEIKKAVKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GYTED VVS+DF+GDS SSIFDA AGIALN +F+K +SWYDNEWGYSNRVVD
Sbjct  272  EGKLKGIMGYTEDAVVSSDFIGDSRSSIFDAAAGIALNDSFVKLVSWYDNEWGYSNRVVD  331

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  332  LIVHMAKT  339



>ref|XP_002263145.2| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Vitis vinifera]
Length=337

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EKAA+Y+ +K AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYEQVKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN  F+K ++WYDNEWGYS+RV+D
Sbjct  269  EGKMKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNEKFLKIVAWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI HMAS 
Sbjct  329  LIVHMASC  336



>ref|XP_009597424.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Nicotiana tomentosiformis]
Length=337

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+ NF+K +SWYDNE GYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSKNFVKLVSWYDNEMGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+HMAS
Sbjct  329  LIKHMAS  335



>emb|CBI14856.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EKAA+Y+ +K AIKEES
Sbjct  215  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYEQVKAAIKEES  274

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN  F+K ++WYDNEWGYS+RV+D
Sbjct  275  EGKMKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNEKFLKIVAWYDNEWGYSSRVID  334

Query  74   LIRHMASS  51
            LI HMAS 
Sbjct  335  LIVHMASC  342



>ref|XP_002892749.1| GAPC-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69008.1| GAPC-2 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>gb|AAM65189.1| glyceraldehyde-3-phosphate dehydrogenase C subunit (GapC) [Arabidopsis 
thaliana]
Length=338

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGY++RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYNSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|NP_001240046.1| uncharacterized protein LOC100782924 [Glycine max]
 gb|ACU24328.1| unknown [Glycine max]
 gb|KHN24094.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=340

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKPATYEQIKSAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGISLNDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  332  LIVHIASVA  340



>ref|XP_003573317.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic 
[Brachypodium distachyon]
Length=337

 Score =   221 bits (563),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R EKAASY+DIKKAIK  S
Sbjct  209  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRTEKAASYEDIKKAIKVAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN +F+K +SWYDNEWGYSNRVVD
Sbjct  269  EGNLKGIMGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDHFVKLVSWYDNEWGYSNRVVD  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>gb|AAA32794.1| cystolic glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis 
thaliana]
 gb|AAA32796.1| glyceraldehyde-3-phosphate dehydrogenase [Arabidopsis thaliana]
Length=338

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+Y++IKKAIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYEEIKKAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIAL+  F+K +SWYDNEWGYS+RVVD
Sbjct  271  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALSDKFVKLVSWYDNEWGYSSRVVD  330

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  331  LIVHMSKA  338



>ref|XP_009382908.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=295

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 115/125 (92%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  167  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYEEIKAAIKEES  226

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDFVGD  SSIFDAKAGI+LNG F+K +SWYDNEWGYS+RV+D
Sbjct  227  EGKLKGILGYVEEDLVSTDFVGDKRSSIFDAKAGISLNGKFVKLVSWYDNEWGYSSRVID  286

Query  74   LIRHM  60
            LIRHM
Sbjct  287  LIRHM  291



>ref|XP_004502328.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cicer arietinum]
Length=340

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKVVSWYDNEWGYSTRVID  331

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  332  LIVHIASVA  340



>ref|NP_001241184.1| uncharacterized protein LOC100807342 [Glycine max]
 gb|ACU19758.1| unknown [Glycine max]
 gb|KHN44409.1| Glyceraldehyde-3-phosphate dehydrogenase, cytosolic [Glycine 
soja]
Length=340

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKPATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGI+LN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGISLNENFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  332  LIAHIASVA  340



>gb|AFK45399.1| unknown [Lotus japonicus]
Length=337

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAA+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAATYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNE GYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALNDNFVKLVSWYDNEMGYSTRVVD  328

Query  74   LIRHMASS  51
            LI H+A S
Sbjct  329  LIVHVAKS  336



>ref|XP_004489569.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
[Cicer arietinum]
Length=338

