BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7160_g1_i2 len=1618 path=[1596:0-376 1973:377-1617]

Length=1618
                                                                      Score     E

ref|XP_006347092.1|  PREDICTED: uncharacterized protein LOC102580388    596   0.0      
ref|XP_004232824.1|  PREDICTED: uncharacterized protein LOC101260688    595   0.0      
ref|XP_009763335.1|  PREDICTED: uncharacterized protein LOC104215273    590   0.0      
ref|XP_009603719.1|  PREDICTED: uncharacterized protein LOC104098641    587   0.0      
ref|XP_011096284.1|  PREDICTED: uncharacterized protein LOC105175522    582   0.0      
ref|XP_010092612.1|  hypothetical protein L484_006374                   561   0.0      
ref|XP_009631143.1|  PREDICTED: uncharacterized protein LOC104120968    562   0.0      
gb|EYU27955.1|  hypothetical protein MIMGU_mgv1a007977mg                560   0.0      
ref|XP_011086083.1|  PREDICTED: uncharacterized protein LOC105167912    560   0.0      
ref|XP_009766485.1|  PREDICTED: uncharacterized protein LOC104217853    559   0.0      
ref|XP_010327022.1|  PREDICTED: uncharacterized protein LOC101254...    556   0.0      
emb|CDO99608.1|  unnamed protein product                                546   0.0      
ref|XP_007211954.1|  hypothetical protein PRUPE_ppa006425mg             542   0.0      
ref|XP_007025742.1|  Uncharacterized protein TCM_029952                 548   0.0      
ref|XP_010327027.1|  PREDICTED: uncharacterized protein LOC101254...    540   0.0      
ref|XP_008224979.1|  PREDICTED: uncharacterized protein LOC103324663    540   0.0      
ref|XP_010646775.1|  PREDICTED: uncharacterized protein LOC100257753    540   0.0      
ref|XP_011027923.1|  PREDICTED: uncharacterized protein LOC105128...    539   0.0      
ref|XP_006384013.1|  hypothetical protein POPTR_0004s03700g             538   0.0      
ref|XP_011043338.1|  PREDICTED: uncharacterized protein LOC105138816    536   0.0      
ref|XP_006361017.1|  PREDICTED: uncharacterized protein LOC102578...    535   0.0      
ref|XP_002316643.2|  hypothetical protein POPTR_0011s04510g             534   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002305670.2|  hypothetical protein POPTR_0004s03700g             533   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006449262.1|  hypothetical protein CICLE_v10015451mg             531   0.0      
ref|XP_006467869.1|  PREDICTED: uncharacterized protein LOC102620...    531   0.0      
ref|XP_009378251.1|  PREDICTED: uncharacterized protein LOC103966743    530   0.0      
gb|AES63728.2|  lysine ketoglutarate reductase trans-splicing-lik...    529   0.0      
ref|XP_006449263.1|  hypothetical protein CICLE_v10015451mg             529   0.0      
ref|XP_006467868.1|  PREDICTED: uncharacterized protein LOC102620...    528   0.0      
ref|XP_003593477.1|  Lysine ketoglutarate reductase trans-splicin...    528   0.0      
gb|KEH36526.1|  lysine ketoglutarate reductase trans-splicing-lik...    526   0.0      
ref|XP_008355992.1|  PREDICTED: uncharacterized protein LOC103419671    527   0.0      
ref|XP_008383799.1|  PREDICTED: uncharacterized protein LOC103446457    525   7e-180   
ref|XP_006594617.1|  PREDICTED: uncharacterized protein LOC100776...    523   5e-179   
ref|XP_006594612.1|  PREDICTED: uncharacterized protein LOC100776...    522   1e-178   
gb|KHN08570.1|  hypothetical protein glysoja_014335                     520   2e-178   
ref|XP_004146635.1|  PREDICTED: uncharacterized protein LOC101217607    521   2e-178   
gb|KGN64636.1|  hypothetical protein Csa_1G072470                       520   3e-178   
ref|XP_006594619.1|  PREDICTED: uncharacterized protein LOC100776...    520   4e-178   
ref|XP_004293534.1|  PREDICTED: uncharacterized protein LOC101292191    520   5e-178   
gb|EPS65991.1|  hypothetical protein M569_08784                         520   5e-178   
gb|KHG05934.1|  26S proteasome regulatory subunit rpn-1                 520   6e-178   
gb|KHG04115.1|  GTPase Der                                              520   6e-178   
ref|XP_006597406.1|  PREDICTED: uncharacterized protein LOC100778...    519   7e-178   
ref|XP_006597405.1|  PREDICTED: uncharacterized protein LOC100778...    520   9e-178   
ref|XP_006594618.1|  PREDICTED: uncharacterized protein LOC100776...    519   1e-177   
ref|XP_010268785.1|  PREDICTED: uncharacterized protein LOC104605639    517   1e-177   
ref|XP_006597401.1|  PREDICTED: uncharacterized protein LOC100778...    519   1e-177   
ref|XP_004158032.1|  PREDICTED: uncharacterized protein LOC101230572    519   1e-177   
gb|EYU43400.1|  hypothetical protein MIMGU_mgv1a022983mg                515   2e-176   
ref|XP_010696585.1|  PREDICTED: uncharacterized protein LOC104909088    515   4e-176   
ref|XP_007148219.1|  hypothetical protein PHAVU_006G190100g             511   8e-175   
ref|XP_007148218.1|  hypothetical protein PHAVU_006G190100g             511   1e-174   
ref|XP_006583798.1|  PREDICTED: uncharacterized protein LOC100792...    511   1e-174   
gb|KHN07305.1|  hypothetical protein glysoja_027395                     510   1e-174   
ref|XP_008442108.1|  PREDICTED: uncharacterized protein LOC103486065    508   2e-173   
ref|XP_004485727.1|  PREDICTED: uncharacterized protein LOC101506...    502   3e-171   
ref|XP_003541558.1|  PREDICTED: uncharacterized protein LOC100807...    500   1e-170   
ref|XP_002521414.1|  conserved hypothetical protein                     499   2e-170   Ricinus communis
ref|XP_004504995.1|  PREDICTED: uncharacterized protein LOC101512967    499   3e-170   
ref|XP_004485732.1|  PREDICTED: uncharacterized protein LOC101506...    499   4e-170   
ref|XP_007159269.1|  hypothetical protein PHAVU_002G223800g             499   4e-170   
ref|XP_009104492.1|  PREDICTED: uncharacterized protein LOC103830...    499   1e-169   
gb|KHG08288.1|  hypothetical protein F383_16150                         496   2e-169   
ref|XP_009104564.1|  PREDICTED: uncharacterized protein LOC103830...    497   7e-169   
emb|CDY03814.1|  BnaC01g29310D                                          496   3e-168   
emb|CDY12891.1|  BnaA09g13830D                                          496   3e-168   
ref|XP_009113143.1|  PREDICTED: uncharacterized protein LOC103838453    495   5e-168   
emb|CDY52220.1|  BnaA01g35920D                                          495   5e-168   
ref|XP_010905352.1|  PREDICTED: uncharacterized protein LOC105032...    491   2e-167   
ref|XP_006392027.1|  hypothetical protein EUTSA_v10023474mg             493   4e-167   
emb|CDY40958.1|  BnaCnng10010D                                          491   1e-166   
ref|XP_002889853.1|  predicted protein                                  491   3e-166   
ref|XP_006301321.1|  hypothetical protein CARUB_v10021730mg             489   9e-166   
ref|XP_010533870.1|  PREDICTED: uncharacterized protein LOC104809554    488   1e-165   
ref|XP_006417384.1|  hypothetical protein EUTSA_v10007686mg             489   2e-165   
ref|XP_010905328.1|  PREDICTED: uncharacterized protein LOC105032...    486   3e-165   
ref|XP_006307556.1|  hypothetical protein CARUB_v10009178mg             488   5e-165   
ref|XP_010473328.1|  PREDICTED: uncharacterized protein LOC104752...    487   1e-164   
ref|NP_172583.2|  uncharacterized protein                               487   2e-164   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418093.1|  PREDICTED: uncharacterized protein LOC104703720    486   2e-164   
ref|XP_010430128.1|  PREDICTED: uncharacterized protein LOC104714458    485   3e-164   
ref|XP_002888096.1|  hypothetical protein ARALYDRAFT_475199             485   3e-164   
ref|XP_010458502.1|  PREDICTED: uncharacterized protein LOC104739...    483   1e-163   
ref|XP_010492476.1|  PREDICTED: uncharacterized protein LOC104769...    483   1e-163   
gb|KDP20910.1|  hypothetical protein JCGZ_21381                         481   2e-163   
ref|XP_010458500.1|  PREDICTED: uncharacterized protein LOC104739...    484   2e-163   
ref|XP_008809916.1|  PREDICTED: uncharacterized protein LOC103721469    482   2e-163   
ref|XP_010492461.1|  PREDICTED: uncharacterized protein LOC104769...    484   2e-163   
ref|XP_010278334.1|  PREDICTED: uncharacterized protein LOC104612...    480   5e-163   
ref|XP_006449261.1|  hypothetical protein CICLE_v10015451mg             481   6e-163   
ref|NP_176319.1|  uncharacterized protein                               481   2e-162   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007148221.1|  hypothetical protein PHAVU_006G190100g             476   1e-161   
ref|XP_010458503.1|  PREDICTED: uncharacterized protein LOC104739...    478   1e-161   
ref|XP_010458501.1|  PREDICTED: uncharacterized protein LOC104739...    479   2e-161   
ref|XP_006449259.1|  hypothetical protein CICLE_v10015451mg             475   3e-161   
ref|XP_010278336.1|  PREDICTED: uncharacterized protein LOC104612...    474   3e-161   
gb|KDO75805.1|  hypothetical protein CISIN_1g015555mg                   474   4e-161   
ref|XP_006449260.1|  hypothetical protein CICLE_v10015451mg             474   5e-161   
ref|XP_010476024.1|  PREDICTED: uncharacterized protein LOC104755...    476   6e-161   
ref|XP_010476020.1|  PREDICTED: uncharacterized protein LOC104755...    477   1e-160   
emb|CDY20982.1|  BnaA08g25430D                                          475   2e-160   
ref|XP_003593478.1|  Lysine ketoglutarate reductase trans-splicin...    473   2e-160   
gb|KEH31135.1|  lysine ketoglutarate reductase trans-splicing-rel...    486   4e-160   
gb|ABK25584.1|  unknown                                                 475   7e-160   Picea sitchensis
gb|KEH36527.1|  lysine ketoglutarate reductase trans-splicing-lik...    470   9e-160   
emb|CDY19346.1|  BnaC05g08550D                                          474   1e-159   
emb|CDY20585.1|  BnaC08g14730D                                          473   2e-159   
emb|CDX97937.1|  BnaA06g06880D                                          473   5e-159   
ref|XP_009148446.1|  PREDICTED: uncharacterized protein LOC103871881    472   8e-159   
ref|XP_010059328.1|  PREDICTED: uncharacterized protein LOC104447263    469   7e-158   
ref|XP_009110741.1|  PREDICTED: uncharacterized protein LOC103836245    468   7e-158   
ref|XP_010040735.1|  PREDICTED: uncharacterized protein LOC104429587    466   1e-157   
ref|XP_006574635.1|  PREDICTED: uncharacterized protein LOC100807...    466   9e-157   
gb|KCW74645.1|  hypothetical protein EUGRSUZ_E03369                     464   2e-156   
ref|XP_006848620.1|  hypothetical protein AMTR_s00171p00031600          464   5e-156   
ref|XP_006597407.1|  PREDICTED: uncharacterized protein LOC100778...    461   6e-156   
ref|XP_010473332.1|  PREDICTED: uncharacterized protein LOC104752...    460   3e-155   
gb|AAN63500.1|AF317555_1  lysine ketoglutarate reductase trans-sp...    451   6e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274911.1|  PREDICTED: uncharacterized protein LOC104610...    451   2e-151   
ref|XP_010274912.1|  PREDICTED: uncharacterized protein LOC104610...    449   8e-151   
ref|XP_009395413.1|  PREDICTED: uncharacterized protein LOC103980679    442   5e-148   
ref|XP_008802583.1|  PREDICTED: uncharacterized protein LOC103716...    440   2e-147   
ref|XP_010935614.1|  PREDICTED: uncharacterized protein LOC105055...    438   1e-146   
ref|XP_008802591.1|  PREDICTED: uncharacterized protein LOC103716...    438   1e-146   
ref|XP_006307555.1|  hypothetical protein CARUB_v10009178mg             436   6e-146   
ref|XP_010278338.1|  PREDICTED: uncharacterized protein LOC104612...    434   6e-146   
ref|XP_010278337.1|  PREDICTED: uncharacterized protein LOC104612...    434   7e-146   
ref|XP_008778200.1|  PREDICTED: uncharacterized protein LOC103698...    435   1e-145   
gb|KDO75810.1|  hypothetical protein CISIN_1g015555mg                   432   1e-144   
ref|XP_010278339.1|  PREDICTED: uncharacterized protein LOC104612...    431   1e-144   
ref|XP_006449264.1|  hypothetical protein CICLE_v10015451mg             432   2e-144   
ref|NP_001060006.1|  Os07g0564800                                       431   3e-143   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002439080.1|  hypothetical protein SORBIDRAFT_10g031220          426   9e-142   Sorghum bicolor [broomcorn]
gb|EEC77985.1|  hypothetical protein OsI_17370                          432   1e-141   Oryza sativa Indica Group [Indian rice]
ref|XP_006657845.1|  PREDICTED: uncharacterized protein LOC102704...    426   1e-141   
ref|XP_006657844.1|  PREDICTED: uncharacterized protein LOC102704...    426   2e-141   
ref|XP_006574636.1|  PREDICTED: uncharacterized protein LOC100807...    425   4e-141   
ref|NP_001130789.1|  uncharacterized protein LOC100191893               424   5e-141   Zea mays [maize]
ref|XP_004958045.1|  PREDICTED: uncharacterized protein LOC101761...    424   1e-140   
ref|XP_006574638.1|  PREDICTED: uncharacterized protein LOC100807...    423   2e-140   
ref|XP_004958044.1|  PREDICTED: uncharacterized protein LOC101761...    423   3e-140   
ref|XP_009396162.1|  PREDICTED: uncharacterized protein LOC103981234    418   3e-140   
ref|XP_006657376.1|  PREDICTED: uncharacterized protein LOC102704535    422   4e-140   
ref|XP_004966564.1|  PREDICTED: uncharacterized protein LOC101765...    422   4e-140   
ref|XP_008668561.1|  PREDICTED: uncharacterized protein LOC100502...    421   2e-139   
dbj|BAJ99055.1|  predicted protein                                      420   2e-139   
ref|XP_008650832.1|  PREDICTED: hypothetical protein isoform X1         420   5e-139   
ref|NP_001058667.1|  Os06g0731900                                       416   3e-138   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA63157.1|  TPA: hypothetical protein ZEAMMB73_938040              416   2e-137   
ref|XP_008668562.1|  PREDICTED: uncharacterized protein LOC100502...    416   2e-137   
ref|XP_008650833.1|  PREDICTED: hypothetical protein isoform X2         414   6e-137   
ref|XP_008650835.1|  PREDICTED: hypothetical protein isoform X4         414   2e-136   
ref|XP_006574639.1|  PREDICTED: uncharacterized protein LOC100807...    410   9e-136   
gb|AFW69650.1|  hypothetical protein ZEAMMB73_069164                    407   1e-135   
dbj|BAD62500.1|  putative lysine ketoglutarate reductase trans-sp...    409   3e-135   Oryza sativa Japonica Group [Japonica rice]
gb|KHN10306.1|  hypothetical protein glysoja_040534                     407   6e-135   
ref|XP_010248201.1|  PREDICTED: uncharacterized protein LOC104590...    407   1e-134   
ref|XP_010248154.1|  PREDICTED: uncharacterized protein LOC104590...    408   1e-134   
ref|XP_010236939.1|  PREDICTED: uncharacterized protein LOC100833...    407   8e-134   
ref|XP_010247917.1|  PREDICTED: uncharacterized protein LOC104590...    407   1e-133   
gb|EEE66410.1|  hypothetical protein OsJ_22755                          404   3e-133   Oryza sativa Japonica Group [Japonica rice]
gb|EMS62996.1|  hypothetical protein TRIUR3_26204                       404   1e-132   
ref|XP_002265374.2|  PREDICTED: uncharacterized protein LOC100255...    402   1e-131   Vitis vinifera
ref|XP_010657947.1|  PREDICTED: uncharacterized protein LOC100255...    401   1e-131   
ref|XP_010657946.1|  PREDICTED: uncharacterized protein LOC100255...    401   1e-131   
gb|EEE67421.1|  hypothetical protein OsJ_24761                          401   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010248082.1|  PREDICTED: uncharacterized protein LOC104590...    400   4e-131   
ref|XP_010236941.1|  PREDICTED: uncharacterized protein LOC100833...    400   5e-131   
ref|XP_010657948.1|  PREDICTED: uncharacterized protein LOC100255...    399   8e-131   
ref|XP_010274913.1|  PREDICTED: uncharacterized protein LOC104610...    394   8e-131   
ref|XP_010236937.1|  PREDICTED: uncharacterized protein LOC100833...    399   1e-130   
ref|NP_973809.1|  uncharacterized protein                               395   4e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006602841.1|  PREDICTED: uncharacterized protein LOC100798633    396   5e-130   
ref|XP_007139737.1|  hypothetical protein PHAVU_008G055100g             394   3e-129   
gb|KDO75811.1|  hypothetical protein CISIN_1g015555mg                   390   1e-128   
ref|XP_009410632.1|  PREDICTED: uncharacterized protein LOC103992...    394   1e-128   
ref|XP_009410631.1|  PREDICTED: uncharacterized protein LOC103992...    394   1e-128   
ref|XP_008778204.1|  PREDICTED: uncharacterized protein LOC103698...    390   2e-128   
ref|XP_002982728.1|  hypothetical protein SELMODRAFT_116806             391   2e-128   
ref|XP_009392032.1|  PREDICTED: uncharacterized protein LOC103978053    387   7e-128   
ref|XP_008368197.1|  PREDICTED: uncharacterized protein LOC103431805    393   1e-127   
ref|XP_008218666.1|  PREDICTED: uncharacterized protein LOC103318...    391   1e-127   
ref|XP_002463031.1|  hypothetical protein SORBIDRAFT_02g036520          388   1e-127   Sorghum bicolor [broomcorn]
ref|XP_008218669.1|  PREDICTED: uncharacterized protein LOC103318...    391   1e-127   
ref|XP_010527349.1|  PREDICTED: uncharacterized protein LOC104804...    390   2e-127   
ref|XP_010527348.1|  PREDICTED: uncharacterized protein LOC104804...    390   2e-127   
ref|XP_007049550.1|  Uncharacterized protein TCM_002621                 389   2e-127   
ref|XP_010030218.1|  PREDICTED: uncharacterized protein LOC104420...    390   3e-127   
ref|XP_010030219.1|  PREDICTED: uncharacterized protein LOC104420...    389   4e-127   
ref|XP_010030213.1|  PREDICTED: uncharacterized protein LOC104420...    390   4e-127   
gb|KDO42569.1|  hypothetical protein CISIN_1g014004mg                   387   7e-127   
ref|XP_009341364.1|  PREDICTED: uncharacterized protein LOC103933...    387   7e-127   
gb|KDO42568.1|  hypothetical protein CISIN_1g014004mg                   389   1e-126   
ref|XP_006470988.1|  PREDICTED: uncharacterized protein LOC102624954    389   1e-126   
ref|XP_009139663.1|  PREDICTED: uncharacterized protein LOC103863...    387   1e-126   
ref|XP_010682054.1|  PREDICTED: uncharacterized protein LOC104896...    388   1e-126   
ref|XP_010682053.1|  PREDICTED: uncharacterized protein LOC104896...    388   1e-126   
ref|XP_010557744.1|  PREDICTED: uncharacterized protein LOC104826...    387   2e-126   
ref|XP_010557742.1|  PREDICTED: uncharacterized protein LOC104826...    387   2e-126   
gb|KHG18284.1|  GTPase Der                                              387   2e-126   
ref|XP_008802242.1|  PREDICTED: uncharacterized protein LOC103716...    387   2e-126   
ref|XP_009341361.1|  PREDICTED: uncharacterized protein LOC103933...    387   3e-126   
ref|XP_009341362.1|  PREDICTED: uncharacterized protein LOC103933...    387   3e-126   
ref|XP_007222756.1|  hypothetical protein PRUPE_ppa006529mg             387   5e-126   
ref|XP_009355359.1|  PREDICTED: uncharacterized protein LOC103946...    386   5e-126   
ref|XP_009355356.1|  PREDICTED: uncharacterized protein LOC103946...    386   6e-126   
gb|KCW57157.1|  hypothetical protein EUGRSUZ_I02788                     384   8e-126   
ref|XP_010935615.1|  PREDICTED: uncharacterized protein LOC105055...    384   8e-126   
tpg|DAA63156.1|  TPA: hypothetical protein ZEAMMB73_938040              383   1e-125   
gb|ABR17377.1|  unknown                                                 383   1e-125   Picea sitchensis
ref|XP_006431495.1|  hypothetical protein CICLE_v10001347mg             384   1e-125   
ref|XP_002527278.1|  conserved hypothetical protein                     385   1e-125   Ricinus communis
ref|XP_010926741.1|  PREDICTED: uncharacterized protein LOC105048...    384   1e-125   
ref|XP_009384294.1|  PREDICTED: uncharacterized protein LOC103971...    383   2e-125   
ref|XP_006431494.1|  hypothetical protein CICLE_v10001347mg             385   3e-125   
ref|XP_009384293.1|  PREDICTED: uncharacterized protein LOC103971...    385   3e-125   
ref|XP_008650834.1|  PREDICTED: hypothetical protein isoform X3         384   3e-125   
ref|XP_009404257.1|  PREDICTED: uncharacterized protein LOC103987...    384   3e-125   
ref|XP_003548344.1|  PREDICTED: uncharacterized protein LOC100797...    384   3e-125   
ref|XP_006598790.1|  PREDICTED: uncharacterized protein LOC100797...    384   4e-125   
ref|XP_010926739.1|  PREDICTED: uncharacterized protein LOC105048...    384   4e-125   
ref|XP_006587812.1|  PREDICTED: uncharacterized protein LOC100814260    384   5e-125   
ref|XP_006285943.1|  hypothetical protein CARUB_v10007463mg             384   5e-125   
ref|XP_009381324.1|  PREDICTED: uncharacterized protein LOC103969504    385   5e-125   
ref|XP_008218668.1|  PREDICTED: uncharacterized protein LOC103318...    384   6e-125   
ref|XP_006414995.1|  hypothetical protein EUTSA_v10025444mg             383   8e-125   
ref|XP_009404256.1|  PREDICTED: uncharacterized protein LOC103987...    384   1e-124   
ref|XP_008357685.1|  PREDICTED: uncharacterized protein LOC103421429    384   1e-124   
ref|XP_006592650.1|  PREDICTED: uncharacterized protein LOC100526...    381   1e-124   
ref|XP_010929765.1|  PREDICTED: uncharacterized protein LOC105051...    382   1e-124   
ref|XP_010929762.1|  PREDICTED: uncharacterized protein LOC105051...    383   2e-124   
ref|XP_006592649.1|  PREDICTED: uncharacterized protein LOC100526...    382   3e-124   
ref|XP_009139661.1|  PREDICTED: uncharacterized protein LOC103863...    382   3e-124   
ref|XP_006606436.1|  PREDICTED: uncharacterized protein LOC100802...    382   4e-124   
ref|XP_010929761.1|  PREDICTED: uncharacterized protein LOC105051...    382   4e-124   
ref|XP_009139659.1|  PREDICTED: uncharacterized protein LOC103863...    382   5e-124   
ref|XP_006589226.1|  PREDICTED: uncharacterized protein LOC100807...    380   5e-124   
ref|XP_010533215.1|  PREDICTED: uncharacterized protein LOC104809032    381   7e-124   
ref|XP_006589225.1|  PREDICTED: uncharacterized protein LOC100807...    381   7e-124   
emb|CDY60485.1|  BnaC04g55870D                                          381   7e-124   
ref|XP_010070146.1|  PREDICTED: uncharacterized protein LOC104456...    381   8e-124   
ref|XP_009342401.1|  PREDICTED: uncharacterized protein LOC103934377    383   9e-124   
ref|XP_008794582.1|  PREDICTED: uncharacterized protein LOC103710...    382   1e-123   
ref|XP_008218437.1|  PREDICTED: uncharacterized protein LOC103318783    380   1e-123   
ref|XP_007205391.1|  hypothetical protein PRUPE_ppa007419mg             379   1e-123   
ref|XP_008794581.1|  PREDICTED: uncharacterized protein LOC103710...    381   1e-123   
ref|XP_008794583.1|  PREDICTED: uncharacterized protein LOC103710...    381   1e-123   
ref|XP_007143978.1|  hypothetical protein PHAVU_007G118700g             380   2e-123   
ref|XP_011028387.1|  PREDICTED: uncharacterized protein LOC105128...    378   2e-123   
ref|XP_004292326.1|  PREDICTED: uncharacterized protein LOC101291991    381   3e-123   
ref|XP_009355358.1|  PREDICTED: uncharacterized protein LOC103946...    380   3e-123   
ref|XP_007041143.1|  Uncharacterized protein isoform 2                  380   3e-123   
ref|XP_004966565.1|  PREDICTED: uncharacterized protein LOC101765...    377   4e-123   
ref|XP_006598789.1|  PREDICTED: uncharacterized protein LOC100797...    379   4e-123   
ref|XP_002528866.1|  conserved hypothetical protein                     378   5e-123   Ricinus communis
ref|XP_006598788.1|  PREDICTED: uncharacterized protein LOC100797...    379   5e-123   
ref|XP_008382542.1|  PREDICTED: uncharacterized protein LOC103445...    379   7e-123   
ref|XP_008382541.1|  PREDICTED: uncharacterized protein LOC103445...    379   7e-123   
ref|XP_011028386.1|  PREDICTED: uncharacterized protein LOC105128...    378   8e-123   
ref|XP_006353831.1|  PREDICTED: uncharacterized protein LOC102586...    378   8e-123   
ref|XP_002981263.1|  hypothetical protein SELMODRAFT_420787             375   9e-123   
ref|XP_010450248.1|  PREDICTED: uncharacterized protein LOC104732...    378   9e-123   
ref|XP_010450249.1|  PREDICTED: uncharacterized protein LOC104732...    377   1e-122   
ref|XP_006353830.1|  PREDICTED: uncharacterized protein LOC102586...    378   1e-122   
ref|XP_010927700.1|  PREDICTED: uncharacterized protein LOC105049...    381   1e-122   
ref|XP_010440627.1|  PREDICTED: uncharacterized protein LOC104723886    377   1e-122   
ref|NP_001154227.2|  uncharacterized protein                            378   1e-122   Arabidopsis thaliana [mouse-ear cress]
gb|KCW44964.1|  hypothetical protein EUGRSUZ_L01443                     372   1e-122   
ref|XP_009791978.1|  PREDICTED: uncharacterized protein LOC104239...    379   2e-122   
ref|XP_010450250.1|  PREDICTED: uncharacterized protein LOC104732...    377   2e-122   
gb|KEH42947.1|  lysine ketoglutarate reductase trans-splicing-lik...    377   2e-122   
ref|NP_193020.6|  uncharacterized protein                               377   2e-122   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009791977.1|  PREDICTED: uncharacterized protein LOC104239...    379   2e-122   
gb|KCW58742.1|  hypothetical protein EUGRSUZ_H01384                     380   3e-122   
ref|XP_006349291.1|  PREDICTED: uncharacterized protein LOC102579...    378   3e-122   
ref|XP_010926740.1|  PREDICTED: uncharacterized protein LOC105048...    376   3e-122   
ref|XP_009775315.1|  PREDICTED: uncharacterized protein LOC104225252    377   4e-122   
ref|XP_006349292.1|  PREDICTED: uncharacterized protein LOC102579...    377   4e-122   
ref|XP_007148587.1|  hypothetical protein PHAVU_006G221000g             376   5e-122   
ref|XP_011047857.1|  PREDICTED: uncharacterized protein LOC105142...    376   5e-122   
ref|XP_010929763.1|  PREDICTED: uncharacterized protein LOC105051...    375   5e-122   
ref|XP_009626423.1|  PREDICTED: uncharacterized protein LOC104117127    376   5e-122   
ref|XP_011047856.1|  PREDICTED: uncharacterized protein LOC105142...    376   5e-122   
ref|XP_009601482.1|  PREDICTED: uncharacterized protein LOC104096...    377   7e-122   
gb|AES63134.2|  lysine ketoglutarate reductase trans-splicing-lik...    376   7e-122   
ref|XP_006574640.1|  PREDICTED: uncharacterized protein LOC100807...    373   7e-122   
ref|XP_004301559.1|  PREDICTED: uncharacterized protein LOC101306243    376   8e-122   
ref|XP_009601481.1|  PREDICTED: uncharacterized protein LOC104096...    377   8e-122   
gb|KDO42572.1|  hypothetical protein CISIN_1g014004mg                   373   8e-122   
ref|XP_008668563.1|  PREDICTED: uncharacterized protein LOC100502...    375   9e-122   
ref|XP_011047855.1|  PREDICTED: uncharacterized protein LOC105142...    375   9e-122   
ref|XP_004495539.1|  PREDICTED: uncharacterized protein LOC101501...    375   9e-122   
gb|KDO42571.1|  hypothetical protein CISIN_1g014004mg                   372   1e-121   
ref|XP_004495538.1|  PREDICTED: uncharacterized protein LOC101501...    375   1e-121   
ref|XP_010314350.1|  PREDICTED: uncharacterized protein LOC101259...    375   1e-121   
ref|XP_009385148.1|  PREDICTED: uncharacterized protein LOC103972515    375   1e-121   
emb|CDY68706.1|  BnaAnng28070D                                          373   1e-121   
ref|XP_010039032.1|  PREDICTED: uncharacterized protein LOC104427672    379   2e-121   
ref|XP_011047859.1|  PREDICTED: uncharacterized protein LOC105142...    373   2e-121   
ref|XP_006385071.1|  hypothetical protein POPTR_0004s23630g             374   2e-121   
ref|XP_010030221.1|  PREDICTED: uncharacterized protein LOC104420...    372   2e-121   
ref|XP_004230425.1|  PREDICTED: uncharacterized protein LOC101259...    375   3e-121   
gb|EMS58914.1|  hypothetical protein TRIUR3_00657                       373   3e-121   
ref|XP_010326243.1|  PREDICTED: uncharacterized protein LOC101263...    375   3e-121   
gb|EYU46099.1|  hypothetical protein MIMGU_mgv1a007624mg                374   4e-121   
ref|XP_004246997.2|  PREDICTED: uncharacterized protein LOC101263...    374   4e-121   
ref|XP_008443712.1|  PREDICTED: uncharacterized protein LOC103487...    374   5e-121   
ref|XP_010314348.1|  PREDICTED: uncharacterized protein LOC101259...    375   5e-121   
ref|XP_006598791.1|  PREDICTED: uncharacterized protein LOC100797...    370   7e-121   
ref|XP_011077191.1|  PREDICTED: uncharacterized protein LOC105161254    374   7e-121   
ref|XP_007029398.1|  Uncharacterized protein isoform 1                  373   7e-121   
ref|XP_009136939.1|  PREDICTED: uncharacterized protein LOC103861001    374   7e-121   
ref|XP_011009619.1|  PREDICTED: uncharacterized protein LOC105114...    372   8e-121   
ref|XP_011009618.1|  PREDICTED: uncharacterized protein LOC105114...    372   9e-121   
ref|XP_007041142.1|  Uncharacterized protein isoform 1                  373   1e-120   
ref|XP_006431493.1|  hypothetical protein CICLE_v10001347mg             369   2e-120   
gb|KGN49567.1|  hypothetical protein Csa_5G003110                       371   4e-120   
ref|XP_002456843.1|  hypothetical protein SORBIDRAFT_03g043920          372   5e-120   
ref|XP_008788901.1|  PREDICTED: uncharacterized protein LOC103706547    372   5e-120   
emb|CDY01549.1|  BnaC07g35390D                                          371   5e-120   
gb|EYU33290.1|  hypothetical protein MIMGU_mgv1a022895mg                369   6e-120   
ref|XP_010099777.1|  hypothetical protein L484_010964                   369   7e-120   
ref|XP_010649248.1|  PREDICTED: uncharacterized protein LOC100244...    371   8e-120   
ref|XP_010434520.1|  PREDICTED: uncharacterized protein LOC104718463    370   8e-120   
ref|XP_008235931.1|  PREDICTED: uncharacterized protein LOC103334736    371   9e-120   
ref|XP_004142563.1|  PREDICTED: uncharacterized protein LOC101221459    370   1e-119   
emb|CDX76518.1|  BnaA08g08820D                                          369   2e-119   
ref|XP_002512624.1|  conserved hypothetical protein                     369   2e-119   
ref|XP_010439840.1|  PREDICTED: uncharacterized protein LOC104723209    369   3e-119   
gb|KHN29282.1|  hypothetical protein glysoja_005006                     365   3e-119   
ref|XP_007143979.1|  hypothetical protein PHAVU_007G118700g             366   4e-119   
emb|CDP03985.1|  unnamed protein product                                368   4e-119   
ref|XP_009139662.1|  PREDICTED: uncharacterized protein LOC103863...    369   4e-119   
ref|XP_002863207.1|  hypothetical protein ARALYDRAFT_359088             369   5e-119   
ref|XP_006606437.1|  PREDICTED: uncharacterized protein LOC100802...    365   5e-119   
ref|XP_002325467.2|  hypothetical protein POPTR_0019s08010g             368   5e-119   
ref|XP_011013915.1|  PREDICTED: uncharacterized protein LOC105117...    368   7e-119   
ref|XP_010496238.1|  PREDICTED: uncharacterized protein LOC104773...    367   9e-119   
ref|XP_009108367.1|  PREDICTED: uncharacterized protein LOC103834066    367   1e-118   
ref|XP_006646614.1|  PREDICTED: uncharacterized protein LOC102709336    370   1e-118   
ref|XP_010496239.1|  PREDICTED: uncharacterized protein LOC104773...    367   2e-118   
ref|XP_007200003.1|  hypothetical protein PRUPE_ppa024775mg             364   2e-118   
gb|EYU39432.1|  hypothetical protein MIMGU_mgv1a009958mg                364   2e-118   
ref|XP_006414091.1|  hypothetical protein EUTSA_v10025410mg             366   3e-118   
ref|XP_011092273.1|  PREDICTED: uncharacterized protein LOC105172...    367   4e-118   
ref|XP_011092272.1|  PREDICTED: uncharacterized protein LOC105172...    367   5e-118   
ref|XP_003592883.1|  hypothetical protein MTR_2g005330                  366   5e-118   
ref|XP_006389481.1|  hypothetical protein POPTR_0022s00250g             363   6e-118   
gb|KHN11049.1|  hypothetical protein glysoja_044073                     361   8e-118   
ref|XP_006283920.1|  hypothetical protein CARUB_v10005038mg             365   1e-117   
ref|NP_193588.5|  uncharacterized protein                               365   1e-117   
ref|XP_010070147.1|  PREDICTED: uncharacterized protein LOC104456...    362   1e-117   
ref|XP_010245969.1|  PREDICTED: uncharacterized protein LOC104589...    365   2e-117   
emb|CDX99459.1|  BnaC01g10930D                                          364   2e-117   
ref|XP_009338004.1|  PREDICTED: uncharacterized protein LOC103930...    365   2e-117   
ref|XP_001755444.1|  predicted protein                                  363   3e-117   
ref|XP_009338003.1|  PREDICTED: uncharacterized protein LOC103930...    364   5e-117   
ref|XP_009131922.1|  PREDICTED: uncharacterized protein LOC103856...    361   6e-117   
ref|XP_004304811.1|  PREDICTED: uncharacterized protein LOC101306449    364   6e-117   
ref|XP_009131914.1|  PREDICTED: uncharacterized protein LOC103856...    363   8e-117   
ref|XP_004164722.1|  PREDICTED: uncharacterized LOC101205845            363   9e-117   
emb|CDX78869.1|  BnaA01g09360D                                          366   1e-116   
ref|XP_009589414.1|  PREDICTED: uncharacterized protein LOC104086...    362   1e-116   
ref|XP_004149136.1|  PREDICTED: uncharacterized protein LOC101205845    363   1e-116   
emb|CDM85670.1|  unnamed protein product                                365   1e-116   
gb|EMT10964.1|  hypothetical protein F775_16647                         367   2e-116   
ref|XP_009131909.1|  PREDICTED: uncharacterized protein LOC103856...    362   2e-116   
ref|XP_008370820.1|  PREDICTED: uncharacterized protein LOC103434...    362   3e-116   
ref|XP_009803513.1|  PREDICTED: uncharacterized protein LOC104248864    361   4e-116   
ref|XP_010678991.1|  PREDICTED: uncharacterized protein LOC104894459    361   4e-116   
ref|XP_009589410.1|  PREDICTED: uncharacterized protein LOC104086...    362   4e-116   
ref|XP_009589411.1|  PREDICTED: uncharacterized protein LOC104086...    362   4e-116   
ref|XP_009589413.1|  PREDICTED: uncharacterized protein LOC104086...    362   5e-116   
ref|XP_006375602.1|  hypothetical protein POPTR_0014s17420g             357   6e-116   
ref|NP_001045212.1|  Os01g0919600                                       362   7e-116   
ref|XP_009589412.1|  PREDICTED: uncharacterized protein LOC104086...    361   7e-116   
ref|XP_010673921.1|  PREDICTED: uncharacterized protein LOC104890221    360   8e-116   
ref|XP_003608157.1|  Lysine ketoglutarate reductase trans-splicin...    357   8e-116   
gb|EEC72047.1|  hypothetical protein OsI_04953                          361   8e-116   
ref|XP_008370819.1|  PREDICTED: uncharacterized protein LOC103434...    361   8e-116   
ref|XP_009800332.1|  PREDICTED: uncharacterized protein LOC104246...    361   9e-116   
ref|XP_009800331.1|  PREDICTED: uncharacterized protein LOC104246...    361   1e-115   
emb|CDP04217.1|  unnamed protein product                                360   1e-115   
ref|XP_008464732.1|  PREDICTED: uncharacterized protein LOC103502548    361   2e-115   
ref|XP_004485423.1|  PREDICTED: uncharacterized protein LOC101494...    359   2e-115   
ref|XP_004304813.1|  PREDICTED: uncharacterized protein LOC101307034    359   2e-115   
ref|XP_004485425.1|  PREDICTED: uncharacterized protein LOC101494...    358   2e-115   
ref|XP_002271156.1|  PREDICTED: uncharacterized protein LOC100266956    360   3e-115   
ref|XP_004304814.1|  PREDICTED: uncharacterized protein LOC101307323    358   5e-115   
gb|EAZ14639.1|  hypothetical protein OsJ_04563                          359   6e-115   
ref|XP_009800327.1|  PREDICTED: uncharacterized protein LOC104246...    361   7e-115   
ref|XP_009800329.1|  PREDICTED: uncharacterized protein LOC104246...    360   8e-115   
ref|XP_009800328.1|  PREDICTED: uncharacterized protein LOC104246...    360   1e-114   
ref|XP_006848445.1|  hypothetical protein AMTR_s00013p00243430          362   1e-114   
ref|XP_008802245.1|  PREDICTED: uncharacterized protein LOC103716...    356   1e-114   
ref|XP_009139660.1|  PREDICTED: uncharacterized protein LOC103863...    357   1e-114   
ref|XP_006428575.1|  hypothetical protein CICLE_v10011929mg             357   1e-114   
ref|XP_009611370.1|  PREDICTED: uncharacterized protein LOC104104888    357   2e-114   
gb|ACG28658.1|  hypothetical protein                                    356   3e-114   
ref|XP_008656938.1|  PREDICTED: uncharacterized protein LOC103636...    354   3e-114   
ref|XP_004485424.1|  PREDICTED: uncharacterized protein LOC101494...    355   5e-114   
ref|XP_006469340.1|  PREDICTED: uncharacterized protein LOC102608...    354   6e-114   
ref|NP_001130892.1|  hypothetical protein                               353   7e-114   
ref|XP_008656937.1|  PREDICTED: uncharacterized protein LOC103636...    355   7e-114   
gb|KCW57155.1|  hypothetical protein EUGRSUZ_I02788                     355   1e-113   
ref|XP_010649249.1|  PREDICTED: uncharacterized protein LOC100244...    352   1e-113   
gb|KDO75812.1|  hypothetical protein CISIN_1g015555mg                   350   1e-113   
ref|XP_004971069.1|  PREDICTED: uncharacterized protein LOC101761...    355   1e-113   
ref|XP_006469339.1|  PREDICTED: uncharacterized protein LOC102608...    353   1e-113   
ref|XP_008672058.1|  PREDICTED: hypothetical protein isoform X2         354   1e-113   
ref|XP_004971068.1|  PREDICTED: uncharacterized protein LOC101761...    355   2e-113   
gb|KDP23295.1|  hypothetical protein JCGZ_23128                         354   3e-113   
ref|XP_008672057.1|  PREDICTED: hypothetical protein isoform X1         354   3e-113   
gb|KHG02335.1|  Protein kinase US3                                      352   5e-113   
ref|XP_011087633.1|  PREDICTED: uncharacterized protein LOC105169064    354   6e-113   
ref|XP_006480410.1|  PREDICTED: uncharacterized protein LOC102618...    352   1e-112   
ref|XP_006353285.1|  PREDICTED: uncharacterized protein LOC102586299    352   1e-112   
gb|EMT30823.1|  hypothetical protein F775_04800                         353   2e-112   
gb|KDP42486.1|  hypothetical protein JCGZ_00283                         347   7e-112   
ref|XP_002972149.1|  hypothetical protein SELMODRAFT_96555              346   9e-112   
emb|CBI23338.3|  unnamed protein product                                349   1e-111   
gb|KDO42574.1|  hypothetical protein CISIN_1g014004mg                   348   1e-111   
gb|KDO42573.1|  hypothetical protein CISIN_1g014004mg                   350   2e-111   
ref|XP_011009620.1|  PREDICTED: uncharacterized protein LOC105114...    347   3e-111   
gb|KDO43503.1|  hypothetical protein CISIN_1g040488mg                   346   3e-111   
ref|XP_010435350.1|  PREDICTED: uncharacterized protein LOC104719...    347   5e-111   
ref|XP_002977469.1|  hypothetical protein SELMODRAFT_14072              343   5e-111   
gb|EYU35025.1|  hypothetical protein MIMGU_mgv1a021997mg                345   7e-111   
ref|XP_003564937.1|  PREDICTED: uncharacterized protein LOC100845...    348   7e-111   
ref|XP_010232750.1|  PREDICTED: uncharacterized protein LOC100845...    348   1e-110   
ref|XP_010527351.1|  PREDICTED: uncharacterized protein LOC104804...    346   1e-110   
gb|KHN40464.1|  hypothetical protein glysoja_000962                     343   2e-110   
ref|XP_010312628.1|  PREDICTED: uncharacterized protein LOC101258517    345   3e-110   
ref|XP_010435349.1|  PREDICTED: uncharacterized protein LOC104719...    345   4e-110   
ref|XP_010435347.1|  PREDICTED: uncharacterized protein LOC104719...    345   5e-110   
ref|XP_010435348.1|  PREDICTED: uncharacterized protein LOC104719...    345   6e-110   
ref|XP_008794584.1|  PREDICTED: uncharacterized protein LOC103710...    345   7e-110   
gb|EMT15209.1|  hypothetical protein F775_10952                         344   8e-110   
gb|KDO47606.1|  hypothetical protein CISIN_1g021847mg                   342   9e-110   
ref|XP_001763826.1|  predicted protein                                  340   1e-109   
gb|ABE91850.1|  Protein of unknown function DUF707                      342   3e-109   
gb|ACL54625.1|  unknown                                                 339   6e-109   
ref|XP_011080806.1|  PREDICTED: uncharacterized protein LOC105163967    340   1e-108   
ref|XP_001765350.1|  predicted protein                                  338   2e-108   
gb|KCW58743.1|  hypothetical protein EUGRSUZ_H01384                     344   2e-108   
gb|KEH42946.1|  lysine ketoglutarate reductase trans-splicing-lik...    340   3e-108   
gb|KCW58744.1|  hypothetical protein EUGRSUZ_H01384                     342   6e-108   
gb|KEH42948.1|  lysine ketoglutarate reductase trans-splicing-lik...    340   8e-108   
ref|XP_003567406.1|  PREDICTED: uncharacterized protein LOC100846500    340   8e-108   
ref|XP_004959218.1|  PREDICTED: uncharacterized protein LOC101754548    339   1e-107   
gb|KHN14778.1|  hypothetical protein glysoja_020951                     334   2e-106   
ref|XP_010095592.1|  hypothetical protein L484_007431                   335   2e-106   
ref|XP_006447951.1|  hypothetical protein CICLE_v10017835mg             333   2e-106   
gb|KEH36409.1|  lysine ketoglutarate reductase trans-splicing-lik...    328   1e-105   
ref|XP_007041145.1|  Uncharacterized protein isoform 4                  333   2e-105   
gb|KHN04979.1|  hypothetical protein glysoja_013886                     333   2e-105   
gb|KHN39687.1|  hypothetical protein glysoja_020765                     330   2e-105   
ref|XP_003592882.1|  hypothetical protein MTR_2g005330                  332   2e-105   
gb|AAD49998.1|AC007259_11  Hypothetical protein                         327   7e-105   
tpg|DAA60453.1|  TPA: hypothetical protein ZEAMMB73_554322              332   7e-105   
ref|XP_007029399.1|  Uncharacterized protein isoform 2                  331   8e-105   
ref|XP_007041144.1|  Uncharacterized protein isoform 3                  333   9e-105   
gb|KDP45213.1|  hypothetical protein JCGZ_15078                         330   1e-104   
ref|XP_010245967.1|  PREDICTED: uncharacterized protein LOC104589...    332   1e-104   
ref|XP_010927701.1|  PREDICTED: uncharacterized protein LOC105049...    333   3e-104   
gb|KHF99765.1|  Protein Wnt-3a                                          327   6e-104   
gb|EPS71893.1|  hypothetical protein M569_02866                         323   9e-104   
ref|XP_006658519.1|  PREDICTED: uncharacterized protein LOC102704541    328   2e-103   
ref|XP_004959216.1|  PREDICTED: uncharacterized protein LOC101753344    328   3e-103   
ref|XP_008371677.1|  PREDICTED: uncharacterized protein LOC103435056    323   5e-103   
gb|EPS68506.1|  hypothetical protein M569_06262                         323   1e-102   
ref|XP_011013916.1|  PREDICTED: uncharacterized protein LOC105117...    323   3e-102   
ref|XP_008443713.1|  PREDICTED: uncharacterized protein LOC103487...    324   4e-102   
ref|XP_008652315.1|  PREDICTED: uncharacterized protein LOC103632283    320   1e-101   
gb|EAZ03604.1|  hypothetical protein OsI_25741                          320   2e-100   
gb|KDO75813.1|  hypothetical protein CISIN_1g015555mg                   313   2e-99    
ref|XP_010111065.1|  hypothetical protein L484_015120                   318   2e-99    
ref|XP_008794585.1|  PREDICTED: uncharacterized protein LOC103710...    317   4e-99    
ref|NP_001059457.1|  Os07g0414700                                       316   7e-99    
ref|XP_002461919.1|  hypothetical protein SORBIDRAFT_02g010630          315   4e-98    
ref|XP_003560257.1|  PREDICTED: uncharacterized protein LOC100824859    311   7e-97    
gb|KDO42575.1|  hypothetical protein CISIN_1g014004mg                   307   3e-96    
emb|CDO97641.1|  unnamed protein product                                303   5e-95    
gb|KEH42945.1|  lysine ketoglutarate reductase trans-splicing-lik...    304   7e-95    
gb|ACN36331.1|  unknown                                                 294   6e-93    
ref|XP_010929764.1|  PREDICTED: uncharacterized protein LOC105051...    295   7e-91    
dbj|BAC20862.1|  hypothetical protein                                   291   2e-89    
ref|XP_001767366.1|  predicted protein                                  291   6e-87    
gb|EEE67024.1|  hypothetical protein OsJ_23956                          283   3e-86    
tpg|DAA41120.1|  TPA: hypothetical protein ZEAMMB73_447766              269   5e-83    
ref|XP_002870039.1|  hypothetical protein ARALYDRAFT_493006             263   2e-79    
emb|CAN78854.1|  hypothetical protein VITISV_018472                     267   2e-78    
ref|XP_008370821.1|  PREDICTED: uncharacterized protein LOC103434...    260   5e-78    
gb|EMT15642.1|  hypothetical protein F775_21925                         261   7e-78    
ref|XP_006604010.1|  PREDICTED: uncharacterized protein LOC100776...    258   2e-77    
ref|XP_001764755.1|  predicted protein                                  257   4e-77    
ref|XP_003560287.1|  PREDICTED: uncharacterized protein LOC100837632    257   4e-77    
ref|XP_006604009.1|  PREDICTED: uncharacterized protein LOC100776...    258   5e-77    
ref|XP_009338005.1|  PREDICTED: uncharacterized protein LOC103930...    258   5e-77    