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LN KLTGM+FRVPT DVSVVDLT R+EK ASYD+IK A+KE S
Sbjct  210  IPSSTGAAKAVGKVLPSLNNKLTGMSFRVPTVDVSVVDLTVRLEKGASYDEIKAAVKEAS  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGI+L+ NF+K +SWYDNEWGYS+RVVD
Sbjct  270  EGDLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGISLSDNFVKLVSWYDNEWGYSSRVVD  329

Query  74   LIRHMAS  54
            LIRHMAS
Sbjct  330  LIRHMAS  336



>gb|AAV70659.1| glyceraldehyde-3-phosphate dehydrogenase [Musa acuminata]
Length=331

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/125 (84%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IK AIKEES
Sbjct  207  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEES  266

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDFVGDS SSIFDAKAGIALN NF K +SWYDNEWGYS+RV+D
Sbjct  267  EGKLKGILGYVEEDLVSTDFVGDSRSSIFDAKAGIALNPNFAKLVSWYDNEWGYSSRVID  326

Query  74   LIRHM  60
            LIRHM
Sbjct  327  LIRHM  331



>ref|NP_001053139.1| Os04g0486600 [Oryza sativa Japonica Group]
 sp|Q7FAH2.1|G3PC2_ORYSJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Oryza sativa Japonica Group]
 emb|CAE02009.2| OJ000223_09.15 [Oryza sativa Japonica Group]
 emb|CAD79700.2| H0302E05.3 [Oryza sativa Indica Group]
 dbj|BAF15053.1| Os04g0486600 [Oryza sativa Japonica Group]
 gb|ACA50493.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 dbj|BAG89296.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86862.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
Length=337

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPASYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDF GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  269  EGKLKGILGYVEEDLVSTDFQGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  328

Query  74   LIRHMASS  51
            LIRHM ++
Sbjct  329  LIRHMYNT  336



>gb|ABK00054.1| cytosolic glyceraldehyde-3-phosphate dehydrogenase [Marchantia 
polymorpha]
Length=345

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPTADVSVVDLT R EK A+Y+++K AIK ES
Sbjct  220  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTADVSVVDLTVRTEKKATYEEVKAAIKAES  279

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGI+GYTEDDVVSTDF+GDS SSIFDAKAGIA N NF+K +SWYDNEWGYSNRVVD
Sbjct  280  EGEMKGIMGYTEDDVVSTDFIGDSRSSIFDAKAGIAPNDNFMKLVSWYDNEWGYSNRVVD  339

Query  74   LIRHMA  57
            LI HMA
Sbjct  340  LILHMA  345



>ref|XP_006484037.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase GAPC1, cytosolic 
[Citrus sinensis]
Length=341

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKNAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  332  LIVHMAKT  339



>gb|ADZ75465.1| glyceraldehyde-3-phosphate dehydrogenase [Litchi chinensis]
Length=310

 Score =   220 bits (560),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AI+E +
Sbjct  183  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKRASYDEIKAAIREAA  242

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            +G +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN  F+K +SWYDNEWGYS+RVVD
Sbjct  243  DGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDYFVKLVSWYDNEWGYSSRVVD  302

Query  74   LIRHMASS  51
            LIRHMA  
Sbjct  303  LIRHMAKC  310



>ref|XP_004953003.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 3, cytosolic-like 
[Setaria italica]
Length=337

 Score =   221 bits (562),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK+A+YD+IK AIK E+
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYDEIKAAIKAEA  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGY ++D+VSTDF GD+ SSIFDAKAGIALNGNF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGNLKGILGYVDEDLVSTDFQGDNRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LIRHM S+
Sbjct  329  LIRHMHST  336



>ref|XP_006438114.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|ESR51354.1| hypothetical protein CICLE_v10032014mg [Citrus clementina]
 gb|KDO82021.1| hypothetical protein CISIN_1g019445mg [Citrus sinensis]
Length=341

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYEEIKNAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+DVVSTDFVGDS SSIFDAKAGIAL+ NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEEDVVSTDFVGDSRSSIFDAKAGIALSKNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  332  LIVHMAKT  339