>ref|XP_006347092.1| PREDICTED: uncharacterized protein LOC102580388 [Solanum tuberosum]
Length=405

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/378 (75%), Positives = 322/378 (85%), Gaps = 2/378 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             GTC +KM+ + F+ + C+ MLFI+YRTT YQYQQ EMES+ DP YS++DS +  RS  SL
Sbjct  16    GTCGLKMRQLPFMWIICIVMLFIVYRTTNYQYQQTEMESRLDPFYSSKDSSMDMRSLHSL  75

Query  1205  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             PRGII++RSDLELKPL     S SK+K + +  HNLLA+PVGIKQK NV+ ++QKFLS N
Sbjct  76    PRGIIQARSDLELKPLWSTTSSKSKAKASNSSSHNLLAVPVGIKQKSNVDALVQKFLSAN  135

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
              ESEGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   AESEGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  491   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             DSEY+VH  IQ+LGG SLKR S+P+E  K   VD+R EIRRQSTYELQIFK+RWE AVK 
Sbjct  316   DSEYVVHQSIQTLGGQSLKRDSNPEESVKRHVVDVRSEIRRQSTYELQIFKDRWERAVKL  375

Query  311   DKNWVDPYKASQRYRKTW  258
             DKNW DP+KASQR R+ +
Sbjct  376   DKNWADPFKASQRRRQLY  393



>ref|XP_004232824.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum]
 ref|XP_010316708.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum]
 ref|XP_010316709.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum]
Length=405

 Score =   595 bits (1534),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/378 (75%), Positives = 323/378 (85%), Gaps = 2/378 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             GTC VKM+ + F+ + C+ MLFI+YRTT YQYQQ EMES+ DP YS++DS +  RS  SL
Sbjct  16    GTCGVKMRQLPFMWIICIVMLFIVYRTTNYQYQQTEMESRLDPFYSSKDSSMDMRSLHSL  75

Query  1205  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             PRGII++RSDLELKPL     S SK+K + +  HNLLA+PVGIKQK NV+ ++QKFLS N
Sbjct  76    PRGIIQARSDLELKPLWSTTSSKSKAKASNSSSHNLLAVPVGIKQKSNVDALVQKFLSAN  135

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             +ESEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   DESEGPPCTGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  491   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             DSEY+VH  IQ+LGG SLK+ S+ +E  K   VD+R EIRRQSTYELQIFK+RWE AVK+
Sbjct  316   DSEYVVHQSIQTLGGQSLKKDSNSEESVKRHVVDVRSEIRRQSTYELQIFKDRWERAVKQ  375

Query  311   DKNWVDPYKASQRYRKTW  258
             DKNW DP+KASQR R+ +
Sbjct  376   DKNWADPFKASQRRRQLY  393



>ref|XP_009763335.1| PREDICTED: uncharacterized protein LOC104215273 [Nicotiana sylvestris]
 ref|XP_009763336.1| PREDICTED: uncharacterized protein LOC104215273 [Nicotiana sylvestris]
Length=404

 Score =   590 bits (1520),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/378 (75%), Positives = 321/378 (85%), Gaps = 3/378 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C VKM+ + F+G+ C+ MLFI+YRTT YQYQQ E+ES+ DP YS++D  +  RS +SL
Sbjct  16    GACGVKMRQLPFMGIICIVMLFIVYRTTNYQYQQTEIESRLDPFYSSQDPSLDMRSLNSL  75

Query  1205  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             PRGII++RSDLELKPL   + S SK+K + +  HNLLA+PVGI QK NV+ ++QKFLSEN
Sbjct  76    PRGIIQARSDLELKPLWSTSSSKSKAKASNSSCHNLLAVPVGINQKSNVDALVQKFLSEN  135

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             +ESEGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   DESEGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  491   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             DSEY+VH  IQ+LGG SLK+ S+P+E  K   VD+R EIRRQSTYELQIFK+RW  AVKE
Sbjct  316   DSEYVVHQSIQTLGGQSLKKDSNPEESVKRHVVDVRSEIRRQSTYELQIFKDRWARAVKE  375

Query  311   DKNWVDPYKASQRYRKTW  258
             DK W DP+K  QR RK W
Sbjct  376   DKKWSDPFKTRQR-RKQW  392



>ref|XP_009603719.1| PREDICTED: uncharacterized protein LOC104098641 [Nicotiana tomentosiformis]
 ref|XP_009603720.1| PREDICTED: uncharacterized protein LOC104098641 [Nicotiana tomentosiformis]
Length=404

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/376 (74%), Positives = 320/376 (85%), Gaps = 2/376 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C VKM+ + F+ + C+ MLFI+YRTT YQYQQ E+ES+ DP YS++D  +  RS +SL
Sbjct  16    GACGVKMRQLPFMWIICIVMLFIVYRTTNYQYQQTEIESRLDPFYSSQDPSLDMRSLNSL  75

Query  1205  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             PRGII++RSDLELKPL   + S SK+K + +  HNLLA+PVGI QK NV+ ++QKFLSEN
Sbjct  76    PRGIIQARSDLELKPLWSTSSSKSKAKASNSSCHNLLAVPVGINQKSNVDALVQKFLSEN  135

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             +ESEGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   DESEGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  491   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             DSEY+VH  IQ+LGG SLK+ S+P+E  K   VD+R EIRRQSTYELQIFK+RW  AVKE
Sbjct  316   DSEYVVHQSIQTLGGQSLKKDSNPEESVKRHVVDVRSEIRRQSTYELQIFKDRWARAVKE  375

Query  311   DKNWVDPYKASQRYRK  264
             DKNW DP+K  QR R+
Sbjct  376   DKNWSDPFKTRQRRRQ  391



>ref|XP_011096284.1| PREDICTED: uncharacterized protein LOC105175522 [Sesamum indicum]
 ref|XP_011096285.1| PREDICTED: uncharacterized protein LOC105175522 [Sesamum indicum]
Length=374

 Score =   582 bits (1501),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/370 (73%), Positives = 312/370 (84%), Gaps = 1/370 (0%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             M+ + F+G+ C  MLFI+YRTT YQYQQ EMESK  P Y+ ++S +  +S  SLPRGIIE
Sbjct  1     MRQLPFMGVVCTIMLFIIYRTTKYQYQQTEMESKLYPFYTLQESGMESKSLESLPRGIIE  60

Query  1187  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
             +RSDLELKPL   S SKS V+V   +NLLAMPVGI+QK NV+ I+QKFLSENFTI+LFHY
Sbjct  61    ARSDLELKPLWTTSSSKSMVSVRSSNNLLAMPVGIEQKQNVDTIVQKFLSENFTIVLFHY  120

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DGN+DGWW+L WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDLGVENFHP 
Sbjct  121   DGNLDGWWELEWSKKAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVENFHPG  180

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  648
             RYL+IV+SEGLEISQPALDP S GIHHRIT+R+R N FHRRVY  +GS KCS++SEGPPC
Sbjct  181   RYLDIVRSEGLEISQPALDPNSTGIHHRITIRNRMNIFHRRVYDVRGSIKCSDDSEGPPC  240

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
             +GFVEGMAPVFSRSAWRC WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSEY+VH 
Sbjct  241   TGFVEGMAPVFSRSAWRCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSEYIVHQ  300

Query  467   GIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
              IQ+LGG+S ++ + P+E  K  AVD+R EIRRQS  ELQ FK+RWE AVKEDKNWVDP+
Sbjct  301   SIQTLGGASARKVAKPEETTKRHAVDVRSEIRRQSAIELQKFKDRWERAVKEDKNWVDPF  360

Query  287   KASQRYRKTW  258
              AS  +R  W
Sbjct  361   -ASTHFRYFW  369



>ref|XP_010092612.1| hypothetical protein L484_006374 [Morus notabilis]
 gb|EXB51801.1| hypothetical protein L484_006374 [Morus notabilis]
Length=378

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/364 (72%), Positives = 307/364 (84%), Gaps = 6/364 (2%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             MK + F+G+ C  MLFI+YRTT YQ++Q EME+K  P     +  +  R  + LPRGII 
Sbjct  1     MKQLPFMGIVCTVMLFIVYRTTNYQHRQTEMETKIHPF--GTEFLLASRELNGLPRGIIH  58

Query  1187  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
             ++SDLEL+PL + S S+SKVNV  + NLLA+PVGI+QKDNV+ I+QKFL ENFTIILFHY
Sbjct  59    TKSDLELRPLWSTSSSRSKVNVYSHRNLLAIPVGIEQKDNVDAIVQKFLPENFTIILFHY  118

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGV+NF+P 
Sbjct  119   DGNVDGWWDLDWSNEAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVKNFNPG  178

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  648
             RYL+IVK+EGLEISQPALDP S  IHHRIT+R+RT +FHRRVY  +GSTKCS+ SEGPPC
Sbjct  179   RYLKIVKTEGLEISQPALDPNSTDIHHRITIRARTKRFHRRVYDLRGSTKCSDASEGPPC  238

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
             +GFVEGMAPVFSR+AWRC WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+VH 
Sbjct  239   TGFVEGMAPVFSRAAWRCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIVHK  298

Query  467   GIQSLGG--SSLKRASSPQELPK--GRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             GIQSLGG  SS ++AS+ +EL K  G A D+R EIRRQST+ELQ+FKERW  AV+EDKNW
Sbjct  299   GIQSLGGASSSARKASNSEELTKRHGAAADVRTEIRRQSTWELQVFKERWNRAVEEDKNW  358

Query  299   VDPY  288
             VDP+
Sbjct  359   VDPF  362



>ref|XP_009631143.1| PREDICTED: uncharacterized protein LOC104120968 [Nicotiana tomentosiformis]
Length=411

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/368 (73%), Positives = 312/368 (85%), Gaps = 0/368 (0%)
 Frame = -3

Query  1382  TCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLP  1203
             T  +K+K + F+G+ C  MLFI+YRTT YQYQQ EMESK DP YS++DS V     +SLP
Sbjct  22    TWGIKVKQLPFMGIMCTVMLFIVYRTTNYQYQQTEMESKLDPFYSSKDSDVDITRLNSLP  81

Query  1202  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1023
             RGII+  SDLEL PL + S S+SK +++   NLLA+ VG+KQK NV+ ++QKFLSENFTI
Sbjct  82    RGIIQPSSDLELMPLWSTSGSRSKASISSSRNLLAIAVGVKQKSNVDALVQKFLSENFTI  141

Query  1022  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  843
             +LFHYDG+VDGWWDL WSKEAIHIVA++QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV+
Sbjct  142   VLFHYDGHVDGWWDLQWSKEAIHIVANNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVK  201

Query  842   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  663
             NFHP RYL+IVKSEGLEISQPALD  S  IHHRIT+RS+  +FHRRVY  +GSTKCS+ES
Sbjct  202   NFHPGRYLKIVKSEGLEISQPALDRNSTDIHHRITIRSKKKRFHRRVYDSRGSTKCSDES  261

Query  662   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  483
             EGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSE
Sbjct  262   EGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSE  321

Query  482   YLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             Y+VH GIQ+LGG SLK+ S+ +E  K   VD+R EIRRQST+ELQIFK+RWE AV+ED+N
Sbjct  322   YIVHQGIQTLGGPSLKKRSNLEESVKRHDVDVRSEIRRQSTHELQIFKDRWERAVEEDQN  381

Query  302   WVDPYKAS  279
             WVDP++AS
Sbjct  382   WVDPFEAS  389



>gb|EYU27955.1| hypothetical protein MIMGU_mgv1a007977mg [Erythranthe guttata]
 gb|EYU27956.1| hypothetical protein MIMGU_mgv1a007977mg [Erythranthe guttata]
Length=389

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/361 (72%), Positives = 301/361 (83%), Gaps = 0/361 (0%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             KMK + F+   C+ ML I+Y +T YQYQQ EM+S   P Y+ ++S V  +S  SLPRGII
Sbjct  26    KMKQLPFMVAVCIIMLLIIYTSTKYQYQQTEMDSTFYPFYTFKESGVDSKSLDSLPRGII  85

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             E+RSDLELKPL   S S+SKV+     NLLAMPVG+KQK NV+ I+QKFLSENFTIILFH
Sbjct  86    EARSDLELKPLWTTSSSRSKVSDRSSSNLLAMPVGVKQKQNVDTIVQKFLSENFTIILFH  145

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDGN+DGWWDL WSK+A+HI AH+QTKWWFAKRFLHP +VS+YDYIFLWDEDLGVENFHP
Sbjct  146   YDGNLDGWWDLEWSKKAVHIAAHNQTKWWFAKRFLHPAIVSMYDYIFLWDEDLGVENFHP  205

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  651
              RYL+IV+SEG EISQPALDP S GIHHRITVR+R N FHRRVY+ +GS KCS++SEGPP
Sbjct  206   GRYLDIVRSEGFEISQPALDPNSTGIHHRITVRNRMNIFHRRVYEVRGSIKCSDDSEGPP  265

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             CSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDSEY+VH
Sbjct  266   CSGFVEGMAPVFSRSAWHCAWHLIQNDLVHGWGMDMKLGYCAQGDRTEKVGIVDSEYIVH  325

Query  470   LGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDP  291
               IQ+LGG+S  + S+ +E  K   VD+R EIRRQS+ ELQ FKERWE+AVK+D+NWVDP
Sbjct  326   QSIQTLGGASATKVSNHEETVKRHGVDVRSEIRRQSSIELQKFKERWEQAVKDDENWVDP  385

Query  290   Y  288
             +
Sbjct  386   F  386



>ref|XP_011086083.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
 ref|XP_011086084.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
 ref|XP_011086085.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
 ref|XP_011086086.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
Length=405

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 301/369 (82%), Gaps = 0/369 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C  KMK M F+G  C  MLFI+YRTT YQYQQ E+ESK  P Y  + S V     +SL
Sbjct  21    GICGTKMKQMPFMGFICTVMLFIIYRTTNYQYQQTEVESKLLPFYKPKASVVATSGLNSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGIIE RSDLEL+PL   S SKSK+     + LLAMPVGIKQK NV+ I++KFL ENFT
Sbjct  81    PRGIIEPRSDLELRPLWTTSSSKSKMRSRSSNYLLAMPVGIKQKQNVDTIVRKFLPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGN+DGWWDL WS+EA+HIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNLDGWWDLEWSREAVHIVAHNQTKWWFAKRFLHPSVVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             +NFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+R RT  FHRRVY  +GSTKCS++
Sbjct  201   QNFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRKRTKIFHRRVYDARGSTKCSDD  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWHCAWNLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+VH  IQ+LGG S ++ S+ ++  K   VD+R EIRRQST EL+ FKERWE AVKEDK
Sbjct  321   EYIVHQSIQTLGGQSARKVSNLEQTVKSHTVDVRSEIRRQSTIELKKFKERWERAVKEDK  380

Query  305   NWVDPYKAS  279
              WVDP+ ++
Sbjct  381   KWVDPFPST  389



>ref|XP_009766485.1| PREDICTED: uncharacterized protein LOC104217853 [Nicotiana sylvestris]
Length=411

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/368 (72%), Positives = 311/368 (85%), Gaps = 0/368 (0%)
 Frame = -3

Query  1382  TCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLP  1203
             T  +K+K + F+G+ C  MLFI+YRTT YQYQQ E+ESK DP YS++DS V     +SLP
Sbjct  22    TWGIKVKQLPFMGIMCTVMLFIVYRTTNYQYQQTEIESKLDPFYSSKDSDVDITRLNSLP  81

Query  1202  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1023
             RGI +  SDLEL PL + S S+SK +++   NLLA+ VG+KQK NV+ ++QKFLSENFTI
Sbjct  82    RGISQPSSDLELMPLWSTSGSRSKASISSSRNLLAIAVGVKQKSNVDALVQKFLSENFTI  141

Query  1022  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  843
             +LFHYDG+VDGWWDL WSKEA+HIVA++QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV+
Sbjct  142   VLFHYDGHVDGWWDLQWSKEAVHIVANNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVK  201

Query  842   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  663
             NFHP RYL+IVKSEGLEISQPALD  S  IHHRIT+RS+  +FHRRVY  +GSTKCS+ES
Sbjct  202   NFHPGRYLKIVKSEGLEISQPALDRNSTDIHHRITIRSKKKRFHRRVYDSRGSTKCSDES  261

Query  662   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  483
             EGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSE
Sbjct  262   EGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSE  321

Query  482   YLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             Y+VH GIQ+LGG SLK+ S+ +E  K   VD+R EIRRQST+ELQIFK+RWE AV+EDKN
Sbjct  322   YIVHQGIQTLGGPSLKKRSNLEESVKRHDVDVRSEIRRQSTHELQIFKDRWERAVEEDKN  381

Query  302   WVDPYKAS  279
             WVDP++AS
Sbjct  382   WVDPFEAS  389



>ref|XP_010327022.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_004248459.2| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327023.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327024.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327025.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327026.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
Length=409

 Score =   556 bits (1432),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/369 (73%), Positives = 305/369 (83%), Gaps = 1/369 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
              TC VK+K + F+G+ C  M  I+YRTT YQY+Q EMESKSDP YS++DS V   S +SL
Sbjct  21    ATCGVKVKQIAFMGIICTIMFLIVYRTTNYQYRQTEMESKSDPFYSSKDSDVDITSFNSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII + SDLELKPL + S SKSK +V+   NLLAM VGIKQK NV+ ++QKFLSENFT
Sbjct  81    PRGIIHASSDLELKPLWSTSNSKSKDSVSSSRNLLAMAVGIKQKKNVDTLVQKFLSENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDG+VDGWWDL WSKEA+HIVA++QTKWWFAKRFLHP  VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGHVDGWWDLKWSKEAVHIVANNQTKWWFAKRFLHPAAVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             +NFHP RYL+IVKSEGLEISQPALD  S  IHHR+T+RS+  +FHRRVY  +GSTKCS E
Sbjct  201   KNFHPGRYLKIVKSEGLEISQPALDRNSTEIHHRLTIRSKRKRFHRRVYDSRGSTKCSGE  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPCSGFVEGMAPVFS SAW C WHLIQNDLVHGWGMDMK GYCAQGDR   VG+VDS
Sbjct  261   SEGPPCSGFVEGMAPVFSISAWVCAWHLIQNDLVHGWGMDMKFGYCAQGDRNKKVGVVDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+VH GIQ+LGG SLK+ S+ +E  K   VD+R EIRRQS YELQIFKERWE AV+EDK
Sbjct  321   EYIVHQGIQTLGGPSLKKPSNLEESTKRHVVDVRSEIRRQSMYELQIFKERWERAVEEDK  380

Query  305   NW-VDPYKA  282
             NW VD  KA
Sbjct  381   NWVVDQVKA  389



>emb|CDO99608.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/370 (69%), Positives = 301/370 (81%), Gaps = 0/370 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             GTC  KMK + F+ + C  MLF++YRTT YQY+Q EMES+  P +  +DS +   S ++L
Sbjct  21    GTCGAKMKPLPFMVVICTLMLFVVYRTTNYQYRQTEMESRLRPFFMLKDSGIPTTSLNAL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGIIE+RSDLELKPL +   S+ ++N      LLA+PVGIKQK NV+ I+QKFL ENFT
Sbjct  81    PRGIIEARSDLELKPLWSSDSSRKELNTPSSQCLLAIPVGIKQKHNVDRIVQKFLPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             I+LFHYDGNVDGWW+L WSK+AIH+VA +QTKWWFAKRFLHP VVS YDYIFLWDEDLGV
Sbjct  141   IVLFHYDGNVDGWWNLEWSKKAIHMVAFNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P RYLEIVK+EGLEISQPALDP S GIHHRIT+R R+ KFH+RVY+ +GSTKCS+ 
Sbjct  201   EHFCPRRYLEIVKAEGLEISQPALDPNSTGIHHRITIRQRSKKFHQRVYETRGSTKCSDA  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S+GPPC+GFVEGMAPVFSR+AW C WHLIQ+DLVHGWGMDMKLGYCAQGDRT NVG+VDS
Sbjct  261   SDGPPCAGFVEGMAPVFSRAAWHCSWHLIQSDLVHGWGMDMKLGYCAQGDRTKNVGVVDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+VH  IQ+LGG S K+ S      K   VD+R E+RRQST ELQ F++RWE A+KED+
Sbjct  321   EYIVHQSIQTLGGKSAKKTSIAGGSTKRHEVDVRSEVRRQSTSELQTFEDRWERAIKEDR  380

Query  305   NWVDPYKASQ  276
              WVDPYK SQ
Sbjct  381   YWVDPYKGSQ  390



>ref|XP_007211954.1| hypothetical protein PRUPE_ppa006425mg [Prunus persica]
 gb|EMJ13153.1| hypothetical protein PRUPE_ppa006425mg [Prunus persica]
Length=412

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/382 (67%), Positives = 300/382 (79%), Gaps = 8/382 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1215
             G C +KMK + F+G+ C  MLFI+YRTT YQYQ   Q EM++K +P  + +D  VT +  
Sbjct  21    GKCGLKMKQLSFMGVVCTVMLFIVYRTTNYQYQAYQQTEMDAKWNPFDTVKDIFVTSKKL  80

Query  1214  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1035
              SLPRGII++RSDLEL+PL   S S+ KV+   + NLLA+PVGIKQKD+V+ I++KFL E
Sbjct  81    DSLPRGIIQARSDLELRPLWLTSGSRLKVDDYSHRNLLAIPVGIKQKDSVDAIVEKFLPE  140

Query  1034  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  855
             NFTIILFHYDGNVDGWWDL WS  AIHIVA +QTKWWFAKRFLHPD+VSIYDY+FLWDED
Sbjct  141   NFTIILFHYDGNVDGWWDLEWSSNAIHIVAQNQTKWWFAKRFLHPDIVSIYDYVFLWDED  200

Query  854   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             LGVENFHP RYLEIV+  GLEISQPAL P S  IHHRIT+R+R  KFHRRVY  +GS KC
Sbjct  201   LGVENFHPGRYLEIVRQAGLEISQPALHPNSTDIHHRITIRARKKKFHRRVYDIRGSVKC  260

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             +  S+ PPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRTT VG+
Sbjct  261   TEASQTPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTTKVGV  320

Query  494   VDSEYLVHLGIQSL--GGSSLKRASSPQELPKGRAV---DLRVEIRRQSTYELQIFKERW  330
             VDSEY+VH GIQ+L  GG S ++ SS  +  K R     D+R EIRRQST E  IFKERW
Sbjct  321   VDSEYVVHKGIQTLGDGGLSARKVSSRGKTSKKRGASGFDVRTEIRRQSTREFSIFKERW  380

Query  329   EEAVKEDKNWVDPYKASQRYRK  264
               AV ED NW DP+K+S R RK
Sbjct  381   NNAVDEDMNWTDPFKSSIRRRK  402



>ref|XP_007025742.1| Uncharacterized protein TCM_029952 [Theobroma cacao]
 gb|EOY28364.1| Uncharacterized protein TCM_029952 [Theobroma cacao]
Length=592

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/370 (68%), Positives = 299/370 (81%), Gaps = 0/370 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C  KMK + F+G+ C  MLFI+YRTT YQY + EMESK  P  + +D  +      SL
Sbjct  21    GNCGFKMKQLPFMGVICAVMLFIVYRTTNYQYHETEMESKLHPFETVKDYRLPSGKLKSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI+ + SDLEL+PL + S  +SKVNVT   NLLAMPVGIKQK+NV++I+QKFL+ENFT
Sbjct  81    PRGIMHAHSDLELRPLWSRSSLRSKVNVTMNKNLLAMPVGIKQKENVDDIVQKFLAENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDG+VDGW DL W  +A+HIVAH+QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGHVDGWLDLEWGDKAVHIVAHNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ++F P RYLEIVK+EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +G TKC++ 
Sbjct  201   QHFDPGRYLEIVKAEGLEISQPALDPNSTEIHHRITIRARMKKFHRRVYDLRGKTKCTSA  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG++DS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVIDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+VH GIQSLGGS     ++  + P     DLR EIRRQST+ELQ+FK+RW +AV+EDK
Sbjct  321   EYIVHKGIQSLGGSGHSTMTTTIKSPGASGFDLRTEIRRQSTWELQVFKDRWNQAVEEDK  380

Query  305   NWVDPYKASQ  276
             +WVDP+  + 
Sbjct  381   SWVDPFSPTH  390



>ref|XP_010327027.1| PREDICTED: uncharacterized protein LOC101254342 isoform X2 [Solanum 
lycopersicum]
Length=400

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/369 (72%), Positives = 300/369 (81%), Gaps = 10/369 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
              TC VK+K + F+G+ C  M  I+YRTT YQY+Q EMESKSDP YS++DS V   S +SL
Sbjct  21    ATCGVKVKQIAFMGIICTIMFLIVYRTTNYQYRQTEMESKSDPFYSSKDSDVDITSFNSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII + SDLELKPL + S SKSK +V+   NLLAM VGIKQK NV+ ++QKFLSENFT
Sbjct  81    PRGIIHASSDLELKPLWSTSNSKSKDSVSSSRNLLAMAVGIKQKKNVDTLVQKFLSENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDG+VDGWWDL WSKEA+HIVA++QTKWWFAKRFLHP  VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGHVDGWWDLKWSKEAVHIVANNQTKWWFAKRFLHPAAVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             +NFHP RYL+IVKSEGLEISQPALD  S  IHHR+T+RS+  +FHRRVY  +GSTKCS E
Sbjct  201   KNFHPGRYLKIVKSEGLEISQPALDRNSTEIHHRLTIRSKRKRFHRRVYDSRGSTKCSGE  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPCSGFVEGMAPVFS SAW C WHLIQNDLVHGWGMDMK GYCAQGDR   VG+VDS
Sbjct  261   SEGPPCSGFVEGMAPVFSISAWVCAWHLIQNDLVHGWGMDMKFGYCAQGDRNKKVGVVDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+VH GIQ+LGG SLK+ S+ +E  K         IRRQS YELQIFKERWE AV+EDK
Sbjct  321   EYIVHQGIQTLGGPSLKKPSNLEESTK---------IRRQSMYELQIFKERWERAVEEDK  371

Query  305   NW-VDPYKA  282
             NW VD  KA
Sbjct  372   NWVVDQVKA  380



>ref|XP_008224979.1| PREDICTED: uncharacterized protein LOC103324663 [Prunus mume]
Length=413

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/383 (67%), Positives = 300/383 (78%), Gaps = 9/383 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1215
             G C +KMK + F+G+ C  MLFI+YRTT YQYQ   Q EM++K +P  + +D  VT +  
Sbjct  21    GKCGLKMKQLSFMGVVCTVMLFIVYRTTNYQYQAYRQTEMDAKWNPFDTVKDIFVTSKKL  80

Query  1214  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1035
              SLP GII++RSDLEL+PL   S S+ KVN   + NLLA+PVGIKQKD+V+ I++KFL E
Sbjct  81    DSLPHGIIQARSDLELRPLWLTSGSRLKVNDYSHRNLLAIPVGIKQKDSVDAIVEKFLPE  140

Query  1034  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  855
             NFTIILFHYDGNVDGWWDL WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDY+FLWDED
Sbjct  141   NFTIILFHYDGNVDGWWDLEWSSDAIHIVAQNQTKWWFAKRFLHPDIVSIYDYVFLWDED  200

Query  854   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             LGVENFHP RYLEIV+  GLEISQPAL P S  IHHRIT+R+R  KFHRRVY  +GS KC
Sbjct  201   LGVENFHPGRYLEIVREAGLEISQPALHPNSTDIHHRITIRARKKKFHRRVYDIRGSVKC  260

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             +  S+ PPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRTT VG+
Sbjct  261   TEASQTPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTTKVGV  320

Query  494   VDSEYLVHLGIQSL--GGSSLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKER  333
             VDSEY+VH GIQ+L  GG S ++ SS  +  K +      D+R EIRRQST E  IFKER
Sbjct  321   VDSEYIVHKGIQTLGDGGLSARKVSSRGKTSKKKHGASGFDVRTEIRRQSTREFSIFKER  380

Query  332   WEEAVKEDKNWVDPYKASQRYRK  264
             W  AV ED NW DP+K+S R RK
Sbjct  381   WNNAVDEDMNWTDPFKSSIRRRK  403



>ref|XP_010646775.1| PREDICTED: uncharacterized protein LOC100257753 [Vitis vinifera]
Length=412

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/383 (67%), Positives = 303/383 (79%), Gaps = 24/383 (6%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             KMK + F+G+ C+ ML I+YRTT YQYQQ EME+K  P  + E   +   +  +LPRGII
Sbjct  30    KMKQLPFMGIVCIVMLVIVYRTTNYQYQQTEMETKFQPFGTVEG--LASMTLVNLPRGII  87

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             ++RSDLEL+PL + S S+SKV+ +  HNLLA+PVGIKQK NV+ I++KFL ENFTIILFH
Sbjct  88    QARSDLELRPLWSTSSSRSKVDDSSEHNLLAIPVGIKQKYNVDAIVEKFLPENFTIILFH  147

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDGNVDGWWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYD+IFLWDEDLGVENFHP
Sbjct  148   YDGNVDGWWDLDWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDHIFLWDEDLGVENFHP  207

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  651
              RYL+I+KSEGLEISQPALDP S  IHHRIT+R R  K HRRV+  +GS KCSN SEGPP
Sbjct  208   RRYLDIMKSEGLEISQPALDPNSTDIHHRITIRKRMKKVHRRVWDLRGSVKCSNISEGPP  267

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             C+GFVEGMAPVFSRSAWRC WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG++DSE++VH
Sbjct  268   CTGFVEGMAPVFSRSAWRCTWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVIDSEFIVH  327

Query  470   LGIQSLGGSS---------------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKE  336
              GIQ+LGG S               +KR  +P       AVD R EIRRQST+EL +F++
Sbjct  328   QGIQTLGGGSPSAKKVSKDTFLDETVKRQGAP-------AVDTRSEIRRQSTWELHVFRD  380

Query  335   RWEEAVKEDKNWVDPYKASQRYR  267
             RW++AVKED+ WVDP+K  QR R
Sbjct  381   RWDKAVKEDRKWVDPFKKIQRRR  403



>ref|XP_011027923.1| PREDICTED: uncharacterized protein LOC105128100 isoform X1 [Populus 
euphratica]
 ref|XP_011027924.1| PREDICTED: uncharacterized protein LOC105128100 isoform X2 [Populus 
euphratica]
 ref|XP_011027925.1| PREDICTED: uncharacterized protein LOC105128100 isoform X2 [Populus 
euphratica]
 ref|XP_011027926.1| PREDICTED: uncharacterized protein LOC105128100 isoform X2 [Populus 
euphratica]
Length=403

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 301/367 (82%), Gaps = 5/367 (1%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             +KMK + F+G+ C +MLF++YRTTIYQY   EM+ K  P    ++S +       LP GI
Sbjct  23    LKMKLLPFMGVLCTAMLFVVYRTTIYQYHHTEMDEKLYPFEILKESALASGLLGGLPHGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             I + SDLELKPL + S S+SKV+ +  H LLA+P GIKQKDNV+ I+QKFL ENFT+ILF
Sbjct  83    IRASSDLELKPLWSTSSSRSKVDPSTRHYLLAIPAGIKQKDNVDHIVQKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLG+E+F+
Sbjct  143   HYDGNVDGWWDLDWSNEAIHIVAKNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGIEHFN  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P +YL+IV+ EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +GSTKCS+ SEGP
Sbjct  203   PGKYLKIVRFEGLEISQPALDPNSTDIHHRITIRARMKKFHRRVYDSRGSTKCSDISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  322

Query  473   HLGIQSLGG--SSLKRASSPQELPK---GRAVDLRVEIRRQSTYELQIFKERWEEAVKED  309
             H GIQ+LGG  ++ ++AS+ +EL K     +VD R+EIRRQST+ELQIFK+RW++AVKED
Sbjct  323   HKGIQTLGGRKTARRKASNTEELTKRYSAASVDPRMEIRRQSTWELQIFKDRWKQAVKED  382

Query  308   KNWVDPY  288
             KNWVDP+
Sbjct  383   KNWVDPF  389



>ref|XP_006384013.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 ref|XP_006384014.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 gb|ERP61810.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 gb|ERP61811.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
Length=403

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/367 (69%), Positives = 301/367 (82%), Gaps = 5/367 (1%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             +KMK + F+G+ C +MLF++YRTTIYQY   EM+ K  P    ++S +       LP GI
Sbjct  23    LKMKLLPFMGVLCTAMLFVVYRTTIYQYHHTEMDEKLYPFEILKESALASGLLGGLPHGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             I + SDLELKPL + S S+SKV+ +  H LLA+PVGIKQKDNV+ I+QKFL ENFT+ILF
Sbjct  83    IRASSDLELKPLWSTSSSRSKVDPSTRHYLLAIPVGIKQKDNVDHIVQKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLG+E+F+
Sbjct  143   HYDGNVDGWWDLDWSNEAIHIVAKNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGIEHFN  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P +YL+IV+ EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +GSTKCS+ SEGP
Sbjct  203   PGKYLKIVRFEGLEISQPALDPNSTDIHHRITIRARMKKFHRRVYDSRGSTKCSDISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  322

Query  473   HLGIQSLGG--SSLKRASSPQELPK---GRAVDLRVEIRRQSTYELQIFKERWEEAVKED  309
             H GIQ+LGG  +  +++S+ +EL K     +VD R+EIRRQST+ELQIFK+RW++AVKED
Sbjct  323   HKGIQTLGGRKTPRRKSSNTEELTKRHSAASVDPRMEIRRQSTWELQIFKDRWKQAVKED  382

Query  308   KNWVDPY  288
             KNWVDP+
Sbjct  383   KNWVDPF  389



>ref|XP_011043338.1| PREDICTED: uncharacterized protein LOC105138816, partial [Populus 
euphratica]
Length=396

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 255/368 (69%), Positives = 296/368 (80%), Gaps = 5/368 (1%)
 Frame = -3

Query  1376  RVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRG  1197
             R+KMK + F+G    +MLFI+YRTT YQY+  EME K  P  S ++S +       LP G
Sbjct  21    RLKMKQLPFMGFLFTTMLFIVYRTTTYQYKHTEMEEKLYPFDSLKESALASGLLVGLPHG  80

Query  1196  IIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1017
             II + SDLELKPL + S SK K   +    LLA+PVGIKQKDNVN I+QKFL ENFT+IL
Sbjct  81    IIRANSDLELKPLWSTSSSKLKAYPSTRRFLLAIPVGIKQKDNVNRIVQKFLPENFTVIL  140

Query  1016  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  837
             FHYDG VDGWWDLAWS E IHI A +QTKWWFAKRFLHP VVSIYDY+FLWDEDLGVE+F
Sbjct  141   FHYDGKVDGWWDLAWSNEVIHIAAKNQTKWWFAKRFLHPAVVSIYDYVFLWDEDLGVEHF  200

Query  836   HPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  657
             +P RYL+IV+ EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GSTKCS+ SEG
Sbjct  201   NPGRYLKIVRYEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTKCSDVSEG  260

Query  656   PPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYL  477
             PPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSEY+
Sbjct  261   PPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSEYI  320

Query  476   VHLGIQSLGGSSL--KRASSPQELPK---GRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             VH GIQ+LGG+    ++AS+ +EL K      +D R+EIRRQST+ELQIFK+RW +AVKE
Sbjct  321   VHKGIQTLGGNGPPERKASNTEELTKRHSATGMDPRMEIRRQSTWELQIFKDRWNQAVKE  380

Query  311   DKNWVDPY  288
             DKNWVDP+
Sbjct  381   DKNWVDPF  388



>ref|XP_006361017.1| PREDICTED: uncharacterized protein LOC102578269 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361018.1| PREDICTED: uncharacterized protein LOC102578269 isoform X2 [Solanum 
tuberosum]
Length=408

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/367 (73%), Positives = 304/367 (83%), Gaps = 0/367 (0%)
 Frame = -3

Query  1382  TCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLP  1203
             TC +K+K + F+G+ C  M  I+YRTT YQYQQ EMESKSDP YS++DS V     +SLP
Sbjct  22    TCGIKVKQIAFMGIICTIMFLIVYRTTNYQYQQTEMESKSDPFYSSKDSDVDITRLNSLP  81

Query  1202  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1023
             RGII++ SDLELKPL + S SKSK +V+   NLLAM VGIKQK NV+ ++QKFLSENFTI
Sbjct  82    RGIIQASSDLELKPLWSTSNSKSKGSVSSSRNLLAMAVGIKQKKNVDTLVQKFLSENFTI  141

Query  1022  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  843
             ILFHYDG+VDGWWDL WSKEA+HI A++QTKWWFAKRFLHP  VSIYDYIFLWDEDLGV+
Sbjct  142   ILFHYDGHVDGWWDLQWSKEAVHIAANNQTKWWFAKRFLHPAAVSIYDYIFLWDEDLGVK  201

Query  842   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  663
             NFHP RYLEIVKSEGLEISQPALD  S  IHHRIT+R +  +FHRRVY  +GSTKCS ES
Sbjct  202   NFHPGRYLEIVKSEGLEISQPALDRNSTEIHHRITIRRKRKRFHRRVYDSRGSTKCSGES  261

Query  662   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  483
             EGPPCSGFVEGMAPVFS +AW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSE
Sbjct  262   EGPPCSGFVEGMAPVFSIAAWVCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSE  321

Query  482   YLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             Y+VH  IQ+LGG SLK+ S  +E  K   VD+R EIRRQS YELQIFK+RWE AV+EDKN
Sbjct  322   YIVHQSIQTLGGPSLKKRSDLEESTKRHVVDVRSEIRRQSMYELQIFKDRWERAVEEDKN  381

Query  302   WVDPYKA  282
             WVDP +A
Sbjct  382   WVDPVEA  388



>ref|XP_002316643.2| hypothetical protein POPTR_0011s04510g [Populus trichocarpa]
 gb|EEE97255.2| hypothetical protein POPTR_0011s04510g [Populus trichocarpa]
Length=401

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/367 (69%), Positives = 295/367 (80%), Gaps = 5/367 (1%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             +KMK + F+G    +MLFI+YRTT YQY+  EME K  P  S ++S +       LP GI
Sbjct  22    LKMKQLPFMGFLFTTMLFIVYRTTTYQYKHTEMEEKLYPFDSLKESALASGLLVGLPHGI  81

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             I + SDLELKPL + S S+SK + +    LLA+PVGIKQKDNVN I+QKFL ENFT+ILF
Sbjct  82    IRASSDLELKPLWSTSSSRSKADPSTRRFLLAIPVGIKQKDNVNRIVQKFLPENFTVILF  141

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG VDGWWDL WS E IHI A +QTKWWFAKRFLHP VVSIYDYIFLWDEDLGVE+F+
Sbjct  142   HYDGKVDGWWDLDWSNEVIHIAAKNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVEHFN  201

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYL+IV+ EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GSTKCS+ SEGP
Sbjct  202   PGRYLKIVRYEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTKCSDVSEGP  261

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSEY+V
Sbjct  262   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSEYIV  321

Query  473   HLGIQSLGGSSL--KRASSPQELPK---GRAVDLRVEIRRQSTYELQIFKERWEEAVKED  309
             H GIQ+LGG     ++AS+ +EL K      +D R+EIRRQST+ELQIFK+RW +AVKED
Sbjct  322   HKGIQTLGGHGPPGRKASNTEELTKRHSATGMDPRMEIRRQSTWELQIFKDRWNQAVKED  381

Query  308   KNWVDPY  288
             KNWVDP+
Sbjct  382   KNWVDPF  388



>ref|XP_002305670.2| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 gb|EEE86181.2| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
Length=394

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/362 (69%), Positives = 295/362 (81%), Gaps = 4/362 (1%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             +KMK + F+G+ C +MLF++YRTTIYQY   EM+ K  P    ++S +       LP GI
Sbjct  23    LKMKLLPFMGVLCTAMLFVVYRTTIYQYHHTEMDEKLYPFEILKESALASGLLGGLPHGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             I + SDLELKPL + S S+SKV+ +  H LLA+PVGIKQKDNV+ I+QKFL ENFT+ILF
Sbjct  83    IRASSDLELKPLWSTSSSRSKVDPSTRHYLLAIPVGIKQKDNVDHIVQKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLG+E+F+
Sbjct  143   HYDGNVDGWWDLDWSNEAIHIVAKNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGIEHFN  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P +YL+IV+ EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +GSTKCS+ SEGP
Sbjct  203   PGKYLKIVRFEGLEISQPALDPNSTDIHHRITIRARMKKFHRRVYDSRGSTKCSDISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  322

Query  473   HLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVD  294
             H GIQ+LGG    R +  ++     +VD R+EIRRQST+ELQIFK+RW++AVKEDKNWVD
Sbjct  323   HKGIQTLGG----RKTPRRKRHSAASVDPRMEIRRQSTWELQIFKDRWKQAVKEDKNWVD  378

Query  293   PY  288
             P+
Sbjct  379   PF  380



>ref|XP_006449262.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62502.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=402

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/366 (68%), Positives = 290/366 (79%), Gaps = 4/366 (1%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             H GIQ+LGG    R S+ +E    R     VDLR EIRRQST ELQIFK+RW EA+++DK
Sbjct  323   HQGIQTLGGQRPTRKSTKREELAKRHGPAPVDLRAEIRRQSTMELQIFKKRWNEAIEQDK  382

Query  305   NWVDPY  288
             +WVDP+
Sbjct  383   SWVDPF  388



>ref|XP_006467869.1| PREDICTED: uncharacterized protein LOC102620672 isoform X2 [Citrus 
sinensis]
 gb|KDO75802.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=402

 Score =   531 bits (1368),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/366 (68%), Positives = 291/366 (80%), Gaps = 4/366 (1%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             H GIQ+LGG    R S+ +E    R     VDLR EIRRQST ELQIFK+RW EA+++DK
Sbjct  323   HQGIQTLGGQPPTRKSTKREELAKRHGPAPVDLRAEIRRQSTMELQIFKKRWNEAIEQDK  382

Query  305   NWVDPY  288
             +WVDP+
Sbjct  383   SWVDPF  388



>ref|XP_009378251.1| PREDICTED: uncharacterized protein LOC103966743 [Pyrus x bretschneideri]
Length=410

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/375 (66%), Positives = 291/375 (78%), Gaps = 6/375 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1215
             G   +KMK + F+G+ C  MLF++YRTT YQYQ   Q EM++K +P  + ++  VT R  
Sbjct  21    GKSGMKMKQLSFMGVVCTVMLFVVYRTTNYQYQAYQQTEMDAKWNPFDTVKEIFVTSRKL  80

Query  1214  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1035
               LPRGII+ RSDLE +PL   S S+ KV      NLLA+PVGIKQKD+V+ I+ KFL E
Sbjct  81    DGLPRGIIQPRSDLEQRPLWLTSSSRLKVGDYSSRNLLAIPVGIKQKDSVDAIVGKFLPE  140

Query  1034  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  855
             NFT+ILFHYDGNVDGWWDL WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDED
Sbjct  141   NFTVILFHYDGNVDGWWDLEWSNDAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDED  200

Query  854   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             LGVENFHP RYLEIVK  GLEISQPAL P S  IHHRIT+R++  KFHRRVY  +GSTKC
Sbjct  201   LGVENFHPGRYLEIVKEAGLEISQPALHPNSTDIHHRITIRAKKKKFHRRVYDTRGSTKC  260

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             +  S+GPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+
Sbjct  261   TEASQGPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTKKVGV  320

Query  494   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV---DLRVEIRRQSTYELQIFKERWEE  324
             VDSEY+VH GIQ+LG         P++  K RA    D+R+EIRRQST E   FKERW  
Sbjct  321   VDSEYIVHKGIQTLGEGGSSTNKVPEKKSKKRAAPGHDMRIEIRRQSTREYTTFKERWNN  380

Query  323   AVKEDKNWVDPYKAS  279
             AV+ED NW+DP+K+S
Sbjct  381   AVEEDLNWIDPFKSS  395



>gb|AES63728.2| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=402

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 297/382 (78%), Gaps = 13/382 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    +MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    L
Sbjct  21    GKSSFRMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDA  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  485   EYLVHLGIQSLGGSS--------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
             +Y+VH GIQ+LGGS         LK+ ++ Q    G  VD+R EIRRQST+EL++FKERW
Sbjct  321   QYVVHKGIQTLGGSDHGATKVSKLKKTTTKQ---GGATVDVRSEIRRQSTWELEVFKERW  377

Query  329   EEAVKEDKNWVDPYKASQRYRK  264
              +A+ +DKNWVDP+K  +R RK
Sbjct  378   NQAIAKDKNWVDPFK--RRIRK  397



>ref|XP_006449263.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62503.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=405

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 290/369 (79%), Gaps = 7/369 (2%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKRAS----SPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEAVK  315
             H GIQ+LGG    R S      +EL K      VDLR EIRRQST ELQIFK+RW EA++
Sbjct  323   HQGIQTLGGQRPTRKSLQSTKREELAKRHGPAPVDLRAEIRRQSTMELQIFKKRWNEAIE  382

Query  314   EDKNWVDPY  288
             +DK+WVDP+
Sbjct  383   QDKSWVDPF  391



>ref|XP_006467868.1| PREDICTED: uncharacterized protein LOC102620672 isoform X1 [Citrus 
sinensis]
 gb|KDO75803.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75804.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=405

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 250/369 (68%), Positives = 291/369 (79%), Gaps = 7/369 (2%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKRAS----SPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEAVK  315
             H GIQ+LGG    R S      +EL K      VDLR EIRRQST ELQIFK+RW EA++
Sbjct  323   HQGIQTLGGQPPTRKSLQSTKREELAKRHGPAPVDLRAEIRRQSTMELQIFKKRWNEAIE  382

Query  314   EDKNWVDPY  288
             +DK+WVDP+
Sbjct  383   QDKSWVDPF  391



>ref|XP_003593477.1| Lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=403

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/382 (66%), Positives = 298/382 (78%), Gaps = 12/382 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    +MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    L
Sbjct  21    GKSSFRMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDA  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  485   EYLVHLGIQSLGGSS--------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
             +Y+VH GIQ+LGGS         LK+ ++ ++   G  VD+R EIRRQST+EL++FKERW
Sbjct  321   QYVVHKGIQTLGGSDHGATKVSKLKKTTTQKQ--GGATVDVRSEIRRQSTWELEVFKERW  378

Query  329   EEAVKEDKNWVDPYKASQRYRK  264
              +A+ +DKNWVDP+K  +R RK
Sbjct  379   NQAIAKDKNWVDPFK--RRIRK  398



>gb|KEH36526.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=376

 Score =   526 bits (1356),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/376 (67%), Positives = 295/376 (78%), Gaps = 13/376 (3%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    LPRGII+
Sbjct  1     MKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGLPRGIIQ  60

Query  1187  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
               SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFTIILFHY
Sbjct  61    DSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFTIILFHY  120

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGVE+F P+
Sbjct  121   DGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGVEHFSPS  180

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  648
             RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ SEGPPC
Sbjct  181   RYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDASEGPPC  240

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
             +GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS+Y+VH 
Sbjct  241   TGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSQYVVHK  300

Query  467   GIQSLGGSS--------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             GIQ+LGGS         LK+ ++ Q    G  VD+R EIRRQST+EL++FKERW +A+ +
Sbjct  301   GIQTLGGSDHGATKVSKLKKTTTKQ---GGATVDVRSEIRRQSTWELEVFKERWNQAIAK  357

Query  311   DKNWVDPYKASQRYRK  264
             DKNWVDP+K  +R RK
Sbjct  358   DKNWVDPFK--RRIRK  371



>ref|XP_008355992.1| PREDICTED: uncharacterized protein LOC103419671 [Malus domestica]
Length=410

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 291/380 (77%), Gaps = 6/380 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1215
             G   +KMK + F+G+ C  MLF++YRTT YQYQ   Q EM++K +P  + ++  V+ R  
Sbjct  21    GKSGIKMKQLSFMGVVCTVMLFVVYRTTNYQYQAYQQTEMDAKWNPFDTVKEIFVSSRKL  80

Query  1214  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1035
              SLPRGII+ RSDLE +PL   S S  KV      NLLA+PVGIKQKD+V+ I+ KFL E
Sbjct  81    DSLPRGIIQPRSDLEQRPLWLTSSSMLKVGDXSNRNLLAIPVGIKQKDSVDAIVGKFLPE  140

Query  1034  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  855
             NFT+ILFHYDGNVDGWWDL WS EA HIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDED
Sbjct  141   NFTVILFHYDGNVDGWWDLEWSNEAXHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDED  200

Query  854   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             LGVENFHP RYLEIVK  GLEISQPAL P S  IHHRIT+R++  KFHRRVY  +GSTKC
Sbjct  201   LGVENFHPGRYLEIVKEAGLEISQPALHPNSTDIHHRITIRAKKKKFHRRVYDTRGSTKC  260

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             +  S+GPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+
Sbjct  261   TEASQGPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTKKVGV  320

Query  494   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV---DLRVEIRRQSTYELQIFKERWEE  324
             VDSEY+VH GIQ+LG         P++  K RA     +R+EIRRQST E   FKERW  
Sbjct  321   VDSEYIVHKGIQTLGEGGSSTDKVPEKKSKKRAAPGHXMRIEIRRQSTREYTTFKERWNN  380

Query  323   AVKEDKNWVDPYKASQRYRK  264
             AV+ED  W+DP+K+S + RK
Sbjct  381   AVEEDLKWIDPFKSSLKRRK  400



>ref|XP_008383799.1| PREDICTED: uncharacterized protein LOC103446457 [Malus domestica]
Length=409

 Score =   525 bits (1351),  Expect = 7e-180, Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 294/380 (77%), Gaps = 6/380 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1215
             G   +KMK + F+G+ C  MLFI+YRTT +QYQ   Q E+++K +P  + ++   T R  
Sbjct  21    GKSGMKMKQLSFMGVTCTVMLFIVYRTTNFQYQAYQQTEIDAKWNPFDTVKEIFATSRKL  80

Query  1214  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1035
              SLPRGII+ RSDLE +PL   S S+ KV+     NLLA+PVGIKQKD+V+ I++KFL E
Sbjct  81    DSLPRGIIQPRSDLEQRPLWLTSSSRLKVDDYSNRNLLAIPVGIKQKDSVDAIVRKFLPE  140

Query  1034  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  855
             NFT ILFHYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHPD+VSIYDY+FLWDED
Sbjct  141   NFTFILFHYDGNVDGWWDLEWSNEAIHIVAQNQTKWWFAKRFLHPDIVSIYDYVFLWDED  200

Query  854   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             LGV+NFHP RYLEIVK  GLEISQPAL P S  IHHRIT+R++  KFHRRVY  +GSTKC
Sbjct  201   LGVDNFHPGRYLEIVKEAGLEISQPALHPNSTDIHHRITIRAKNKKFHRRVYDTRGSTKC  260

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             +  S+GPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DM+LGYCAQGDRT  VG+
Sbjct  261   TEASQGPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMRLGYCAQGDRTKKVGV  320

Query  494   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV---DLRVEIRRQSTYELQIFKERWEE  324
             VDSEY+VH GIQ+LG         P++  K RA    D+R+EIRRQST E   FK+RW  
Sbjct  321   VDSEYIVHKGIQTLGYGGSSTNKVPEKKSKKRAASGHDVRIEIRRQSTREFITFKQRWNN  380

Query  323   AVKEDKNWVDPYKASQRYRK  264
             AV+ED +W DP+K+S + RK
Sbjct  381   AVEEDPSWADPFKSSLKRRK  400



>ref|XP_006594617.1| PREDICTED: uncharacterized protein LOC100776750 isoform X6 [Glycine 
max]
Length=411

 Score =   523 bits (1346),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 292/376 (78%), Gaps = 6/376 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELP---KGRAVDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS   + + S PQ       G  +D+R EIRRQST+E +IFKERW EA
Sbjct  320   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMKQGGVGIDVRTEIRRQSTWEFEIFKERWNEA  379

Query  320   VKEDKNWVDPYKASQR  273
             +  DKNWVDP+K+ QR
Sbjct  380   IAADKNWVDPFKSDQR  395



>ref|XP_006594612.1| PREDICTED: uncharacterized protein LOC100776750 isoform X1 [Glycine 
max]
 ref|XP_006594613.1| PREDICTED: uncharacterized protein LOC100776750 isoform X2 [Glycine 
max]
 ref|XP_006594614.1| PREDICTED: uncharacterized protein LOC100776750 isoform X3 [Glycine 
max]
 ref|XP_006594615.1| PREDICTED: uncharacterized protein LOC100776750 isoform X4 [Glycine 
max]
 ref|XP_006594616.1| PREDICTED: uncharacterized protein LOC100776750 isoform X5 [Glycine 
max]
Length=412

 Score =   522 bits (1344),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 249/377 (66%), Positives = 293/377 (78%), Gaps = 7/377 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSS--LKRASSPQ----ELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             EY+ H GIQ+LGGS   + + S PQ    +   G  +D+R EIRRQST+E +IFKERW E
Sbjct  320   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMQKQGGVGIDVRTEIRRQSTWEFEIFKERWNE  379

Query  323   AVKEDKNWVDPYKASQR  273
             A+  DKNWVDP+K+ QR
Sbjct  380   AIAADKNWVDPFKSDQR  396



>gb|KHN08570.1| hypothetical protein glysoja_014335, partial [Glycine soja]
Length=379

 Score =   520 bits (1339),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 249/376 (66%), Positives = 292/376 (78%), Gaps = 18/376 (5%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q E       +Y +    + G     L
Sbjct  1     GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEE-------VYPSTSGKLKG-----L  48

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  49    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  107

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  108   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  167

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  168   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  227

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  228   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  287

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPK---GRAVDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS   + + S PQ       G  +D+R EIRRQST+E +IFKERW EA
Sbjct  288   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMKQGGVGIDVRTEIRRQSTWEFEIFKERWNEA  347

Query  320   VKEDKNWVDPYKASQR  273
             +  DKNWVDP+K+ QR
Sbjct  348   IAADKNWVDPFKSDQR  363



>ref|XP_004146635.1| PREDICTED: uncharacterized protein LOC101217607 [Cucumis sativus]
Length=419

 Score =   521 bits (1343),  Expect = 2e-178, Method: Compositional matrix adjust.
 Identities = 246/375 (66%), Positives = 294/375 (78%), Gaps = 4/375 (1%)
 Frame = -3

Query  1391  LEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS  1212
             ++G    KMK + F+G+ C  MLFI+YRTT YQY Q ++E+   P  +A+D     ++ +
Sbjct  28    VQGKYGFKMKQLPFMGVICSVMLFIIYRTTNYQYLQTKIETALQPFDTAKDYPEESQNLN  87

Query  1211  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LPRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK+NVN I+QKF+ EN
Sbjct  88    GLPRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKENVNSIVQKFIPEN  147

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FTIILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDL
Sbjct  148   FTIILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDL  207

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVE+F P RYLEIVKSEGLEISQPALDP S  IHHRITVR+RT K HRRVY  +G+ KCS
Sbjct  208   GVEHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITVRARTKKIHRRVYDLRGNVKCS  267

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             +ESE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++
Sbjct  268   DESEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVI  327

Query  491   DSEYLVHLGIQSLGGSSLK----RASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             DS+Y+VH GIQ+LGG   K    +A+   +       D+R EIRRQST+ELQIFKERW +
Sbjct  328   DSQYIVHKGIQTLGGGGTKSKPSKAAGYAKKQNPIPSDVRTEIRRQSTWELQIFKERWNK  387

Query  323   AVKEDKNWVDPYKAS  279
             AV ED++WVDP+K +
Sbjct  388   AVAEDQSWVDPFKTN  402



>gb|KGN64636.1| hypothetical protein Csa_1G072470 [Cucumis sativus]
Length=410

 Score =   520 bits (1340),  Expect = 3e-178, Method: Compositional matrix adjust.
 Identities = 246/373 (66%), Positives = 292/373 (78%), Gaps = 4/373 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+G+ C  MLFI+YRTT YQY Q ++E+   P  +A+D     ++ + L
Sbjct  21    GKYGFKMKQLPFMGVICSVMLFIIYRTTNYQYLQTKIETALQPFDTAKDYPEESQNLNGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK+NVN I+QKF+ ENFT
Sbjct  81    PRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKENVNSIVQKFIPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRITVR+RT K HRRVY  +G+ KCS+E
Sbjct  201   EHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITVRARTKKIHRRVYDLRGNVKCSDE  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++DS
Sbjct  261   SEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDS  320

Query  485   EYLVHLGIQSLGGSSLK----RASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +Y+VH GIQ+LGG   K    +A+   +       D+R EIRRQST+ELQIFKERW +AV
Sbjct  321   QYIVHKGIQTLGGGGTKSKPSKAAGYAKKQNPIPSDVRTEIRRQSTWELQIFKERWNKAV  380

Query  317   KEDKNWVDPYKAS  279
              ED++WVDP+K +
Sbjct  381   AEDQSWVDPFKTN  393



>ref|XP_006594619.1| PREDICTED: uncharacterized protein LOC100776750 isoform X8 [Glycine 
max]
 ref|XP_006594620.1| PREDICTED: uncharacterized protein LOC100776750 isoform X9 [Glycine 
max]
Length=400

 Score =   520 bits (1339),  Expect = 4e-178, Method: Compositional matrix adjust.
 Identities = 249/377 (66%), Positives = 292/377 (77%), Gaps = 19/377 (5%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q E       +Y +    + G     L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEE-------VYPSTSGKLKG-----L  68

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  69    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  127

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  128   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  187

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  188   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  247

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  248   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  307

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPK----GRAVDLRVEIRRQSTYELQIFKERWEE  324
             EY+ H GIQ+LGGS   + + S PQ        G  +D+R EIRRQST+E +IFKERW E
Sbjct  308   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMQKQGGVGIDVRTEIRRQSTWEFEIFKERWNE  367

Query  323   AVKEDKNWVDPYKASQR  273
             A+  DKNWVDP+K+ QR
Sbjct  368   AIAADKNWVDPFKSDQR  384



>ref|XP_004293534.1| PREDICTED: uncharacterized protein LOC101292191 [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   520 bits (1339),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 250/368 (68%), Positives = 294/368 (80%), Gaps = 9/368 (2%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSSSSLP  1203
             +KMK + F+G+ C  MLFI+YRTT YQYQ   +AEME K  P    ++  ++ R+   LP
Sbjct  29    LKMKQVSFMGVVCTVMLFIVYRTTNYQYQAYKEAEMEGKMHPF--NQEILLSSRALDGLP  86

Query  1202  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1023
             RGI+++RSDLEL+PL  +S SK KV+ +   NLLAMPVGIKQKDNV+EI+QKFL ENFTI
Sbjct  87    RGIVQARSDLELRPL-WLSSSKLKVDYSN-RNLLAMPVGIKQKDNVDEIVQKFLPENFTI  144

Query  1022  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  843
             ILFHYDG+V GWWDL WS EAIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE
Sbjct  145   ILFHYDGDVKGWWDLEWSDEAIHIVARNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  204

Query  842   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  663
             NF+PARYLEIV+  GLEISQPAL P S  IHHRITVR++  KFHRR+Y  +GS KC+ ES
Sbjct  205   NFNPARYLEIVRGAGLEISQPALHPNSTEIHHRITVRAKKKKFHRRIYDSRGSVKCTEES  264

Query  662   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  483
             +GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDR+ NVG+VD E
Sbjct  265   QGPPCTGFVEGMAPVFSRSAWDCTWHLIQNDLVHGWGLDMKLGYCAQGDRSKNVGVVDVE  324

Query  482   YLVHLGIQSLGG--SSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKED  309
             Y+ H GIQSLGG  S  ++ S+ ++       D R EIRRQST E  +FKERW  AV+ED
Sbjct  325   YIFHKGIQSLGGGDSQERKVSNSKKKRIVSNHDGRTEIRRQSTREFTVFKERWNRAVEED  384

Query  308   KNWVDPYK  285
             K W+DP+K
Sbjct  385   KKWIDPFK  392



>gb|EPS65991.1| hypothetical protein M569_08784, partial [Genlisea aurea]
Length=398

 Score =   520 bits (1338),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 244/374 (65%), Positives = 295/374 (79%), Gaps = 2/374 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G+CR KMK +  +G+ C +MLF++YRT  YQY++  MES     +S+ D  ++     SL
Sbjct  25    GSCRGKMKQLPLMGIICTAMLFVIYRTAYYQYRETMMESTLPFYWSSNDQGLSISRFRSL  84

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGIIE+++DLELKPL   S  K +   +  + LLAMPVGI QK NV+ ++++FL ENFT
Sbjct  85    PRGIIEAKTDLELKPLWRTSHFKPRKTQSSRY-LLAMPVGIMQKQNVDLVVKRFLPENFT  143

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYD N++GWW+L WS+EAIH+VA +QTKWWFAKRFLHP VVS+YDYIFLWDEDLGV
Sbjct  144   VILFHYDENLEGWWNLDWSREAIHVVARNQTKWWFAKRFLHPAVVSMYDYIFLWDEDLGV  203

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+FHP RYL+IVKSEGLEISQPALDP S  IHHRITVR+R + FHRRVY  +GS KC  +
Sbjct  204   EHFHPGRYLDIVKSEGLEISQPALDPNSTEIHHRITVRNRMHAFHRRVYDSRGSIKCVED  263

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDS
Sbjct  264   SEGPPCTGFVEGMAPVFSRSAWHCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGIVDS  323

Query  485   EYLVHLGIQSLGGSSLKRASSPQELP-KGRAVDLRVEIRRQSTYELQIFKERWEEAVKED  309
             EY++H GIQ+LGGSS K+A  P+E   K  + D R+EIRRQS  ELQ FK+RW+ AV+ED
Sbjct  324   EYVIHQGIQTLGGSSAKKAPIPEEAAIKKHSYDSRIEIRRQSMNELQTFKKRWDRAVEED  383

Query  308   KNWVDPYKASQRYR  267
               W DPY  ++R R
Sbjct  384   SKWSDPYSRNRRLR  397



>gb|KHG05934.1| 26S proteasome regulatory subunit rpn-1 [Gossypium arboreum]
Length=401

 Score =   520 bits (1338),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 242/374 (65%), Positives = 290/374 (78%), Gaps = 1/374 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+G+ C+ MLFI+YRTT+YQY + EME K       +D         SL
Sbjct  21    GKIGFKMKQLPFMGVICIVMLFIVYRTTVYQYHKTEMEMKLYRFEMVKDYQQPSGKLRSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI++ RSDLE++PL  MS S  + +V    NLLAMPVGI QK+NV+++++KFL+ NFT
Sbjct  81    PRGIMQVRSDLEIRPL-WMSSSSRQASVNTNKNLLAMPVGIMQKENVDDVVEKFLAANFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWWDL W  +AIH+VAH+QTKWWFAKRFLHP+VVSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWDLDWGDKAIHVVAHNQTKWWFAKRFLHPNVVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ++F P RYL+IVK+ GLEISQPALDP S  IHH+IT+RSRT + HRRVY+ +G TKCS  
Sbjct  200   DHFDPKRYLQIVKTAGLEISQPALDPDSTEIHHKITIRSRTKELHRRVYELRGKTKCSKA  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPCSGFVEGMAPVF+RSAW C WHLIQNDLVHGWGMDMKLGYCAQG R+  VG++DS
Sbjct  260   SEGPPCSGFVEGMAPVFTRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGVRSKKVGVIDS  319

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+VH GIQSLGGS      +  +       DLR +IRRQST+EL++FKERW  AV+EDK
Sbjct  320   EYIVHKGIQSLGGSGYPATRTTVKRNGASGFDLRTQIRRQSTWELEVFKERWNRAVEEDK  379

Query  305   NWVDPYKASQRYRK  264
             NWVDP+   Q  +K
Sbjct  380   NWVDPFLRYQSRKK  393



>gb|KHG04115.1| GTPase Der [Gossypium arboreum]
Length=403

 Score =   520 bits (1338),  Expect = 6e-178, Method: Compositional matrix adjust.
 Identities = 245/373 (66%), Positives = 293/373 (79%), Gaps = 12/373 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+G+ C   L+I+YRTT YQY + +ME+K  P  S ED+ +       L
Sbjct  16    GNSGFKMKQLPFMGVICSVTLYIVYRTTNYQYYETQMETKLHPFDSVEDNELPSGKLKDL  75

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI+ +RSDLEL+P    S+ +S V V    NLLAMPVGIKQK++V+++++KF +ENFT
Sbjct  76    PRGIMHTRSDLELRPQWRKSL-RSAVKVNTNKNLLAMPVGIKQKEHVDDVVKKFRTENFT  134

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             I+LFHYDG VDGWWDL W  +AIHIVAH+QTKWWFAKRFLHPD+VS YDYIFLWDEDLGV
Sbjct  135   IVLFHYDGKVDGWWDLDWCDKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYIFLWDEDLGV  194

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F+P RYLEIVKSEGLEISQPALDP S  IHHRIT+RSR  KFHRRVY+ +G T+CSN 
Sbjct  195   EHFNPGRYLEIVKSEGLEISQPALDPNSTEIHHRITIRSRMKKFHRRVYELRGKTRCSNI  254

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPCSGFVEGMAPVFSR+AWRC WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++D 
Sbjct  255   SEGPPCSGFVEGMAPVFSRAAWRCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDR  314

Query  485   EYLVHLGIQSLGGSS-------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWE  327
             EY+VH GIQ+LGG+         KR +S         +D R EIRRQST+EL+IFKERW 
Sbjct  315   EYIVHKGIQTLGGTGELTKKTKKKRGTS----SGSSGLDTRAEIRRQSTWELKIFKERWN  370

Query  326   EAVKEDKNWVDPY  288
             +AV +DK+W+DP+
Sbjct  371   QAVTQDKDWIDPF  383



>ref|XP_006597406.1| PREDICTED: uncharacterized protein LOC100778191 isoform X6 [Glycine 
max]
Length=402

 Score =   519 bits (1337),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 248/376 (66%), Positives = 293/376 (78%), Gaps = 5/376 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+ H GIQ+LGGS   R +  Q    G  +D+R EIRRQST+E +IFKERW +A+  DK
Sbjct  320   EYVFHKGIQTLGGSG-HRMTKKQ---GGVGIDVRTEIRRQSTWEFEIFKERWNKAIGADK  375

Query  305   NWVDPYKASQRYRKTW  258
             NWVDP+K+ QR  + W
Sbjct  376   NWVDPFKSDQRRIRKW  391



>ref|XP_006597405.1| PREDICTED: uncharacterized protein LOC100778191 isoform X5 [Glycine 
max]
Length=411

 Score =   520 bits (1338),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 249/384 (65%), Positives = 295/384 (77%), Gaps = 12/384 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSS--------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
             EY+ H GIQ+LGGS         L+R +  Q    G  +D+R EIRRQST+E +IFKERW
Sbjct  320   EYVFHKGIQTLGGSGHRMTKVSKLQRTTMKQ---GGVGIDVRTEIRRQSTWEFEIFKERW  376

Query  329   EEAVKEDKNWVDPYKASQRYRKTW  258
              +A+  DKNWVDP+K+ QR  + W
Sbjct  377   NKAIGADKNWVDPFKSDQRRIRKW  400



>ref|XP_006594618.1| PREDICTED: uncharacterized protein LOC100776750 isoform X7 [Glycine 
max]
Length=402

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 248/371 (67%), Positives = 290/371 (78%), Gaps = 5/371 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+ H GIQ+LGGS   R +  Q    G  +D+R EIRRQST+E +IFKERW EA+  DK
Sbjct  320   EYVFHQGIQTLGGSG-HRMTKKQ---GGVGIDVRTEIRRQSTWEFEIFKERWNEAIAADK  375

Query  305   NWVDPYKASQR  273
             NWVDP+K+ QR
Sbjct  376   NWVDPFKSDQR  386



>ref|XP_010268785.1| PREDICTED: uncharacterized protein LOC104605639 [Nelumbo nucifera]
Length=369

 Score =   517 bits (1332),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 242/369 (66%), Positives = 291/369 (79%), Gaps = 6/369 (2%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             MK + F+G+ C+ MLFI+YR T YQ+Q  EME +  P  + ++  V     + LPRGI++
Sbjct  1     MKQLPFMGMVCMVMLFIVYRMTNYQFQHTEMEDRLHPFGNIKEPQVASMKMNYLPRGIVQ  60

Query  1187  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
             S SD+E+KPL   S S+ KV V    +LLA+P GIKQK NV+ I+QKF+SENFTIILFHY
Sbjct  61    SSSDMEMKPLWLTSSSRLKVKVPKNKSLLAIPAGIKQKQNVDAIVQKFISENFTIILFHY  120

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DGNVDGW DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP 
Sbjct  121   DGNVDGWRDLEWSNKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPG  180

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  648
             RYL+I+KSE LEISQPALDP S  IHHRIT+R R+   HRRVY  +GS KCS+ SEGPPC
Sbjct  181   RYLKIMKSENLEISQPALDPNSSDIHHRITIRKRSKIVHRRVYDSRGSVKCSDASEGPPC  240

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
             +G+VEGMAPVFSR AWRCVW+LIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSE++ H 
Sbjct  241   TGWVEGMAPVFSRYAWRCVWNLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEFIFHK  300

Query  467   GIQSLGGSSLKRASS------PQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             GIQ+LGGSS ++ S+        +     AVD+R EIRRQST ELQIF +RW+ A++EDK
Sbjct  301   GIQTLGGSSARKVSNNIHHEESMQRRGAAAVDVRSEIRRQSTSELQIFGQRWDHAIREDK  360

Query  305   NWVDPYKAS  279
             +WVDP++ S
Sbjct  361   DWVDPFQRS  369



>ref|XP_006597401.1| PREDICTED: uncharacterized protein LOC100778191 isoform X1 [Glycine 
max]
 ref|XP_006597402.1| PREDICTED: uncharacterized protein LOC100778191 isoform X2 [Glycine 
max]
 ref|XP_006597403.1| PREDICTED: uncharacterized protein LOC100778191 isoform X3 [Glycine 
max]
 ref|XP_006597404.1| PREDICTED: uncharacterized protein LOC100778191 isoform X4 [Glycine 
max]
Length=412

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 248/384 (65%), Positives = 296/384 (77%), Gaps = 11/384 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSS--------LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
             EY+ H GIQ+LGGS         L+R +  ++   G  +D+R EIRRQST+E +IFKERW
Sbjct  320   EYVFHKGIQTLGGSGHRMTKVSKLQRTTMQKQ--GGVGIDVRTEIRRQSTWEFEIFKERW  377

Query  329   EEAVKEDKNWVDPYKASQRYRKTW  258
              +A+  DKNWVDP+K+ QR  + W
Sbjct  378   NKAIGADKNWVDPFKSDQRRIRKW  401



>ref|XP_004158032.1| PREDICTED: uncharacterized protein LOC101230572 [Cucumis sativus]
Length=410

 Score =   519 bits (1336),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 246/373 (66%), Positives = 291/373 (78%), Gaps = 4/373 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+G+ C  MLFI+YRTT YQY Q ++E+   P  +A+D     ++ + L
Sbjct  21    GKYGFKMKQLPFMGVICSVMLFIIYRTTNYQYLQTKIETALQPFDTAKDYPEESQNLNGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK+NVN I+QKF+ ENFT
Sbjct  81    PRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKENVNSIVQKFIPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRITVR+RT K HRRVY  +G+ KCS+E
Sbjct  201   EHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITVRARTKKIHRRVYDLRGNVKCSDE  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++DS
Sbjct  261   SEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDS  320

Query  485   EYLVHLGIQSLGGSSLK----RASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +Y+VH GIQ+LGG   K    +A+   +       D+R EIRRQST+ELQIFKERW +AV
Sbjct  321   QYIVHKGIQTLGGGGTKSKPSKAAGYAKKQNPIPSDVRTEIRRQSTWELQIFKERWNKAV  380

Query  317   KEDKNWVDPYKAS  279
              ED +WVDP+K +
Sbjct  381   AEDLSWVDPFKTN  393



>gb|EYU43400.1| hypothetical protein MIMGU_mgv1a022983mg [Erythranthe guttata]
Length=377

 Score =   515 bits (1326),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 252/371 (68%), Positives = 287/371 (77%), Gaps = 30/371 (8%)
 Frame = -3

Query  1379  CRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPR  1200
             C  KMK + F+G+ C  MLFI+YRTT YQ+QQ E        Y  ED+  TG +S  LPR
Sbjct  25    CGAKMKQLPFMGVVCTVMLFIIYRTTNYQHQQTE--------YIGEDT--TGLNS--LPR  72

Query  1199  GIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTII  1020
             GIIE++SDL+LKPL   S SKS++NV    NLLAMPVGIKQK NV+ I+QKFL ENFTII
Sbjct  73    GIIEAKSDLDLKPLWTTSSSKSQINVRSSSNLLAMPVGIKQKQNVDTIVQKFLPENFTII  132

Query  1019  LFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVEN  840
             LFHYDGNV+GW DL WS+EA+HIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV N
Sbjct  133   LFHYDGNVNGWSDLEWSREAVHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVNN  192

Query  839   FHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESE  660
             FHP RYLEIVKSEGLEISQPALDP S GIHHRITVR RT  FHRRVY  +GSTKC ++SE
Sbjct  193   FHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITVRKRTKIFHRRVYDYRGSTKCLDDSE  252

Query  659   GPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEY  480
             GP C+GFVEGMAPVFS+SAW+C WHLIQNDLVHGWGMD+KLGYCAQGD T  VG+VDSEY
Sbjct  253   GPSCTGFVEGMAPVFSKSAWQCAWHLIQNDLVHGWGMDIKLGYCAQGDPTKKVGVVDSEY  312

Query  479   LVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             ++H  IQ+LGG S  +                  IRRQST ELQ FKERWE AV EDK W
Sbjct  313   VLHQSIQTLGGPSATK------------------IRRQSTIELQKFKERWERAVDEDKKW  354

Query  299   VDPYKASQRYR  267
             VDP+  +++ +
Sbjct  355   VDPFPLTRKRK  365



>ref|XP_010696585.1| PREDICTED: uncharacterized protein LOC104909088 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   515 bits (1326),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 247/397 (62%), Positives = 303/397 (76%), Gaps = 16/397 (4%)
 Frame = -3

Query  1397  VGLEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRS  1218
              G  G    +M+ + F+G  C++M+FI+YRTT YQYQQ E+++K  P  S E+S      
Sbjct  22    AGPHGAHGFRMRQLAFMGFVCIAMMFIVYRTTNYQYQQTEIDAKRHPFDSIENSRTL--E  79

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
              + LP+GII++RSDLELKPL   S ++ KV+ +  HNLLA+  GIKQK NV+ I QKFL+
Sbjct  80    LNRLPQGIIQARSDLELKPL--WSRTRDKVDDSTNHNLLAIAAGIKQKHNVDSIAQKFLA  137

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
             ENFTI+LFHYDGN++ WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDYIFLWDE
Sbjct  138   ENFTIMLFHYDGNMNSWWDLDWSNKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYIFLWDE  197

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV +FHP RYL+IVK+E  +ISQPALD  S  IHHRIT+R +T  +HRR+Y  +G TK
Sbjct  198   DLGVRHFHPGRYLKIVKAERFDISQPALDSNSTEIHHRITIRKKTKMYHRRIYDSRGFTK  257

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C++ S GPPC+G+VEGMAPVFSRSAWRC WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG
Sbjct  258   CTSSSMGPPCTGWVEGMAPVFSRSAWRCAWHLIQNDLVHGWGLDMKLGYCAQGDRTKRVG  317

Query  497   IVDSEYLVHLGIQSLGGSSLKRA-SSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEA  321
             I+DSEY+VH GIQ+LGG+S K+  +    L K   VD R  IRRQST+EL++FKERWE+A
Sbjct  318   IIDSEYVVHQGIQTLGGASAKKVLNKDGSLKKRSGVDHRAWIRRQSTWELEVFKERWEKA  377

Query  320   VKEDKNWVDPYKASQRYRKTWNYW*NLKPIFINTQKI  210
             VKED +W+DPY          N W N   IF  T+KI
Sbjct  378   VKEDTSWIDPYSR--------NSWFN---IFARTRKI  403



>ref|XP_007148219.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20213.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
Length=400

 Score =   511 bits (1317),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 246/371 (66%), Positives = 293/371 (79%), Gaps = 4/371 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    K+K + F+ L C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKIKQLPFMALLCTVMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII + SDLEL+PL + S S+SK +V+   NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHADSDLELRPLWSRSSSRSKASVSSNRNLLAVPVGIKQKQNVDVMVQKFLRENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDG VDGW +L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGTVDGWLNLGWSSQAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVEIIKQEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDS  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT NVG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRAAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKNVGVVDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY+ H GIQ+LGGS   R +  Q    G  +D+R EIRRQST+E ++FKERW EA+ +DK
Sbjct  321   EYVFHKGIQTLGGSG-HRMTKRQS---GTGIDVRTEIRRQSTWEFEMFKERWNEAISQDK  376

Query  305   NWVDPYKASQR  273
             NWVDP+K+ QR
Sbjct  377   NWVDPFKSDQR  387



>ref|XP_007148218.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 ref|XP_007148220.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20212.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20214.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
Length=407

 Score =   511 bits (1317),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 245/374 (66%), Positives = 294/374 (79%), Gaps = 3/374 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    K+K + F+ L C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKIKQLPFMALLCTVMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII + SDLEL+PL + S S+SK +V+   NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHADSDLELRPLWSRSSSRSKASVSSNRNLLAVPVGIKQKQNVDVMVQKFLRENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDG VDGW +L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGTVDGWLNLGWSSQAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVEIIKQEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDS  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT NVG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRAAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKNVGVVDS  320

Query  485   EYLVHLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVK  315
             EY+ H GIQ+LGGS     K ++   +   G  +D+R EIRRQST+E ++FKERW EA+ 
Sbjct  321   EYVFHKGIQTLGGSGHRMTKVSNLHSKRQSGTGIDVRTEIRRQSTWEFEMFKERWNEAIS  380

Query  314   EDKNWVDPYKASQR  273
             +DKNWVDP+K+ QR
Sbjct  381   QDKNWVDPFKSDQR  394



>ref|XP_006583798.1| PREDICTED: uncharacterized protein LOC100792028 isoform X1 [Glycine 
max]
 ref|XP_006583799.1| PREDICTED: uncharacterized protein LOC100792028 isoform X2 [Glycine 
max]
 ref|XP_006583800.1| PREDICTED: uncharacterized protein LOC100792028 isoform X3 [Glycine 
max]
 ref|XP_006583801.1| PREDICTED: uncharacterized protein LOC100792028 isoform X4 [Glycine 
max]
Length=388

 Score =   511 bits (1315),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 239/375 (64%), Positives = 295/375 (79%), Gaps = 4/375 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G   +KMK + F+ + C+ MLF++YRT  YQ  Q E++ + +     + S  T  +   L
Sbjct  2     GKSSLKMKQLPFMAVVCIVMLFVVYRTLKYQSYQEEIDKQWNFREDEKASSETSGNLKGL  61

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII++ SD EL+PL + S  +SKV+V    NLLA+PVGIKQK NV+ ++QKFL +NFT
Sbjct  62    PRGIIQATSDFELRPLWSPSSLRSKVSVYSNRNLLAVPVGIKQKHNVDAMVQKFLPDNFT  121

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYD N+DGWWDL W+ +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  122   IILFHYDANMDGWWDLNWTSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  181

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +GST+CS  
Sbjct  182   EHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGSTRCSEA  241

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+K+GYCAQGDRT NVG+VDS
Sbjct  242   SKGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDIKIGYCAQGDRTQNVGVVDS  301

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPKG--RAVDLRVEIRRQSTYELQIFKERWEEAV  318
             EY+VH  IQ+LGGS    K ++  +  PK    A D RVEIRRQST+EL++FKERW  A+
Sbjct  302   EYVVHKAIQTLGGSDDPTKVSNRQRTTPKHGVAAFDQRVEIRRQSTWELEVFKERWNRAI  361

Query  317   KEDKNWVDPYKASQR  273
              EDKNWV+P+K+ ++
Sbjct  362   AEDKNWVNPFKSDKK  376



>gb|KHN07305.1| hypothetical protein glysoja_027395 [Glycine soja]
Length=385

 Score =   510 bits (1314),  Expect = 1e-174, Method: Compositional matrix adjust.
 Identities = 237/372 (64%), Positives = 292/372 (78%), Gaps = 5/372 (1%)
 Frame = -3

Query  1388  EGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSS  1209
             +G   +KMK + F+ + C+ MLF++YRT  YQ  Q E++ + +     + S  T  +   
Sbjct  7     QGKSSLKMKQLPFMAVVCIVMLFVVYRTLKYQSYQEEIDKQWNFREDEKASSETSGNLKG  66

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             LPRGII++ SD EL+PL + S  +SKV+V    NLLA+PVGIKQK NV+ ++QKFL +NF
Sbjct  67    LPRGIIQATSDFELRPLWSPSSLRSKVSVYSNRNLLAVPVGIKQKHNVDAMVQKFLPDNF  126

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
             TIILFHYD N+DGWWDL W+ +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLG
Sbjct  127   TIILFHYDANMDGWWDLNWTSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLG  186

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  669
             VE+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +GST+CS 
Sbjct  187   VEHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGSTRCSE  246

Query  668   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  489
              S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+K+GYCAQGDRT NVG+VD
Sbjct  247   ASKGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDIKIGYCAQGDRTQNVGVVD  306

Query  488   SEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKED  309
             SEY+VH  IQ+LGGS       P +     A D RVEIRRQST+EL++FKERW  A+ ED
Sbjct  307   SEYVVHKAIQTLGGS-----DDPTKKHGVAAFDQRVEIRRQSTWELEVFKERWNRAIAED  361

Query  308   KNWVDPYKASQR  273
             KNWV+P+K+ ++
Sbjct  362   KNWVNPFKSDKK  373



>ref|XP_008442108.1| PREDICTED: uncharacterized protein LOC103486065 [Cucumis melo]
 ref|XP_008442114.1| PREDICTED: uncharacterized protein LOC103486065 [Cucumis melo]
Length=409

 Score =   508 bits (1308),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 242/373 (65%), Positives = 287/373 (77%), Gaps = 4/373 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q ++E+   P  + ++      + + L
Sbjct  21    GKYGFKMKQLPFMAVICSVMLFIVYRTTNYQYLQTKIETTLLPFDTTKEFPEESLNLNGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK NVN I+QKF+  NFT
Sbjct  81    PRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKKNVNSIVQKFIPANFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRIT+R+RT K HRRVY  +G+ KCS+E
Sbjct  201   EHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITIRARTKKIHRRVYDLRGNVKCSDE  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++DS
Sbjct  261   SEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDS  320

Query  485   EYLVHLGIQSLGGSSLK----RASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +Y+VH GIQ+LGG   K    +A+   +       D+R EIRRQST+ELQIFKERW +AV
Sbjct  321   QYIVHKGIQTLGGGGTKSKPSKAAGYAKKHSPIPGDVRTEIRRQSTWELQIFKERWNKAV  380

Query  317   KEDKNWVDPYKAS  279
              EDK+WVDP+K +
Sbjct  381   AEDKSWVDPFKPN  393



>ref|XP_004485727.1| PREDICTED: uncharacterized protein LOC101506019 isoform X1 [Cicer 
arietinum]
 ref|XP_004485728.1| PREDICTED: uncharacterized protein LOC101506019 isoform X2 [Cicer 
arietinum]
 ref|XP_004485729.1| PREDICTED: uncharacterized protein LOC101506019 isoform X3 [Cicer 
arietinum]
 ref|XP_004485730.1| PREDICTED: uncharacterized protein LOC101506019 isoform X4 [Cicer 
arietinum]
 ref|XP_004485731.1| PREDICTED: uncharacterized protein LOC101506019 isoform X5 [Cicer 
arietinum]
Length=403

 Score =   502 bits (1293),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 242/377 (64%), Positives = 287/377 (76%), Gaps = 6/377 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       E    T      L
Sbjct  21    GKSSFKMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKTEAYSATSVKLRGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAVPVGIKQKHNVDVMVQKFLRENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGW  L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWLSLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY++IVK EGLEISQPALDP S  IHHRIT+R+R  + HRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITIRARNKQVHRRVYERRGSTRCSDA  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVVDS  320

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPK------GRAVDLRVEIRRQSTYELQIFKERWEE  324
             +Y+VH GIQ+LGGS    A+   +L K      G  +D+R EIRRQST+EL++FKERW +
Sbjct  321   QYVVHKGIQTLGGSDDHGATKVTKLKKTTTKQGGAPIDVRTEIRRQSTWELEVFKERWNQ  380