>sp|Q41595.1|G3PC_TAXBA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Taxus baccata]
 gb|AAA89207.1| glyceraldehyde-phosphate dehydrogenase [Taxus baccata]
Length=340

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM FRVPT DVSVVDLT ++EK+A+Y +IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPVLNGKLTGMCFRVPTQDVSVVDLTVKLEKSATYGEIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASSA  48
            LI HM S+A
Sbjct  332  LIVHMDSTA  340



>gb|AAA33466.1| glyceraldehyde-3-phosphate dehydrogenase, partial [Zea mays]
Length=247

 Score =   218 bits (555),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEK ASY++IKKAIK  S
Sbjct  119  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRIEKGASYEEIKKAIKAAS  178

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDF GDS SSIFDAKAGIALN +FIK +SWYDNEWGYSNRVVD
Sbjct  179  EGPLKGIMGYVEEDLVSTDFTGDSRSSIFDAKAGIALNDHFIKLVSWYDNEWGYSNRVVD  238

Query  74   LIRHM  60
            LIRHM
Sbjct  239  LIRHM  243



>gb|AFD62802.1| GAPDH2 [Ipomoea purpurea]
Length=337

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 118/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R EK A+Y+D+K+AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRTEKRATYEDVKQAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+D+VS+DFVGD  SSIFDAKAGI+LN NF K ++WYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEEDLVSSDFVGDCRSSIFDAKAGISLNENFFKVVAWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            LIRHM S+A
Sbjct  329  LIRHMHSAA  337



>ref|XP_002312644.2| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
 gb|EEE90011.2| glyceraldehyde 3-phosphate dehydrogenase family protein [Populus 
trichocarpa]
Length=341

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPAL+GKLTGM+FRVPTADVSVVDLT R+EK A+Y+DIK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALDGKLTGMSFRVPTADVSVVDLTVRLEKKATYEDIKSAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E ++KGILGY EDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  ETNLKGILGYIEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKIVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  332  LIAHMAKT  339



>gb|AID52923.1| cytosolic glyceraldehyde-3-phosphate dehydrogenase [Carthamus 
tinctorius]
Length=341

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY EDD+VSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLKGILGYVEDDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  332  LICHIAS  338



>ref|XP_009792011.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Nicotiana sylvestris]
Length=337

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIAL+ NF+K +SWYDNE GYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFIGDNRSSIFDAKAGIALSKNFVKLVSWYDNEMGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+HMAS
Sbjct  329  LIKHMAS  335



>ref|XP_006440049.1| hypothetical protein CICLE_v10021037mg [Citrus clementina]
 gb|ESR53289.1| hypothetical protein CICLE_v10021037mg [Citrus clementina]
Length=337

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+  F+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI HMA +
Sbjct  329  LIVHMAKT  336



>ref|XP_008439417.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Cucumis melo]
 gb|ADN33958.1| glyceraldehyde-3-phosphate dehydrogenase [Cucumis melo subsp. 
melo]
Length=337

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAASY+DIK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAASYEDIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVS+DFVGDS SSIFDAKAGIALN NF+K +SWYDNE GYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSSDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEVGYSTRVVD  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LIVHIAS  335



>gb|AGY14240.1| glyceraldehyde 3-phosphate dehydrogenase [Eschenbachia blinii]
Length=339

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYEQIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG ++GILGY EDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGKLEGILGYVEDDVVSTDFIGDSHSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMASS  51
            LI H+AS+
Sbjct  332  LICHIASA  339



>ref|XP_003523131.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Glycine max]
Length=338

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDEIKNAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            L+  +A  +
Sbjct  329  LLVFVAKKS  337



>ref|XP_006578692.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Glycine 
max]
Length=338

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDEIKNAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            L+  +A  +
Sbjct  329  LLVFVAKKS  337



>gb|ACJ85080.1| unknown [Medicago truncatula]
 gb|AFK44286.1| unknown [Medicago truncatula]
Length=340