Query  323   AVKEDKNWVDPYKASQR  273
             A+ +D+ WVDP+K   R
Sbjct  381   AIAKDRYWVDPFKRHMR  397



>ref|XP_003541558.1| PREDICTED: uncharacterized protein LOC100807744 isoform X1 [Glycine 
max]
 ref|XP_006594339.1| PREDICTED: uncharacterized protein LOC100807744 isoform X2 [Glycine 
max]
 ref|XP_006594340.1| PREDICTED: uncharacterized protein LOC100807744 isoform X3 [Glycine 
max]
Length=388

 Score =   500 bits (1287),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 233/375 (62%), Positives = 294/375 (78%), Gaps = 4/375 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G   +KM  + F+ + C+ MLF++YRT  YQ  Q +++ + +     +    T  +   L
Sbjct  2     GKSSLKMTQLPFMAVVCIVMLFVVYRTLKYQSYQEQIDKQWNIREEEKAYTETSGNLKGL  61

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P+GII++ SDLEL+ L + S  +SK +V    NLLA+ VGIKQK NV+ ++QKFL +NFT
Sbjct  62    PQGIIQATSDLELRRLWSPSNLRSKASVYSNRNLLAVAVGIKQKHNVDVMVQKFLPDNFT  121

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYD N+DGWWDL+WS +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  122   IILFHYDANLDGWWDLSWSSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  181

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +G+TKCS+ 
Sbjct  182   EHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGNTKCSDA  241

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMK+GYCAQG+RT NVG+VDS
Sbjct  242   SKGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDMKVGYCAQGERTQNVGVVDS  301

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPK--GRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             E++VH GIQ+LGGS    K +S  ++ P+    A D RVEIRRQST+EL++F ERW  A+
Sbjct  302   EFVVHKGIQTLGGSDDPTKVSSQKRKTPRHGAAAFDQRVEIRRQSTWELEVFNERWNRAI  361

Query  317   KEDKNWVDPYKASQR  273
              EDKNWV+P+K+ ++
Sbjct  362   AEDKNWVNPFKSDKK  376



>ref|XP_002521414.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40904.1| conserved hypothetical protein [Ricinus communis]
Length=358

 Score =   499 bits (1284),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 236/346 (68%), Positives = 276/346 (80%), Gaps = 4/346 (1%)
 Frame = -3

Query  1316  LYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISK  1137
             L RTT+YQ+Q  +ME+K  P  + +DS +       LP GII + SDLE+KPL + S S+
Sbjct  4     LIRTTMYQFQHTQMEAKVHPFGTLKDSALASGLLGGLPVGIIRASSDLEMKPLWSSSSSR  63

Query  1136  SKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAI  957
              KV+ +   NLLA+PVGI QK NV+ I+QKFL ENFT+ILFHYDG++DGWWDL WSKEAI
Sbjct  64    LKVDTSMRRNLLAIPVGINQKHNVDTIVQKFLPENFTVILFHYDGHLDGWWDLEWSKEAI  123

Query  956   HIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPA  777
             HIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLGV++F P RYL IV+SEGLEISQPA
Sbjct  124   HIVAQNQTKWWFAKRFLHPAVVSTYDYIFLWDEDLGVKHFDPGRYLRIVRSEGLEISQPA  183

Query  776   LDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWR  597
             LDP S  IHHRIT+RSRT +FHRRVY  +GSTKCS++SEGPPC+GFVEGMAPVFSR+AW 
Sbjct  184   LDPNSTDIHHRITIRSRTKRFHRRVYDKRGSTKCSDDSEGPPCTGFVEGMAPVFSRAAWY  243

Query  596   CVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQ  417
             C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+VH GIQ+LGG          
Sbjct  244   CAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIVHQGIQTLGGGGPPGKKRYG  303

Query  416   ELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
                    +D R EIRRQST+ELQIFKERW EAVKED++WVDP++ S
Sbjct  304   T----STMDSRTEIRRQSTWELQIFKERWNEAVKEDEDWVDPFRGS  345



>ref|XP_004504995.1| PREDICTED: uncharacterized protein LOC101512967 [Cicer arietinum]
Length=382

 Score =   499 bits (1285),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 243/375 (65%), Positives = 289/375 (77%), Gaps = 12/375 (3%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQY--QQAEMESKSDPLYSAEDSCVTGRSSS  1212
             G   +K+K + F+ + C  MLF++YRT  YQY  +QAE++ K       E          
Sbjct  2     GKSSLKIKRLPFMAVACTVMLFVVYRTLKYQYNQEQAEIDKKWSIWGEVEPYNSHSGKLK  61

Query  1211  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LPRGII++ SD EL+PL + S  +SKVNV    +LLA+PVGIKQK NV+ ++QKFL+ N
Sbjct  62    GLPRGIIDATSDFELRPLWSPSNLRSKVNVYSDRSLLAVPVGIKQKHNVDAMVQKFLTGN  121

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FTIILFHYD NVDGW DL WS +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDL
Sbjct  122   FTIILFHYDANVDGWLDLDWSGKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDL  181

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVE F P+RY+EIVK EGLEISQPALDP S  IHHRIT+R+RT K HRRVY+ +G T+CS
Sbjct  182   GVEYFSPSRYIEIVKEEGLEISQPALDPDSTEIHHRITIRARTKKVHRRVYELRGKTRCS  241

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             +ES+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+ NVG+V
Sbjct  242   DESDGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRSQNVGVV  301

Query  491   DSEYLVHLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEA  321
             DSEY+VH GI +LGGSS    KR  S        AVD R EIRRQST+EL+IFKERW +A
Sbjct  302   DSEYIVHKGIPTLGGSSHDTTKRHGST-------AVDQRTEIRRQSTWELEIFKERWNQA  354

Query  320   VKEDKNWVDPYKASQ  276
             + ED++WV+P K+ Q
Sbjct  355   IAEDRSWVNPSKSDQ  369



>ref|XP_004485732.1| PREDICTED: uncharacterized protein LOC101506019 isoform X6 [Cicer 
arietinum]
Length=377

 Score =   499 bits (1284),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 240/371 (65%), Positives = 285/371 (77%), Gaps = 6/371 (2%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             MK + F+ + C  MLFI+YRTT YQY Q E++ K       E    T      LPRGII+
Sbjct  1     MKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKTEAYSATSVKLRGLPRGIIQ  60

Query  1187  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
               SDLEL+PL   S S+SK       NLLA+PVGIKQK NV+ ++QKFL ENFTIILFHY
Sbjct  61    DSSDLELRPLWLRSNSRSKSRDYSNRNLLAVPVGIKQKHNVDVMVQKFLRENFTIILFHY  120

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DGNVDGW  L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGVE+F P+
Sbjct  121   DGNVDGWLSLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGVEHFSPS  180

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  648
             RY++IVK EGLEISQPALDP S  IHHRIT+R+R  + HRRVY+ +GST+CS+ SEGPPC
Sbjct  181   RYVKIVKEEGLEISQPALDPNSTEIHHRITIRARNKQVHRRVYERRGSTRCSDASEGPPC  240

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
             +GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+VDS+Y+VH 
Sbjct  241   TGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVVDSQYVVHK  300

Query  467   GIQSLGGSSLKRASSPQELPK------GRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             GIQ+LGGS    A+   +L K      G  +D+R EIRRQST+EL++FKERW +A+ +D+
Sbjct  301   GIQTLGGSDDHGATKVTKLKKTTTKQGGAPIDVRTEIRRQSTWELEVFKERWNQAIAKDR  360

Query  305   NWVDPYKASQR  273
              WVDP+K   R
Sbjct  361   YWVDPFKRHMR  371



>ref|XP_007159269.1| hypothetical protein PHAVU_002G223800g [Phaseolus vulgaris]
 gb|ESW31263.1| hypothetical protein PHAVU_002G223800g [Phaseolus vulgaris]
Length=390

 Score =   499 bits (1285),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 236/373 (63%), Positives = 291/373 (78%), Gaps = 5/373 (1%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G   +KMK + F+ + C  MLF++YRT  YQY Q E++ K   L        T  +   L
Sbjct  2     GKSILKMKQLPFMIVVCTVMLFVVYRTLKYQYYQEEIDKKWSILEEDRPYPDTSGNLKGL  61

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII+  SDLE +PL + S  +SK +V  + NLLA+PVG+KQK NV+ ++QKFL ENFT
Sbjct  62    PRGIIQDTSDLEFRPLWSPSNLRSKASVYSHRNLLAIPVGMKQKHNVDAMVQKFLPENFT  121

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYD N+DGWWDL WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  122   IILFHYDANLDGWWDLKWSSKAIHIIAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  181

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +G+T+CS  
Sbjct  182   EHFSPSRYIEIVKEEGLEISQPALDPDSTEIHHRITVRARTKKVHRRVYELRGNTRCSES  241

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMK+GYCAQGDRT NVG+VD 
Sbjct  242   SKGPPCTGFVEGMAPVFSRSAWDCTWHLIQNDLVHGWGVDMKIGYCAQGDRTKNVGVVDR  301

Query  485   EYLVHLGIQSLGGS---SLKRASSPQELPK--GRAVDLRVEIRRQSTYELQIFKERWEEA  321
             EY+VH GIQ+LGGS   ++K  +  +  P+    A D RVEIRRQST+ELQ+F++RW+ A
Sbjct  302   EYVVHKGIQTLGGSGDETVKIFNRRRPTPRHGASAFDERVEIRRQSTWELQVFEDRWKRA  361

Query  320   VKEDKNWVDPYKA  282
             + ED +WV+P+ +
Sbjct  362   ITEDLSWVNPFNS  374



>ref|XP_009104492.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104501.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104508.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104517.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104525.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104533.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104541.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104548.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104556.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
Length=428

 Score =   499 bits (1286),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 240/371 (65%), Positives = 281/371 (76%), Gaps = 7/371 (2%)
 Frame = -3

Query  1391  LEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS  1212
             L+G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S        
Sbjct  26    LQGKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLK  83

Query  1211  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNVN ++QKFL  N
Sbjct  84    GLPFGIIQPRSDLELKPLWSSTSLRSKGGELTNRNLLAMPVGLKQKDNVNAVVQKFLPAN  143

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT+ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDL
Sbjct  144   FTVILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDL  203

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENF+P +YL+IVK  GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCS
Sbjct  204   GVENFNPQKYLKIVKKAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCS  263

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             N SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIV
Sbjct  264   NTSEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIV  323

Query  491   DSEYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWE  327
             DSEY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+EL+ FKERW 
Sbjct  324   DSEYIFHQGIQTLGGSGYPDKKNSARSGVTRRRGSATFDSRTEIRRQSTWELRTFKERWN  383

Query  326   EAVKEDKNWVD  294
              AV+EDKNW+D
Sbjct  384   RAVEEDKNWID  394



>gb|KHG08288.1| hypothetical protein F383_16150 [Gossypium arboreum]
Length=371

 Score =   496 bits (1278),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/338 (68%), Positives = 272/338 (80%), Gaps = 1/338 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C  KM+ + F+G+ C  MLFI+YRTT YQY + EME++  P  + +D  +       L
Sbjct  21    GNCGFKMRQLPFMGVICTVMLFIVYRTTDYQYHKTEMETRFHPFATVKDYHLHLGKLRGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI+++RSDLEL+PL + S S+SK +VT   NLLAMPVGIKQKD V+++++KFL+ NFT
Sbjct  81    PRGIMQARSDLELRPLWS-SNSQSKASVTTNKNLLAMPVGIKQKDYVDDVVKKFLAANFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWWDL W ++AIHIVAH+QTKWWFAKRFLHPD+VS+YDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWDLGWGEKAIHIVAHNQTKWWFAKRFLHPDIVSVYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRIT+R+RT KFHRR+Y  +G TKCSN 
Sbjct  200   EHFDPTRYLEIVKSEGLEISQPALDPNSTEIHHRITIRARTKKFHRRIYDLRGKTKCSNS  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDR+  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGVDMKLGYCAQGDRSKKVGVVDS  319

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIR  372
             EY+VH GIQSLGGS      +  +     + DLR E+R
Sbjct  320   EYIVHKGIQSLGGSGHPTMRTTMKRHGASSFDLRTEVR  357



>ref|XP_009104564.1| PREDICTED: uncharacterized protein LOC103830459 isoform X2 [Brassica 
rapa]
Length=425

 Score =   497 bits (1280),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 239/369 (65%), Positives = 279/369 (76%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNVN ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSTSLRSKGGELTNRNLLAMPVGLKQKDNVNAVVQKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL+IVK  GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLKIVKKAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCSNT  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+EL+ FKERW  A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSGVTRRRGSATFDSRTEIRRQSTWELRTFKERWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNW+D
Sbjct  383   VEEDKNWID  391



>emb|CDY03814.1| BnaC01g29310D [Brassica napus]
Length=425

 Score =   496 bits (1276),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 237/369 (64%), Positives = 280/369 (76%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSTSLRSKGGELTNRNLLAMPVGLKQKDNVDAVVQKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL+IVK+ GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLKIVKTAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCSNT  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ ++   + + R     D R EIRRQST+EL+ FKERW  A
Sbjct  323   EYIFHQGIQTLGGSGYPEKKNAARSGVTRRRGSATFDSRTEIRRQSTWELRTFKERWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNW+D
Sbjct  383   VEEDKNWID  391



>emb|CDY12891.1| BnaA09g13830D [Brassica napus]
Length=425

 Score =   496 bits (1276),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 239/369 (65%), Positives = 278/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK   F+ L C  +L   Y+TT  QY+Q + E    P   A++S         L
Sbjct  25    GKLSWKMK--PFMALMCTVLLIFWYKTTNIQYEQTQFEESDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + +  +SK       NLLA+PVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PYGIIQPRSDLELKPLWSSNTLRSKGGKLTNRNLLAIPVGLKQKDNVDALVQKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKAAGLEISQPALHPNSTEVHHRITVRSRTKVFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGR---AVDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R   A D R EIRRQST+ELQ FKERW  A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSVVNRRRGSPAFDSRTEIRRQSTWELQTFKERWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNWVD
Sbjct  383   VEEDKNWVD  391



>ref|XP_009113143.1| PREDICTED: uncharacterized protein LOC103838453 [Brassica rapa]
 ref|XP_009113144.1| PREDICTED: uncharacterized protein LOC103838453 [Brassica rapa]
Length=425

 Score =   495 bits (1274),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 238/369 (64%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK   F+ L C  +L   Y+TT  QY+Q + E    P   A++S         L
Sbjct  25    GKLSWKMK--PFMALMCTVLLIFWYKTTNIQYEQTQFEESDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + +  +SK       NLLA+PVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PYGIIQPRSDLELKPLWSSNTLRSKGGKLTNRNLLAIPVGLKQKDNVDALVQKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKAAGLEISQPALHPNSTEVHHRITVRSRTKVFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+ELQ FKERW  A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSGVSRRRGSPTFDSRTEIRRQSTWELQTFKERWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNWVD
Sbjct  383   VEEDKNWVD  391



>emb|CDY52220.1| BnaA01g35920D [Brassica napus]
Length=425

 Score =   495 bits (1274),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 238/369 (64%), Positives = 279/369 (76%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSTNLRSKGGELTNRNLLAMPVGLKQKDNVDAVVQKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL+IVK  GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLKIVKKAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCSNT  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+EL+ FKERW  A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSGVTRRRGSATFDSRTEIRRQSTWELRTFKERWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNW+D
Sbjct  383   VEEDKNWID  391



>ref|XP_010905352.1| PREDICTED: uncharacterized protein LOC105032557 isoform X2 [Elaeis 
guineensis]
 ref|XP_010905361.1| PREDICTED: uncharacterized protein LOC105032557 isoform X2 [Elaeis 
guineensis]
Length=379

 Score =   491 bits (1265),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 240/378 (63%), Positives = 285/378 (75%), Gaps = 16/378 (4%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYS--AEDSCVTGRSSSSLPRGI  1194
             MK   ++ + CV ML I Y TT +QYQQ E E++S P  S    +S +T      LPRGI
Sbjct  1     MKQKLYLSVLCVVMLCIFYTTTNFQYQQTEFEARSRPFDSDLMTESYMTTSRIGYLPRGI  60

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             + S SD+ELKPL     S+SK     + NLL +PVGIKQK NV+ I+ KFL ENFT+ILF
Sbjct  61    VHSNSDMELKPLWVTKNSESKEPDQSHQNLLGIPVGIKQKKNVDAIVSKFLPENFTVILF  120

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGW DL WS   IHI A +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH
Sbjct  121   HYDGNVDGWHDLHWSNSLIHIAAPNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  180

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYL+I+KSEGLEISQPALDPK   IHHRIT+R +  K HRRV+  +GS  CSN SEGP
Sbjct  181   PGRYLQIMKSEGLEISQPALDPKLSEIHHRITIRRKKGKVHRRVHGTRGSGYCSNASEGP  240

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+G+VEGMAPVFSR+AWRC W+LIQNDL+HGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  241   PCTGWVEGMAPVFSRAAWRCAWYLIQNDLIHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  300

Query  473   HLGIQSLGGSS-----LKRAS--SPQELPK------GRA-VDLRVEIRRQSTYELQIFKE  336
             H G+++LGGSS     ++R S  S + LPK      GR   D R+EIRRQ+  ELQ F+E
Sbjct  301   HQGVETLGGSSNEKKAVRRTSGRSKRLLPKATLQMRGRTPFDARIEIRRQAKSELQNFQE  360

Query  335   RWEEAVKEDKNWVDPYKA  282
             RW++A KEDK+WVDP++ 
Sbjct  361   RWDQAAKEDKDWVDPFRT  378



>ref|XP_006392027.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
 ref|XP_006392028.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
 gb|ESQ29313.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
 gb|ESQ29314.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
Length=425

 Score =   493 bits (1268),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 239/369 (65%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QYQQ E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYQQTELEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + S  +SK       NLLA+PVG+KQKDNV+ I++KFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSSSLRSKGGELTNRNLLAIPVGLKQKDNVDAIVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL IVKS GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKSAGLEISQPALHPNSTEVHHRITVRSRTKIFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQG R+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGARSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+ELQ FKERW  A
Sbjct  323   EYIFHQGIQTLGGSGYPEKKNSARSGVTRRRGSATFDSRTEIRRQSTWELQTFKERWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNW+D
Sbjct  383   VEEDKNWID  391



>emb|CDY40958.1| BnaCnng10010D [Brassica napus]
Length=425

 Score =   491 bits (1265),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 239/369 (65%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QY+Q E E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEFEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GII+ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSSTLRSKGGELMNRNLLAMPVGLKQKDNVDSLVQKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCS  
Sbjct  203   ENFNPQKYLRIVKAAGLEISQPALHPNSTEVHHRITVRSRTKVFHRRVYDSRGNMKCSIA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGR---AVDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R   A D R EIRRQST+ELQ FK+RW  A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSVVNRRRGSPAFDSRTEIRRQSTWELQTFKKRWNRA  382

Query  320   VKEDKNWVD  294
             V+EDKNWVD
Sbjct  383   VEEDKNWVD  391



>ref|XP_002889853.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66112.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   491 bits (1264),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 232/367 (63%), Positives = 279/367 (76%), Gaps = 4/367 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LP GII+ RSDL
Sbjct  37    FLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESETVNDKLKVLPHGIIQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL I
Sbjct  157   KWWDLDWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLRI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G  +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGHKRCSNTSADPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+VH GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIVHQGIQTL  336

Query  452   GGSSLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
             G S  ++ ++ +++   R      D R EIRRQST+ELQ FKERW +AV+ED NW+DP  
Sbjct  337   GESVPEKKTTARDVRPRRHGHTTFDSRTEIRRQSTWELQTFKERWSKAVEEDNNWIDPSS  396

Query  284   ASQRYRK  264
             +S   ++
Sbjct  397   SSSMTKR  403



>ref|XP_006301321.1| hypothetical protein CARUB_v10021730mg [Capsella rubella]
 gb|EOA34219.1| hypothetical protein CARUB_v10021730mg [Capsella rubella]
Length=425

 Score =   489 bits (1259),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 238/369 (64%), Positives = 279/369 (76%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P RYL+IVKS GLEISQPAL P S  +HHR+TVRSRT KFHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLKIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKKFHRRVYDSRGNMKCSNT  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGR---AVDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S    + + R   A D R EIRRQST+EL+ FKERW +A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSGRGGVTRKRGSAAFDSRTEIRRQSTWELRTFKERWNQA  382

Query  320   VKEDKNWVD  294
             V EDKNWVD
Sbjct  383   VAEDKNWVD  391



>ref|XP_010533870.1| PREDICTED: uncharacterized protein LOC104809554 [Tarenaya hassleriana]
 ref|XP_010533872.1| PREDICTED: uncharacterized protein LOC104809554 [Tarenaya hassleriana]
 ref|XP_010533873.1| PREDICTED: uncharacterized protein LOC104809554 [Tarenaya hassleriana]
Length=414

 Score =   488 bits (1257),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 238/366 (65%), Positives = 273/366 (75%), Gaps = 7/366 (2%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             KMK   F+ + C  +L + Y+TT  QY+Q EME +  PL  A++S         LP GI 
Sbjct  33    KMK--PFMAILCTVLLIVWYKTTNIQYEQTEMEEQDYPLEMAKESEPDNEWLKGLPLGIR  90

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
              SRSDLELKPL + S S+ K       NLLAMPVGI QKDNV+ ++QKFL  NFT+ILFH
Sbjct  91    HSRSDLELKPLWSRSSSRLKEGELTNRNLLAMPVGITQKDNVDTVVQKFLPSNFTVILFH  150

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG +D W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV+NF+P
Sbjct  151   YDGKMDNWSDLVWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVKNFNP  210

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  651
              RYL I+KSEGLEISQPALDP S  IHHRITVRSR+ + HRRVY  +G+ KCSN SEGPP
Sbjct  211   ERYLRIIKSEGLEISQPALDPNSTEIHHRITVRSRSKRVHRRVYDHRGNMKCSNASEGPP  270

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             C+GFVEGMAPVFSR+AW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDSEY+ H
Sbjct  271   CTGFVEGMAPVFSRAAWFCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGIVDSEYVFH  330

Query  470   LGIQSLGGSSLKRASS-----PQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
              GIQ+LGGS      +               D R EIRRQST+EL+ FKERW  AV+EDK
Sbjct  331   HGIQTLGGSGHPEKKTAARSVSSRRRGSATFDSRTEIRRQSTWELKAFKERWNRAVEEDK  390

Query  305   NWVDPY  288
             +WVDP+
Sbjct  391   SWVDPF  396



>ref|XP_006417384.1| hypothetical protein EUTSA_v10007686mg [Eutrema salsugineum]
 gb|ESQ35737.1| hypothetical protein EUTSA_v10007686mg [Eutrema salsugineum]
Length=432

 Score =   489 bits (1258),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 235/359 (65%), Positives = 272/359 (76%), Gaps = 5/359 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C  +L   Y+TT  Q++Q E+E    P   A +S         LPRGII+ RSDL
Sbjct  37    FLALMCTVLLIFWYKTTNIQFEQTELEEADYPFDMATESKTVDEKLKGLPRGIIQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLAMPVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSSSLRSKGVDMTNRNLLAMPVGIKQKVNVDAIVKKFLPANFTVVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV+NF P RYL+I
Sbjct  157   KWWDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVKNFSPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS+G EISQPALD  S  IHH+IT+RSRT KFHRRVY ++GS +CSN SE PPC+GFVE
Sbjct  217   VKSQGFEISQPALDSNSTEIHHKITLRSRTKKFHRRVYINRGSKRCSNASEDPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKKVGIVDSEYIFHQGIQTL  336

Query  452   GGS--SLKRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDP  291
             G S  S K+A++       R     D R  IRRQST+ELQ FKERW  AV+EDKNW+DP
Sbjct  337   GESVHSEKKATARDVGTSRRGHTTFDSRTSIRRQSTWELQTFKERWNRAVEEDKNWIDP  395



>ref|XP_010905328.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
 ref|XP_010905337.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
 ref|XP_010905342.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
 ref|XP_010905348.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
Length=382

 Score =   486 bits (1252),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 240/381 (63%), Positives = 285/381 (75%), Gaps = 19/381 (5%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYS--AEDSCVTGRSSSSLPRGI  1194
             MK   ++ + CV ML I Y TT +QYQQ E E++S P  S    +S +T      LPRGI
Sbjct  1     MKQKLYLSVLCVVMLCIFYTTTNFQYQQTEFEARSRPFDSDLMTESYMTTSRIGYLPRGI  60

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQK---FLSENFTI  1023
             + S SD+ELKPL     S+SK     + NLL +PVGIKQK NV+ I+ K   FL ENFT+
Sbjct  61    VHSNSDMELKPLWVTKNSESKEPDQSHQNLLGIPVGIKQKKNVDAIVSKGMQFLPENFTV  120

Query  1022  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  843
             ILFHYDGNVDGW DL WS   IHI A +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE
Sbjct  121   ILFHYDGNVDGWHDLHWSNSLIHIAAPNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  180

Query  842   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  663
             NFHP RYL+I+KSEGLEISQPALDPK   IHHRIT+R +  K HRRV+  +GS  CSN S
Sbjct  181   NFHPGRYLQIMKSEGLEISQPALDPKLSEIHHRITIRRKKGKVHRRVHGTRGSGYCSNAS  240

Query  662   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  483
             EGPPC+G+VEGMAPVFSR+AWRC W+LIQNDL+HGWGMDMKLGYCAQGDRT  VG++DSE
Sbjct  241   EGPPCTGWVEGMAPVFSRAAWRCAWYLIQNDLIHGWGMDMKLGYCAQGDRTKKVGVIDSE  300

Query  482   YLVHLGIQSLGGSS-----LKRAS--SPQELPK------GRA-VDLRVEIRRQSTYELQI  345
             Y+VH G+++LGGSS     ++R S  S + LPK      GR   D R+EIRRQ+  ELQ 
Sbjct  301   YIVHQGVETLGGSSNEKKAVRRTSGRSKRLLPKATLQMRGRTPFDARIEIRRQAKSELQN  360

Query  344   FKERWEEAVKEDKNWVDPYKA  282
             F+ERW++A KEDK+WVDP++ 
Sbjct  361   FQERWDQAAKEDKDWVDPFRT  381



>ref|XP_006307556.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
 gb|EOA40454.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
Length=438

 Score =   488 bits (1256),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 236/368 (64%), Positives = 277/368 (75%), Gaps = 5/368 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGIIE RSDL
Sbjct  37    FLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIEPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+ VGIKQK NVN I++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRSSLRSKGVEMTNRNLLAISVGIKQKGNVNAIVKKFLPANFTIVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY  +G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYIKRGTKRCSNSSADPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ + +   R      D R EIRRQST+ELQ FKERW +AV+EDKNW+DP 
Sbjct  337   GESVHPEKKTTSRNVGTKRQGHITFDSRTEIRRQSTWELQTFKERWNKAVEEDKNWIDPS  396

Query  287   KASQRYRK  264
              AS    K
Sbjct  397   AASSSMTK  404



>ref|XP_010473328.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
 ref|XP_010473329.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
 ref|XP_010473330.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
 ref|XP_010473331.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
Length=425

 Score =   487 bits (1253),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 237/369 (64%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+EL+ FKERW +A
Sbjct  323   EYIFHQGIQTLGGSGDPDKKNSARSGVTRKRGSPTFDSRTEIRRQSTWELRTFKERWNQA  382

Query  320   VKEDKNWVD  294
             V EDKNWVD
Sbjct  383   VAEDKNWVD  391



>ref|NP_172583.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL77664.1| At1g11170/T28P6_16 [Arabidopsis thaliana]
 gb|AAM70519.1| At1g11170/T28P6_16 [Arabidopsis thaliana]
 gb|AEE28693.1| uncharacterized protein AT1G11170 [Arabidopsis thaliana]
Length=438

 Score =   487 bits (1253),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/370 (62%), Positives = 280/370 (76%), Gaps = 4/370 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGII+SRSDL
Sbjct  37    FLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIQSRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL +    +SK       NLLA+PVG+KQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRGSLRSKGVEMTNRNLLAIPVGLKQKGNVDALVKKFLPANFTIVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              WWDL WS ++IHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWWDLEWSSKSIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G  +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSKTKKFHRRVYINRGHKRCSNTSSDPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY++H GIQ+L
Sbjct  277   GMAPVFSKAAWLCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYILHQGIQTL  336

Query  452   GGSSLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
             G S  ++  + +++   R      D R EIRRQST+ELQ FKERW +AV+ED  W+DP  
Sbjct  337   GESVPEKKKTARDVGTRRQGHTTFDSRTEIRRQSTWELQTFKERWSKAVEEDIKWIDPSS  396

Query  284   ASQRYRKTWN  255
             +S   ++  N
Sbjct  397   SSSMTKRKSN  406



>ref|XP_010418093.1| PREDICTED: uncharacterized protein LOC104703720 [Camelina sativa]
 ref|XP_010418094.1| PREDICTED: uncharacterized protein LOC104703720 [Camelina sativa]
Length=425

 Score =   486 bits (1250),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 236/369 (64%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMK+GYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKIGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+EL+ FKERW +A
Sbjct  323   EYIFHQGIQTLGGSGDPDKKNSARSGVTRKRGSPTFDSRTEIRRQSTWELRTFKERWNQA  382

Query  320   VKEDKNWVD  294
             V EDKNWVD
Sbjct  383   VAEDKNWVD  391



>ref|XP_010430128.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430129.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430130.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430131.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430132.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430133.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430134.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430135.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430136.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430137.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
Length=425

 Score =   485 bits (1249),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 236/369 (64%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + + C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MAVMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSS--LKRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+EL+ FKERW +A
Sbjct  323   EYIFHQGIQTLGGSGDPDKKNSARSGVTRKRGSPTFDSRTEIRRQSTWELRTFKERWNQA  382

Query  320   VKEDKNWVD  294
             V EDKNWVD
Sbjct  383   VAEDKNWVD  391



>ref|XP_002888096.1| hypothetical protein ARALYDRAFT_475199 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64355.1| hypothetical protein ARALYDRAFT_475199 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   485 bits (1249),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 237/369 (64%), Positives = 276/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--VVLMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P  YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQMYLRIVKTAGLEISQPALHPNSTEVHHRITVRSRTKIFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+ELQ FKERW +A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSRVNRRRGSATFDSRTEIRRQSTWELQAFKERWNQA  382

Query  320   VKEDKNWVD  294
             V EDKNW D
Sbjct  383   VAEDKNWAD  391



>ref|XP_010458502.1| PREDICTED: uncharacterized protein LOC104739751 isoform X3 [Camelina 
sativa]
Length=406

 Score =   483 bits (1244),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 275/363 (76%), Gaps = 5/363 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q++Q E+E    P   A +S         LP+GII+ RSDL
Sbjct  4     FIALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMATESEAVNDKLKGLPQGIIQPRSDL  63

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  64    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  123

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  124   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  183

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  184   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  243

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  244   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  303

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ +++   R      D R EIRRQST+ELQ FKERW  AV EDKNW+DP 
Sbjct  304   GESVHSEKKTTARDVGTKRQGHTTFDSRTEIRRQSTWELQTFKERWNRAVDEDKNWIDPS  363

Query  287   KAS  279
              +S
Sbjct  364   ASS  366



>ref|XP_010492476.1| PREDICTED: uncharacterized protein LOC104769846 isoform X2 [Camelina 
sativa]
 ref|XP_010492484.1| PREDICTED: uncharacterized protein LOC104769846 isoform X2 [Camelina 
sativa]
Length=404

 Score =   483 bits (1243),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 278/363 (77%), Gaps = 5/363 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q+++ E+E    P   A +S         LP+GII+ RSDL
Sbjct  4     FIALMCTALLIFWYKTTNIQFERTEIEETDYPFDMATESEGIDNKLKGLPQGIIQPRSDL  63

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  64    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNMD  123

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DLAWS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  124   KWRDLAWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  183

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  184   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  243

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  244   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  303

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ +++   R      D R EIRRQST+ELQ FKERW  AV+EDKNW+DP 
Sbjct  304   GESVHSEKKTTARDVGTKRQGHTTFDSRTEIRRQSTWELQTFKERWNRAVEEDKNWIDPS  363

Query  287   KAS  279
              +S
Sbjct  364   ASS  366



>gb|KDP20910.1| hypothetical protein JCGZ_21381 [Jatropha curcas]
Length=349

 Score =   481 bits (1237),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/339 (68%), Positives = 268/339 (79%), Gaps = 5/339 (1%)
 Frame = -3

Query  1277  MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLA  1098
             ME K  P  +  +S +     + LP GI+ + SDLELKPL + S S+SKV+      LLA
Sbjct  1     MEEKMHPFDTLTESALATGLLAGLPAGIVRATSDLELKPLWSSSNSRSKVDTRSSRYLLA  60

Query  1097  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  918
             +PVGI+QK NV+ ++QKFL ENFT+ILFHYDGN+DGWWDL WS +AIHIVA +QTKWWFA
Sbjct  61    VPVGIRQKHNVDAMVQKFLPENFTVILFHYDGNMDGWWDLNWSDKAIHIVAQNQTKWWFA  120

Query  917   KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRIT  738
             KRFLHP VVSIYDY+FLWDEDLGVE F P RYLEIVKS GLEISQPAL P S GIHHRIT
Sbjct  121   KRFLHPAVVSIYDYVFLWDEDLGVEKFDPRRYLEIVKSRGLEISQPALGPNSTGIHHRIT  180

Query  737   VRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  558
             +RSR+ ++H RVY  +GSTKCS+ S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHG
Sbjct  181   IRSRSKEYHTRVYDHRGSTKCSDVSQGPPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHG  240

Query  557   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL--GGSSLKRASSPQELPK---GRAV  393
             WGMDMKLGYCAQGDRT  VGIVD EY+VH GIQ+L  GGS  K+ S+ +EL K       
Sbjct  241   WGMDMKLGYCAQGDRTKKVGIVDREYIVHQGIQTLGGGGSPTKKGSNSEELTKRHGASVT  300

Query  392   DLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
             D R+EIRRQST+ELQIFKERW +AV  D++W DP+K S+
Sbjct  301   DPRMEIRRQSTWELQIFKERWNKAVNGDRHWFDPFKGSE  339



>ref|XP_010458500.1| PREDICTED: uncharacterized protein LOC104739751 isoform X1 [Camelina 
sativa]
Length=439

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 275/363 (76%), Gaps = 5/363 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q++Q E+E    P   A +S         LP+GII+ RSDL
Sbjct  37    FIALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMATESEAVNDKLKGLPQGIIQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  97    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ +++   R      D R EIRRQST+ELQ FKERW  AV EDKNW+DP 
Sbjct  337   GESVHSEKKTTARDVGTKRQGHTTFDSRTEIRRQSTWELQTFKERWNRAVDEDKNWIDPS  396

Query  287   KAS  279
              +S
Sbjct  397   ASS  399



>ref|XP_008809916.1| PREDICTED: uncharacterized protein LOC103721469 [Phoenix dactylifera]
 ref|XP_008809917.1| PREDICTED: uncharacterized protein LOC103721469 [Phoenix dactylifera]
Length=379

 Score =   482 bits (1240),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 238/378 (63%), Positives = 283/378 (75%), Gaps = 16/378 (4%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYS--AEDSCVTGRSSSSLPRGI  1194
             MK   ++ +  V ML I Y TT +QYQQ E E++S P  S    +S +T      LPRGI
Sbjct  1     MKQKLYLSVLSVVMLCIFYTTTNFQYQQTEFEARSHPFDSDLLMESDMTTSRIGYLPRGI  60

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             + S SD+ELKPL     S SK     + NLLA+PVGIKQK NV+ I+ KFL ENFT+ILF
Sbjct  61    VHSNSDMELKPLWVTKNSGSKELDQSHQNLLAIPVGIKQKKNVDAIVLKFLPENFTVILF  120

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGW DL WS   IHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGV NFH
Sbjct  121   HYDGNVDGWHDLHWSNSVIHIAAPNQTKWWFAKRFLHPDVVSTYDYIFLWDEDLGVANFH  180

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYL+I+KSEGLEISQPALDPK   IHHRIT+R +  K HRRVY  +GS  CS+ SEGP
Sbjct  181   PGRYLQIMKSEGLEISQPALDPKLSEIHHRITIRRKKGKVHRRVYGTRGSGYCSSASEGP  240

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+G+VEGMAPVFSR+AWRC W+LIQNDL+HGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  241   PCTGWVEGMAPVFSRAAWRCAWYLIQNDLIHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  300

Query  473   HLGIQSLGGSS-----LKRAS--SPQELPK------GRA-VDLRVEIRRQSTYELQIFKE  336
             H G+++LGGSS     + RAS  S + +PK      GR   D R+EIRR+S  ELQ F+E
Sbjct  301   HQGVETLGGSSSEKKAVGRASGRSKRLIPKATLQKRGRTPFDARIEIRRRSKAELQNFQE  360

Query  335   RWEEAVKEDKNWVDPYKA  282
             RW++A KEDK+WVDP+++
Sbjct  361   RWDQAAKEDKDWVDPFQS  378



>ref|XP_010492461.1| PREDICTED: uncharacterized protein LOC104769846 isoform X1 [Camelina 
sativa]
 ref|XP_010492470.1| PREDICTED: uncharacterized protein LOC104769846 isoform X1 [Camelina 
sativa]
Length=437

 Score =   484 bits (1246),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 278/363 (77%), Gaps = 5/363 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q+++ E+E    P   A +S         LP+GII+ RSDL
Sbjct  37    FIALMCTALLIFWYKTTNIQFERTEIEETDYPFDMATESEGIDNKLKGLPQGIIQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DLAWS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLAWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ +++   R      D R EIRRQST+ELQ FKERW  AV+EDKNW+DP 
Sbjct  337   GESVHSEKKTTARDVGTKRQGHTTFDSRTEIRRQSTWELQTFKERWNRAVEEDKNWIDPS  396

Query  287   KAS  279
              +S
Sbjct  397   ASS  399



>ref|XP_010278334.1| PREDICTED: uncharacterized protein LOC104612579 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278335.1| PREDICTED: uncharacterized protein LOC104612579 isoform X1 [Nelumbo 
nucifera]
Length=355

 Score =   480 bits (1235),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 226/353 (64%), Positives = 274/353 (78%), Gaps = 14/353 (4%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             GT   KMK + F+G+ C +MLFI+YRTT YQYQ  EME++  P    ++S         L
Sbjct  13    GTHGFKMKQLPFMGIVCATMLFIVYRTTNYQYQHTEMEARLHPFADVKESQEDSMKVDYL  72

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI++S SD+E++PL   S SK KVN+    +LLA+P GIKQK  V+ I+QKF+SENFT
Sbjct  73    PRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLAIPAGIKQKRYVDAIVQKFVSENFT  132

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             ++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFAKRFLHPDVVS+YDYIFLWDEDL V
Sbjct  133   VVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFAKRFLHPDVVSVYDYIFLWDEDLRV  192

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             +NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT+R ++   HRRVY  +GS KCS+ 
Sbjct  193   DNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRITIRKKSKILHRRVYDRRGSVKCSDA  252

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DS
Sbjct  253   SQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDS  312

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLR----VEIRRQSTYELQIFK  339
             E++VH GIQ+LGGSS ++ S           D+R    ++IRRQST +L+IF+
Sbjct  313   EFIVHKGIQTLGGSSARKVSK----------DIRGNNSMQIRRQSTLDLRIFR  355



>ref|XP_006449261.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62501.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=383

 Score =   481 bits (1237),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 235/369 (64%), Positives = 272/369 (74%), Gaps = 29/369 (8%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHR                  
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHR------------------  244

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
                 FVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  245   ----FVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  300

Query  473   HLGIQSLGGSSLKRAS----SPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEAVK  315
             H GIQ+LGG    R S      +EL K      VDLR EIRRQST ELQIFK+RW EA++
Sbjct  301   HQGIQTLGGQRPTRKSLQSTKREELAKRHGPAPVDLRAEIRRQSTMELQIFKKRWNEAIE  360

Query  314   EDKNWVDPY  288
             +DK+WVDP+
Sbjct  361   QDKSWVDPF  369



>ref|NP_176319.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974064.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001077754.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001117527.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42054.1| unknown protein [Arabidopsis thaliana]
 gb|ABG48406.1| At1g61240 [Arabidopsis thaliana]
 gb|AEE33807.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
 gb|AEE33808.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
 gb|AEE33809.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
 gb|AEE33810.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
Length=425

 Score =   481 bits (1237),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 235/369 (64%), Positives = 277/369 (75%), Gaps = 7/369 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--VVLMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             P GI++ +SDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPKSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKTAGLEISQPALHPNSTEVHHRITVRSRTKIFHRRVYDSRGNMKCSNA  262

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  485   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQSTYELQIFKERWEEA  321
             EY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQST+ELQ FKERW +A
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSGVNRRRGSATFDSRTEIRRQSTWELQAFKERWNQA  382

Query  320   VKEDKNWVD  294
             V EDK WV+
Sbjct  383   VAEDKYWVE  391



>ref|XP_007148221.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20215.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
Length=341

 Score =   476 bits (1224),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 266/315 (84%), Gaps = 3/315 (1%)
 Frame = -3

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             LPRGII + SDLEL+PL + S S+SK +V+   NLLA+PVGIKQK NV+ ++QKFL ENF
Sbjct  14    LPRGIIHADSDLELRPLWSRSSSRSKASVSSNRNLLAVPVGIKQKQNVDVMVQKFLRENF  73

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
             TIILFHYDG VDGW +L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLG
Sbjct  74    TIILFHYDGTVDGWLNLGWSSQAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLG  133

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  669
             VE+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+
Sbjct  134   VEHFSPSRYVEIIKQEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSD  193

Query  668   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  489
              SEGPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT NVG+VD
Sbjct  194   SSEGPPCTGFVEGMAPVFSRAAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKNVGVVD  253

Query  488   SEYLVHLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             SEY+ H GIQ+LGGS     K ++   +   G  +D+R EIRRQST+E ++FKERW EA+
Sbjct  254   SEYVFHKGIQTLGGSGHRMTKVSNLHSKRQSGTGIDVRTEIRRQSTWEFEMFKERWNEAI  313

Query  317   KEDKNWVDPYKASQR  273
              +DKNWVDP+K+ QR
Sbjct  314   SQDKNWVDPFKSDQR  328



>ref|XP_010458503.1| PREDICTED: uncharacterized protein LOC104739751 isoform X4 [Camelina 
sativa]
Length=404

 Score =   478 bits (1230),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 276/363 (76%), Gaps = 7/363 (2%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q++Q E+E    P +  E   V  +    LP+GII+ RSDL
Sbjct  4     FIALMCTALLIFWYKTTNIQFEQTEIEETDYP-FDMESEAVNDKLKG-LPQGIIQPRSDL  61

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  62    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  121

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  122   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  181

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  182   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  241

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  242   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  301

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ +++   R      D R EIRRQST+ELQ FKERW  AV EDKNW+DP 
Sbjct  302   GESVHSEKKTTARDVGTKRQGHTTFDSRTEIRRQSTWELQTFKERWNRAVDEDKNWIDPS  361

Query  287   KAS  279
              +S
Sbjct  362   ASS  364



>ref|XP_010458501.1| PREDICTED: uncharacterized protein LOC104739751 isoform X2 [Camelina 
sativa]
Length=437

 Score =   479 bits (1232),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 232/363 (64%), Positives = 276/363 (76%), Gaps = 7/363 (2%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q++Q E+E    P +  E   V  +    LP+GII+ RSDL
Sbjct  37    FIALMCTALLIFWYKTTNIQFEQTEIEETDYP-FDMESEAVNDKLKG-LPQGIIQPRSDL  94

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  95    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  154

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  155   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  214

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  215   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  274

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  275   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  334

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S   ++ ++ +++   R      D R EIRRQST+ELQ FKERW  AV EDKNW+DP 
Sbjct  335   GESVHSEKKTTARDVGTKRQGHTTFDSRTEIRRQSTWELQTFKERWNRAVDEDKNWIDPS  394

Query  287   KAS  279
              +S
Sbjct  395   ASS  397



>ref|XP_006449259.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62499.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=349

 Score =   475 bits (1222),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKR  432
             H GIQ+LGG    R
Sbjct  323   HQGIQTLGGQRPTR  336



>ref|XP_010278336.1| PREDICTED: uncharacterized protein LOC104612579 isoform X2 [Nelumbo 
nucifera]
Length=343

 Score =   474 bits (1221),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 223/349 (64%), Positives = 268/349 (77%), Gaps = 18/349 (5%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             GT   KMK + F+G+ C +MLFI+YRTT YQYQ  EME++  P    ++S         L
Sbjct  13    GTHGFKMKQLPFMGIVCATMLFIVYRTTNYQYQHTEMEARLHPFADVKESQEDSMKVDYL  72

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGI++S SD+E++PL   S SK KVN+    +LLA+P GIKQK  V+ I+QKF+SENFT
Sbjct  73    PRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLAIPAGIKQKRYVDAIVQKFVSENFT  132

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             ++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFAKRFLHPDVVS+YDYIFLWDEDL V
Sbjct  133   VVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFAKRFLHPDVVSVYDYIFLWDEDLRV  192

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             +NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT+R ++   HRRVY  +GS KCS+ 
Sbjct  193   DNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRITIRKKSKILHRRVYDRRGSVKCSDA  252

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DS
Sbjct  253   SQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDS  312

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFK  339
             E++VH GIQ+LGGSS ++                  IRRQST +L+IF+
Sbjct  313   EFIVHKGIQTLGGSSARK------------------IRRQSTLDLRIFR  343



>gb|KDO75805.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75806.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75807.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75808.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75809.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=350

 Score =   474 bits (1221),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 253/314 (81%), Gaps = 0/314 (0%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKR  432
             H GIQ+LGG    R
Sbjct  323   HQGIQTLGGQPPTR  336



>ref|XP_006449260.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62500.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=350

 Score =   474 bits (1221),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  473   HLGIQSLGGSSLKR  432
             H GIQ+LGG    R
Sbjct  323   HQGIQTLGGQRPTR  336



>ref|XP_010476024.1| PREDICTED: uncharacterized protein LOC104755357 isoform X2 [Camelina 
sativa]
Length=404

 Score =   476 bits (1226),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 272/368 (74%), Gaps = 15/368 (4%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q++Q  +E    P   A +S         LP+GII+ RSDL
Sbjct  4     FIALICTALLIFWYKTTNIQFEQTAIEETDYPFDMATESEGVDNKLKGLPQGIIQPRSDL  63

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDG +D
Sbjct  64    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGIMD  123

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  124   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  183

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  184   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  243

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  244   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  303

Query  452   GGSSLKRASSPQELPKGRAV----------DLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             G S       P++  + R V          D R EIRRQST+ELQ FKERW  AV EDKN
Sbjct  304   GES-----VHPEKKTRARDVGTKKQGHTTFDSRTEIRRQSTWELQTFKERWNRAVDEDKN  358

Query  302   WVDPYKAS  279
             W+DP  +S
Sbjct  359   WIDPSASS  366



>ref|XP_010476020.1| PREDICTED: uncharacterized protein LOC104755357 isoform X1 [Camelina 
sativa]
 ref|XP_010476021.1| PREDICTED: uncharacterized protein LOC104755357 isoform X1 [Camelina 
sativa]
 ref|XP_010476023.1| PREDICTED: uncharacterized protein LOC104755357 isoform X1 [Camelina 
sativa]
Length=437

 Score =   477 bits (1227),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 272/368 (74%), Gaps = 15/368 (4%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             FI L C ++L   Y+TT  Q++Q  +E    P   A +S         LP+GII+ RSDL
Sbjct  37    FIALICTALLIFWYKTTNIQFEQTAIEETDYPFDMATESEGVDNKLKGLPQGIIQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDG +D
Sbjct  97    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGIMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  452   GGSSLKRASSPQELPKGRAV----------DLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             G S       P++  + R V          D R EIRRQST+ELQ FKERW  AV EDKN
Sbjct  337   GES-----VHPEKKTRARDVGTKKQGHTTFDSRTEIRRQSTWELQTFKERWNRAVDEDKN  391

Query  302   WVDPYKAS  279
             W+DP  +S
Sbjct  392   WIDPSASS  399



>emb|CDY20982.1| BnaA08g25430D [Brassica napus]
Length=398

 Score =   475 bits (1222),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 229/364 (63%), Positives = 270/364 (74%), Gaps = 5/364 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q++  ++E    P+  A++S    +    LPRGII+ RSDL
Sbjct  33    FLALICTALLIFWYKTTHIQFEDTDLEESDYPIDMAKESEPVDQKLKGLPRGIIQPRSDL  92

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + SI  SK       NLLA+PVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  93    ELKPLWSSSILSSKGVEMATRNLLAIPVGIKQKSNVDAIVKKFLPANFTVVLFHYDGNMD  152

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA  QTKWWFAKRFLHPDVVSIYDYIF+WDEDLGVENF P  YLEI
Sbjct  153   QWLDLEWSSKAIHIVAQDQTKWWFAKRFLHPDVVSIYDYIFIWDEDLGVENFSPESYLEI  212

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKSEGLEISQPALD  S GIHH+ITVRS T  FHRRVY  KG+ KCSN S  PPC+GFVE
Sbjct  213   VKSEGLEISQPALDSNSSGIHHKITVRSSTEIFHRRVYISKGNRKCSNASVDPPCTGFVE  272

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  273   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  332

Query  452   GGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
             G S    +       K    + R  IRRQST+ELQ F+ERW +AV++DKNW+       R
Sbjct  333   GESGHSESEK-----KRHGHNSRTSIRRQSTWELQTFEERWNKAVEQDKNWIKSNNRRLR  387

Query  272   YRKT  261
             +++T
Sbjct  388   HKRT  391



>ref|XP_003593478.1| Lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
 gb|AES63729.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=355

 Score =   473 bits (1217),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    +MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    L
Sbjct  21    GKSSFRMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFT  140

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDA  260

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  485   EYLVHLGIQSLGGS  444
             +Y+VH GIQ+LGGS
Sbjct  321   QYVVHKGIQTLGGS  334



>gb|KEH31135.1| lysine ketoglutarate reductase trans-splicing-related protein, 
putative [Medicago truncatula]
Length=734

 Score =   486 bits (1250),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 237/367 (65%), Positives = 280/367 (76%), Gaps = 22/367 (6%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             +K+K + F+ + C+ MLF+LYRT  YQY+Q E+       YS     + G     LPRGI
Sbjct  386   LKIKRLPFMAVACIVMLFVLYRTLKYQYKQEEIR------YSTHFEELKG-----LPRGI  434

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             I + SD EL+PL   S  +SKV+V    NLLA+ VGIKQK NV+ ++QKFL+ NFTIILF
Sbjct  435   IHTTSDFELRPLWLRS--RSKVSVYTKRNLLAVAVGIKQKYNVDAMVQKFLTGNFTIILF  492

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYD NVDGW DL WS + IHI A  QTKWWFAKRFLHPD+V IYDYIFLWDEDL VENF 
Sbjct  493   HYDANVDGWQDLDWSSKVIHIAAKKQTKWWFAKRFLHPDIVYIYDYIFLWDEDLEVENFS  552

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P+RY++IV+ EGLEISQPAL P S  IHHRITVR+RT K HRRVY+ +G TKCS+ES+GP
Sbjct  553   PSRYVKIVREEGLEISQPALHPNSTEIHHRITVRARTKKVHRRVYERRGKTKCSDESDGP  612

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+ NVG+VDSEY+ 
Sbjct  613   PCTGFVEGMAPVFSRSAWFCTWHLIQNDLVHGWGMDMKLGYCAQGDRSQNVGVVDSEYVF  672

Query  473   HLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             H  I +LGGSS   +KR  SP       AVD R EIRRQS +EL+IFKERW +A+ EDK+
Sbjct  673   HKAIPTLGGSSHYIIKRRGSPP------AVDPRTEIRRQSAWELKIFKERWNQAITEDKS  726

Query  302   WVDPYKA  282
             WV P+K+
Sbjct  727   WVKPFKS  733



>gb|ABK25584.1| unknown [Picea sitchensis]
Length=441

 Score =   475 bits (1222),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 235/416 (56%), Positives = 294/416 (71%), Gaps = 43/416 (10%)
 Frame = -3

Query  1391  LEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG----  1224
             + G+  +++K +  +G+  V MLF++  T   QY+Q   E +  P  SA++S +T     
Sbjct  25    VSGSKGLRIKTIPSLGILTVLMLFLIAMTMKEQYEQTRAEGRWQPFDSAKNSNLTASNHR  84

Query  1223  ----------------------RSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTG--  1116
                                   +   SLPRGI++  SDLELKPL       S++  TG  
Sbjct  85    KYLSKNLQEEWRITDQLNTDNKKGIESLPRGIVQETSDLELKPL----WRNSRIKDTGKQ  140

Query  1115  YHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQ  936
             + NL+AM +GIKQK NVN I+QKFLS NF+IILFHYDGNVDGW DL WS++ +HI A +Q
Sbjct  141   HRNLMAMTIGIKQKANVNLIVQKFLSANFSIILFHYDGNVDGWNDLEWSRKTVHIGAQNQ  200

Query  935   TKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIG  756
             TKWWFAKRFLHP VVS+YDYIF+WDEDLGVENFHP RYL I+K+EGLEISQPALDPKS  
Sbjct  201   TKWWFAKRFLHPAVVSVYDYIFIWDEDLGVENFHPGRYLRIMKAEGLEISQPALDPKSSE  260

Query  755   IHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQ  576
             IHHRIT+R++T + HRR+Y  +GST CS  S GPPC+G+VEGMAPVF+R+AW+C WHLIQ
Sbjct  261   IHHRITIRNKTRRVHRRLYNLRGSTNCSATSIGPPCTGWVEGMAPVFTRAAWQCAWHLIQ  320

Query  575   NDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS---SPQELPK  405
             NDL+HGWGMDMKLGYCAQGD T NVG++DSEY+VH G+QSLGG S  ++S   SP +   
Sbjct  321   NDLIHGWGMDMKLGYCAQGDHTKNVGVIDSEYIVHQGLQSLGGPSANKSSVAVSPSQRSV  380

Query  404   GRA---VDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY-----KASQRYRKT  261
              +A   VD R EIRRQS  EL IF+ RW+ AV+EDKNWVDP+     K S  Y+K+
Sbjct  381   TKAASEVDPRSEIRRQSVAELTIFRRRWQRAVEEDKNWVDPFEDLRKKKSHLYKKS  436



>gb|KEH36527.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=329

 Score =   470 bits (1210),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 250/308 (81%), Gaps = 0/308 (0%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    LPRGII+
Sbjct  1     MKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGLPRGIIQ  60

Query  1187  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
               SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFTIILFHY
Sbjct  61    DSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFTIILFHY  120

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGVE+F P+
Sbjct  121   DGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGVEHFSPS  180

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  648
             RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ SEGPPC
Sbjct  181   RYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDASEGPPC  240

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
             +GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS+Y+VH 
Sbjct  241   TGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSQYVVHK  300

Query  467   GIQSLGGS  444
             GIQ+LGGS
Sbjct  301   GIQTLGGS  308



>emb|CDY19346.1| BnaC05g08550D [Brassica napus]
Length=433

 Score =   474 bits (1220),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 224/360 (62%), Positives = 273/360 (76%), Gaps = 5/360 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   YRTT  Q+++ E+E    P   A +S         LPRGI++ RSDL
Sbjct  37    FLALICTALLIFWYRTTNIQFEETELEEADYPFDMAMESEPVDAKLKGLPRGILQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + +  ++K       NLLA+PVGIKQK NV+ +++KFL  NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSNSLRAKGVEMTNRNLLAVPVGIKQKGNVDAMVKKFLPANFTVVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGVENF P RYL+I
Sbjct  157   KWWDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVENFTPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VK EGLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G+ KCSN SE PPC+GFVE
Sbjct  217   VKVEGLEISQPALDRNSTEIHHKITLRSKTKKFHRRVYINRGTKKCSNTSEDPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR   VGIVD EY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRKMKVGIVDREYIFHQGIQTL  336

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S    + +  +++   R      D R  IRRQST+ELQ F+ERW++AV+EDKNW+DP+
Sbjct  337   GESVQSDKKTRARDVRTNRHGHTTFDSRTSIRRQSTWELQRFEERWKKAVEEDKNWIDPF  396



>emb|CDY20585.1| BnaC08g14730D [Brassica napus]
Length=431

 Score =   473 bits (1218),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/364 (63%), Positives = 270/364 (74%), Gaps = 7/364 (2%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q++  ++E    P+  A++S    +    LPRGIIE R+DL
Sbjct  33    FLALICTALLIFWYKTTHIQFEDTDLEESDYPIDMAKESEPVDQKLKGLPRGIIEPRTDL  92

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  93    ELKPLWSSSSLRSKGVEMTNRNLLAIPVGIKQKSNVDAIVKKFLPANFTVVLFHYDGNMD  152

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA  QTKWWFAKRFLHPDVVSIYDYIF+WDEDLGVENF P RYLEI
Sbjct  153   QWLDLEWSSKAIHIVAQDQTKWWFAKRFLHPDVVSIYDYIFIWDEDLGVENFSPERYLEI  212

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKSEGLEISQPALD  S GIHH+ITVRS +  FHRRVY  KG+ KCSN S  PPC+GFVE
Sbjct  213   VKSEGLEISQPALDSNSSGIHHKITVRSSSEIFHRRVYISKGNRKCSNASVDPPCTGFVE  272

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  273   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  332

Query  452   GGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
             G S            K    + R  IRRQST+ELQ F+ERW +AV++DKNW+       R
Sbjct  333   GESG-------HSEKKRHGHNSRTSIRRQSTWELQTFEERWNKAVEQDKNWIKSNNRRLR  385

Query  272   YRKT  261
             +++T
Sbjct  386   HKRT  389



>emb|CDX97937.1| BnaA06g06880D [Brassica napus]
Length=433

 Score =   473 bits (1216),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 273/360 (76%), Gaps = 5/360 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q+++ E+E    P   A +S         LPRGI++ RSDL
Sbjct  37    FLLLMCTALLIFWYKTTNIQFEETELEEADYPFDMAVESEPVDEKLKGLPRGILQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + +  ++K       NLLA+PVGIKQK NV+ +++KFL  NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSNSLRAKGVEMTNRNLLAVPVGIKQKGNVDAMVKKFLPANFTVVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              WWDL WS  AIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGVENF P RYL+I
Sbjct  157   KWWDLEWSSRAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVENFTPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VK+EGLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G+ KCSN SE PPC+GFVE
Sbjct  217   VKAEGLEISQPALDRNSTEIHHKITLRSKTKKFHRRVYINRGTKKCSNTSEDPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR   VGIVD EY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRKMKVGIVDREYIFHQGIQTL  336

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S    + +  +++   R      D R  IRRQST+ELQ F+ERW++AV+EDKNW+DP+
Sbjct  337   GESVPSDKKTRTRDVRTNRHGHTTFDSRTSIRRQSTWELQRFEERWKKAVEEDKNWIDPF  396



>ref|XP_009148446.1| PREDICTED: uncharacterized protein LOC103871881 [Brassica rapa]
 ref|XP_009148447.1| PREDICTED: uncharacterized protein LOC103871881 [Brassica rapa]
 ref|XP_009148448.1| PREDICTED: uncharacterized protein LOC103871881 [Brassica rapa]
Length=433

 Score =   472 bits (1214),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 223/360 (62%), Positives = 273/360 (76%), Gaps = 5/360 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q+++ E+E    P   A +S         LPRGI++ RSDL
Sbjct  37    FLLLMCTALLIFWYKTTNIQFEETELEEADYPFDMAVESEPVDEKLKGLPRGILQPRSDL  96

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + +  ++K       NLLA+PVGIKQK NV+ +++KF   NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSNSLRAKGVEMTNRNLLAVPVGIKQKGNVDAMVKKFRPANFTVVLFHYDGNMD  156

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGVENF P RYL+I
Sbjct  157   KWWDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVENFTPERYLKI  216

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VK+EGLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ KCSN SE PPC+GFVE
Sbjct  217   VKAEGLEISQPALDRNSTEIHHKITLRSRTKKFHRRVYINRGTKKCSNTSEDPPCTGFVE  276

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR   VGIVD EY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRKMKVGIVDREYIFHQGIQTL  336

Query  452   GGS-SLKRASSPQELPKGR----AVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G S    + +  +++   R      D R  IRRQST+ELQ F+ERW++AV+EDKNW+DP+
Sbjct  337   GESVPSDKKTRTRDVRTNRHGHTTFDSRTSIRRQSTWELQRFEERWKKAVEEDKNWIDPF  396



>ref|XP_010059328.1| PREDICTED: uncharacterized protein LOC104447263, partial [Eucalyptus 
grandis]
Length=412

 Score =   469 bits (1206),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 228/357 (64%), Positives = 266/357 (75%), Gaps = 26/357 (7%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C  KMK + F+G+ CV MLFI+YRTT YQY+Q EME    P  + ++S    R   SL
Sbjct  21    GLCGFKMKQLPFMGIICVVMLFIVYRTTKYQYRQTEMEINLHPFDTLKESQGLSRRLGSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTG-------YHNLLAMPVGIKQKDNVNEIIQK  1047
             PRGII++RSDLEL+PL + S S+SKV+V+        Y  LLA+ VGIKQK NVN I+QK
Sbjct  81    PRGIIQARSDLELRPLWSTSSSRSKVDVSSNEVDAPRYRYLLAIAVGIKQKYNVNAIVQK  140

Query  1046  FLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFL  867
             F  +NFT++LFHYDG VD W DL WS  AIHIVA +QTKWWFAKRFLHP +VS YDYIFL
Sbjct  141   FRPDNFTVMLFHYDGKVDAWGDLNWSNNAIHIVARNQTKWWFAKRFLHPSIVSAYDYIFL  200

Query  866   WDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKG  687
             WDEDLGV+NFHP RYL+IVKSEGLEISQPAL P S  IHHRIT+RSRT KFHRRVY  +G
Sbjct  201   WDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRITIRSRTKKFHRRVYDVRG  260

Query  686   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  507
             STKC+N S GPPC+GFVEGMAPVFSRSAW C WHL+QNDL+HGWGMDMKLGYCAQGDRT 
Sbjct  261   STKCTNVSWGPPCTGFVEGMAPVFSRSAWFCTWHLLQNDLIHGWGMDMKLGYCAQGDRTK  320

Query  506   NVGIVDSEYLVHLGIQSL------------GGSSLKRASSPQELPKGRAVDLRVEIR  372
              VG++DSEY+ H GIQ+L               S KR S+P       +VD+R E+R
Sbjct  321   KVGVIDSEYIFHKGIQTLGGGGPPGKKGSNSEESTKRHSTP-------SVDMRAEVR  370



>ref|XP_009110741.1| PREDICTED: uncharacterized protein LOC103836245 [Brassica rapa]
Length=398

 Score =   468 bits (1205),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 227/364 (62%), Positives = 268/364 (74%), Gaps = 5/364 (1%)
 Frame = -3

Query  1352  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             F+ L C ++L   Y+TT  Q++  ++E    P+   ++S    +    LPRGII+ RSDL
Sbjct  33    FLALICTALLIFWYKTTHIQFEDTDLEESDYPIDMTKESEPVDQKLEGLPRGIIQPRSDL  92

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL + S   SK       NLLA+PVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  93    ELKPLWSSSSLSSKGVEMATRNLLAIPVGIKQKSNVDAIVKKFLPANFTVVLFHYDGNMD  152

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W DL WS +AIHIVA  QTKWWFAKRFLHPDVVSIYDYIF+WDEDLGVENF P  YLEI
Sbjct  153   QWLDLEWSSKAIHIVAQDQTKWWFAKRFLHPDVVSIYDYIFIWDEDLGVENFSPESYLEI  212

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKSEGLEISQPALD  S GIHH+ITVRS T  FHRRVY  KG+ KCSN S  PPC+GFVE
Sbjct  213   VKSEGLEISQPALDSNSSGIHHKITVRSSTEIFHRRVYISKGNRKCSNASVDPPCTGFVE  272

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  273   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  332

Query  452   GGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
             G S    +       K    + R  IRRQST+ELQ F+ERW +AV++DKNW+       R
Sbjct  333   GESGHSESEK-----KRHGHNSRTSIRRQSTWELQTFEERWNKAVEQDKNWIKSNNRRLR  387

Query  272   YRKT  261
             +++T
Sbjct  388   HKRT  391



>ref|XP_010040735.1| PREDICTED: uncharacterized protein LOC104429587, partial [Eucalyptus 
grandis]
Length=359

 Score =   466 bits (1199),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 228/336 (68%), Positives = 266/336 (79%), Gaps = 12/336 (4%)
 Frame = -3

Query  1259  PLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTG-------YHNLL  1101
             P    ++S    R   SLPRGII++RSDLEL+PL + S S+SKV+V+        Y  LL
Sbjct  4     PFCFLQESQGLSRRLGSLPRGIIQARSDLELRPLWSTSSSRSKVDVSSNEVDAPRYRYLL  63

Query  1100  AMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWF  921
             A+ VGIKQK NVN I+QKF  +NFT++LFHYDG VD W DL WS  AIHIVA +QTKWWF
Sbjct  64    AIAVGIKQKYNVNAIVQKFRPDNFTVMLFHYDGKVDAWGDLNWSNNAIHIVARNQTKWWF  123

Query  920   AKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRI  741
             AKRFLHP +VS YDYIFLWDEDLGV+NFHP RYL+IVKSEGLEISQPAL P S  IHHRI
Sbjct  124   AKRFLHPSIVSAYDYIFLWDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRI  183

Query  740   TVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVH  561
             T+RSRT KFHRRVY  +GSTKC+N S GPPC+GFVEGMAPVFSRSAW C WHL+QNDL+H
Sbjct  184   TIRSRTKKFHRRVYDVRGSTKCTNVSWGPPCTGFVEGMAPVFSRSAWFCTWHLLQNDLIH  243

Query  560   GWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL--GGSSLKRASSPQELPK---GRA  396
             GWGMDMKLGYCAQGDRT  VG++DSEY+ H GIQ+L  GG   K+ S+ +EL K     +
Sbjct  244   GWGMDMKLGYCAQGDRTKKVGVIDSEYIFHKGIQTLGGGGPPGKKGSNSEELTKRHSAPS  303

Query  395   VDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             VD+R EIRRQST+ELQ+FKERW +AVK DKNW+DP+
Sbjct  304   VDMRAEIRRQSTWELQVFKERWNKAVKMDKNWIDPF  339



>ref|XP_006574635.1| PREDICTED: uncharacterized protein LOC100807505 isoform X1 [Glycine 
max]
Length=412

 Score =   466 bits (1199),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 230/373 (62%), Positives = 279/373 (75%), Gaps = 10/373 (3%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  654
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQG RT  VG+VDSEY+ 
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQGRRTKKVGVVDSEYVF  323

Query  473   HLGIQSLGGSSLKRASSPQELPK------GRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             H GIQ+LGGS   R +   +L K      G  +D+R EIRRQST E +IF+ERW +A+ E
Sbjct  324   HKGIQTLGGSG-HRMTKVSKLQKTTMKQGGVGIDVRTEIRRQSTREFEIFQERWNQAISE  382

Query  311   DKNWVDPYKASQR  273
             DK WVDP+K+ QR
Sbjct  383   DKTWVDPFKSDQR  395



>gb|KCW74645.1| hypothetical protein EUGRSUZ_E03369 [Eucalyptus grandis]
Length=404

 Score =   464 bits (1195),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 252/318 (79%), Gaps = 7/318 (2%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G C  KMK + F+G+ CV MLFI+YRTT YQY+Q EME    P  + ++S    R   SL
Sbjct  21    GLCGFKMKQLPFMGIICVVMLFIVYRTTKYQYRQTEMEINLHPFDTLKESQGLSRRLGSL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTG-------YHNLLAMPVGIKQKDNVNEIIQK  1047
             PRGII++RSDLEL+PL + S S+SKV+V+        Y  LLA+ VGIKQK NVN I+QK
Sbjct  81    PRGIIQARSDLELRPLWSTSSSRSKVDVSSNEVDAPRYRYLLAIAVGIKQKYNVNAIVQK  140

Query  1046  FLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFL  867
             F  +NFT++LFHYDG VD W DL WS  AIHIVA +QTKWWFAKRFLHP +VS YDYIFL
Sbjct  141   FRPDNFTVMLFHYDGKVDAWGDLNWSNNAIHIVARNQTKWWFAKRFLHPSIVSAYDYIFL  200

Query  866   WDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKG  687
             WDEDLGV+NFHP RYL+IVKSEGLEISQPAL P S  IHHRIT+RSRT KFHRRVY  +G
Sbjct  201   WDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRITIRSRTKKFHRRVYDVRG  260

Query  686   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  507
             STKC+N S GPPC+GFVEGMAPVFSRSAW C WHL+QNDL+HGWGMDMKLGYCAQGDRT 
Sbjct  261   STKCTNVSWGPPCTGFVEGMAPVFSRSAWFCTWHLLQNDLIHGWGMDMKLGYCAQGDRTK  320

Query  506   NVGIVDSEYLVHLGIQSL  453
              VG++DSEY+ H GIQ+L
Sbjct  321   KVGVIDSEYIFHKGIQTL  338



>ref|XP_006848620.1| hypothetical protein AMTR_s00171p00031600 [Amborella trichopoda]
 gb|ERN10201.1| hypothetical protein AMTR_s00171p00031600 [Amborella trichopoda]
Length=412

 Score =   464 bits (1193),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 221/359 (62%), Positives = 270/359 (75%), Gaps = 20/359 (6%)
 Frame = -3

Query  1307  TTIYQYQQAEMESKSDPLYSAEDSCVTGRSS----SSLPRGIIESRSDLELKPLKAMSIS  1140
             T  +QY+  +M++   P  S +       +      SLPRGI+ES SD+ELKPL   S  
Sbjct  49    TMKHQYEHIKMDNTWYPFASTKQRPQIMMTHFDHIHSLPRGIVESTSDMELKPLWETSTL  108

Query  1139  KSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEA  960
               K     +  LLA+PVGIKQK NVN ++QKFL+ENF+IILFHYDGNVDGW DL WS  A
Sbjct  109   TDKNQ--NHKALLAIPVGIKQKKNVNAMVQKFLAENFSIILFHYDGNVDGWHDLGWSDRA  166

Query  959   IHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQP  780
             IHI+AH+QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP RYL I+K+EGLEISQP
Sbjct  167   IHILAHNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPGRYLRIMKAEGLEISQP  226

Query  779   ALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAW  600
             ALDP    IHHRIT+R++T K HRR+Y  +GS  CS+ S GPPC+G+VEGMAPVFSR++W
Sbjct  227   ALDPNQSEIHHRITIRNKTGKVHRRMYASRGSLNCSDASMGPPCTGWVEGMAPVFSRASW  286

Query  599   RCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKR----  432
              C WHLIQNDL+HGWG+DMKLGYC+QGDRT NVG++DSE+++HLGI SLGGSS  +    
Sbjct  287   HCTWHLIQNDLIHGWGLDMKLGYCSQGDRTKNVGVIDSEFIIHLGIPSLGGSSANKQLSS  346

Query  431   ----ASSPQE------LPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
                 A+ P +      +   R +DLR +IRRQST EL+IF++RW+ AV++DK W DPYK
Sbjct  347   ESNEAAGPADQSMVTKVQGERVIDLRSQIRRQSTAELEIFRKRWDRAVRDDKEWADPYK  405



>ref|XP_006597407.1| PREDICTED: uncharacterized protein LOC100778191 isoform X7 [Glycine 
max]
Length=349

 Score =   461 bits (1187),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 252/314 (80%), Gaps = 1/314 (0%)
 Frame = -3

Query  1385  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1206
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1205  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1026
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1025  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  846
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  845   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  666
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  485   EYLVHLGIQSLGGS  444
             EY+ H GIQ+LGGS
Sbjct  320   EYVFHKGIQTLGGS  333



>ref|XP_010473332.1| PREDICTED: uncharacterized protein LOC104752789 isoform X2 [Camelina 
sativa]
Length=358

 Score =   460 bits (1183),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 221/323 (68%), Positives = 255/323 (79%), Gaps = 5/323 (2%)
 Frame = -3

Query  1247  AEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDN  1068
             A++S         LP GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDN
Sbjct  2     AKESEPVSEKLKGLPFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDN  61

Query  1067  VNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVS  888
             V+ +++KFL  NFT+ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS
Sbjct  62    VDAVVKKFLPANFTVILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVS  121

Query  887   IYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHR  708
              YDY+FLWDEDLGVENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHR
Sbjct  122   TYDYVFLWDEDLGVENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHR  181

Query  707   RVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYC  528
             RVY  +G+ KCSN SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYC
Sbjct  182   RVYDSRGNMKCSNASEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYC  241

Query  527   AQGDRTTNVGIVDSEYLVHLGIQSLGGSS--LKRASSPQELPKGRA---VDLRVEIRRQS  363
             AQGDR+  VGIVDSEY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQS
Sbjct  242   AQGDRSKKVGIVDSEYIFHQGIQTLGGSGDPDKKNSARSGVTRKRGSPTFDSRTEIRRQS  301

Query  362   TYELQIFKERWEEAVKEDKNWVD  294
             T+EL+ FKERW +AV EDKNWVD
Sbjct  302   TWELRTFKERWNQAVAEDKNWVD  324



>gb|AAN63500.1|AF317555_1 lysine ketoglutarate reductase trans-splicing related 1 [Arabidopsis 
thaliana]
Length=358

 Score =   451 bits (1161),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 218/323 (67%), Positives = 254/323 (79%), Gaps = 5/323 (2%)
 Frame = -3

Query  1247  AEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDN  1068
             A++S         LP GI++ +SDLELKPL + S  +SK       NLLAMPVG+KQKDN
Sbjct  2     AKESEPVSEKLKGLPFGIMQPKSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDN  61

Query  1067  VNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVS  888
             V+ +++KFL  NFT+ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS
Sbjct  62    VDAVVKKFLPANFTVILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVS  121

Query  887   IYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHR  708
             IYDY+FLWDEDLGVENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHR
Sbjct  122   IYDYVFLWDEDLGVENFNPQKYLRIVKTAGLEISQPALHPNSTEVHHRITVRSRTKIFHR  181

Query  707   RVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYC  528
             RVY  +G+ KCSN SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLG C
Sbjct  182   RVYDSRGNMKCSNASEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGSC  241

Query  527   AQGDRTTNVGIVDSEYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEIRRQS  363
             AQGDR+  VGIVDSEY+ H GIQ+LGGS    K+ S+   + + R     D R EIRRQS
Sbjct  242   AQGDRSKKVGIVDSEYIFHQGIQTLGGSGYPDKKNSARSGVNRRRGSATFDSRTEIRRQS  301

Query  362   TYELQIFKERWEEAVKEDKNWVD  294
             T+ELQ FKERW +AV EDK WV+
Sbjct  302   TWELQAFKERWNQAVAEDKYWVE  324



>ref|XP_010274911.1| PREDICTED: uncharacterized protein LOC104610123 isoform X1 [Nelumbo 
nucifera]
Length=385

 Score =   451 bits (1161),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 219/374 (59%), Positives = 277/374 (74%), Gaps = 18/374 (5%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG------RSSS  1212
              K+K    +GL    M  +++ TT  QY+  ++E++  P  S   S           S  
Sbjct  2     TKVKSRTSLGLLTTLMFVVIFVTTKLQYEHVKVENRWHPFVSTRGSSGLASGEDRFESLD  61

Query  1211  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             SL +G++E  S+LELKPL     S S +N      LLA+PVGIKQK NV+ ++QKFLSEN
Sbjct  62    SLRQGVVEWASNLELKPLWQ---SSSSLNCNA---LLAIPVGIKQKQNVDIMVQKFLSEN  115

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
              +I+LFHYDG+VDGW DL WS +A+HI+AH+QTKWWFAKRFLHPDVVS YD+IFLWDEDL
Sbjct  116   CSILLFHYDGSVDGWNDLEWSNKAVHILAHNQTKWWFAKRFLHPDVVSPYDFIFLWDEDL  175

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENFHP R+LEI+ SEGLEISQPALDP+   +HHRIT+R++T K HR+VY  +GS  CS
Sbjct  176   GVENFHPGRFLEIMISEGLEISQPALDPELSEVHHRITLRNKTVKVHRQVYVSRGSFNCS  235

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             + S GPPC+G+VEGMAPVFSR+AW CVWHLIQNDL+HGWG+DMKLGYCAQGD T  VG++
Sbjct  236   DNSTGPPCTGWVEGMAPVFSRAAWHCVWHLIQNDLIHGWGLDMKLGYCAQGDPTKTVGVI  295

Query  491   DSEYLVHLGIQSLGGSSLKRA----SSPQELP--KGRAVDLRVEIRRQSTYELQIFKERW  330
             DSEY+VH GI +LGG+S  +      SP+  P    R++DLR  IRRQST EL+IFK+RW
Sbjct  296   DSEYIVHRGIPTLGGASATKPPPDRKSPEHSPVKSDRSIDLRTHIRRQSTAELEIFKQRW  355

Query  329   EEAVKEDKNWVDPY  288
             ++AV+ED  W+DP+
Sbjct  356   DQAVREDDRWIDPF  369



>ref|XP_010274912.1| PREDICTED: uncharacterized protein LOC104610123 isoform X2 [Nelumbo 
nucifera]
Length=384

 Score =   449 bits (1156),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 218/374 (58%), Positives = 276/374 (74%), Gaps = 19/374 (5%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG------RSSS  1212
              K+K    +GL    M  +++ TT  QY+  ++E++  P  S   S           S  
Sbjct  2     TKVKSRTSLGLLTTLMFVVIFVTTKLQYEHVKVENRWHPFVSTRGSSGLASGEDRFESLD  61

Query  1211  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             SL +G++E  S+LELKPL       S +N      LLA+PVGIKQK NV+ ++QKFLSEN
Sbjct  62    SLRQGVVEWASNLELKPL----WQSSSLNCNA---LLAIPVGIKQKQNVDIMVQKFLSEN  114

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
              +I+LFHYDG+VDGW DL WS +A+HI+AH+QTKWWFAKRFLHPDVVS YD+IFLWDEDL
Sbjct  115   CSILLFHYDGSVDGWNDLEWSNKAVHILAHNQTKWWFAKRFLHPDVVSPYDFIFLWDEDL  174

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
             GVENFHP R+LEI+ SEGLEISQPALDP+   +HHRIT+R++T K HR+VY  +GS  CS
Sbjct  175   GVENFHPGRFLEIMISEGLEISQPALDPELSEVHHRITLRNKTVKVHRQVYVSRGSFNCS  234

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
             + S GPPC+G+VEGMAPVFSR+AW CVWHLIQNDL+HGWG+DMKLGYCAQGD T  VG++
Sbjct  235   DNSTGPPCTGWVEGMAPVFSRAAWHCVWHLIQNDLIHGWGLDMKLGYCAQGDPTKTVGVI  294

Query  491   DSEYLVHLGIQSLGGSSLKRA----SSPQELP--KGRAVDLRVEIRRQSTYELQIFKERW  330
             DSEY+VH GI +LGG+S  +      SP+  P    R++DLR  IRRQST EL+IFK+RW
Sbjct  295   DSEYIVHRGIPTLGGASATKPPPDRKSPEHSPVKSDRSIDLRTHIRRQSTAELEIFKQRW  354

Query  329   EEAVKEDKNWVDPY  288
             ++AV+ED  W+DP+
Sbjct  355   DQAVREDDRWIDPF  368



>ref|XP_009395413.1| PREDICTED: uncharacterized protein LOC103980679 [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   442 bits (1136),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 216/356 (61%), Positives = 265/356 (74%), Gaps = 10/356 (3%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKS-DPLYSAEDSCVTGRSSSSLPRGII  1191
             MK    +GL  +     L  T   Q++  +++ +  +P  S E     G +   LPRGI+
Sbjct  1     MKKRTSLGLVALFTSLTLLITMNLQFEHLKIDVQHHEPFVSTERPW--GGALQGLPRGIV  58

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             ES SDL+LKPL   S  +SK     Y  LLAM VGI QK+NV+ +++KFL EN +IILFH
Sbjct  59    ESTSDLKLKPLWMSSSFESKETGGSYSALLAMAVGISQKENVDSVVRKFLQENCSIILFH  118

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDGNVDGW DL W+ +AIHIVA++QTKWWFAKRFLHPD+V  YDY+FLWDEDLGVENFHP
Sbjct  119   YDGNVDGWRDLEWNSKAIHIVAYNQTKWWFAKRFLHPDIVFFYDYLFLWDEDLGVENFHP  178

Query  830   ARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
              RYL+++ SEGLEISQPALDP  S  IHHRITVR+R  K HRR+Y  +GS +CSNES+ P
Sbjct  179   GRYLQVMSSEGLEISQPALDPDLSSDIHHRITVRNRMKKVHRRIYNRRGSLRCSNESKEP  238

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+G+VEGMAPVFSR+AW+CVWHLIQNDLVHGWG+DMKLGYCAQGDRT  VG++DSE++V
Sbjct  239   PCTGWVEGMAPVFSRAAWQCVWHLIQNDLVHGWGLDMKLGYCAQGDRTKKVGVIDSEFIV  298

Query  473   HLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             H GI SLGG S  +A +       R++D R  IRRQST EL+IFK RW +AV ED+
Sbjct  299   HKGIPSLGGPSANKARNR------RSLDSRTHIRRQSTAELKIFKARWNKAVTEDR  348



>ref|XP_008802583.1| PREDICTED: uncharacterized protein LOC103716387 isoform X1 [Phoenix 
dactylifera]
Length=363

 Score =   440 bits (1131),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 217/369 (59%), Positives = 269/369 (73%), Gaps = 13/369 (4%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             MK     G+  + M  +L+   T   Q +  +M+ +     S +           LPRG+
Sbjct  1     MKKRASCGIVALLMALVLFGVMTMKIQNENLKMDMRHQSFESPKRRLRN--RIDGLPRGV  58

Query  1193  IESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1017
             ++S SD+ELK L A S  K   +++G Y  LLAM VGI QK NV+ +++KFL +N +IIL
Sbjct  59    VQSTSDMELKRLWASSSQKYLQDISGNYTALLAMAVGISQKQNVDILVRKFLIDNCSIIL  118

Query  1016  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  837
             FHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF
Sbjct  119   FHYDGNVDGWRDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDLGVENF  178

Query  836   HPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESE  660
             H  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  CS+ES 
Sbjct  179   HLGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHRRVYDFRGSLNCSDESR  238

Query  659   GPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEY  480
             GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D+EY
Sbjct  239   GPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDTEY  298

Query  479   LVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             ++H GI SLGG+S+ +A S       +++DLR  IRRQST EL+ F +RW +AV+EDK W
Sbjct  299   IIHQGIPSLGGASINKAPS-------KSLDLRTHIRRQSTAELEKFNKRWNQAVREDKEW  351

Query  299   VDPYKASQR  273
                ++   R
Sbjct  352   SKHFEGYAR  360



>ref|XP_010935614.1| PREDICTED: uncharacterized protein LOC105055478 isoform X1 [Elaeis 
guineensis]
Length=360

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 253/314 (81%), Gaps = 12/314 (4%)
 Frame = -3

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             LPRG+++S SD+ELKPL     S S+ +++G Y  LLAM VGI QK NV+ +++KFL +N
Sbjct  54    LPRGVVQSTSDMELKPLWK---SSSQKDISGKYTALLAMAVGISQKQNVDILVRKFLIDN  110

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
              +IILFHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDL
Sbjct  111   CSIILFHYDGNVDGWHDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDL  170

Query  851   GVENFHPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             GVENFH  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  C
Sbjct  171   GVENFHLGRYLQIMASEGLEISQPALDPDQSSEIHHRITVRDRKAKVHRRVYDFRGSLNC  230

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             S+ES GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG+
Sbjct  231   SDESRGPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGV  290

Query  494   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVK  315
             +D+EY++H GI SLGG+S+ +A S       +++DLR  IRRQST EL+ F +RW +AV+
Sbjct  291   IDTEYIIHQGIPSLGGASVNKAPS-------KSLDLRTHIRRQSTAELEKFNKRWNQAVR  343

Query  314   EDKNWVDPYKASQR  273
             EDK W + ++   R
Sbjct  344   EDKEWFEHFEGYAR  357



>ref|XP_008802591.1| PREDICTED: uncharacterized protein LOC103716387 isoform X2 [Phoenix 
dactylifera]
Length=360

 Score =   438 bits (1126),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 217/371 (58%), Positives = 271/371 (73%), Gaps = 16/371 (4%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             MK     G+  + M  +L+   T   Q +  +M+ +     S +           LPRG+
Sbjct  1     MKKRASCGIVALLMALVLFGVMTMKIQNENLKMDMRHQSFESPKRRLRN--RIDGLPRGV  58

Query  1193  IESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1017
             ++S SD+ELK L A   S S+ +++G Y  LLAM VGI QK NV+ +++KFL +N +IIL
Sbjct  59    VQSTSDMELKRLWA---SSSQKDISGNYTALLAMAVGISQKQNVDILVRKFLIDNCSIIL  115

Query  1016  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  837
             FHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF
Sbjct  116   FHYDGNVDGWRDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDLGVENF  175

Query  836   HPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESE  660
             H  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  CS+ES 
Sbjct  176   HLGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHRRVYDFRGSLNCSDESR  235

Query  659   GPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEY  480
             GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D+EY
Sbjct  236   GPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDTEY  295

Query  479   LVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             ++H GI SLGG+S+ +A S       +++DLR  IRRQST EL+ F +RW +AV+EDK W
Sbjct  296   IIHQGIPSLGGASINKAPS-------KSLDLRTHIRRQSTAELEKFNKRWNQAVREDKEW  348

Query  299   VDPYKASQRYR  267
                ++   R +
Sbjct  349   SKHFEGYARKK  359



>ref|XP_006307555.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
 gb|EOA40453.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
Length=368

 Score =   436 bits (1122),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 213/332 (64%), Positives = 248/332 (75%), Gaps = 7/332 (2%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             KMK   F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGII
Sbjct  33    KMK--PFLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGII  90

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             E RSDLELKPL + S  +SK       NLLA+ VGIKQK NVN I++KFL  NFTI+LFH
Sbjct  91    EPRSDLELKPLWSRSSLRSKGVEMTNRNLLAISVGIKQKGNVNAIVKKFLPANFTIVLFH  150

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDGN+D W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P
Sbjct  151   YDGNMDKWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNP  210

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  651
              RYL+IVKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY  +G+ +CSN S  PP
Sbjct  211   ERYLKIVKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYIKRGTKRCSNSSADPP  270

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             C+GFVEGMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H
Sbjct  271   CTGFVEGMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFH  330

Query  470   LGIQSLGGSSLKRASSPQELPKGRAVDLRVEI  375
              GIQ+LG S       P++    R V  +V +
Sbjct  331   QGIQTLGES-----VHPEKKTTSRNVGTKVSL  357



>ref|XP_010278338.1| PREDICTED: uncharacterized protein LOC104612579 isoform X4 [Nelumbo 
nucifera]
Length=307

 Score =   434 bits (1116),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 248/317 (78%), Gaps = 14/317 (4%)
 Frame = -3

Query  1277  MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLA  1098
             ME++  P    ++S         LPRGI++S SD+E++PL   S SK KVN+    +LLA
Sbjct  1     MEARLHPFADVKESQEDSMKVDYLPRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLA  60

Query  1097  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  918
             +P GIKQK  V+ I+QKF+SENFT++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFA
Sbjct  61    IPAGIKQKRYVDAIVQKFVSENFTVVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFA  120

Query  917   KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRIT  738
             KRFLHPDVVS+YDYIFLWDEDL V+NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT
Sbjct  121   KRFLHPDVVSVYDYIFLWDEDLRVDNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRIT  180

Query  737   VRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  558
             +R ++   HRRVY  +GS KCS+ S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHG
Sbjct  181   IRKKSKILHRRVYDRRGSVKCSDASQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHG  240

Query  557   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLR--  384
             WGMDMKLGYCAQGDRT  VG++DSE++VH GIQ+LGGSS ++ S           D+R  
Sbjct  241   WGMDMKLGYCAQGDRTKKVGVIDSEFIVHKGIQTLGGSSARKVSK----------DIRGN  290

Query  383   --VEIRRQSTYELQIFK  339
               ++IRRQST +L+IF+
Sbjct  291   NSMQIRRQSTLDLRIFR  307



>ref|XP_010278337.1| PREDICTED: uncharacterized protein LOC104612579 isoform X3 [Nelumbo 
nucifera]
Length=319

 Score =   434 bits (1117),  Expect = 7e-146, Method: Compositional matrix adjust.
 Identities = 205/317 (65%), Positives = 248/317 (78%), Gaps = 14/317 (4%)
 Frame = -3

Query  1277  MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLA  1098
             ME++  P    ++S         LPRGI++S SD+E++PL   S SK KVN+    +LLA
Sbjct  13    MEARLHPFADVKESQEDSMKVDYLPRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLA  72

Query  1097  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  918
             +P GIKQK  V+ I+QKF+SENFT++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFA
Sbjct  73    IPAGIKQKRYVDAIVQKFVSENFTVVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFA  132

Query  917   KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRIT  738
             KRFLHPDVVS+YDYIFLWDEDL V+NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT
Sbjct  133   KRFLHPDVVSVYDYIFLWDEDLRVDNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRIT  192