 Score =   220 bits (561),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGA KAVGKVLP LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y++IK AIKEES
Sbjct  212  IPSSTGAVKAVGKVLPVLNGKLTGMSFRVPTVDVSVVDLTVRLEKKATYEEIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS RV+D
Sbjct  272  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSTRVID  331

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  332  LIVHIASVA  340



>ref|XP_011024076.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic 
[Populus euphratica]
Length=338

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EKAA YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKAAKYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG MKGILGYT++D+VSTDF+GDS SSIFDAKAGIALN N++K +SWYDNEWGYS RVVD
Sbjct  269  EGKMKGILGYTDEDLVSTDFIGDSRSSIFDAKAGIALNDNYVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMAS  54
            LI ++AS
Sbjct  329  LICYIAS  335



>ref|NP_001236129.1| glyceraldehyde-3-phosphate dehydrogenase [Glycine max]
 gb|ABC75834.1| glyceraldehyde-3-phosphate dehydrogenase [Glycine max]
 gb|KHN23268.1| Glyceraldehyde-3-phosphate dehydrogenase [Glycine soja]
Length=338

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDEIKNAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            L+  +A  +
Sbjct  329  LLVFVAKKS  337



>ref|XP_010910405.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Elaeis guineensis]
Length=340

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK+A+Y DIK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKSATYADIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDD+VSTDF+GDS SSIFDAKAGIALN +F+K ++WYDNEWGYS+RVVD
Sbjct  272  EGRLKGILGYTEDDLVSTDFIGDSRSSIFDAKAGIALNDHFVKMVAWYDNEWGYSSRVVD  331

Query  74   LIRHMAS  54
            LIR M S
Sbjct  332  LIRAMDS  338



>ref|NP_001237544.1| glyceraldehyde-3-dehydrogenase C subunit [Glycine max]
 gb|ABA07956.1| glyceraldehyde-3-dehydrogenase C subunit [Glycine max]
Length=338

 Score =   220 bits (560),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDEIKNAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            L+  +A  +
Sbjct  329  LLVFVAKKS  337



>gb|KHN31916.1| Glyceraldehyde-3-phosphate dehydrogenase [Glycine soja]
Length=384

 Score =   221 bits (564),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/129 (83%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIKEES
Sbjct  255  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKEASYDEIKNAIKEES  314

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  315  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNKNFVKLVSWYDNEWGYSSRVID  374

Query  74   LIRHMASSA  48
            L+  +A  +
Sbjct  375  LLVFVAKKS  383



>dbj|BAN45710.1| putative glycelaldehyde-3-phosphate dehydrogenase, partial [Pyrus 
pyrifolia var. culta]
Length=334

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EK A+Y+ IK AIKEES
Sbjct  206  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKPATYEQIKAAIKEES  265

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GDS SSIFDAKAGIALN  F+K +SWYDNEWGYS RVVD
Sbjct  266  EGKLKGILGYTEDDVVSTDFIGDSRSSIFDAKAGIALNDKFVKLVSWYDNEWGYSTRVVD  325

Query  74   LIRHMASSA  48
            LI H+AS+ 
Sbjct  326  LIVHVASTC  334



>ref|XP_009387502.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+Y++IK AIK ES
Sbjct  210  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPATYEEIKAAIKAES  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDF+GD+ SSIFDAKAGIALNGNF+K +SWYDNEWGYS+RVVD
Sbjct  270  EGKLKGILGYVEEDLVSTDFLGDNRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSSRVVD  329

Query  74   LIRHM  60
            L+RHM
Sbjct  330  LVRHM  334



>gb|ACX30668.1| glyceraldehyde-3-phosphate dehydrogenase [Tamarix hispida]
Length=341

 Score =   220 bits (560),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EKAA+Y DIK AIKEE 
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYFDIKAAIKEEF  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KG+LGYTE+D+V TDF+GDS SSIFDAKAGIALNGNF+K +SWYDNEWGYS+RV+D
Sbjct  272  EGNLKGVLGYTEEDLVFTDFIGDSRSSIFDAKAGIALNGNFVKLVSWYDNEWGYSSRVID  331