Query  737   VRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  558
             +R ++   HRRVY  +GS KCS+ S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHG
Sbjct  193   IRKKSKILHRRVYDRRGSVKCSDASQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHG  252

Query  557   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLR--  384
             WGMDMKLGYCAQGDRT  VG++DSE++VH GIQ+LGGSS ++ S           D+R  
Sbjct  253   WGMDMKLGYCAQGDRTKKVGVIDSEFIVHKGIQTLGGSSARKVSK----------DIRGN  302

Query  383   --VEIRRQSTYELQIFK  339
               ++IRRQST +L+IF+
Sbjct  303   NSMQIRRQSTLDLRIFR  319



>ref|XP_008778200.1| PREDICTED: uncharacterized protein LOC103698025 isoform X1 [Phoenix 
dactylifera]
Length=360

 Score =   435 bits (1119),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/370 (58%), Positives = 264/370 (71%), Gaps = 14/370 (4%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             MK     GL  + M  +++   T   QY+   M+       S +           LPRG+
Sbjct  1     MKTQASFGLVFLLMTLVIFVAMTMKIQYENLTMDMGQQSFESTKRQWRN--RIDGLPRGV  58

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +ES +D+ LKPL     S  K     Y  LLAM VGI QK NV+ +++KFL +N +IILF
Sbjct  59    VESTTDMALKPL--WERSSRKDGSGNYAALLAMAVGISQKQNVDILVRKFLIDNCSIILF  116

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGW DL WS +AIHI+A++QTKWWFAKRFLHP+ VS YDYIFLWDEDLGVENFH
Sbjct  117   HYDGNVDGWHDLEWSGKAIHILAYNQTKWWFAKRFLHPNAVSAYDYIFLWDEDLGVENFH  176

Query  833   PARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  657
               RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  CS+ES G
Sbjct  177   LGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHRRVYDFRGSLNCSDESTG  236

Query  656   PPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYL  477
             PPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D EY+
Sbjct  237   PPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDVEYI  296

Query  476   VHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWV  297
             VH GI SLGG S+ +A S       +++DLR  IRRQST EL+ FKERW++A ++DK W 
Sbjct  297   VHQGIPSLGGGSVNKAPS-------KSLDLRAHIRRQSTAELEKFKERWDQAARKDKEWF  349

Query  296   DPYKASQRYR  267
             DP++   R +
Sbjct  350   DPFEGYARIK  359



>gb|KDO75810.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=332

 Score =   432 bits (1110),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 229/284 (81%), Gaps = 0/284 (0%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  522
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQ
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQ  306



>ref|XP_010278339.1| PREDICTED: uncharacterized protein LOC104612579 isoform X5 [Nelumbo 
nucifera]
Length=299

 Score =   431 bits (1107),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 201/294 (68%), Positives = 240/294 (82%), Gaps = 14/294 (5%)
 Frame = -3

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             LPRGI++S SD+E++PL   S SK KVN+    +LLA+P GIKQK  V+ I+QKF+SENF
Sbjct  16    LPRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLAIPAGIKQKRYVDAIVQKFVSENF  75

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
             T++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFAKRFLHPDVVS+YDYIFLWDEDL 
Sbjct  76    TVVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFAKRFLHPDVVSVYDYIFLWDEDLR  135

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  669
             V+NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT+R ++   HRRVY  +GS KCS+
Sbjct  136   VDNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRITIRKKSKILHRRVYDRRGSVKCSD  195

Query  668   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  489
              S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++D
Sbjct  196   ASQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVID  255

Query  488   SEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLR----VEIRRQSTYELQIFK  339
             SE++VH GIQ+LGGSS ++ S           D+R    ++IRRQST +L+IF+
Sbjct  256   SEFIVHKGIQTLGGSSARKVSK----------DIRGNNSMQIRRQSTLDLRIFR  299



>ref|XP_006449264.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62504.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=347

 Score =   432 bits (1110),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 228/284 (80%), Gaps = 0/284 (0%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  522
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQ
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQ  306



>ref|NP_001060006.1| Os07g0564800 [Oryza sativa Japonica Group]
 dbj|BAC79660.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAD30106.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAF21920.1| Os07g0564800 [Oryza sativa Japonica Group]
 dbj|BAG94802.1| unnamed protein product [Oryza sativa Japonica Group]
Length=390

 Score =   431 bits (1107),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 212/372 (57%), Positives = 267/372 (72%), Gaps = 25/372 (7%)
 Frame = -3

Query  1316  LYRTTIYQYQQAEMESKSDPLYSAE-----DSCVTGRSSSS---LPRGIIESRSDLELKP  1161
             +Y    YQ++Q ++E+KS P  +        S V+ RS++    LP GI+E  SD+ELKP
Sbjct  18    VYNMASYQHKQTKLEAKSRPFDTITVSDKVSSKVSKRSANRVGFLPHGIVEPYSDMELKP  77

Query  1160  LKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWD  981
             L     ++SK +      LLA+P GI QK +V+ I++KFL ENFT++LFHYDGNVDGW D
Sbjct  78    LWLTRSAQSKDSSQKDRCLLAIPAGIDQKRSVDAIMKKFLPENFTVMLFHYDGNVDGWND  137

Query  980   LAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSE  801
             L WSK  IHI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NFHP RYL IVKSE
Sbjct  138   LPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFHPRRYLNIVKSE  197

Query  800   GLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAP  621
             GLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  C+   EGPPCSG+VEGMAP
Sbjct  198   GLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCAK--EGPPCSGWVEGMAP  253

Query  620   VFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  441
             VFSRSAWRC WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+LGG S
Sbjct  254   VFSRSAWRCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTLGGPS  313

Query  440   LKR-------------ASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             +KR             A + Q++     +D+R ++RR S  EL+ F++RWE A +ED+ W
Sbjct  314   VKRSHGKNNDPLHQKTAEAQQQMRVKAGLDMRTKVRRYSRSELRDFQKRWERATREDRAW  373

Query  299   VDPYKASQRYRK  264
             VDP+   +R RK
Sbjct  374   VDPFARPRRKRK  385



>ref|XP_002439080.1| hypothetical protein SORBIDRAFT_10g031220 [Sorghum bicolor]
 gb|EER90447.1| hypothetical protein SORBIDRAFT_10g031220 [Sorghum bicolor]
Length=380

 Score =   426 bits (1096),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 251/314 (80%), Gaps = 8/314 (3%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHN-LLAMPVGIKQKDNVNEIIQKFL  1041
             + SLPRGI++  SD+ L+PL     + +  N  G H+ LLAM VGI Q  NV+ + +KFL
Sbjct  73    ADSLPRGIVQRHSDMSLRPLWEDDAASTHKNKNGDHSALLAMAVGISQIKNVDTMARKFL  132

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
              EN+ ++LFHYDGNVDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWD
Sbjct  133   KENYAVMLFHYDGNVDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWD  192

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGS  684
             EDLGVE+F+P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S
Sbjct  193   EDLGVESFNPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKMTKVHRRIYDNRPS  252

Query  683   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  504
               CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  
Sbjct  253   MNCSDESKGPPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEK  312

Query  503   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FKERW  
Sbjct  313   VGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKERWNR  366

Query  323   AVKEDKNWVDPYKA  282
             AV+ED+ W DP+ +
Sbjct  367   AVREDEGWKDPFDS  380



>gb|EEC77985.1| hypothetical protein OsI_17370 [Oryza sativa Indica Group]
Length=535

 Score =   432 bits (1110),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 212/372 (57%), Positives = 267/372 (72%), Gaps = 25/372 (7%)
 Frame = -3

Query  1316  LYRTTIYQYQQAEMESKSDPLYSAE-----DSCVTGRSSSS---LPRGIIESRSDLELKP  1161
             +Y    YQ++Q ++E+KS P  +        S V+ RS++    LP GI+E  SD+ELKP
Sbjct  163   VYNMASYQHKQTKLEAKSRPFDTITVSDKVSSKVSKRSANRVGFLPHGIVEPYSDMELKP  222

Query  1160  LKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWD  981
             L     ++SK +      LLA+P GI QK +V+ I++KFL ENFT++LFHYDGNVDGW D
Sbjct  223   LWLTRSAQSKDSSQKDRCLLAIPAGIDQKRSVDAIMKKFLPENFTVMLFHYDGNVDGWND  282

Query  980   LAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSE  801
             L WSK  IHI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NFHP RYL IVKSE
Sbjct  283   LPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFHPRRYLNIVKSE  342

Query  800   GLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAP  621
             GLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  C+   EGPPCSG+VEGMAP
Sbjct  343   GLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCAK--EGPPCSGWVEGMAP  398

Query  620   VFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  441
             VFSRSAWRC WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+LGG S
Sbjct  399   VFSRSAWRCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTLGGPS  458

Query  440   LKR-------------ASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             +KR             A + Q++     +D+R ++RR S  EL+ F++RWE A +ED+ W
Sbjct  459   VKRSHGKNNDPLHQKTAEAQQQMRVKAGLDMRTKVRRYSRSELRDFQKRWERATREDRAW  518

Query  299   VDPYKASQRYRK  264
             VDP+   +R RK
Sbjct  519   VDPFARPRRKRK  530



>ref|XP_006657845.1| PREDICTED: uncharacterized protein LOC102704159 isoform X2 [Oryza 
brachyantha]
Length=387

 Score =   426 bits (1095),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 266/373 (71%), Gaps = 22/373 (6%)
 Frame = -3

Query  1328  MLFILYRTTIYQYQQAEMESKSDPLYSAEDS-----CVTGRSSSS---LPRGIIESRSDL  1173
             ++F++Y    YQ++Q  +E+KS P  +   S      V  RS+     LP GI+E  SD+
Sbjct  14    IIFLVYNMASYQHRQTTLEAKSRPFDTITVSDKVPGKVPKRSADRVGFLPHGIVEPYSDM  73

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL     ++SK +      L+A+P GI QK +V+ I++KFL ENFT++LFHYDGNVD
Sbjct  74    ELKPLWLTRSAQSKESSQNDRCLIAIPAGINQKKSVDAILKKFLPENFTVMLFHYDGNVD  133

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
             GW DL WS+  +HI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NF+P RYL I
Sbjct  134   GWNDLPWSRSVVHISASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFNPRRYLNI  193

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKSEGLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  CS   EGPPCSG+VE
Sbjct  194   VKSEGLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCS--KEGPPCSGWVE  249

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS+SAW+C WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+L
Sbjct  250   GMAPVFSKSAWQCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTL  309

Query  452   GGSSLKRASSPQELPKGR----------AVDLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             GGSS KR       P G+           +D+R ++RR S  EL+ F++RWE A +ED+ 
Sbjct  310   GGSSSKRTHGKNIDPHGQTTVEAQQVRTGLDMRTKVRRNSRLELRDFQKRWERAAREDRA  369

Query  302   WVDPYKASQRYRK  264
             WVDP+  S+R  K
Sbjct  370   WVDPFARSRRKGK  382



>ref|XP_006657844.1| PREDICTED: uncharacterized protein LOC102704159 isoform X1 [Oryza 
brachyantha]
Length=408

 Score =   426 bits (1096),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 209/373 (56%), Positives = 266/373 (71%), Gaps = 22/373 (6%)
 Frame = -3

Query  1328  MLFILYRTTIYQYQQAEMESKSDPLYSAEDS-----CVTGRSSSS---LPRGIIESRSDL  1173
             ++F++Y    YQ++Q  +E+KS P  +   S      V  RS+     LP GI+E  SD+
Sbjct  35    IIFLVYNMASYQHRQTTLEAKSRPFDTITVSDKVPGKVPKRSADRVGFLPHGIVEPYSDM  94

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             ELKPL     ++SK +      L+A+P GI QK +V+ I++KFL ENFT++LFHYDGNVD
Sbjct  95    ELKPLWLTRSAQSKESSQNDRCLIAIPAGINQKKSVDAILKKFLPENFTVMLFHYDGNVD  154

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
             GW DL WS+  +HI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NF+P RYL I
Sbjct  155   GWNDLPWSRSVVHISASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFNPRRYLNI  214

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             VKSEGLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  CS   EGPPCSG+VE
Sbjct  215   VKSEGLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCS--KEGPPCSGWVE  270

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
             GMAPVFS+SAW+C WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+L
Sbjct  271   GMAPVFSKSAWQCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTL  330

Query  452   GGSSLKRASSPQELPKGR----------AVDLRVEIRRQSTYELQIFKERWEEAVKEDKN  303
             GGSS KR       P G+           +D+R ++RR S  EL+ F++RWE A +ED+ 
Sbjct  331   GGSSSKRTHGKNIDPHGQTTVEAQQVRTGLDMRTKVRRNSRLELRDFQKRWERAAREDRA  390

Query  302   WVDPYKASQRYRK  264
             WVDP+  S+R  K
Sbjct  391   WVDPFARSRRKGK  403



>ref|XP_006574636.1| PREDICTED: uncharacterized protein LOC100807505 isoform X2 [Glycine 
max]
 ref|XP_006574637.1| PREDICTED: uncharacterized protein LOC100807505 isoform X3 [Glycine 
max]
Length=396

 Score =   425 bits (1093),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 216/373 (58%), Positives = 265/373 (71%), Gaps = 26/373 (7%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QK            
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQK------------  131

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
                 VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  132   ----VDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  187

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  654
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  188   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  247

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQG RT  VG+VDSEY+ 
Sbjct  248   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQGRRTKKVGVVDSEYVF  307

Query  473   HLGIQSLGGSSLKRASSPQELPK------GRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             H GIQ+LGGS   R +   +L K      G  +D+R EIRRQST E +IF+ERW +A+ E
Sbjct  308   HKGIQTLGGSG-HRMTKVSKLQKTTMKQGGVGIDVRTEIRRQSTREFEIFQERWNQAISE  366

Query  311   DKNWVDPYKASQR  273
             DK WVDP+K+ QR
Sbjct  367   DKTWVDPFKSDQR  379



>ref|NP_001130789.1| uncharacterized protein LOC100191893 [Zea mays]
 gb|ACF79143.1| unknown [Zea mays]
 gb|ACG29211.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 gb|ACR36421.1| unknown [Zea mays]
 gb|AFW69653.1| lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
Length=372

 Score =   424 bits (1090),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 198/314 (63%), Positives = 250/314 (80%), Gaps = 8/314 (3%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             + SLPRGI+   SD+ L+PL +  + S  K   + Y  LLAM VGI Q  N++ + +KFL
Sbjct  65    AHSLPRGIVHRHSDMSLRPLWEDDTASTHKNKNSDYSALLAMAVGISQIKNIDTMARKFL  124

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
              EN+ ++LFHYDGNVDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWD
Sbjct  125   KENYAVMLFHYDGNVDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWD  184

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGS  684
             EDLGVENF+P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S
Sbjct  185   EDLGVENFNPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKMAKVHRRIYDNRPS  244

Query  683   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  504
               CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  
Sbjct  245   MNCSDESKGPPCTGWVEGMAPVFSRTAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEK  304

Query  503   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FKERW  
Sbjct  305   VGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKERWNR  358

Query  323   AVKEDKNWVDPYKA  282
             AV+ED+ W DP+ +
Sbjct  359   AVREDEGWRDPFDS  372



>ref|XP_004958045.1| PREDICTED: uncharacterized protein LOC101761432 isoform X2 [Setaria 
italica]
Length=392

 Score =   424 bits (1089),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 210/383 (55%), Positives = 268/383 (70%), Gaps = 27/383 (7%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAE--DSCVTGRSSSS-----  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P  +    D      S  +     
Sbjct  1     MKLRLHLLVLCVIIVFLVYNMANFQHKQTSLEAKSRPFDTVTVFDRAAVKVSQKAVARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GI+ES SD+ELKPL   + ++S+ +      L+A+  GI QK  V+ II+KFL EN
Sbjct  61    YLPHGIVESNSDMELKPLWLTTSAESQKSKQNDQFLIAIAAGINQKKTVDAIIKKFLPEN  120

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWDEDL
Sbjct  121   FTAMLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYQYIFLWDEDL  180

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
              V+NF+P RYL IVKSEGLEISQP LD K   IHHRITVR RT  FHRRV   + + +CS
Sbjct  181   EVDNFNPRRYLNIVKSEGLEISQPGLDSKLSEIHHRITVRKRTGSFHRRV--SRANKECS  238

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  239   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  296

Query  491   DSEYLVHLGIQSLGGSSL----KRASSPQEL---------PKGRA--VDLRVEIRRQSTY  357
             DSE++VH G+Q+LGGS+      R    Q+L          +GRA  +D+R +IRR+S  
Sbjct  297   DSEFIVHRGVQTLGGSTTTKDGTRGKKAQQLRQKDAQVQKTRGRAAGLDMRTKIRRKSRS  356

Query  356   ELQIFKERWEEAVKEDKNWVDPY  288
             EL+ F++RW+ A +ED+ WVDP+
Sbjct  357   ELRDFQKRWDRAAREDRTWVDPF  379



>ref|XP_006574638.1| PREDICTED: uncharacterized protein LOC100807505 isoform X4 [Glycine 
max]
Length=380

 Score =   423 bits (1087),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 211/367 (57%), Positives = 260/367 (71%), Gaps = 30/367 (8%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  654
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQ                
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQ----------------  307

Query  473   HLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVD  294
                +  L  +++K+         G  +D+R EIRRQST E +IF+ERW +A+ EDK WVD
Sbjct  308   ---VSKLQKTTMKQG--------GVGIDVRTEIRRQSTREFEIFQERWNQAISEDKTWVD  356

Query  293   PYKASQR  273
             P+K+ QR
Sbjct  357   PFKSDQR  363



>ref|XP_004958044.1| PREDICTED: uncharacterized protein LOC101761432 isoform X1 [Setaria 
italica]
Length=395

 Score =   423 bits (1088),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 211/386 (55%), Positives = 268/386 (69%), Gaps = 30/386 (8%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAE--DSCVTGRSSSS-----  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P  +    D      S  +     
Sbjct  1     MKLRLHLLVLCVIIVFLVYNMANFQHKQTSLEAKSRPFDTVTVFDRAAVKVSQKAVARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHN---LLAMPVGIKQKDNVNEIIQKFL  1041
              LP GI+ES SD+ELKPL   + ++S+       N   L+A+  GI QK  V+ II+KFL
Sbjct  61    YLPHGIVESNSDMELKPLWLTTSAESQFQQKSKQNDQFLIAIAAGINQKKTVDAIIKKFL  120

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
              ENFT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWD
Sbjct  121   PENFTAMLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYQYIFLWD  180

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDL V+NF+P RYL IVKSEGLEISQP LD K   IHHRITVR RT  FHRRV   + + 
Sbjct  181   EDLEVDNFNPRRYLNIVKSEGLEISQPGLDSKLSEIHHRITVRKRTGSFHRRV--SRANK  238

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +CS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+
Sbjct  239   ECSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNI  296

Query  500   GIVDSEYLVHLGIQSLGGSSL----KRASSPQEL---------PKGRA--VDLRVEIRRQ  366
             G+VDSE++VH G+Q+LGGS+      R    Q+L          +GRA  +D+R +IRR+
Sbjct  297   GVVDSEFIVHRGVQTLGGSTTTKDGTRGKKAQQLRQKDAQVQKTRGRAAGLDMRTKIRRK  356

Query  365   STYELQIFKERWEEAVKEDKNWVDPY  288
             S  EL+ F++RW+ A +ED+ WVDP+
Sbjct  357   SRSELRDFQKRWDRAAREDRTWVDPF  382



>ref|XP_009396162.1| PREDICTED: uncharacterized protein LOC103981234 [Musa acuminata 
subsp. malaccensis]
Length=265

 Score =   418 bits (1074),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 192/271 (71%), Positives = 230/271 (85%), Gaps = 7/271 (3%)
 Frame = -3

Query  1097  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  918
             M VGI QK+NV+  ++KFL EN +IILFHYDGNVDGW DL W+ +A+HIVA +QTKWWFA
Sbjct  1     MAVGILQKENVDCTVRKFLIENCSIILFHYDGNVDGWHDLQWNNKAVHIVARNQTKWWFA  60

Query  917   KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRI  741
             KRFLHPDVVS+YDYIFLWDEDLGVENFHP RYL ++ SEGLEISQPALDP  S  IHHRI
Sbjct  61    KRFLHPDVVSVYDYIFLWDEDLGVENFHPGRYLHVMSSEGLEISQPALDPDLSSDIHHRI  120

Query  740   TVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVH  561
             TVR+R  K HRR+Y  +GS +CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDLVH
Sbjct  121   TVRNRMTKVHRRIYDQRGSLRCSDESKGPPCTGWVEGMAPVFSRAAWQCVWHLIQNDLVH  180

Query  560   GWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRV  381
             GWG+DMKLGYCAQGDRT  VG++D+E++VH+GI SLGGSS+ +AS+       R++DLR 
Sbjct  181   GWGLDMKLGYCAQGDRTEKVGVIDTEFIVHMGIPSLGGSSINKASNH------RSLDLRT  234

Query  380   EIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
              IRRQST EL+IFK RW +AV ED+ WVDP+
Sbjct  235   HIRRQSTAELKIFKARWNKAVNEDREWVDPF  265



>ref|XP_006657376.1| PREDICTED: uncharacterized protein LOC102704535 [Oryza brachyantha]
Length=369

 Score =   422 bits (1084),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 195/314 (62%), Positives = 249/314 (79%), Gaps = 8/314 (3%)
 Frame = -3

Query  1220  SSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             +   LPRGI+ S SD+ L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL
Sbjct  63    AEGQLPRGIVHSHSDMYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFL  121

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             ++N+T++LFHYDGNVDGW +L WS +A+HI+AH+QTKWWFAKRFLHPDVV+IY++IFLWD
Sbjct  122   NQNYTVMLFHYDGNVDGWRNLEWSDKAVHILAHNQTKWWFAKRFLHPDVVAIYNFIFLWD  181

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGS  684
             EDLGV+NF P RYL+I+ SEGLEI+QPALDP  S  IHHRIT R++  K HRR+Y ++ S
Sbjct  182   EDLGVDNFDPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITTRNKMTKVHRRIYDNRAS  241

Query  683   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  504
               CS+ES+GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDR   
Sbjct  242   MNCSDESKGPPCTGWVEGMAPVFSRNAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRAEK  301

Query  503   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FK+RW  
Sbjct  302   VGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKQRWNI  355

Query  323   AVKEDKNWVDPYKA  282
             AV+ED+ W DP++A
Sbjct  356   AVREDEEWTDPFEA  369



>ref|XP_004966564.1| PREDICTED: uncharacterized protein LOC101765020 isoform X1 [Setaria 
italica]
Length=374

 Score =   422 bits (1084),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 198/313 (63%), Positives = 252/313 (81%), Gaps = 8/313 (3%)
 Frame = -3

Query  1214  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHN-LLAMPVGIKQKDNVNEIIQKFLS  1038
             +SLPRGI+E  SD+ L+PL   S + +  N     + LLAM VGI Q  NV+ + +KFL 
Sbjct  68    NSLPRGIVERHSDMYLRPLWDDSAAATHKNKNDDPSALLAMAVGISQIKNVDTMARKFLK  127

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
             EN+ ++LFHYDGNVDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWDE
Sbjct  128   ENYAVMLFHYDGNVDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWDE  187

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGST  681
             DLGV+NF+P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++ +K HRR+Y ++ S 
Sbjct  188   DLGVDNFNPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKLSKVHRRIYDNRPSM  247

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
              CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  V
Sbjct  248   NCSDESKGPPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEKV  307

Query  500   GIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEA  321
             G++DSEY+VH GI SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FKERW  A
Sbjct  308   GVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKERWNRA  361

Query  320   VKEDKNWVDPYKA  282
             V+ED+ W DP+++
Sbjct  362   VREDEGWRDPFES  374



>ref|XP_008668561.1| PREDICTED: uncharacterized protein LOC100502312 isoform X1 [Zea 
mays]
Length=392

 Score =   421 bits (1081),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 208/397 (52%), Positives = 274/397 (69%), Gaps = 33/397 (8%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPR----  1200
             MK    + + CV ++F++Y    +Q++Q   E+KS P    +   V+ R +  LP+    
Sbjct  1     MKLRLHLLVLCVIIIFLVYNMASFQHKQTSSEAKSHPF---DTVTVSDRDAVKLPQKAEV  57

Query  1199  -------GIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
                    GI+ES SD++LKPL   + ++SK +    H L+A+  GI QK +V+ I++KFL
Sbjct  58    RIGYLPHGIVESNSDMKLKPLWLTTSAQSKKSKQKDHFLIAIAAGINQKKSVDAIMKKFL  117

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
              ENFT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWD
Sbjct  118   PENFTAVLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYQYIFLWD  177

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDL V+NF+P RYL IV+SEGLEISQP LD K   IHHRITVR  T  FHRRV   + + 
Sbjct  178   EDLEVDNFNPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKNTGTFHRRV--SRANK  235

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C    EGPPCSG+VEGMAPVFS+ AW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+
Sbjct  236   RCLR--EGPPCSGWVEGMAPVFSKYAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNI  293

Query  500   GIVDSEYLVHLGIQSLGGS-------------SLKRASSPQELPKGR--AVDLRVEIRRQ  366
             G+VDSE++VH G+Q+LGGS             SL++ ++  +  +GR   +D+R +IRR+
Sbjct  294   GVVDSEFIVHRGVQTLGGSTITKDGIRGKNAQSLRQKAAQVQKSRGRDPGLDMRTKIRRK  353

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTWN  255
             S  EL+ F++RW  A +ED+ WVDP+  S+R R+  N
Sbjct  354   SRSELRDFQKRWARAAREDRTWVDPFAHSRRKRRNRN  390



>dbj|BAJ99055.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 198/315 (63%), Positives = 249/315 (79%), Gaps = 9/315 (3%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHN-LLAMPVGIKQKDNVNEIIQKF  1044
             +  LPRGI+E+ SD+ L+PL  + +   S  N    H  LLAM VGI Q  NV+ + +KF
Sbjct  80    AEGLPRGIVETSSDMFLRPLWDSTAKHASAKNKHDQHKALLAMAVGISQMQNVDIMARKF  139

Query  1043  LSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLW  864
             L+E++T++LFHYDGNVDGW  L WS +AIHI+A +QTKWWFAKRFLHP VV+IYD+IFLW
Sbjct  140   LNESYTVMLFHYDGNVDGWRSLEWSDKAIHILAPNQTKWWFAKRFLHPSVVAIYDFIFLW  199

Query  863   DEDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKG  687
             DEDLGVENF P RY++I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRRVY ++ 
Sbjct  200   DEDLGVENFDPRRYIDIMVSEGLEITQPALDPDLSTDIHHRITIRNKLTKVHRRVYDNRS  259

Query  686   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  507
             S  CS++S GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDR  
Sbjct  260   SMNCSDDSRGPPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRAE  319

Query  506   NVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWE  327
              VG++DSEY+VH GI SLGG      S   +LP+ R++DLR  IRRQS+ EL++FKERWE
Sbjct  320   KVGVIDSEYVVHQGIPSLGGP-----SDTSKLPR-RSMDLRTHIRRQSSAELEMFKERWE  373

Query  326   EAVKEDKNWVDPYKA  282
             +AV+ED  W+DP+ A
Sbjct  374   KAVREDDEWMDPFDA  388



>ref|XP_008650832.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=392

 Score =   420 bits (1079),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 207/383 (54%), Positives = 269/383 (70%), Gaps = 27/383 (7%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FHRRV   + + KCS
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHRRV--SRANKKCS  238

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  239   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  296

Query  491   DSEYLVHLGIQSLGGSS-------------LKRASSPQELPKGRA--VDLRVEIRRQSTY  357
             DSE++VH G+Q+LGGS+             L + ++  +  +GRA  +D+R +IRR+S  
Sbjct  297   DSEFIVHRGVQTLGGSTITKDGIRGKNAKPLGQKAAQIQRSRGRAPGLDMRTKIRRKSRS  356

Query  356   ELQIFKERWEEAVKEDKNWVDPY  288
             EL+ F++RW+ A +ED+ WVDP+
Sbjct  357   ELRDFQKRWDRAAREDRTWVDPF  379



>ref|NP_001058667.1| Os06g0731900 [Oryza sativa Japonica Group]
 dbj|BAD62499.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAF20581.1| Os06g0731900 [Oryza sativa Japonica Group]
 dbj|BAG89051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=360

 Score =   416 bits (1070),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 200/357 (56%), Positives = 259/357 (73%), Gaps = 11/357 (3%)
 Frame = -3

Query  1346  GLFCVSMLFILYRTTIYQY---QQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSD  1176
             GL  V +  I+  +   Q+   ++  +        +  D       +  LPRGI+ S SD
Sbjct  9     GLLAVVVTLIVLASLQIQFHHLKEDRLTGDRTFATTTTDPVHWRTGAEGLPRGIVHSNSD  68

Query  1175  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  996
             + L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL++N+T++LFHYDGNV
Sbjct  69    MYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFLNQNYTVMLFHYDGNV  127

Query  995   DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  816
             DGW +L WS +AIHI+A +QTKWWFAKRFLHPDVV+IY +IFLWDEDLGV+NF P RYL+
Sbjct  128   DGWHNLEWSDKAIHILARNQTKWWFAKRFLHPDVVAIYGFIFLWDEDLGVDNFDPRRYLD  187

Query  815   IVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  639
             I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ S+GPPC+G+
Sbjct  188   IMVSEGLEITQPALDPDLSTDIHHRITIRNKMMKVHRRIYDNRASMNCSDGSKGPPCTGW  247

Query  638   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  459
             VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDR   VG++DSEY+VH GI 
Sbjct  248   VEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRAEKVGVIDSEYVVHQGIP  307

Query  458   SLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FKERW  AV+ED+ W DP+
Sbjct  308   SLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKERWNRAVREDEEWTDPF  358



>tpg|DAA63157.1| TPA: hypothetical protein ZEAMMB73_938040 [Zea mays]
Length=410

 Score =   416 bits (1070),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 209/401 (52%), Positives = 270/401 (67%), Gaps = 45/401 (11%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDP---------LYSAEDSCVTGRSS  1215
             MK    + + CV ++F++Y    +Q++Q  +E+KS P         L+   D C+  +  
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTRQVFLFLNYDMCLQCKHQ  60

Query  1214  SS-----------------LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVG  1086
              S                 LP GI+ES SD++LKPL   + ++SK      + L+A+  G
Sbjct  61    VSDRDAVKVPQKAEARIGYLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAG  120

Query  1085  IKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFL  906
             I QK  V+ I++KFL ENFT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFL
Sbjct  121   INQKKTVDAIMKKFLPENFTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFL  180

Query  905   HPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSR  726
             HP VVSIY YIFLWDEDL V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +
Sbjct  181   HPAVVSIYQYIFLWDEDLEVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKK  240

Query  725   TNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMD  546
                FHRRV   + + KCS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D
Sbjct  241   AGTFHRRV--SRANKKCSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGID  296

Query  545   MKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS-------------LKRASSPQELPK  405
              K GYCAQGDRT N+G+VDSE++VH G+Q+LGGS+             L + ++  +  +
Sbjct  297   YKFGYCAQGDRTKNIGVVDSEFIVHRGVQTLGGSTITKDGIRGKNAKPLGQKAAQIQRSR  356

Query  404   GRA--VDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             GRA  +D+R +IRR+S  EL+ F++RW+ A +ED+ WVDP+
Sbjct  357   GRAPGLDMRTKIRRKSRSELRDFQKRWDRAAREDRTWVDPF  397



>ref|XP_008668562.1| PREDICTED: uncharacterized protein LOC100502312 isoform X2 [Zea 
mays]
Length=391

 Score =   416 bits (1068),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 206/397 (52%), Positives = 272/397 (69%), Gaps = 34/397 (9%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPR----  1200
             MK    + + CV ++F++Y    +Q++Q   E+KS P    +   V+ R +  LP+    
Sbjct  1     MKLRLHLLVLCVIIIFLVYNMASFQHKQTSSEAKSHPF---DTVTVSDRDAVKLPQKAEV  57

Query  1199  -------GIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
                    GI+ES SD++LKPL   + ++SK +    H L+A+  GI QK +V+ I++KFL
Sbjct  58    RIGYLPHGIVESNSDMKLKPLWLTTSAQSKKSKQKDHFLIAIAAGINQKKSVDAIMKKFL  117

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
              ENFT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWD
Sbjct  118   PENFTAVLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYQYIFLWD  177

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDL V+NF+P RYL IV+SEGLEISQP LD K   IHHRITVR  T  FHR     + + 
Sbjct  178   EDLEVDNFNPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKNTGTFHR---VSRANK  234

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C    EGPPCSG+VEGMAPVFS+ AW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+
Sbjct  235   RCLR--EGPPCSGWVEGMAPVFSKYAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNI  292

Query  500   GIVDSEYLVHLGIQSLGGS-------------SLKRASSPQELPKGR--AVDLRVEIRRQ  366
             G+VDSE++VH G+Q+LGGS             SL++ ++  +  +GR   +D+R +IRR+
Sbjct  293   GVVDSEFIVHRGVQTLGGSTITKDGIRGKNAQSLRQKAAQVQKSRGRDPGLDMRTKIRRK  352

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTWN  255
             S  EL+ F++RW  A +ED+ WVDP+  S+R R+  N
Sbjct  353   SRSELRDFQKRWARAAREDRTWVDPFAHSRRKRRNRN  389



>ref|XP_008650833.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=391

 Score =   414 bits (1065),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 205/383 (54%), Positives = 267/383 (70%), Gaps = 28/383 (7%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FHR     + + KCS
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHR---VSRANKKCS  237

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  238   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  295

Query  491   DSEYLVHLGIQSLGGSS-------------LKRASSPQELPKGRA--VDLRVEIRRQSTY  357
             DSE++VH G+Q+LGGS+             L + ++  +  +GRA  +D+R +IRR+S  
Sbjct  296   DSEFIVHRGVQTLGGSTITKDGIRGKNAKPLGQKAAQIQRSRGRAPGLDMRTKIRRKSRS  355

Query  356   ELQIFKERWEEAVKEDKNWVDPY  288
             EL+ F++RW+ A +ED+ WVDP+
Sbjct  356   ELRDFQKRWDRAAREDRTWVDPF  378



>ref|XP_008650835.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=397

 Score =   414 bits (1063),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 207/387 (53%), Positives = 269/387 (70%), Gaps = 30/387 (8%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKD----KGS  684
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FH  VY D    + +
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFH-SVYFDRRVSRAN  239

Query  683   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  504
              KCS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N
Sbjct  240   KKCSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKN  297

Query  503   VGIVDSEYLVHLGIQSLGGSS-------------LKRASSPQELPKGRA--VDLRVEIRR  369
             +G+VDSE++VH G+Q+LGGS+             L + ++  +  +GRA  +D+R +IRR
Sbjct  298   IGVVDSEFIVHRGVQTLGGSTITKDGIRGKNAKPLGQKAAQIQRSRGRAPGLDMRTKIRR  357

Query  368   QSTYELQIFKERWEEAVKEDKNWVDPY  288
             +S  EL+ F++RW+ A +ED+ WVDP+
Sbjct  358   KSRSELRDFQKRWDRAAREDRTWVDPF  384



>ref|XP_006574639.1| PREDICTED: uncharacterized protein LOC100807505 isoform X5 [Glycine 
max]
Length=358

 Score =   410 bits (1054),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 239/310 (77%), Gaps = 3/310 (1%)
 Frame = -3

Query  1370  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1191
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  654
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQG RT  VG+VDSEY+ 
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQGRRTKKVGVVDSEYVF  323

Query  473   HLGIQSLGGS  444
             H GIQ+LGGS
Sbjct  324   HKGIQTLGGS  333



>gb|AFW69650.1| hypothetical protein ZEAMMB73_069164 [Zea mays]
Length=294

 Score =   407 bits (1047),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 190/300 (63%), Positives = 240/300 (80%), Gaps = 8/300 (3%)
 Frame = -3

Query  1175  LELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  999
             + L+PL +  + S  K   + Y  LLAM VGI Q  N++ + +KFL EN+ ++LFHYDGN
Sbjct  1     MSLRPLWEDDTASTHKNKNSDYSALLAMAVGISQIKNIDTMARKFLKENYAVMLFHYDGN  60

Query  998   VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  819
             VDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWDEDLGVENF+P RYL
Sbjct  61    VDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWDEDLGVENFNPRRYL  120

Query  818   EIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSG  642
             +I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ES+GPPC+G
Sbjct  121   DIMVSEGLEITQPALDPDLSTDIHHRITIRNKMAKVHRRIYDNRPSMNCSDESKGPPCTG  180

Query  641   FVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGI  462
             +VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++DSEY+VH GI
Sbjct  181   WVEGMAPVFSRTAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEKVGVIDSEYVVHQGI  240

Query  461   QSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKA  282
              SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FKERW  AV+ED+ W DP+ +
Sbjct  241   PSLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKERWNRAVREDEGWRDPFDS  294



>dbj|BAD62500.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAG93400.1| unnamed protein product [Oryza sativa Japonica Group]
Length=359

 Score =   409 bits (1050),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 199/357 (56%), Positives = 258/357 (72%), Gaps = 12/357 (3%)
 Frame = -3

Query  1346  GLFCVSMLFILYRTTIYQY---QQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSD  1176
             GL  V +  I+  +   Q+   ++  +        +  D       +  LPRGI+ S SD
Sbjct  9     GLLAVVVTLIVLASLQIQFHHLKEDRLTGDRTFATTTTDPVHWRTGAEGLPRGIVHSNSD  68

Query  1175  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  996
             + L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL++N+T++LFHYDGNV
Sbjct  69    MYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFLNQNYTVMLFHYDGNV  127

Query  995   DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  816
             DGW +L WS +AIHI+A +QTKW FAKRFLHPDVV+IY +IFLWDEDLGV+NF P RYL+
Sbjct  128   DGWHNLEWSDKAIHILARNQTKW-FAKRFLHPDVVAIYGFIFLWDEDLGVDNFDPRRYLD  186

Query  815   IVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  639
             I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ S+GPPC+G+
Sbjct  187   IMVSEGLEITQPALDPDLSTDIHHRITIRNKMMKVHRRIYDNRASMNCSDGSKGPPCTGW  246

Query  638   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  459
             VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDR   VG++DSEY+VH GI 
Sbjct  247   VEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRAEKVGVIDSEYVVHQGIP  306

Query  458   SLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             SLGG SL  + +P+     R++DLR  IRRQS+ EL+ FKERW  AV+ED+ W DP+
Sbjct  307   SLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKFKERWNRAVREDEEWTDPF  357



>gb|KHN10306.1| hypothetical protein glysoja_040534, partial [Glycine soja]
Length=326

 Score =   407 bits (1045),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 198/326 (61%), Positives = 241/326 (74%), Gaps = 32/326 (10%)
 Frame = -3

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             LP+GII++ SDLEL+ L + S  +SK +V    NLLA+ VGIKQK NV+ ++QKFL +NF
Sbjct  7     LPQGIIQATSDLELRRLWSPSNLRSKASVYSNRNLLAVAVGIKQKHNVDVMVQKFLPDNF  66

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
             TIILFHYD N+DGWWDL+WS +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLG
Sbjct  67    TIILFHYDANLDGWWDLSWSSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLG  126

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  669
             VE+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +G+TKCS+
Sbjct  127   VEHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGNTKCSD  186

Query  668   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  489
              S+GPPC+GFVEGMAPVFSRSAW C WHLI                  QG+RT NVG+VD
Sbjct  187   ASKGPPCTGFVEGMAPVFSRSAWYCTWHLI------------------QGERTQNVGVVD  228

Query  488   SEYLVHLGIQSLGG--------------SSLKRASSPQELPKGRAVDLRVEIRRQSTYEL  351
             SE++VH GIQ+LG               +S        +     A D RVEIRRQST+EL
Sbjct  229   SEFVVHKGIQTLGVLNVILFPLLTHSILTSFSCILYTNQRHGAAAFDQRVEIRRQSTWEL  288

Query  350   QIFKERWEEAVKEDKNWVDPYKASQR  273
             ++F ERW  A+ EDKNWV+P+K+ ++
Sbjct  289   EVFNERWNRAIAEDKNWVNPFKSDKK  314



>ref|XP_010248201.1| PREDICTED: uncharacterized protein LOC104590836 isoform X4 [Nelumbo 
nucifera]
Length=342

 Score =   407 bits (1045),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 245/329 (74%), Gaps = 9/329 (3%)
 Frame = -3

Query  1268  KSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPV  1089
             K+ P ++ ++ C     S +LP+GI+ + +DLE++PL    +  +  NV    NLLA+ V
Sbjct  14    KNRPSHACKNQC-QPYGSEALPKGILSTTADLEMRPLWGTPMKMA--NVKPSMNLLAISV  70

Query  1088  GIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRF  909
             GIKQK+ VN++++KFLS NF I+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRF
Sbjct  71    GIKQKEVVNQMVKKFLSSNFVIMLFHYDGVVDEWRDLEWSDRAVHVSAINQTKWWFAKRF  130

Query  908   LHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRS  729
             LHPD+V+ YDYIF+WDED+GVENFHP RYL I+K EGLEISQPALDP    +HH+ITVR 
Sbjct  131   LHPDIVAGYDYIFVWDEDIGVENFHPGRYLSIIKDEGLEISQPALDPTKSEVHHQITVRG  190

Query  728   RTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  552
             R +K HRR+YK KG  K C N S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG
Sbjct  191   RKSKVHRRIYKLKGKGKRCDNNSTAPPCIGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWG  250

Query  551   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIR  372
             +DM+LGYCAQGDRT NVG+VDSEY+VHLG+ +LG     +A     +     +D R  +R
Sbjct  251   LDMQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVVDENKAPFDSHV-----IDGRSSVR  305

Query  371   RQSTYELQIFKERWEEAVKEDKNWVDPYK  285
             RQS  EL+IF+ RWE+AV+ DK W+DPYK
Sbjct  306   RQSYTELEIFRSRWEKAVEGDKCWIDPYK  334



>ref|XP_010248154.1| PREDICTED: uncharacterized protein LOC104590836 isoform X3 [Nelumbo 
nucifera]
Length=382

 Score =   408 bits (1049),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 200/361 (55%), Positives = 256/361 (71%), Gaps = 16/361 (4%)
 Frame = -3

Query  1346  GLFCVSMLFILYRTTIYQYQQ------AEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1185
              L CV++L I    T   Y+       A    K+ P ++ ++ C     S +LP+GI+ +
Sbjct  23    ALICVALL-IGSAFTARNYKDKFSRWGAVDTQKNRPSHACKNQC-QPYGSEALPKGILST  80

Query  1184  RSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYD  1005
              +DLE++PL    +  +  NV    NLLA+ VGIKQK+ VN++++KFLS NF I+LFHYD
Sbjct  81    TADLEMRPLWGTPMKMA--NVKPSMNLLAISVGIKQKEVVNQMVKKFLSSNFVIMLFHYD  138

Query  1004  GNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPAR  825
             G VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ YDYIF+WDED+GVENFHP R
Sbjct  139   GVVDEWRDLEWSDRAVHVSAINQTKWWFAKRFLHPDIVAGYDYIFVWDEDIGVENFHPGR  198

Query  824   YLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNESEGPPC  648
             YL I+K EGLEISQPALDP    +HH+ITVR R +K HRR+YK KG  K C N S  PPC
Sbjct  199   YLSIIKDEGLEISQPALDPTKSEVHHQITVRGRKSKVHRRIYKLKGKGKRCDNNSTAPPC  258

Query  647   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  468
              G+VE MAPVFSR+AWRC W++IQNDL+H WG+DM+LGYCAQGDRT NVG+VDSEY+VHL
Sbjct  259   IGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWGLDMQLGYCAQGDRTKNVGVVDSEYIVHL  318

Query  467   GIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             G+ +LG     +A     +     +D R  +RRQS  EL+IF+ RWE+AV+ DK W+DPY
Sbjct  319   GLPTLGVVDENKAPFDSHV-----IDGRSSVRRQSYTELEIFRSRWEKAVEGDKCWIDPY  373

Query  287   K  285
             K
Sbjct  374   K  374



>ref|XP_010236939.1| PREDICTED: uncharacterized protein LOC100833044 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010236940.1| PREDICTED: uncharacterized protein LOC100833044 isoform X2 [Brachypodium 
distachyon]
Length=408

 Score =   407 bits (1046),  Expect = 8e-134, Method: Compositional matrix adjust.
 Identities = 208/395 (53%), Positives = 266/395 (67%), Gaps = 44/395 (11%)
 Frame = -3

Query  1328  MLFILYRTTIYQYQQAEMESKSDPLYSAEDS-------------CVTGRSSSS-------  1209
             +LF++Y    YQ++Q  +E+KS P  +  +S              V+GR++         
Sbjct  14    ILFVVYSMASYQHRQTALEAKSRPFDTMIESDGAAVKVSDGAAVKVSGRAAVKVSERAAG  73

Query  1208  ----LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
                 LP GI+E  SD+ELKPL   S  +S+ +      L+A+P GI QK +V+ I++KFL
Sbjct  74    RIGFLPHGIVEPYSDMELKPLWLTSSVQSQKSNQNDRCLIAIPAGINQKKSVDAIMKKFL  133

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
              ENFT ILFHYDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+YDYIFLWD
Sbjct  134   PENFTAILFHYDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYDYIFLWD  193

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDL V+NF+P RYL IVKSE L ISQP LDPK   IHH ITVR +T  FHRRV   + + 
Sbjct  194   EDLEVDNFNPRRYLNIVKSERLVISQPGLDPKLSEIHHPITVRKKTGNFHRRV--SRANK  251

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
              CS   EGPPCSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT ++
Sbjct  252   DCSR--EGPPCSGWVEGMAPVFSKSAWKCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKHI  309

Query  500   GIVDSEYLVHLGIQSLGGSSL---KRASSPQELPKGRA------------VDLRVEIRRQ  366
             G+VDSE++VH G+Q+LGGS++    R  + Q L +  A            +D+R ++RR+
Sbjct  310   GVVDSEFVVHRGVQTLGGSAMTKHTRGKNSQALRQKNAQVQQQTRVRAPGLDMRTKVRRK  369

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKASQRYRKT  261
             S  EL+ F++RWE A +ED+ WVDP+ A +R R T
Sbjct  370   SRVELRDFQKRWERATREDRTWVDPF-ARRRKRMT  403



>ref|XP_010247917.1| PREDICTED: uncharacterized protein LOC104590836 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247971.1| PREDICTED: uncharacterized protein LOC104590836 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248031.1| PREDICTED: uncharacterized protein LOC104590836 isoform X1 [Nelumbo 
nucifera]
Length=438

 Score =   407 bits (1047),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 192/329 (58%), Positives = 245/329 (74%), Gaps = 9/329 (3%)
 Frame = -3

Query  1268  KSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPV  1089
             K+ P ++ ++ C     S +LP+GI+ + +DLE++PL    +  +  NV    NLLA+ V
Sbjct  110   KNRPSHACKNQC-QPYGSEALPKGILSTTADLEMRPLWGTPMKMA--NVKPSMNLLAISV  166

Query  1088  GIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRF  909
             GIKQK+ VN++++KFLS NF I+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRF
Sbjct  167   GIKQKEVVNQMVKKFLSSNFVIMLFHYDGVVDEWRDLEWSDRAVHVSAINQTKWWFAKRF  226

Query  908   LHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRS  729
             LHPD+V+ YDYIF+WDED+GVENFHP RYL I+K EGLEISQPALDP    +HH+ITVR 
Sbjct  227   LHPDIVAGYDYIFVWDEDIGVENFHPGRYLSIIKDEGLEISQPALDPTKSEVHHQITVRG  286

Query  728   RTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  552
             R +K HRR+YK KG  K C N S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG
Sbjct  287   RKSKVHRRIYKLKGKGKRCDNNSTAPPCIGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWG  346

Query  551   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIR  372
             +DM+LGYCAQGDRT NVG+VDSEY+VHLG+ +LG     +A     +     +D R  +R
Sbjct  347   LDMQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVVDENKAPFDSHV-----IDGRSSVR  401

Query  371   RQSTYELQIFKERWEEAVKEDKNWVDPYK  285
             RQS  EL+IF+ RWE+AV+ DK W+DPYK
Sbjct  402   RQSYTELEIFRSRWEKAVEGDKCWIDPYK  430



>gb|EEE66410.1| hypothetical protein OsJ_22755 [Oryza sativa Japonica Group]
Length=381

 Score =   404 bits (1039),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 200/378 (53%), Positives = 259/378 (69%), Gaps = 32/378 (8%)
 Frame = -3

Query  1346  GLFCVSMLFILYRTTIYQY---QQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSD  1176
             GL  V +  I+  +   Q+   ++  +        +  D       +  LPRGI+ S SD
Sbjct  9     GLLAVVVTLIVLASLQIQFHHLKEDRLTGDRTFATTTTDPVHWRTGAEGLPRGIVHSNSD  68

Query  1175  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  996
             + L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL++N+T++LFHYDGNV
Sbjct  69    MYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFLNQNYTVMLFHYDGNV  127

Query  995   DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  816
             DGW +L WS +AIHI+A +QTKWWFAKRFLHPDVV+IY +IFLWDEDLGV+NF P RYL+
Sbjct  128   DGWHNLEWSDKAIHILARNQTKWWFAKRFLHPDVVAIYGFIFLWDEDLGVDNFDPRRYLD  187

Query  815   IVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  639
             I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ S+GPPC+G+
Sbjct  188   IMVSEGLEITQPALDPDLSTDIHHRITIRNKMMKVHRRIYDNRASMNCSDGSKGPPCTGW  247

Query  638   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCA---------------------Q  522
             VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCA                     Q
Sbjct  248   VEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQHMLIENESNQNINECSAMGFQ  307

Query  521   GDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIF  342
             GDR   VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  IRRQS+ EL+ F
Sbjct  308   GDRAEKVGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHIRRQSSAELEKF  361

Query  341   KERWEEAVKEDKNWVDPY  288
             KERW  AV+ED+ W DP+
Sbjct  362   KERWNRAVREDEEWTDPF  379



>gb|EMS62996.1| hypothetical protein TRIUR3_26204 [Triticum urartu]
Length=406

 Score =   404 bits (1037),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/382 (52%), Positives = 260/382 (68%), Gaps = 39/382 (10%)
 Frame = -3

Query  1328  MLFILYRTTIYQYQQAEMESKSDPL-------YSAEDSCVTGRSSSS-------------  1209
             +LF++Y    YQ +Q  ++  + P         +A  +  TGR+++              
Sbjct  15    ILFVVYNMASYQRRQTVLDEDAPPFDTMMGSDRAAVKASGTGRATAKVSHGAASTARVGF  74

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             LP GI+E  SD+ELKPL      +S  +      L+A+P GI QK +V+ +++KFL+ENF
Sbjct  75    LPHGIVEPYSDMELKPLWLTRSVQSPESNQKDRCLIAIPAGINQKKSVDALMKKFLAENF  134

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
             T ILFHYDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWDEDL 
Sbjct  135   TAILFHYDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYKYIFLWDEDLE  194

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  669
             V+NF+P RYL IVKSE LEISQP LDPK   IHH ITVR +T  FHRRV   + +  CS 
Sbjct  195   VDNFNPRRYLNIVKSERLEISQPGLDPKLSEIHHPITVRKKTGSFHRRV--SRANKDCSR  252

Query  668   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  489
               EGPPCSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT N+G+VD
Sbjct  253   --EGPPCSGWVEGMAPVFSKSAWQCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKNIGVVD  310

Query  488   SEYLVHLGIQSLGGSSL-------------KRASSPQELPKGRA--VDLRVEIRRQSTYE  354
             SE++VH G+Q+LGGS++             +R +  Q+  +G+A  +D+R ++RR+S  E
Sbjct  311   SEFVVHRGVQTLGGSAMTKRTRGKSSHALRQRTAQVQQQTRGKAASLDMRTKVRRKSRVE  370

Query  353   LQIFKERWEEAVKEDKNWVDPY  288
             L+ F++RWE A +ED+ W+DP+
Sbjct  371   LRDFQKRWERAAREDRTWIDPF  392



>ref|XP_002265374.2| PREDICTED: uncharacterized protein LOC100255698 isoform X1 [Vitis 
vinifera]
 ref|XP_010657945.1| PREDICTED: uncharacterized protein LOC100255698 isoform X1 [Vitis 
vinifera]
 emb|CBI29673.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   402 bits (1032),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/387 (51%), Positives = 260/387 (67%), Gaps = 25/387 (6%)
 Frame = -3

Query  1379  CRVKMKHMQFIGLFCVSMLFIL-------YRTTIYQYQQAEMESKSDPLYSAEDSCVTGR  1221
             C + +    F G++ ++  F +        R  I  +Q A   S  +   S   +     
Sbjct  20    CSLFIGACLFCGVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPS  79

Query  1220  SSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
              S +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+
Sbjct  80    GSEALPEGIVVKTSNLEVQPLWGATLNGEKSSPS--KSLLAMAVGIKQKEIVNQIVEKFI  137

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
               NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  138   LSNFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWD  197

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS 
Sbjct  198   EDLGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSG  257

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NV
Sbjct  258   RCDDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNV  317

Query  500   GIVDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRA--------VDLRVEIRR  369
             G+VDSEY+VHL + +LG        G     +S  ++LPK  A        VD R  +RR
Sbjct  318   GVVDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVALAQSEFHKVDNRSAVRR  377

Query  368   QSTYELQIFKERWEEAVKEDKNWVDPY  288
             QS  E+QIF+ RW  AVKEDK W+DPY
Sbjct  378   QSFIEMQIFRSRWANAVKEDKCWIDPY  404



>ref|XP_010657947.1| PREDICTED: uncharacterized protein LOC100255698 isoform X3 [Vitis 
vinifera]
Length=408

 Score =   401 bits (1031),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/387 (51%), Positives = 260/387 (67%), Gaps = 25/387 (6%)
 Frame = -3

Query  1379  CRVKMKHMQFIGLFCVSMLFIL-------YRTTIYQYQQAEMESKSDPLYSAEDSCVTGR  1221
             C + +    F G++ ++  F +        R  I  +Q A   S  +   S   +     
Sbjct  15    CSLFIGACLFCGVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPS  74

Query  1220  SSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
              S +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+
Sbjct  75    GSEALPEGIVVKTSNLEVQPLWGATLNGEKSSPS--KSLLAMAVGIKQKEIVNQIVEKFI  132

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
               NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  133   LSNFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWD  192

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS 
Sbjct  193   EDLGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSG  252

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NV
Sbjct  253   RCDDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNV  312

Query  500   GIVDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRA--------VDLRVEIRR  369
             G+VDSEY+VHL + +LG        G     +S  ++LPK  A        VD R  +RR
Sbjct  313   GVVDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVALAQSEFHKVDNRSAVRR  372

Query  368   QSTYELQIFKERWEEAVKEDKNWVDPY  288
             QS  E+QIF+ RW  AVKEDK W+DPY
Sbjct  373   QSFIEMQIFRSRWANAVKEDKCWIDPY  399



>ref|XP_010657946.1| PREDICTED: uncharacterized protein LOC100255698 isoform X2 [Vitis 
vinifera]
Length=410

 Score =   401 bits (1031),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 197/387 (51%), Positives = 260/387 (67%), Gaps = 25/387 (6%)
 Frame = -3

Query  1379  CRVKMKHMQFIGLFCVSMLFIL-------YRTTIYQYQQAEMESKSDPLYSAEDSCVTGR  1221
             C + +    F G++ ++  F +        R  I  +Q A   S  +   S   +     
Sbjct  17    CSLFIGACLFCGVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPS  76

Query  1220  SSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
              S +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+
Sbjct  77    GSEALPEGIVVKTSNLEVQPLWGATLNGEKSSPS--KSLLAMAVGIKQKEIVNQIVEKFI  134

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
               NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  135   LSNFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWD  194

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS 
Sbjct  195   EDLGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSG  254

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NV
Sbjct  255   RCDDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNV  314

Query  500   GIVDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRA--------VDLRVEIRR  369
             G+VDSEY+VHL + +LG        G     +S  ++LPK  A        VD R  +RR
Sbjct  315   GVVDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVALAQSEFHKVDNRSAVRR  374

Query  368   QSTYELQIFKERWEEAVKEDKNWVDPY  288
             QS  E+QIF+ RW  AVKEDK W+DPY
Sbjct  375   QSFIEMQIFRSRWANAVKEDKCWIDPY  401



>gb|EEE67421.1| hypothetical protein OsJ_24761 [Oryza sativa Japonica Group]
Length=437

 Score =   401 bits (1030),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 202/372 (54%), Positives = 252/372 (68%), Gaps = 43/372 (12%)
 Frame = -3

Query  1316  LYRTTIYQYQQAEMESKSDPLYSAE-----DSCVTGRSSSS---LPRGIIESRSDLELKP  1161
             +Y    YQ++Q ++E+KS P  +        S V+ RS++    LP GI+E  SD+ELKP
Sbjct  83    VYNMASYQHKQTKLEAKSRPFDTITVSDKVSSKVSKRSANRVGFLPHGIVEPYSDMELKP  142

Query  1160  LKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWD  981
             L     ++SK +      LLA+P GI QK +V+ I++KFL ENFT++LFHYDGNVDGW D
Sbjct  143   LWLTRSAQSKDSSQKDRCLLAIPAGIDQKRSVDAIMKKFLPENFTVMLFHYDGNVDGWND  202

Query  980   LAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSE  801
             L WSK  IHI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NFHP RYL IVKSE
Sbjct  203   LPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFHPRRYLNIVKSE  262

Query  800   GLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAP  621
             GLEISQP LDPK   IHHRITVR +   FHR                      +VEGMAP
Sbjct  263   GLEISQPGLDPKLSEIHHRITVRKKGWSFHR----------------------WVEGMAP  300

Query  620   VFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  441
             VFSRSAWRC WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+LGG S
Sbjct  301   VFSRSAWRCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTLGGPS  360

Query  440   LKR-------------ASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             +KR             A + Q++     +D+R ++RR S  EL+ F++RWE A +ED+ W
Sbjct  361   VKRSHGKNNDPLHQKTAEAQQQMRVKAGLDMRTKVRRYSRSELRDFQKRWERATREDRAW  420

Query  299   VDPYKASQRYRK  264
             VDP+   +R RK
Sbjct  421   VDPFARPRRKRK  432



>ref|XP_010248082.1| PREDICTED: uncharacterized protein LOC104590836 isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   400 bits (1029),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 191/329 (58%), Positives = 242/329 (74%), Gaps = 22/329 (7%)
 Frame = -3

Query  1268  KSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPV  1089
             K+ P ++ ++ C     S +LP+GI+ + +DLE++PL    +  +  NV    NLLA+ V
Sbjct  110   KNRPSHACKNQC-QPYGSEALPKGILSTTADLEMRPLWGTPMKMA--NVKPSMNLLAISV  166

Query  1088  GIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRF  909
             GIKQK+ VN++++KFLS NF I+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRF
Sbjct  167   GIKQKEVVNQMVKKFLSSNFVIMLFHYDGVVDEWRDLEWSDRAVHVSAINQTKWWFAKRF  226

Query  908   LHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRS  729
             LHPD+V+ YDYIF+WDED+GVENFHP RYL I+K EGLEISQPALDP    +HH+ITVR 
Sbjct  227   LHPDIVAGYDYIFVWDEDIGVENFHPGRYLSIIKDEGLEISQPALDPTKSEVHHQITVRG  286

Query  728   RTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  552
             R +K HRR+YK KG  K C N S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG
Sbjct  287   RKSKVHRRIYKLKGKGKRCDNNSTAPPCIGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWG  346

Query  551   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIR  372
             +DM+LGYCAQGDRT NVG+VDSEY+VHLG+ +LG                  VD   ++R
Sbjct  347   LDMQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLG-----------------VVD-ENKVR  388

Query  371   RQSTYELQIFKERWEEAVKEDKNWVDPYK  285
             RQS  EL+IF+ RWE+AV+ DK W+DPYK
Sbjct  389   RQSYTELEIFRSRWEKAVEGDKCWIDPYK  417



>ref|XP_010236941.1| PREDICTED: uncharacterized protein LOC100833044 isoform X3 [Brachypodium 
distachyon]
Length=400

 Score =   400 bits (1027),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 260/385 (68%), Gaps = 44/385 (11%)
 Frame = -3

Query  1298  YQYQQAEMESKSDPLYSAEDS-------------CVTGRSSSS-----------LPRGII  1191
             YQ++Q  +E+KS P  +  +S              V+GR++             LP GI+
Sbjct  16    YQHRQTALEAKSRPFDTMIESDGAAVKVSDGAAVKVSGRAAVKVSERAAGRIGFLPHGIV  75

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             E  SD+ELKPL   S  +S+ +      L+A+P GI QK +V+ I++KFL ENFT ILFH
Sbjct  76    EPYSDMELKPLWLTSSVQSQKSNQNDRCLIAIPAGINQKKSVDAIMKKFLPENFTAILFH  135

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+YDYIFLWDEDL V+NF+P
Sbjct  136   YDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYDYIFLWDEDLEVDNFNP  195

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  651
              RYL IVKSE L ISQP LDPK   IHH ITVR +T  FHRRV   + +  CS   EGPP
Sbjct  196   RRYLNIVKSERLVISQPGLDPKLSEIHHPITVRKKTGNFHRRV--SRANKDCSR--EGPP  251

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             CSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT ++G+VDSE++VH
Sbjct  252   CSGWVEGMAPVFSKSAWKCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKHIGVVDSEFVVH  311

Query  470   LGIQSLGGSSL---KRASSPQELPKGRA------------VDLRVEIRRQSTYELQIFKE  336
              G+Q+LGGS++    R  + Q L +  A            +D+R ++RR+S  EL+ F++
Sbjct  312   RGVQTLGGSAMTKHTRGKNSQALRQKNAQVQQQTRVRAPGLDMRTKVRRKSRVELRDFQK  371

Query  335   RWEEAVKEDKNWVDPYKASQRYRKT  261
             RWE A +ED+ WVDP+ A +R R T
Sbjct  372   RWERATREDRTWVDPF-ARRRKRMT  395



>ref|XP_010657948.1| PREDICTED: uncharacterized protein LOC100255698 isoform X4 [Vitis 
vinifera]
Length=400

 Score =   399 bits (1025),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 194/379 (51%), Positives = 258/379 (68%), Gaps = 22/379 (6%)
 Frame = -3

Query  1379  CRVKMKHMQFIGLFCVSMLFIL-------YRTTIYQYQQAEMESKSDPLYSAEDSCVTGR  1221
             C + +    F G++ ++  F +        R  I  +Q A   S  +   S   +     
Sbjct  20    CSLFIGACLFCGVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPS  79

Query  1220  SSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
              S +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+
Sbjct  80    GSEALPEGIVVKTSNLEVQPLWGATLNGEKSSPS--KSLLAMAVGIKQKEIVNQIVEKFI  137

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
               NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  138   LSNFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWD  197

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS 
Sbjct  198   EDLGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSG  257

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NV
Sbjct  258   RCDDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNV  317

Query  500   GIVDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQI  345
             G+VDSEY+VHL + +LG        G     +S  ++LPK  A+     +RRQS  E+QI
Sbjct  318   GVVDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVAL-----VRRQSFIEMQI  372

Query  344   FKERWEEAVKEDKNWVDPY  288
             F+ RW  AVKEDK W+DPY
Sbjct  373   FRSRWANAVKEDKCWIDPY  391



>ref|XP_010274913.1| PREDICTED: uncharacterized protein LOC104610123 isoform X3 [Nelumbo 
nucifera]
Length=279

 Score =   394 bits (1013),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 179/263 (68%), Positives = 220/263 (84%), Gaps = 6/263 (2%)
 Frame = -3

Query  1058  IIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYD  879
             ++QKFLSEN +I+LFHYDG+VDGW DL WS +A+HI+AH+QTKWWFAKRFLHPDVVS YD
Sbjct  1     MVQKFLSENCSILLFHYDGSVDGWNDLEWSNKAVHILAHNQTKWWFAKRFLHPDVVSPYD  60

Query  878   YIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVY  699
             +IFLWDEDLGVENFHP R+LEI+ SEGLEISQPALDP+   +HHRIT+R++T K HR+VY
Sbjct  61    FIFLWDEDLGVENFHPGRFLEIMISEGLEISQPALDPELSEVHHRITLRNKTVKVHRQVY  120

Query  698   KDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQG  519
               +GS  CS+ S GPPC+G+VEGMAPVFSR+AW CVWHLIQNDL+HGWG+DMKLGYCAQG
Sbjct  121   VSRGSFNCSDNSTGPPCTGWVEGMAPVFSRAAWHCVWHLIQNDLIHGWGLDMKLGYCAQG  180

Query  518   DRTTNVGIVDSEYLVHLGIQSLGGSSLKRA----SSPQELP--KGRAVDLRVEIRRQSTY  357
             D T  VG++DSEY+VH GI +LGG+S  +      SP+  P    R++DLR  IRRQST 
Sbjct  181   DPTKTVGVIDSEYIVHRGIPTLGGASATKPPPDRKSPEHSPVKSDRSIDLRTHIRRQSTA  240

Query  356   ELQIFKERWEEAVKEDKNWVDPY  288
             EL+IFK+RW++AV+ED  W+DP+
Sbjct  241   ELEIFKQRWDQAVREDDRWIDPF  263



>ref|XP_010236937.1| PREDICTED: uncharacterized protein LOC100833044 isoform X1 [Brachypodium 
distachyon]
Length=420

 Score =   399 bits (1026),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 205/385 (53%), Positives = 260/385 (68%), Gaps = 44/385 (11%)
 Frame = -3

Query  1298  YQYQQAEMESKSDPLYSAEDS-------------CVTGRSSSS-----------LPRGII  1191
             YQ++Q  +E+KS P  +  +S              V+GR++             LP GI+
Sbjct  36    YQHRQTALEAKSRPFDTMIESDGAAVKVSDGAAVKVSGRAAVKVSERAAGRIGFLPHGIV  95

Query  1190  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             E  SD+ELKPL   S  +S+ +      L+A+P GI QK +V+ I++KFL ENFT ILFH
Sbjct  96    EPYSDMELKPLWLTSSVQSQKSNQNDRCLIAIPAGINQKKSVDAIMKKFLPENFTAILFH  155

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+YDYIFLWDEDL V+NF+P
Sbjct  156   YDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYDYIFLWDEDLEVDNFNP  215

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  651
              RYL IVKSE L ISQP LDPK   IHH ITVR +T  FHRRV   + +  CS   EGPP
Sbjct  216   RRYLNIVKSERLVISQPGLDPKLSEIHHPITVRKKTGNFHRRV--SRANKDCSR--EGPP  271

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             CSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT ++G+VDSE++VH
Sbjct  272   CSGWVEGMAPVFSKSAWKCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKHIGVVDSEFVVH  331

Query  470   LGIQSLGGSSL---KRASSPQELPKGRA------------VDLRVEIRRQSTYELQIFKE  336
              G+Q+LGGS++    R  + Q L +  A            +D+R ++RR+S  EL+ F++
Sbjct  332   RGVQTLGGSAMTKHTRGKNSQALRQKNAQVQQQTRVRAPGLDMRTKVRRKSRVELRDFQK  391

Query  335   RWEEAVKEDKNWVDPYKASQRYRKT  261
             RWE A +ED+ WVDP+ A +R R T
Sbjct  392   RWERATREDRTWVDPF-ARRRKRMT  415



>ref|NP_973809.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE28694.1| uncharacterized protein AT1G11170 [Arabidopsis thaliana]
Length=335

 Score =   395 bits (1014),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 218/281 (78%), Gaps = 0/281 (0%)
 Frame = -3

Query  1364  KHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1185
             K   F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGII+S
Sbjct  33    KMKPFLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIQS  92

Query  1184  RSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYD  1005
             RSDLELKPL +    +SK       NLLA+PVG+KQK NV+ +++KFL  NFTI+LFHYD
Sbjct  93    RSDLELKPLWSRGSLRSKGVEMTNRNLLAIPVGLKQKGNVDALVKKFLPANFTIVLFHYD  152

Query  1004  GNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPAR  825
             GN+D WWDL WS ++IHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P R
Sbjct  153   GNMDKWWDLEWSSKSIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPER  212

Query  824   YLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCS  645
             YL+IVKS GLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G  +CSN S  PPC+
Sbjct  213   YLKIVKSVGLEISQPALDHNSTEIHHKITLRSKTKKFHRRVYINRGHKRCSNTSSDPPCT  272

Query  644   GFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  522
             GFVEGMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQ
Sbjct  273   GFVEGMAPVFSKAAWLCTWNLIQNDLVHGWGMDMKLGYCAQ  313



>ref|XP_006602841.1| PREDICTED: uncharacterized protein LOC100798633 [Glycine max]
Length=383

 Score =   396 bits (1018),  Expect = 5e-130, Method: Compositional matrix adjust.
 Identities = 193/363 (53%), Positives = 254/363 (70%), Gaps = 19/363 (5%)
 Frame = -3

Query  1349  IGLFCVSMLFIL------YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1188
             + L CV +LF        Y   + +++    + K+D   + ++ C TG  S +LP GII 
Sbjct  32    VSLLCVVLLFSTLFFAQRYNEKLLRWKMNIKKLKND---NCKNQCRTG-GSHALPEGIIS  87

Query  1187  SRSDLELKPLKAMSISKSKVNV-TGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1011
             + SDLE++ L  + ++K+  N      NL AM VGIKQKD VN++++KFLS NF ++LFH
Sbjct  88    NTSDLEMRHLWDLPMTKTIENKENASTNLFAMAVGIKQKDLVNKLVKKFLSSNFVVMLFH  147

Query  1010  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  831
             YDG VD W D  W+   IH+   +Q+KWWFAKRFLHPD+V+ Y YIFLWDEDLGVE+FHP
Sbjct  148   YDGIVDEWNDFEWNNHVIHVAVANQSKWWFAKRFLHPDIVAEYGYIFLWDEDLGVEHFHP  207

Query  830   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNESEGP  654
              RY+ I+KSEGLEISQPALD     +HH+IT R R +  HRR+YK  GS K C   S  P
Sbjct  208   DRYVSIIKSEGLEISQPALDSNKSEVHHQITARGRRSNVHRRIYKTGGSGKRCDESSTAP  267

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  474
             PC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DM+LGYCAQGDRT NVG+VD+EY+V
Sbjct  268   PCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMQLGYCAQGDRTKNVGVVDAEYIV  327

Query  473   HLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVD  294
             H G  +LGG  +   SS       R  D RV++RR S  ELQ+F++RW++AV+ED  WVD
Sbjct  328   HYGHPTLGGLDVNEVSS-------RTKDHRVDVRRLSYRELQVFRKRWQKAVEEDDCWVD  380

Query  293   PYK  285
             P++
Sbjct  381   PFQ  383



>ref|XP_007139737.1| hypothetical protein PHAVU_008G055100g [Phaseolus vulgaris]
 gb|ESW11731.1| hypothetical protein PHAVU_008G055100g [Phaseolus vulgaris]
Length=378

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 189/362 (52%), Positives = 260/362 (72%), Gaps = 17/362 (5%)
 Frame = -3

Query  1349  IGLFCVSMLF---ILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1179
             + + CV ++F      +    +  +  M + +    + ++ C  G  SS+LP GII + S
Sbjct  27    VSILCVVLIFSSSFFTQRFNEKLLRWRMNTSTLENDTCKNQCRPG-GSSALPEGIISNTS  85

Query  1178  DLELKPLKAMSISKS---KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1008
             DLE++PL ++S++K+   + N++   NL AM VGI QKD VN++++KFL+ NF ++LFHY
Sbjct  86    DLEMRPLWSISMTKTIEKEQNLST--NLFAMAVGITQKDLVNKMVKKFLASNFVVMLFHY  143

Query  1007  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  828
             DG VD W +  WS   IH+   +Q+KWWFAKRFLHPD+V+ Y YIFLWDEDLGVE+FHP 
Sbjct  144   DGIVDEWNEFEWSNHVIHVAVANQSKWWFAKRFLHPDIVAEYGYIFLWDEDLGVEHFHPD  203

Query  827   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNESEGPP  651
             +Y+ I+KSEGLEISQPALD +   +HH+IT R R +  HRR+YK  G  K C   S GPP
Sbjct  204   KYVSIIKSEGLEISQPALDTEKSEVHHQITSRGRRSNVHRRIYKTGGRGKSCDENSSGPP  263

Query  650   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  471
             C+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+D++LGYCAQGDRT NVG+VD+EY++H
Sbjct  264   CTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDIQLGYCAQGDRTKNVGVVDAEYIIH  323

Query  470   LGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDP  291
              G  +LGG  L + SS        A D RV++RRQS  ELQ+F++RW++AV+EDK WVDP
Sbjct  324   YGHPTLGGLDLHKVSSG-------AKDHRVDVRRQSYNELQVFRKRWQKAVEEDKCWVDP  376

Query  290   YK  285
             ++
Sbjct  377   FQ  378



>gb|KDO75811.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=310

 Score =   390 bits (1002),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 211/266 (79%), Gaps = 0/266 (0%)
 Frame = -3

Query  1373  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  833   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  654
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  653   PCSGFVEGMAPVFSRSAWRCVWHLIQ  576
             PC+GFVEGMAPVFSRSAW C WHLIQ
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQ  288



>ref|XP_009410632.1| PREDICTED: uncharacterized protein LOC103992585 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=403

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 235/321 (73%), Gaps = 8/321 (2%)
 Frame = -3

Query  1250  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1071
             S E  C++   S  LP+GI+  +SDLE+ PL      K+K +V+   +LLA+PVGIKQK+
Sbjct  88    SCESPCISS-GSEPLPKGIVMRKSDLEMVPL--WGPPKAKESVSSQKSLLAIPVGIKQKE  144

Query  1070  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  891
              VN+I+ KF S +FT++LFHYDG VD W DL WS+ A+HI A +QTKWWFAKRFLHPD+V
Sbjct  145   IVNKIVTKFASHDFTVMLFHYDGVVDEWKDLQWSEGALHISAINQTKWWFAKRFLHPDIV  204

Query  890   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  711
             + Y YIFLWDEDL V+NFHP RYL IV+ EGLEISQPALDP    IHH+IT R R    H
Sbjct  205   APYRYIFLWDEDLEVQNFHPERYLSIVEREGLEISQPALDPAKSQIHHQITARLRKGHVH  264

Query  710   RRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGY  531
             RR+YK  G  KCS +S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL++ WG+DM LGY
Sbjct  265   RRMYKFNGGGKCSKKSSSPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIYAWGLDMNLGY  324

Query  530   CAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYEL  351
             CAQGDRT  VG+VDSEY+VH G+ +LGGS  K  SS        A + R  +RR+S  EL
Sbjct  325   CAQGDRTKKVGVVDSEYIVHTGLPTLGGSDEKMGSSDLH-----AANHRFAVRRRSYVEL  379

Query  350   QIFKERWEEAVKEDKNWVDPY  288
             +IF+ RW++A+ EDK W + Y
Sbjct  380   EIFRNRWQKAMAEDKCWTNSY  400



>ref|XP_009410631.1| PREDICTED: uncharacterized protein LOC103992585 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=404

 Score =   394 bits (1011),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 188/321 (59%), Positives = 235/321 (73%), Gaps = 8/321 (2%)
 Frame = -3

Query  1250  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1071
             S E  C++   S  LP+GI+  +SDLE+ PL      K+K +V+   +LLA+PVGIKQK+
Sbjct  89    SCESPCISS-GSEPLPKGIVMRKSDLEMVPL--WGPPKAKESVSSQKSLLAIPVGIKQKE  145

Query  1070  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  891
              VN+I+ KF S +FT++LFHYDG VD W DL WS+ A+HI A +QTKWWFAKRFLHPD+V
Sbjct  146   IVNKIVTKFASHDFTVMLFHYDGVVDEWKDLQWSEGALHISAINQTKWWFAKRFLHPDIV  205

Query  890   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  711
             + Y YIFLWDEDL V+NFHP RYL IV+ EGLEISQPALDP    IHH+IT R R    H
Sbjct  206   APYRYIFLWDEDLEVQNFHPERYLSIVEREGLEISQPALDPAKSQIHHQITARLRKGHVH  265

Query  710   RRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGY  531
             RR+YK  G  KCS +S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL++ WG+DM LGY
Sbjct  266   RRMYKFNGGGKCSKKSSSPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIYAWGLDMNLGY  325

Query  530   CAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYEL  351
             CAQGDRT  VG+VDSEY+VH G+ +LGGS  K  SS        A + R  +RR+S  EL
Sbjct  326   CAQGDRTKKVGVVDSEYIVHTGLPTLGGSDEKMGSSDLH-----AANHRFAVRRRSYVEL  380

Query  350   QIFKERWEEAVKEDKNWVDPY  288
             +IF+ RW++A+ EDK W + Y
Sbjct  381   EIFRNRWQKAMAEDKCWTNSY  401



>ref|XP_008778204.1| PREDICTED: uncharacterized protein LOC103698025 isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   390 bits (1003),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 201/370 (54%), Positives = 247/370 (67%), Gaps = 36/370 (10%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
             MK     GL  + M  +++   T   QY+   M+       S +           LPRG+
Sbjct  1     MKTQASFGLVFLLMTLVIFVAMTMKIQYENLTMDMGQQSFESTKRQWRN--RIDGLPRGV  58

Query  1193  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1014
             +ES +D+ LKPL   S  K       Y  LLAM VGI QK NV+ +++KFL +N +IILF
Sbjct  59    VESTTDMALKPLWERSSRKD--GSGNYAALLAMAVGISQKQNVDILVRKFLIDNCSIILF  116

Query  1013  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  834
             HYDGNVDGW DL WS +AIHI+A++QTKWWFAKRFLHP+ VS YDYIFLWDEDLGVENFH
Sbjct  117   HYDGNVDGWHDLEWSGKAIHILAYNQTKWWFAKRFLHPNAVSAYDYIFLWDEDLGVENFH  176

Query  833   PARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  657
               RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HR                 
Sbjct  177   LGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHR-----------------  219

Query  656   PPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYL  477
                  +VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D EY+
Sbjct  220   -----WVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDVEYI  274

Query  476   VHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWV  297
             VH GI SLGG S+ +A S       +++DLR  IRRQST EL+ FKERW++A ++DK W 
Sbjct  275   VHQGIPSLGGGSVNKAPS-------KSLDLRAHIRRQSTAELEKFKERWDQAARKDKEWF  327

Query  296   DPYKASQRYR  267
             DP++   R +
Sbjct  328   DPFEGYARIK  337



>ref|XP_002982728.1| hypothetical protein SELMODRAFT_116806 [Selaginella moellendorffii]
 gb|EFJ16481.1| hypothetical protein SELMODRAFT_116806 [Selaginella moellendorffii]
Length=351

 Score =   391 bits (1004),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 247/353 (70%), Gaps = 25/353 (7%)
 Frame = -3

Query  1313  YRTTIYQYQQAE-----MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAM  1149
             Y + I+ Y Q+      ++SK  P           R S +LPRGI+E+ SD+ELKPL   
Sbjct  16    YVSNIFLYSQSAVACLTLQSKRCP-----------RGSEALPRGIVEAASDMELKPLWRS  64

Query  1148  SISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWS  969
             S  K+        +LLA+  GI+QK  V++I +KF   NFTI+LFHYDG VD W DL W 
Sbjct  65    SKKKALQK-----SLLAIAAGIQQKRGVDQIARKFPVTNFTIMLFHYDGVVDRWSDLPWF  119

Query  968   KEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEI  789
               AIHIVA +QTKWWFAKRF+HPDVVS Y++IF+WDEDLGV++F   RYLEIV+ EGL+I
Sbjct  120   GSAIHIVAINQTKWWFAKRFMHPDVVSAYEFIFVWDEDLGVDHFRADRYLEIVRKEGLQI  179

Query  788   SQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFS  612
             SQPALDP  S  +HHRITVR++  + HRR+Y ++G   C N S  PPC+G+VE MAPVFS
Sbjct  180   SQPALDPSLSSEVHHRITVRNKKTRVHRRIYMNRGREYCGNNSTQPPCTGWVEMMAPVFS  239

Query  611   RSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKR  432
             RSAWRC WHLIQNDLVHGWGMDMKLGYCA+GD T NVG+VD++YL+H GI SLGG   K 
Sbjct  240   RSAWRCAWHLIQNDLVHGWGMDMKLGYCAEGDPTRNVGVVDTQYLIHRGIPSLGGG--KF  297

Query  431   ASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
                P   P  R V L  +IRR++  E+++FK+RW  AVK+DK W+DPY    R
Sbjct  298   FVLPTFPPLTRGVCL-FQIRRRAQAEMRLFKKRWTAAVKDDKCWIDPYDRRSR  349



>ref|XP_009392032.1| PREDICTED: uncharacterized protein LOC103978053 [Musa acuminata 
subsp. malaccensis]
Length=276

 Score =   387 bits (993),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 186/259 (72%), Positives = 210/259 (81%), Gaps = 7/259 (3%)
 Frame = -3

Query  1196  IIESRSDLELKPLKAMSISKSKV----NVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             + +S+SDLELKPL     SKS V    N   +HNLLAM VGIKQK  V+ I++KFLSENF
Sbjct  1     MAQSKSDLELKPL---WFSKSHVTKQDNDQSHHNLLAMTVGIKQKLTVDAIVRKFLSENF  57

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
              IILFHYDG V+ W DL WS   IHI AHSQTKWWFAKRFLHPD VSIYDYIFLWDEDLG
Sbjct  58    AIILFHYDGIVNEWHDLWWSHIVIHIAAHSQTKWWFAKRFLHPDTVSIYDYIFLWDEDLG  117

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  669
             VENFHP RYL+I+KSEGLEISQPALDP    IHHRITVR +    HRRV+  +G+ +CS+
Sbjct  118   VENFHPGRYLKIMKSEGLEISQPALDPNLSEIHHRITVRRKKRTVHRRVFGTRGTGECSS  177

Query  668   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  489
              S GPPC+G+VEGMAPVFSRSAW C WHLIQNDL+HGWGMDMKLGYCAQGDRT  VGIVD
Sbjct  178   TSTGPPCTGWVEGMAPVFSRSAWHCAWHLIQNDLIHGWGMDMKLGYCAQGDRTKKVGIVD  237

Query  488   SEYLVHLGIQSLGGSSLKR  432
             SE++VH G+Q+LGGSS K+
Sbjct  238   SEFIVHQGVQTLGGSSAKK  256



>ref|XP_008368197.1| PREDICTED: uncharacterized protein LOC103431805 [Malus domestica]
Length=451

 Score =   393 bits (1009),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 190/343 (55%), Positives = 245/343 (71%), Gaps = 14/343 (4%)
 Frame = -3

Query  1271  SKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMP  1092
             +++  L++ ++ C     S +LP+GI+   SDLE  PL   S+     N     +LLA+ 
Sbjct  72    TQNTTLHTCKNXC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNE--NSKPSKSLLAIA  128

Query  1091  VGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKR  912
             VGIKQK+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKR
Sbjct  129   VGIKQKEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKR  188

Query  911   FLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVR  732
             FLHPD+VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R
Sbjct  189   FLHPDIVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITAR  248

Query  731   SRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  552
              + +K HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG
Sbjct  249   VKNSKVHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWG  308

Query  551   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKGRA-------  396
             +D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG +       
Sbjct  309   LDVQLGYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKGDSKALAPSA  368

Query  395   ---VDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
                V+ R ++R QS  ++QIFKERW  AVKE+K WVDPY+  Q
Sbjct  369   SDKVNDRSKVRMQSFIDMQIFKERWSNAVKEEKCWVDPYQLKQ  411



>ref|XP_008218666.1| PREDICTED: uncharacterized protein LOC103318970 isoform X1 [Prunus 
mume]
Length=402

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 238/324 (73%), Gaps = 13/324 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGI QK+ V+ I++KFLS
Sbjct  79    SEALPEGIVAQTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGINQKEIVDRIVKKFLS  136

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  137   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  196

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K HRR YK KGS +
Sbjct  197   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVHRRFYKFKGSGR  256

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  257   CDDHSSAPPCAGWVEMMAPVFSRAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  316

Query  497   IVDSEYLVHLGIQSLG---GSSLKRASSPQEL--PKGRA------VDLRVEIRRQSTYEL  351
             +VDSEY+VHLG+ +LG   G+ +  A +P +   P+  A      V+ R ++R QS  ++
Sbjct  317   VVDSEYIVHLGLPTLGVSDGNKVTNAPAPPQKGDPEALAPSASDKVNDRAKVRMQSFIDM  376

Query  350   QIFKERWEEAVKEDKNWVDPYKAS  279
             QIFKERW  AVKEDK WVDP++ S
Sbjct  377   QIFKERWSNAVKEDKCWVDPFQLS  400



>ref|XP_002463031.1| hypothetical protein SORBIDRAFT_02g036520 [Sorghum bicolor]
 gb|EER99552.1| hypothetical protein SORBIDRAFT_02g036520 [Sorghum bicolor]
Length=319

 Score =   388 bits (996),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 189/322 (59%), Positives = 240/322 (75%), Gaps = 20/322 (6%)
 Frame = -3

Query  1175  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  996
             +ELKPL  ++ ++SK +      L+A+  GI QK +V+ I++KFL ENFT ILFHYDGNV
Sbjct  1     MELKPL-WLTSAQSKKSKQSDKFLIAIAAGINQKKSVDAIMKKFLPENFTAILFHYDGNV  59

Query  995   DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  816
             +GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWDEDL V+NF+P RYL 
Sbjct  60    NGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYQYIFLWDEDLEVDNFNPRRYLN  119

Query  815   IVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFV  636
             IV+SEGLEISQP LD K   IHHRITVR +T  FHRRV   + + +CS   EGPPCSG+V
Sbjct  120   IVRSEGLEISQPGLDSKLSEIHHRITVRKKTGTFHRRV--SRANKQCSR--EGPPCSGWV  175

Query  635   EGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQS  456
             EGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSE++VH G+Q+
Sbjct  176   EGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEFIVHRGVQT  235

Query  455   LGGSSL----KRASSPQEL---------PKGRA--VDLRVEIRRQSTYELQIFKERWEEA  321
             LGGS++     R  + Q L          +G+A  +D+R +IRR+S  EL+ F++RW+ A
Sbjct  236   LGGSTITKDGTRGKNAQPLRQKADQVQKSRGKAPGLDMRTKIRRKSRSELRDFQKRWDRA  295

Query  320   VKEDKNWVDPYKASQRYRKTWN  255
              +ED+ WVDP+  S+R  +  N
Sbjct  296   AREDRTWVDPFARSRRKHRNRN  317



>ref|XP_008218669.1| PREDICTED: uncharacterized protein LOC103318970 isoform X3 [Prunus 
mume]
Length=398

 Score =   391 bits (1004),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 187/324 (58%), Positives = 238/324 (73%), Gaps = 13/324 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGI QK+ V+ I++KFLS
Sbjct  75    SEALPEGIVAQTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGINQKEIVDRIVKKFLS  132

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  133   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  192

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K HRR YK KGS +
Sbjct  193   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVHRRFYKFKGSGR  252

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  253   CDDHSSAPPCAGWVEMMAPVFSRAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  312

Query  497   IVDSEYLVHLGIQSLG---GSSLKRASSPQEL--PKGRA------VDLRVEIRRQSTYEL  351
             +VDSEY+VHLG+ +LG   G+ +  A +P +   P+  A      V+ R ++R QS  ++
Sbjct  313   VVDSEYIVHLGLPTLGVSDGNKVTNAPAPPQKGDPEALAPSASDKVNDRAKVRMQSFIDM  372

Query  350   QIFKERWEEAVKEDKNWVDPYKAS  279
             QIFKERW  AVKEDK WVDP++ S
Sbjct  373   QIFKERWSNAVKEDKCWVDPFQLS  396



>ref|XP_010527349.1| PREDICTED: uncharacterized protein LOC104804705 isoform X2 [Tarenaya 
hassleriana]
Length=378

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/317 (57%), Positives = 236/317 (74%), Gaps = 14/317 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ + SDLE++PL   ++ K K  +    NLLAM  GIKQK+NVN+I++KF S
Sbjct  65    SETLPRGIVANTSDLEMRPLWG-TVRKKKPKM----NLLAMATGIKQKENVNKIVKKFPS  119

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS  A+H+ A +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   NEFVVMLFHYDGIVDEWKEFEWSGTALHVSAINQTKWWFAKRFLHPDIVSSYSYIFLWDE  179

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RYL I++ EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G T+
Sbjct  180   DLGVDHFDATRYLSIIREEGLEISQPALDPRSSELHHQITARDNKSRVHRRTYKVIGRTR  239

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFS++AWRC WH+IQNDL HGWG+D +LGYC+QGDRT N+G
Sbjct  240   CNENSTGPPCTGFVEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCSQGDRTKNIG  299

Query  497   IVDSEYLVHLGIQSLGGSSLKRA----SSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
             +VDSEYL+H+G+ +LGGS+  +     S  ++   GR+     E+RR+S  EL+ FK RW
Sbjct  300   VVDSEYLLHMGLPTLGGSAENKTEAEISDQRQHSSGRS-----EVRRRSYAELETFKTRW  354