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  332  LIAHIAS  338



>gb|EAY94607.1| hypothetical protein OsI_16384 [Oryza sativa Indica Group]
 gb|EAZ31153.1| hypothetical protein OsJ_15252 [Oryza sativa Japonica Group]
Length=385

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/125 (85%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKEES
Sbjct  257  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPASYDQIKAAIKEES  316

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDF GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RVVD
Sbjct  317  EGKLKGILGYVEEDLVSTDFQGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVVD  376

Query  74   LIRHM  60
            LIRHM
Sbjct  377  LIRHM  381



>dbj|BAH28852.1| glyceraldehyde-3-phosphate dehydrogenase [Ipomoea nil]
Length=337

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/129 (80%), Positives = 117/129 (91%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R EK A+Y+D+K+AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRTEKKATYEDVKQAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTE+D+VS+DFVGD  SSIFDAKAGI+LN NF K ++WYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTEEDLVSSDFVGDCRSSIFDAKAGISLNENFFKVVAWYDNEWGYSSRVID  328

Query  74   LIRHMASSA  48
            LIRHM S A
Sbjct  329  LIRHMHSVA  337



>gb|AFK44506.1| unknown [Lotus japonicus]
Length=286

 Score =   218 bits (555),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAASY+ IK AI EES
Sbjct  158  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAASYEQIKAAIMEES  217

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+DVVSTDFVGDS SSIFDAKAGI+LN NF+K +SWYDNEWGYS RVVD
Sbjct  218  EGKLKGILGYIEEDVVSTDFVGDSRSSIFDAKAGISLNDNFVKLVSWYDNEWGYSTRVVD  277

Query  74   LIRHMASSA  48
            LI H+AS A
Sbjct  278  LIVHIASVA  286



>ref|XP_010907760.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X1 [Elaeis guineensis]
Length=341

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT RIEK+A+Y DIK AIKEES
Sbjct  213  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRIEKSATYADIKAAIKEES  272

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDD+VSTDF+GDS SSIFDAKAGIALN +F+K ++WYDNEWGYS+RVVD
Sbjct  273  EGRLKGILGYTEDDLVSTDFIGDSRSSIFDAKAGIALNDHFVKLVAWYDNEWGYSSRVVD  332

Query  74   LIRHMAS  54
            LIR M S
Sbjct  333  LIRSMDS  339



>ref|NP_001060897.1| Os08g0126300 [Oryza sativa Japonica Group]
 sp|Q0J8A4.1|G3PC1_ORYSJ RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase 1, cytosolic; 
AltName: Full=PP38 [Oryza sativa Japonica Group]
 sp|A2YQT7.1|G3PC_ORYSI RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic; 
AltName: Full=PP38 [Oryza sativa Indica Group]
 pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E5R|A Chain A, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E5R|B Chain B, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E5R|C Chain C, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3V1Y|O Chain O, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 pdb|3V1Y|A Chain A, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 pdb|3V1Y|B Chain B, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 pdb|3V1Y|C Chain C, Crystal Structures Of Glyceraldehyde-3-Phosphate Dehydrogenase 
Complexes With Nad
 dbj|BAD08850.1| glyceraldehyde 3-phosphate dehydrogenase, cytosolic [Oryza sativa 
Japonica Group]
 dbj|BAF22811.1| Os08g0126300 [Oryza sativa Japonica Group]
 gb|ABL74559.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 gb|EAZ05448.1| hypothetical protein OsI_27662 [Oryza sativa Indica Group]
 gb|EAZ41375.1| hypothetical protein OsJ_25892 [Oryza sativa Japonica Group]
 dbj|BAG92310.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96258.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86844.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Japonica 
Group]
 gb|AFI71826.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa]
Length=337

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEKAASYD IK AIK  S
Sbjct  209  IPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYSNRV+D
Sbjct  269  EGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVID  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>gb|AFM93782.1| glyceraldehyde 3-phosphate dehydrogenase [Cymbidium goeringii]
Length=340

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT RIEK ASY++IK A+KEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRIEKKASYEEIKAAVKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY ++D+VSTDF+GD+ SSIFDAKAGIALN NF+K ++WYDNEWGYSNRVVD
Sbjct  272  EGKLKGIIGYVDEDLVSTDFLGDNRSSIFDAKAGIALNDNFVKVVAWYDNEWGYSNRVVD  331

Query  74   LIRHMASS  51
            LIRH+A++
Sbjct  332  LIRHIANT  339



>ref|XP_010907761.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
isoform X2 [Elaeis guineensis]
Length=340

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT RIEK+A+Y DIK AIKEES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRIEKSATYADIKAAIKEES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDD+VSTDF+GDS SSIFDAKAGIALN +F+K ++WYDNEWGYS+RVVD
Sbjct  272  EGRLKGILGYTEDDLVSTDFIGDSRSSIFDAKAGIALNDHFVKLVAWYDNEWGYSSRVVD  331

Query  74   LIRHMAS  54
            LIR M S
Sbjct  332  LIRSMDS  338



>gb|AAA82047.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa]
Length=337

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEKAASYD IK AIK  S
Sbjct  209  IPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSAS  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYSNRV+D
Sbjct  269  EGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVID  328

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  329  LIRHMAKT  336



>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E6A|A Chain A, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E6A|B Chain B, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
 pdb|3E6A|C Chain C, Crystal Structure And Functional Analysis Of Glyceraldehyde- 
3-Phosphate Dehydrogenase From Oryza Sativa
Length=336

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEKAASYD IK AIK  S
Sbjct  208  IPSSTGAAKAVGKVLPDLNGKLTGMSFRVPTVDVSVVDLTVRIEKAASYDAIKSAIKSAS  267

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDFVGDS SSIFDAKAGIALN NF+K ++WYDNEWGYSNRV+D
Sbjct  268  EGKLKGIIGYVEEDLVSTDFVGDSRSSIFDAKAGIALNDNFVKLVAWYDNEWGYSNRVID  327

Query  74   LIRHMASS  51
            LIRHMA +
Sbjct  328  LIRHMAKT  335



>gb|AEQ75490.1| glyeraldehyde 3-phosphate dehydrogenase [Rosa multiflora]
Length=336

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/128 (81%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDQIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYT++DVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNEWGYS+RV+D
Sbjct  269  EGKLKGILGYTDEDVVSTDFIGDNRSSIFDAKAGIALNDNFVKLVSWYDNEWGYSSRVID  328

Query  74   LIRHMASS  51
            LI H+A +
Sbjct  329  LIVHIAKA  336



>ref|XP_006476982.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
X1 [Citrus sinensis]
 ref|XP_006476983.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like isoform 
X2 [Citrus sinensis]
Length=337

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD+IK AIK ES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKDASYDEIKAAIKAES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIAL+  F+K +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALSKKFVKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASS  51
            LI HM+ +
Sbjct  329  LIVHMSKT  336



>ref|XP_009384257.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2, cytosolic-like 
[Musa acuminata subsp. malaccensis]
Length=338

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EKAA+YD+IK AIKEES
Sbjct  210  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKAATYDEIKAAIKEES  269

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VSTDFVGDS SSIFDAKAGIALN NF K +SWYDNEWGYS+RV+D
Sbjct  270  EGKLKGILGYVEEDLVSTDFVGDSRSSIFDAKAGIALNPNFAKLVSWYDNEWGYSSRVID  329

Query  74   LIRHM  60
            LIRH+
Sbjct  330  LIRHI  334



>sp|P34921.1|G3PC_DIACA RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Dianthus caryophyllus]
Length=338

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/129 (81%), Positives = 115/129 (89%), Gaps = 0/129 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT RIEK A+Y+ +K AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRIEKPATYEQVKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGD+ SSIFDAKAGIALN NFIK +SWYDNEWGYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFVGDNRSSIFDAKAGIALNDNFIKLVSWYDNEWGYSTRVVD  328

Query  74   LIRHMASSA  48
            LI H+  + 
Sbjct  329  LIAHIHKTC  337



>gb|ABR25770.1| glyceraldehyde-3-phosphate dehydrogenase [Oryza sativa Indica 
Group]
Length=145

 Score =   213 bits (541),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 111/125 (89%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASYD IK AIKEE 
Sbjct  17   IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPASYDQIKAAIKEEF  76

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGY E+D+VS DF GD+ SSIFDAKAGIAL  NF+K +SWYDNEWGYS+RVVD
Sbjct  77   EGKLKGILGYVEEDLVSPDFQGDNRSSIFDAKAGIALKDNFVKLVSWYDNEWGYSSRVVD  136

Query  74   LIRHM  60
            LIRHM
Sbjct  137  LIRHM  141



>sp|P34924.1|G3PC_PINSY RecName: Full=Glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Pinus sylvestris]
 gb|AAA33779.1| glyceraldehyde-3-phosphate dehydrogenase [Pinus sylvestris]
Length=340

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK+A+YD+IK AIK ES
Sbjct  212  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTPDVSVVDLTVRLEKSATYDEIKAAIKAES  271

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTED VVSTDF+GDS SSIFDA+AGIAL+ NF+K +SWYDNEWGYS+RVVD
Sbjct  272  EGNLKGILGYTEDAVVSTDFIGDSRSSIFDAQAGIALSDNFVKLVSWYDNEWGYSSRVVD  331

Query  74   LIRHMASS  51
            LI HMA++
Sbjct  332  LIVHMAAT  339



>gb|KHG23352.1| Glyceraldehyde-3-phosphate dehydrogenase-2C cytosolic [Gossypium 
arboreum]
Length=263

 Score =   216 bits (551),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 116/128 (91%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK ASY+DIK AI+E S
Sbjct  136  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKASYEDIKAAIREAS  195

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            + +MKGILGY ++D+VSTDFVGDS SSIFDAKAGIALN NF K ++WYDNEWGYS+RV+D
Sbjct  196  QTTMKGILGYVDEDLVSTDFVGDSRSSIFDAKAGIALNDNFTKLVAWYDNEWGYSSRVID  255

Query  74   LIRHMASS  51
            L+RHMAS 
Sbjct  256  LVRHMASC  263



>ref|XP_004241503.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic 
[Solanum lycopersicum]
Length=337

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGM+FRVPT DVSVVDLT R+EK A+YD+IK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPSLNGKLTGMSFRVPTVDVSVVDLTVRLEKEATYDEIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIAL+ NF+K +SWYDNE GYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSTDFLGDNRSSIFDAKAGIALSKNFVKLVSWYDNEMGYSTRVVD  328

Query  74   LIRHMAS  54
            LI+HMAS
Sbjct  329  LIKHMAS  335



>ref|WP_036936905.1| glyceraldehyde-3-phosphate dehydrogenase [Pseudobacteroides cellulosolvens]
Length=335

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKV+P LNGKLTGMAFRVPTADVSVVDLT R+EKAASYDDIK A+K+ S
Sbjct  206  IPSSTGAAKAVGKVIPELNGKLTGMAFRVPTADVSVVDLTVRLEKAASYDDIKAAVKKAS  265

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            E  +KGILGYTED+VVS+DF+ DS +SIFDAKAGIALNGNF+K +SWYDNEWGYSN+VVD
Sbjct  266  ENELKGILGYTEDEVVSSDFIHDSRTSIFDAKAGIALNGNFVKLVSWYDNEWGYSNKVVD  325

Query  74   LIRHMA  57
            LI HMA
Sbjct  326  LIVHMA  331



>gb|ACG32987.1| hypothetical protein [Zea mays]
Length=282

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/125 (83%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP LNGKLTGM+FRVPT DVSVVDLT RIEK ASY++IKKAIK  S
Sbjct  154  IPSSTGAAKAVGKVLPELNGKLTGMSFRVPTVDVSVVDLTVRIEKGASYEEIKKAIKAAS  213

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGI+GY E+D+VSTDF GDS SSIFDAKAGIALN +FIK +SWYDNEWGYSNRVVD
Sbjct  214  EGPLKGIMGYVEEDLVSTDFTGDSRSSIFDAKAGIALNDHFIKLVSWYDNEWGYSNRVVD  273

Query  74   LIRHM  60
            LIRHM
Sbjct  274  LIRHM  278



>gb|AFK35824.1| unknown [Medicago truncatula]
Length=339

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD IK AIKEES
Sbjct  211  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKPATYDQIKAAIKEES  270

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGYTEDDVVSTDF+GD+ SSIFDAKAGIALN NF+K +SWYDNE GYS RVVD
Sbjct  271  EGNLKGILGYTEDDVVSTDFIGDTRSSIFDAKAGIALNDNFVKLVSWYDNELGYSTRVVD  330

Query  74   LIRHMASS  51
            LI H+A  
Sbjct  331  LIVHIAKQ  338



>gb|KHG04963.1| Glyceraldehyde-3-phosphate dehydrogenase [Gossypium arboreum]
Length=287

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 118/128 (92%), Gaps = 0/128 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGMAFRVPT DVSVVDLT R+EK A+YD+IK AIK ES
Sbjct  160  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTVDVSVVDLTVRLEKKATYDEIKAAIKAES  219

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG++KGILGY ++D+VSTDF+GD+ SSIFDAKAGIALN NF+K ++WYDNEWGYS+RV+D
Sbjct  220  EGNLKGILGYVDEDLVSTDFIGDNRSSIFDAKAGIALNDNFVKLVTWYDNEWGYSSRVID  279

Query  74   LIRHMASS  51
            LIRHM+ +
Sbjct  280  LIRHMSKA  287



>gb|AGZ15367.1| glyceraldehyde-3-dehydrogenase C subunit [Phaseolus vulgaris]
Length=487

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLP+LNGKLTGMAFRVPT DVSVVDLT R+EK+A+Y+DIKKAIKEES
Sbjct  358  IPSSTGAAKAVGKVLPSLNGKLTGMAFRVPTVDVSVVDLTVRLEKSATYEDIKKAIKEES  417

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVSTDFVGDS SSIFDAKAGIALN NF+K + WYDNEWGYS+RV+D
Sbjct  418  EGKLKGILGYTEDDVVSTDFVGDSRSSIFDAKAGIALNDNFVKLVMWYDNEWGYSSRVID  477

Query  74   LIRHMA  57
            L+ H+A
Sbjct  478  LLVHVA  483



>ref|NP_001267672.1| glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like [Cucumis 
sativus]
 ref|XP_004162129.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase, cytosolic-like 
[Cucumis sativus]
 gb|ADM89006.1| glyceraldehyde-3-phosphate dehydrogenase [Cucumis sativus]
 gb|KGN64385.1| hypothetical protein Csa_1G050240 [Cucumis sativus]
Length=336

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = -1

Query  434  IPSSTGAAKAVGKVLPALNGKLTGMAFRVPTADVSVVDLTARIEKAASYDDIKKAIKEES  255
            IPSSTGAAKAVGKVLPALNGKLTGM+FRVPT DVSVVDLT R+EK ASY+DIK AIKEES
Sbjct  209  IPSSTGAAKAVGKVLPALNGKLTGMSFRVPTVDVSVVDLTVRLEKKASYEDIKAAIKEES  268

Query  254  EGSMKGILGYTEDDVVSTDFVGDSSSSIFDAKAGIALNGNFIKFISWYDNEWGYSNRVVD  75
            EG +KGILGYTEDDVVS+DFVGDS SSIFDAKAGIALN NF+K +SWYDNE GYS RVVD
Sbjct  269  EGKLKGILGYTEDDVVSSDFVGDSRSSIFDAKAGIALNDNFVKIVSWYDNEVGYSTRVVD  328

Query  74   LIRHMAS  54
            LI H+AS
Sbjct  329  LIVHIAS  335



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 534393183384