Query  329   EEAVKEDKNWVDPYKAS  279
               AVK+D+ WVDP++ S
Sbjct  355   RNAVKKDECWVDPFRQS  371



>ref|XP_010527348.1| PREDICTED: uncharacterized protein LOC104804705 isoform X1 [Tarenaya 
hassleriana]
Length=392

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 235/314 (75%), Gaps = 8/314 (3%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ + SDLE++PL   ++ K K  +    NLLAM  GIKQK+NVN+I++KF S
Sbjct  79    SETLPRGIVANTSDLEMRPLWG-TVRKKKPKM----NLLAMATGIKQKENVNKIVKKFPS  133

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS  A+H+ A +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   NEFVVMLFHYDGIVDEWKEFEWSGTALHVSAINQTKWWFAKRFLHPDIVSSYSYIFLWDE  193

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RYL I++ EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G T+
Sbjct  194   DLGVDHFDATRYLSIIREEGLEISQPALDPRSSELHHQITARDNKSRVHRRTYKVIGRTR  253

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFS++AWRC WH+IQNDL HGWG+D +LGYC+QGDRT N+G
Sbjct  254   CNENSTGPPCTGFVEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCSQGDRTKNIG  313

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA-VDLRVEIRRQSTYELQIFKERWEEA  321
             +VDSEYL+H+G+ +LGGS+  +  +  E+   R     R E+RR+S  EL+ FK RW  A
Sbjct  314   VVDSEYLLHMGLPTLGGSAENKTEA--EISDQRQHSSGRSEVRRRSYAELETFKTRWRNA  371

Query  320   VKEDKNWVDPYKAS  279
             VK+D+ WVDP++ S
Sbjct  372   VKKDECWVDPFRQS  385



>ref|XP_007049550.1| Uncharacterized protein TCM_002621 [Theobroma cacao]
 gb|EOX93707.1| Uncharacterized protein TCM_002621 [Theobroma cacao]
Length=385

 Score =   389 bits (1000),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 183/315 (58%), Positives = 236/315 (75%), Gaps = 8/315 (3%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP+GII   SDLE++PL  +  +K K  ++   NLLA+ VGIKQK++VN+I++KF +
Sbjct  77    SEALPKGIISETSDLEMRPLWGLQ-NKKKPKLS--MNLLAIAVGIKQKESVNKIVKKFPA  133

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   SDFVVMLFHYDGIVDQWKDLEWNDLAIHVSAVNQTKWWFAKRFLHPDIVSEYSYIFLWDE  193

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F+ ARYL I+K EGLEISQPALD +   +HH IT R + +  HRR Y+  G T+
Sbjct  194   DLGVDHFNAARYLSIIKKEGLEISQPALDVEKSELHHPITARDKKSTVHRRTYEVIGRTR  253

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR++WRC WH+IQ+DLV+GWG+D +LGYCAQGDRT  +G
Sbjct  254   CNENSTGPPCTGFVEMMAPVFSRASWRCAWHMIQSDLVYGWGVDFQLGYCAQGDRTQKIG  313

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             IVDSEYLVH  + +LGG +     SP   P GR+     E+R+QS  EL+IFK RW+ AV
Sbjct  314   IVDSEYLVHNALPTLGGVAANEVPSPSSEPGGRS-----EVRKQSFIELEIFKNRWKRAV  368

Query  317   KEDKNWVDPYKASQR  273
             K+DK W DPY+ S +
Sbjct  369   KQDKCWFDPYEPSTK  383



>ref|XP_010030218.1| PREDICTED: uncharacterized protein LOC104420022 isoform X2 [Eucalyptus 
grandis]
Length=394

 Score =   390 bits (1001),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 248/371 (67%), Gaps = 20/371 (5%)
 Frame = -3

Query  1352  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1179
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  25    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  82

Query  1178  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  999
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  83    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  140

Query  998   VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  819
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  141   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  200

Query  818   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  639
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  201   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  260

Query  638   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  459
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  261   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  320

Query  458   SLGGS------SLKRASSPQELPKGRA--------VDLRVEIRRQSTYELQIFKERWEEA  321
             +LG          K   S ++LP   A        VD R E+R++S  E+Q+F  RW+ A
Sbjct  321   TLGAGLKNQVHDHKPVHSAKDLPSAGAVASHEPHVVDSRFEVRKRSYEEMQVFSTRWKNA  380

Query  320   VKEDKNWVDPY  288
             +KED+ WVDP+
Sbjct  381   IKEDRCWVDPF  391



>ref|XP_010030219.1| PREDICTED: uncharacterized protein LOC104420022 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010030220.1| PREDICTED: uncharacterized protein LOC104420022 isoform X3 [Eucalyptus 
grandis]
 gb|KCW57156.1| hypothetical protein EUGRSUZ_I02788 [Eucalyptus grandis]
Length=390

 Score =   389 bits (999),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 248/371 (67%), Gaps = 20/371 (5%)
 Frame = -3

Query  1352  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1179
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  21    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  78

Query  1178  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  999
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  79    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  136

Query  998   VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  819
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  137   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  196

Query  818   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  639
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  197   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  256

Query  638   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  459
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  257   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  316

Query  458   SLGGS------SLKRASSPQELPKGRA--------VDLRVEIRRQSTYELQIFKERWEEA  321
             +LG          K   S ++LP   A        VD R E+R++S  E+Q+F  RW+ A
Sbjct  317   TLGAGLKNQVHDHKPVHSAKDLPSAGAVASHEPHVVDSRFEVRKRSYEEMQVFSTRWKNA  376

Query  320   VKEDKNWVDPY  288
             +KED+ WVDP+
Sbjct  377   IKEDRCWVDPF  387



>ref|XP_010030213.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030214.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030215.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030216.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030217.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
Length=409

 Score =   390 bits (1001),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 193/371 (52%), Positives = 248/371 (67%), Gaps = 20/371 (5%)
 Frame = -3

Query  1352  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1179
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  40    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  97

Query  1178  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  999
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  98    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  155

Query  998   VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  819
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  156   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  215

Query  818   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  639
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  216   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  275

Query  638   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  459
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  276   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  335

Query  458   SLGGS------SLKRASSPQELPKGRA--------VDLRVEIRRQSTYELQIFKERWEEA  321
             +LG          K   S ++LP   A        VD R E+R++S  E+Q+F  RW+ A
Sbjct  336   TLGAGLKNQVHDHKPVHSAKDLPSAGAVASHEPHVVDSRFEVRKRSYEEMQVFSTRWKNA  395

Query  320   VKEDKNWVDPY  288
             +KED+ WVDP+
Sbjct  396   IKEDRCWVDPF  406



>gb|KDO42569.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
 gb|KDO42570.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
Length=358

 Score =   387 bits (995),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 191/347 (55%), Positives = 251/347 (72%), Gaps = 24/347 (7%)
 Frame = -3

Query  1256  LYSAE-DSCVTGR----SSSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAM  1095
             +YSA+ ++C   +     + +LP GI+   S+LE++PL +   S SK+N      NLLA+
Sbjct  9     MYSAKPETCKNQQCRLPGTEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAI  65

Query  1094  PVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAK  915
               GIKQK  V++I++KF S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAK
Sbjct  66    AAGIKQKKIVDQIVRKFPSKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAK  125

Query  914   RFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITV  735
             RFLHPD+V+ Y+YIFLWDED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT 
Sbjct  126   RFLHPDIVAEYNYIFLWDEDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITA  185

Query  734   RSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGW  555
             R R +K HRR+YK KGS +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H W
Sbjct  186   RRRNSKAHRRMYKYKGSGRCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAW  245

Query  554   GMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS-------------LKRASSPQE  414
             G+D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG ++             L++ ++P  
Sbjct  246   GLDIQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVTTEPELNTVGQASDDLEQIANPVA  305

Query  413   LP--KGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
             L   + R  D R E+RRQS  E+QIF+ RW+ AV++DK WVDPY  S
Sbjct  306   LAPSQSRRYDNRPEVRRQSYIEMQIFRNRWKHAVEDDKCWVDPYGQS  352



>ref|XP_009341364.1| PREDICTED: uncharacterized protein LOC103933395 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009341365.1| PREDICTED: uncharacterized protein LOC103933395 isoform X3 [Pyrus 
x bretschneideri]
Length=341

 Score =   387 bits (993),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 242/337 (72%), Gaps = 14/337 (4%)
 Frame = -3

Query  1256  LYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQ  1077
             L++ ++ C     S +LP+GI+   SDLE  PL   S+  +  N     +L+A+ VGIKQ
Sbjct  6     LHTCKNHC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNA--NSKPSKSLMAIAVGIKQ  62

Query  1076  KDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPD  897
             K+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHP 
Sbjct  63    KEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKRFLHPA  122

Query  896   VVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNK  717
             +VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R + +K
Sbjct  123   IVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITARVKNSK  182

Query  716   FHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKL  537
              HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG+D++L
Sbjct  183   VHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWGLDVQL  242

Query  536   GYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKGRA----------VD  390
             GYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG +          V+
Sbjct  243   GYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKGDSKALAPSASDKVN  302

Query  389   LRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
              R ++R QS  ++QIFKERW  AVKE+K WVDPY+ +
Sbjct  303   GRSKVRMQSFIDMQIFKERWSNAVKEEKCWVDPYQLT  339



>gb|KDO42568.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
Length=407

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/329 (57%), Positives = 242/329 (74%), Gaps = 19/329 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             + +LP GI+   S+LE++PL +   S SK+N      NLLA+  GIKQK  V++I++KF 
Sbjct  76    TEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAIAAGIKQKKIVDQIVRKFP  132

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  133   SKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAKRFLHPDIVAEYNYIFLWD  192

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             ED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT R R +K HRR+YK KGS 
Sbjct  193   EDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITARRRNSKAHRRMYKYKGSG  252

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG+D++LGYCAQGDRT NV
Sbjct  253   RCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAWGLDIQLGYCAQGDRTKNV  312

Query  500   GIVDSEYLVHLGIQSLGGSS-------------LKRASSPQELP--KGRAVDLRVEIRRQ  366
             G+VDSEY+VHLG+ +LG ++             L++ ++P  L   + R  D R E+RRQ
Sbjct  313   GVVDSEYIVHLGLPTLGVTTEPELNTVGQASDDLEQIANPVALAPSQSRRYDNRPEVRRQ  372

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKAS  279
             S  E+QIF+ RW+ AV++DK WVDPY  S
Sbjct  373   SYIEMQIFRNRWKHAVEDDKCWVDPYGQS  401



>ref|XP_006470988.1| PREDICTED: uncharacterized protein LOC102624954 [Citrus sinensis]
Length=407

 Score =   389 bits (998),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 187/329 (57%), Positives = 242/329 (74%), Gaps = 19/329 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             + +LP GI+   S+LE++PL +   S SK+N      NLLA+  GIKQK  V++I++KF 
Sbjct  76    TEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAIAAGIKQKKIVDQIVRKFP  132

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  133   SKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAKRFLHPDIVAEYNYIFLWD  192

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             ED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT R R +K HRR+YK KGS 
Sbjct  193   EDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITARRRNSKAHRRMYKYKGSG  252

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG+D++LGYCAQGDRT NV
Sbjct  253   RCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAWGLDIQLGYCAQGDRTKNV  312

Query  500   GIVDSEYLVHLGIQSLGGSS-------------LKRASSPQELP--KGRAVDLRVEIRRQ  366
             G+VDSEY+VHLG+ +LG ++             L++ ++P  L   + R  D R E+RRQ
Sbjct  313   GVVDSEYIVHLGLPTLGVTTEPELNTVGQASDDLEQIANPVALAPSQSRRYDNRPEVRRQ  372

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKAS  279
             S  E+QIF+ RW+ AV++DK WVDPY  S
Sbjct  373   SYIEMQIFRNRWKHAVEDDKCWVDPYGQS  401



>ref|XP_009139663.1| PREDICTED: uncharacterized protein LOC103863665 isoform X5 [Brassica 
rapa]
Length=382

 Score =   387 bits (995),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 178/312 (57%), Positives = 230/312 (74%), Gaps = 11/312 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  254

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  497   IVDSEYLVHLGIQSLGGSSL-KRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEA  321
             IVDSEY++HLG+ +LGGS+  K+ SS  ++   R+     E+R+Q+  EL+ FK RW  A
Sbjct  315   IVDSEYILHLGLPTLGGSAENKKPSSTSQMSSARS-----EVRKQTYAELETFKHRWRNA  369

Query  320   VKEDKNWVDPYK  285
             VK D+ W+D ++
Sbjct  370   VKNDECWIDRFQ  381



>ref|XP_010682054.1| PREDICTED: uncharacterized protein LOC104896958 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 240/347 (69%), Gaps = 7/347 (2%)
 Frame = -3

Query  1313  YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKS  1134
             YR  I ++    M +   P  +   +    R S +LP GI+   S+ E++PL    ++K 
Sbjct  56    YREKISRWPMEMMGTAHQPKPNFCKNQCRPRGSEALPEGIVVQTSNFEMRPLWDSDLAKE  115

Query  1133  KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIH  954
             K+  +   NLLAM VG+KQK+ V+++++KFLS  F ++LFHYDGNVD W  L W+   IH
Sbjct  116   KLKPS--LNLLAMAVGMKQKEIVDKMVEKFLSNGFVVMLFHYDGNVDEWSALEWNDRVIH  173

Query  953   IVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPAL  774
             + A +QTKWWFAKRFLHPDVV+ YDYIFLWDEDLGVENF P RY+ I+KSEGLEISQPAL
Sbjct  174   VSAKNQTKWWFAKRFLHPDVVADYDYIFLWDEDLGVENFSPQRYISIIKSEGLEISQPAL  233

Query  773   DPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRC  594
             DP    +H  IT R +  + HRR YK KGS +C   S  PPC+G+VE MAP FS++AW+C
Sbjct  234   DPIKSVVHQPITARQKYARVHRRYYKSKGSGRCDENSRAPPCTGWVEMMAPAFSKAAWQC  293

Query  593   VWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQE  414
             VW++IQNDL+H WG+D +LGYCAQGDR  NVG+VDSEY+VHLG+ +LG          +E
Sbjct  294   VWYMIQNDLIHAWGLDRQLGYCAQGDRVKNVGVVDSEYIVHLGLPTLG-----VMDGNKE  348

Query  413   LPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
              P+   VD R  +RRQS  E+QIF +RW +AVK DK W+D YK + +
Sbjct  349   SPEPLRVDNRSAVRRQSFIEMQIFSQRWNDAVKNDKCWIDLYKQTNQ  395



>ref|XP_010682053.1| PREDICTED: uncharacterized protein LOC104896958 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=401

 Score =   388 bits (997),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 184/347 (53%), Positives = 240/347 (69%), Gaps = 7/347 (2%)
 Frame = -3

Query  1313  YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKS  1134
             YR  I ++    M +   P  +   +    R S +LP GI+   S+ E++PL    ++K 
Sbjct  58    YREKISRWPMEMMGTAHQPKPNFCKNQCRPRGSEALPEGIVVQTSNFEMRPLWDSDLAKE  117

Query  1133  KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIH  954
             K+  +   NLLAM VG+KQK+ V+++++KFLS  F ++LFHYDGNVD W  L W+   IH
Sbjct  118   KLKPS--LNLLAMAVGMKQKEIVDKMVEKFLSNGFVVMLFHYDGNVDEWSALEWNDRVIH  175

Query  953   IVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPAL  774
             + A +QTKWWFAKRFLHPDVV+ YDYIFLWDEDLGVENF P RY+ I+KSEGLEISQPAL
Sbjct  176   VSAKNQTKWWFAKRFLHPDVVADYDYIFLWDEDLGVENFSPQRYISIIKSEGLEISQPAL  235

Query  773   DPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRC  594
             DP    +H  IT R +  + HRR YK KGS +C   S  PPC+G+VE MAP FS++AW+C
Sbjct  236   DPIKSVVHQPITARQKYARVHRRYYKSKGSGRCDENSRAPPCTGWVEMMAPAFSKAAWQC  295

Query  593   VWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQE  414
             VW++IQNDL+H WG+D +LGYCAQGDR  NVG+VDSEY+VHLG+ +LG          +E
Sbjct  296   VWYMIQNDLIHAWGLDRQLGYCAQGDRVKNVGVVDSEYIVHLGLPTLG-----VMDGNKE  350

Query  413   LPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
              P+   VD R  +RRQS  E+QIF +RW +AVK DK W+D YK + +
Sbjct  351   SPEPLRVDNRSAVRRQSFIEMQIFSQRWNDAVKNDKCWIDLYKQTNQ  397



>ref|XP_010557744.1| PREDICTED: uncharacterized protein LOC104826643 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010557745.1| PREDICTED: uncharacterized protein LOC104826643 isoform X2 [Tarenaya 
hassleriana]
Length=373

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 230/313 (73%), Gaps = 7/313 (2%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ + SDLE++PL  +  +K         NLLAM  GIKQK+NVN+I++KF S
Sbjct  65    SETLPRGIVANTSDLEMRPLWGIVRNKKP-----KLNLLAMATGIKQKENVNKIVKKFPS  119

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F +++FHYDG VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+VS Y Y+FLWDE
Sbjct  120   NEFVVMMFHYDGIVDEWKEFDWSETAIHVSAINQTKWWFAKRFLHPDIVSAYSYVFLWDE  179

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVE+F   RYL IVK EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G  K
Sbjct  180   DLGVEHFDARRYLSIVKEEGLEISQPALDPRSSELHHQITARDSKSRVHRRTYKVIGRAK  239

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GF+E MAPVFS++AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CNENSAGPPCTGFIEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTRNIG  299

Query  497   IVDSEYLVHLGIQSLGGSSLKR--ASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             IVDSEYL+H+G+ +LGGS+  +  A +  +    +    R E+R+QS  EL+ FK RW  
Sbjct  300   IVDSEYLLHMGLPTLGGSAENKTDAETSGQTEHSQHSSGRSEVRKQSYAELERFKSRWRN  359

Query  323   AVKEDKNWVDPYK  285
             AVK D+ W DP++
Sbjct  360   AVKNDECWRDPFQ  372



>ref|XP_010557742.1| PREDICTED: uncharacterized protein LOC104826643 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557743.1| PREDICTED: uncharacterized protein LOC104826643 isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   387 bits (994),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 180/313 (58%), Positives = 230/313 (73%), Gaps = 7/313 (2%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ + SDLE++PL  +  +K         NLLAM  GIKQK+NVN+I++KF S
Sbjct  79    SETLPRGIVANTSDLEMRPLWGIVRNKKP-----KLNLLAMATGIKQKENVNKIVKKFPS  133

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F +++FHYDG VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+VS Y Y+FLWDE
Sbjct  134   NEFVVMMFHYDGIVDEWKEFDWSETAIHVSAINQTKWWFAKRFLHPDIVSAYSYVFLWDE  193

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVE+F   RYL IVK EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G  K
Sbjct  194   DLGVEHFDARRYLSIVKEEGLEISQPALDPRSSELHHQITARDSKSRVHRRTYKVIGRAK  253

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GF+E MAPVFS++AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  254   CNENSAGPPCTGFIEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTRNIG  313

Query  497   IVDSEYLVHLGIQSLGGSSLKR--ASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             IVDSEYL+H+G+ +LGGS+  +  A +  +    +    R E+R+QS  EL+ FK RW  
Sbjct  314   IVDSEYLLHMGLPTLGGSAENKTDAETSGQTEHSQHSSGRSEVRKQSYAELERFKSRWRN  373

Query  323   AVKEDKNWVDPYK  285
             AVK D+ W DP++
Sbjct  374   AVKNDECWRDPFQ  386



>gb|KHG18284.1| GTPase Der [Gossypium arboreum]
Length=394

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 188/365 (52%), Positives = 257/365 (70%), Gaps = 15/365 (4%)
 Frame = -3

Query  1346  GLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1173
             G + +S  FI   Y+    +++   M   S  + + ++ C     S +LP+GI+   S+L
Sbjct  31    GAYFISNAFITNEYKDRFSRWEVINMLRNSKSV-TCKNQC-RPPGSEALPQGIVVKTSNL  88

Query  1172  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  993
             +++PL + S+    VN     NLLA+ VGIKQK+ V++I++KF   ++ ++LFHYDG VD
Sbjct  89    QMQPLWSDSVKN--VNPETSSNLLAIAVGIKQKEIVDQIVKKFPVSDYVVMLFHYDGIVD  146

Query  992   GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  813
              W D  WS  AIH+ A +QTKWWFAKRFLHPD+VS Y YIFLWDEDLGV+NF P +YL I
Sbjct  147   EWKDFEWSDRAIHVSAVNQTKWWFAKRFLHPDIVSKYKYIFLWDEDLGVDNFDPKQYLSI  206

Query  812   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  633
             V+ EGLEISQPALDP    +HH IT R + +KFHRR+YK KG  +C ++S  PPC G+VE
Sbjct  207   VEGEGLEISQPALDPVKSEVHHPITARRKNSKFHRRMYKFKGHGRCDSQSTAPPCIGWVE  266

Query  632   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  453
              MAPVFSR+AWRCVW++IQNDL+H WG+DM+LGYCAQGDR  NVG+VD++Y+VH G+ +L
Sbjct  267   MMAPVFSRAAWRCVWYMIQNDLIHAWGLDMQLGYCAQGDRMKNVGVVDAQYVVHFGLPTL  326

Query  452   GGSSLK-RASSPQELPKGRA--------VDLRVEIRRQSTYELQIFKERWEEAVKEDKNW  300
             G +S + + +  Q+LPK  +        +D R E+RRQS  E+Q F++RWE A K+D+ W
Sbjct  327   GLNSTEVKITQRQQLPKSESPAPSESHKIDNRPEVRRQSFIEMQTFRKRWENAAKDDECW  386

Query  299   VDPYK  285
             VDPY+
Sbjct  387   VDPYQ  391



>ref|XP_008802242.1| PREDICTED: uncharacterized protein LOC103716141 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802244.1| PREDICTED: uncharacterized protein LOC103716141 isoform X1 [Phoenix 
dactylifera]
Length=394

 Score =   387 bits (995),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 181/315 (57%), Positives = 226/315 (72%), Gaps = 7/315 (2%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S  LP+GII   S+ E++PL      K K   +   +LLA+PVG+ QK  VN+I++KF  
Sbjct  83    SEPLPKGIISQTSNFEMQPLWGSPKGKGKTKSS--KSLLAIPVGVMQKKAVNQIVKKFPP  140

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ Y+YIFLWDE
Sbjct  141   SDFMVVLFHYDGVVDEWRDLQWSDSALHISAINQTKWWFAKRFLHPDIVAEYNYIFLWDE  200

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DL VENFHP RYL ++K EGLEISQPALD     IHHRIT RSR    HRR+YK  G  +
Sbjct  201   DLQVENFHPLRYLSLIKREGLEISQPALDTSKSEIHHRITARSRKGDVHRRIYKFTGGGR  260

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C   S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL+H WG+DMKLGYCAQGDR+ NVG
Sbjct  261   CYENSTAPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIHAWGLDMKLGYCAQGDRSKNVG  320

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +VDSEY+VH+GI +LGG   K+       P     + R+ +R++S  EL+IF+ RW+ AV
Sbjct  321   VVDSEYIVHMGIPTLGGFDEKKVH-----PGSHTFNERLAVRKRSYVELEIFRNRWQMAV  375

Query  317   KEDKNWVDPYKASQR  273
              EDK W+DPY  S +
Sbjct  376   TEDKCWIDPYPESSK  390



>ref|XP_009341361.1| PREDICTED: uncharacterized protein LOC103933395 isoform X1 [Pyrus 
x bretschneideri]
Length=400

 Score =   387 bits (995),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 242/337 (72%), Gaps = 14/337 (4%)
 Frame = -3

Query  1256  LYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQ  1077
             L++ ++ C     S +LP+GI+   SDLE  PL   S+  +  N     +L+A+ VGIKQ
Sbjct  65    LHTCKNHC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNA--NSKPSKSLMAIAVGIKQ  121

Query  1076  KDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPD  897
             K+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHP 
Sbjct  122   KEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKRFLHPA  181

Query  896   VVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNK  717
             +VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R + +K
Sbjct  182   IVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITARVKNSK  241

Query  716   FHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKL  537
              HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG+D++L
Sbjct  242   VHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWGLDVQL  301

Query  536   GYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKGRA----------VD  390
             GYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG +          V+
Sbjct  302   GYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKGDSKALAPSASDKVN  361

Query  389   LRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
              R ++R QS  ++QIFKERW  AVKE+K WVDPY+ +
Sbjct  362   GRSKVRMQSFIDMQIFKERWSNAVKEEKCWVDPYQLT  398



>ref|XP_009341362.1| PREDICTED: uncharacterized protein LOC103933395 isoform X2 [Pyrus 
x bretschneideri]
Length=395

 Score =   387 bits (994),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 187/337 (55%), Positives = 242/337 (72%), Gaps = 14/337 (4%)
 Frame = -3

Query  1256  LYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQ  1077
             L++ ++ C     S +LP+GI+   SDLE  PL   S+  +  N     +L+A+ VGIKQ
Sbjct  60    LHTCKNHC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNA--NSKPSKSLMAIAVGIKQ  116

Query  1076  KDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPD  897
             K+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHP 
Sbjct  117   KEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKRFLHPA  176

Query  896   VVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNK  717
             +VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R + +K
Sbjct  177   IVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITARVKNSK  236

Query  716   FHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKL  537
              HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG+D++L
Sbjct  237   VHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWGLDVQL  296

Query  536   GYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKGRA----------VD  390
             GYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG +          V+
Sbjct  297   GYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKGDSKALAPSASDKVN  356

Query  389   LRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
              R ++R QS  ++QIFKERW  AVKE+K WVDPY+ +
Sbjct  357   GRSKVRMQSFIDMQIFKERWSNAVKEEKCWVDPYQLT  393



>ref|XP_007222756.1| hypothetical protein PRUPE_ppa006529mg [Prunus persica]
 gb|EMJ23955.1| hypothetical protein PRUPE_ppa006529mg [Prunus persica]
Length=407

 Score =   387 bits (994),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 188/333 (56%), Positives = 235/333 (71%), Gaps = 22/333 (7%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGIKQK+ V+ I++KFLS
Sbjct  75    SEALPEGIVAKTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGIKQKEIVDRIVKKFLS  132

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  133   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  192

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K HRR YK KGS +
Sbjct  193   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVHRRFYKFKGSGR  252

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C N S  PPC+G+VE MAPVFS++AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  253   CDNHSSAPPCAGWVEMMAPVFSKAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  312

Query  497   IVDSEYLVHLGIQSLGGSSLKRA-----------SSPQEL---------PKGRAVDLRVE  378
             +VDSEY+VHLG+ +LG S   +A            SP  L              V+ R +
Sbjct  313   VVDSEYIVHLGLPTLGVSDGNKAIMLKTRLDFYCLSPIHLSLCNIISAPSASDKVNDRAK  372

Query  377   IRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
             +R QS  ++QIFKERW  AVKEDK WVDP++ S
Sbjct  373   VRMQSFIDMQIFKERWSNAVKEDKCWVDPFQLS  405



>ref|XP_009355359.1| PREDICTED: uncharacterized protein LOC103946389 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009355360.1| PREDICTED: uncharacterized protein LOC103946389 isoform X3 [Pyrus 
x bretschneideri]
Length=395

 Score =   386 bits (992),  Expect = 5e-126, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 235/324 (73%), Gaps = 13/324 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GII   SDLE  PL   S+     N     +LLA+ VGI+QK+ V++I++KFLS
Sbjct  72    SEALPEGIIAKTSDLEPLPLWGSSVKNE--NSKPSKSLLAIAVGIRQKEIVDKIVKKFLS  129

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  130   SDFVVMLFHYDGAVDKWRDLPWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYKYIFLWDE  189

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF+P RY+ I++ EGLEISQPALDP    ++H IT R + +K HRR +K KGS +
Sbjct  190   DLGVENFNPKRYVSIIQEEGLEISQPALDPDKSEVYHPITARVKKSKVHRRFHKYKGSAR  249

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC+G+VE MAPVFSRSAW+CVW++IQNDLVH WG+D++LGYCAQGDRT NVG
Sbjct  250   CDDHSSAPPCAGWVEMMAPVFSRSAWQCVWYMIQNDLVHAWGLDVQLGYCAQGDRTQNVG  309

Query  497   IVDSEYLVHLGIQSLG---GSSLKRASSPQELPKGRA--------VDLRVEIRRQSTYEL  351
             +VDSEY+VHLG+ +LG   G+ +     P +    +A        V+ R ++R QS  ++
Sbjct  310   VVDSEYIVHLGLPTLGVSDGNKVTNGPDPSQKGDSKALAPSSSDKVNDRSKVRMQSFIDM  369

Query  350   QIFKERWEEAVKEDKNWVDPYKAS  279
             QIFKERW  AVK+DK WVDPY+ S
Sbjct  370   QIFKERWSAAVKKDKCWVDPYQLS  393



>ref|XP_009355356.1| PREDICTED: uncharacterized protein LOC103946389 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009355357.1| PREDICTED: uncharacterized protein LOC103946389 isoform X1 [Pyrus 
x bretschneideri]
Length=402

 Score =   386 bits (992),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 235/324 (73%), Gaps = 13/324 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GII   SDLE  PL   S+     N     +LLA+ VGI+QK+ V++I++KFLS
Sbjct  79    SEALPEGIIAKTSDLEPLPLWGSSVKNE--NSKPSKSLLAIAVGIRQKEIVDKIVKKFLS  136

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  137   SDFVVMLFHYDGAVDKWRDLPWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYKYIFLWDE  196

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF+P RY+ I++ EGLEISQPALDP    ++H IT R + +K HRR +K KGS +
Sbjct  197   DLGVENFNPKRYVSIIQEEGLEISQPALDPDKSEVYHPITARVKKSKVHRRFHKYKGSAR  256

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC+G+VE MAPVFSRSAW+CVW++IQNDLVH WG+D++LGYCAQGDRT NVG
Sbjct  257   CDDHSSAPPCAGWVEMMAPVFSRSAWQCVWYMIQNDLVHAWGLDVQLGYCAQGDRTQNVG  316

Query  497   IVDSEYLVHLGIQSLG---GSSLKRASSPQELPKGRA--------VDLRVEIRRQSTYEL  351
             +VDSEY+VHLG+ +LG   G+ +     P +    +A        V+ R ++R QS  ++
Sbjct  317   VVDSEYIVHLGLPTLGVSDGNKVTNGPDPSQKGDSKALAPSSSDKVNDRSKVRMQSFIDM  376

Query  350   QIFKERWEEAVKEDKNWVDPYKAS  279
             QIFKERW  AVK+DK WVDPY+ S
Sbjct  377   QIFKERWSAAVKKDKCWVDPYQLS  400



>gb|KCW57157.1| hypothetical protein EUGRSUZ_I02788 [Eucalyptus grandis]
Length=354

 Score =   384 bits (987),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 188/346 (54%), Positives = 238/346 (69%), Gaps = 18/346 (5%)
 Frame = -3

Query  1283  AEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNL  1104
             +E     D +   +D   +G  S  LP+GI+   S+LE++PL      K+  N T   NL
Sbjct  10    SETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETSNLEMQPL--WGPIKNYKNTTPAMNL  65

Query  1103  LAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWW  924
             LA+ VGIKQK+ VN ++QKF S++F ++LFHYDG VD W +  WS+ AIH+ A +QTKWW
Sbjct  66    LALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGVVDDWKNFTWSERAIHVSAVNQTKWW  125

Query  923   FAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHR  744
             FAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL IV+ EGLEISQPALDP    +H  
Sbjct  126   FAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYLSIVQGEGLEISQPALDPVKSAVHQP  185

Query  743   ITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLV  564
             IT R + +K HRR+YK KGS +C   S  PPC G+VE MAPVFSR AWRCVWH+IQNDL+
Sbjct  186   ITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGWVEMMAPVFSRIAWRCVWHMIQNDLI  245

Query  563   HGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGS------SLKRASSPQELPKG  402
             H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ +LG          K   S ++LP  
Sbjct  246   HAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLPTLGAGLKNQVHDHKPVHSAKDLPSA  305

Query  401   RA--------VDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
              A        VD R E+R++S  E+Q+F  RW+ A+KED+ WVDP+
Sbjct  306   GAVASHEPHVVDSRFEVRKRSYEEMQVFSTRWKNAIKEDRCWVDPF  351



>ref|XP_010935615.1| PREDICTED: uncharacterized protein LOC105055478 isoform X2 [Elaeis 
guineensis]
Length=330

 Score =   384 bits (985),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 189/314 (60%), Positives = 226/314 (72%), Gaps = 42/314 (13%)
 Frame = -3

Query  1208  LPRGIIESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
             LPRG+++S SD+ELKPL     S S+ +++G Y  LLAM VGI QK NV+ +++KFL +N
Sbjct  54    LPRGVVQSTSDMELKPLWK---SSSQKDISGKYTALLAMAVGISQKQNVDILVRKFLIDN  110

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
              +IILFHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDL
Sbjct  111   CSIILFHYDGNVDGWHDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDL  170

Query  851   GVENFHPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  675
             GVENFH  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  C
Sbjct  171   GVENFHLGRYLQIMASEGLEISQPALDPDQSSEIHHRITVRDRKAKVHRRVYDFRGSLNC  230

Query  674   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  495
             S+ES GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQ         
Sbjct  231   SDESRGPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQA--------  282

Query  494   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVK  315
                                            +++DLR  IRRQST EL+ F +RW +AV+
Sbjct  283   -----------------------------PSKSLDLRTHIRRQSTAELEKFNKRWNQAVR  313

Query  314   EDKNWVDPYKASQR  273
             EDK W + ++   R
Sbjct  314   EDKEWFEHFEGYAR  327



>tpg|DAA63156.1| TPA: hypothetical protein ZEAMMB73_938040 [Zea mays]
Length=327

 Score =   383 bits (983),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 233/321 (73%), Gaps = 12/321 (4%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  672
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FHRRV   + + KCS
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHRRV--SRANKKCS  238

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  239   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  296

Query  491   DSEYLVHLGIQSLGGSSLKRA  429
             DSE++VH G+Q+LGGS++ + 
Sbjct  297   DSEFIVHRGVQTLGGSTITKV  317



>gb|ABR17377.1| unknown [Picea sitchensis]
Length=336

 Score =   383 bits (984),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 181/338 (54%), Positives = 239/338 (71%), Gaps = 7/338 (2%)
 Frame = -3

Query  1301  IYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNV  1122
             ++Q     M+S  D     +      R S +LP+G+++  SDLE++ L    I + +   
Sbjct  1     MHQPTPVSMQSSVDNESKDKHGEPCPRGSGALPKGLVQRSSDLEMRSLWGNPIQEGQRKT  60

Query  1121  TGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAH  942
                HNLLA+PVGIKQKDNVN+++QKF ++NFT++LFHY G VD W +  W++ AIH+ A 
Sbjct  61    P--HNLLAIPVGIKQKDNVNKMVQKFPADNFTVMLFHYYGVVDKWSEFKWTETAIHVAAI  118

Query  941   SQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKS  762
             +QTKWWFAKRFLHPD++ +Y+YIF+WDEDLGV NFH  RYL I++ EGLEISQPALD   
Sbjct  119   NQTKWWFAKRFLHPDIIDLYNYIFIWDEDLGVNNFHADRYLAIMEEEGLEISQPALDTSH  178

Query  761   IGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHL  582
               +H+ IT R+   + HRR+YK+ G   C   S  PPC+G+VE MAPVFSR+AWRC W +
Sbjct  179   ADVHYGITKRNPRTRVHRRMYKNGGGHPCLANSIAPPCTGWVEMMAPVFSRAAWRCSWGM  238

Query  581   IQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKG  402
             IQNDLVHGWGMDMKLGYCAQGDRT  VGI+DSEY++H GI SLGG   +  SS      G
Sbjct  239   IQNDLVHGWGMDMKLGYCAQGDRTKKVGIIDSEYILHEGIPSLGGMHDQNVSS-----SG  293

Query  401   RAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
                + R+E+R++S  E++IFK+RW +AV +D  W+DPY
Sbjct  294   VPDNTRLEVRKRSYIEMEIFKQRWAKAVDDDDCWIDPY  331



>ref|XP_006431495.1| hypothetical protein CICLE_v10001347mg [Citrus clementina]
 gb|ESR44735.1| hypothetical protein CICLE_v10001347mg [Citrus clementina]
Length=358

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 189/347 (54%), Positives = 249/347 (72%), Gaps = 24/347 (7%)
 Frame = -3

Query  1256  LYSAE-DSCVTGR----SSSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAM  1095
             +YSA+ ++C   +     + +LP GI+   S+LE++PL +   S SK+N      NLLA+
Sbjct  9     MYSAKPETCKNQQCRLPGTEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAI  65

Query  1094  PVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAK  915
               GIKQK  V++I++KF S++F ++LFHYD  VD W DL W+  AIH+ A +QTKWWFAK
Sbjct  66    AAGIKQKKIVDQIVRKFPSKDFVVMLFHYDSVVDEWKDLVWADRAIHVSAANQTKWWFAK  125

Query  914   RFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITV  735
             RFLHPD+V+ Y+YIFLWDED+GVENF+P RYL IVK EG EISQPALDP    +HH IT 
Sbjct  126   RFLHPDIVAEYNYIFLWDEDIGVENFNPRRYLSIVKDEGFEISQPALDPVKSEVHHPITA  185

Query  734   RSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGW  555
             R R +K HRR+YK KGS +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H W
Sbjct  186   RRRNSKAHRRMYKYKGSGRCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAW  245

Query  554   GMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS-------------LKRASSPQE  414
             G+D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG ++             L++ ++P  
Sbjct  246   GLDIQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVTTEPELNAVGQASDDLEQIANPVA  305

Query  413   LP--KGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
             L   + R  D R E+RRQS  E+QIF+ RW+ AV++DK WVDPY  S
Sbjct  306   LAPSQSRRYDNRPEVRRQSYIEMQIFRNRWKHAVEDDKCWVDPYGQS  352



>ref|XP_002527278.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35122.1| conserved hypothetical protein [Ricinus communis]
Length=382

 Score =   385 bits (988),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 229/317 (72%), Gaps = 10/317 (3%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ + SDLE + L        + N+    N+LAM VGIKQK NV++II+KFLS
Sbjct  72    SETLPRGIVSATSDLERRQL----FGHHEKNLKKPSNILAMAVGIKQKKNVDKIIKKFLS  127

Query  1037  --ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLW  864
                +F ++LFHYDG VD W DL WS  AIHI A +QTKWWFAKRFLHPD+VS YDYIFLW
Sbjct  128   SDNDFVLMLFHYDGVVDEWRDLEWSSRAIHIAAVNQTKWWFAKRFLHPDIVSEYDYIFLW  187

Query  863   DEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGS  684
             DEDLG++NFHP RYL I+K EGLEISQPALDPK   +HH++T R   ++ HRR+ K  G 
Sbjct  188   DEDLGIDNFHPGRYLSIIKEEGLEISQPALDPKKSEVHHQLTKRCNGSRVHRRINKQIGI  247

Query  683   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  504
             ++C     GPPCSGFVE MAPVFS+++WRC W++IQNDLVHGWG+D +LGYCAQGD T N
Sbjct  248   SRCDKNVTGPPCSGFVEMMAPVFSKASWRCTWYMIQNDLVHGWGVDFQLGYCAQGDPTKN  307

Query  503   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEE  324
             VGIVDSEY++H G+ +LGGS+  +A    + P+      R ++++ S  EL IFK RW  
Sbjct  308   VGIVDSEYIIHYGLPTLGGSATDKAQLLSKQPQ----TTRTQVKKWSFVELDIFKNRWRN  363

Query  323   AVKEDKNWVDPYKASQR  273
             A K D  W D YK +Q+
Sbjct  364   AAKSDDCWTDMYKPNQK  380



>ref|XP_010926741.1| PREDICTED: uncharacterized protein LOC105048935 isoform X3 [Elaeis 
guineensis]
Length=355

 Score =   384 bits (986),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 222/310 (72%), Gaps = 7/310 (2%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S  LP+GII   S+ E++PL      K K N     +LLA+PVGI+QK+ VN+I+ KF  
Sbjct  44    SEPLPKGIISQTSNFEMQPL--WGSPKRKGNTKSSKSLLAIPVGIRQKEVVNQIVTKFPP  101

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ Y+YIFLWDE
Sbjct  102   NYFMVMLFHYDGVVDEWRDLQWSDSALHISAINQTKWWFAKRFLHPDIVAEYNYIFLWDE  161

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DL VENFHP  YL I+K EGLEISQPALD     +HHRIT R R    HRR+YK  G  +
Sbjct  162   DLEVENFHPLTYLSIIKREGLEISQPALDISKSEVHHRITARLRKGAVHRRIYKFTGGGR  221

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C   S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL+H WG+D KLGYCAQGDR+ NVG
Sbjct  222   CYENSTAPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIHAWGLDRKLGYCAQGDRSKNVG  281

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +VDSEY+VH GI +LGG   K+       P+    + R  +R++S  EL+IF++RW+ AV
Sbjct  282   VVDSEYIVHKGIPTLGGVDEKKVH-----PRSPTFNDRFAVRKRSYVELEIFRKRWQMAV  336

Query  317   KEDKNWVDPY  288
             KEDK W+DPY
Sbjct  337   KEDKCWIDPY  346



>ref|XP_009384294.1| PREDICTED: uncharacterized protein LOC103971874 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=338

 Score =   383 bits (984),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/319 (59%), Positives = 232/319 (73%), Gaps = 8/319 (3%)
 Frame = -3

Query  1244  EDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNV  1065
             + +C++   S  LP+GI+   SD+E+ PL        K N     +LLAMPVGIKQK+ V
Sbjct  19    QSTCISS-GSEPLPKGIVCQTSDMEMVPL--WGPPNGKENNILQKSLLAMPVGIKQKEIV  75

Query  1064  NEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSI  885
             N+II KF S +FTIILFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ 
Sbjct  76    NQIIIKFASSDFTIILFHYDGVVDEWKDLQWSGSALHISAINQTKWWFAKRFLHPDIVAP  135

Query  884   YDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRR  705
             Y Y+FLWDEDL VENFHP +YL IV+ EGLEISQPAL+P    IHH+ITVRSR    HRR
Sbjct  136   YKYVFLWDEDLEVENFHPEKYLAIVEREGLEISQPALEPAKSRIHHQITVRSRKGDVHRR  195

Query  704   VYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCA  525
             +YK  G +KC   S  PPC+G+VE MAPVFSR+AWRC WH+IQ+DL+H WG+DMKLGYCA
Sbjct  196   MYKFNGGSKCYQNSSAPPCTGWVELMAPVFSRAAWRCAWHMIQSDLIHAWGLDMKLGYCA  255

Query  524   QGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQI  345
             QGDR+ NVG+VDSEY+VH G+ +LG    K  SS  E P   A + R  +R++S  E +I
Sbjct  256   QGDRSKNVGVVDSEYIVHKGLPTLGWFDEKTVSS--ERP---AANNRYAVRQRSYVESEI  310

Query  344   FKERWEEAVKEDKNWVDPY  288
             F++RW++AV ED  W DPY
Sbjct  311   FRKRWQKAVSEDNCWSDPY  329



>ref|XP_006431494.1| hypothetical protein CICLE_v10001347mg [Citrus clementina]
 gb|ESR44734.1| hypothetical protein CICLE_v10001347mg [Citrus clementina]
Length=407

 Score =   385 bits (989),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 185/329 (56%), Positives = 240/329 (73%), Gaps = 19/329 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             + +LP GI+   S+LE++PL +   S SK+N      NLLA+  GIKQK  V++I++KF 
Sbjct  76    TEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAIAAGIKQKKIVDQIVRKFP  132

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S++F ++LFHYD  VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  133   SKDFVVMLFHYDSVVDEWKDLVWADRAIHVSAANQTKWWFAKRFLHPDIVAEYNYIFLWD  192

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             ED+GVENF+P RYL IVK EG EISQPALDP    +HH IT R R +K HRR+YK KGS 
Sbjct  193   EDIGVENFNPRRYLSIVKDEGFEISQPALDPVKSEVHHPITARRRNSKAHRRMYKYKGSG  252

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG+D++LGYCAQGDRT NV
Sbjct  253   RCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAWGLDIQLGYCAQGDRTKNV  312

Query  500   GIVDSEYLVHLGIQSLGGSS-------------LKRASSPQELP--KGRAVDLRVEIRRQ  366
             G+VDSEY+VHLG+ +LG ++             L++ ++P  L   + R  D R E+RRQ
Sbjct  313   GVVDSEYIVHLGLPTLGVTTEPELNAVGQASDDLEQIANPVALAPSQSRRYDNRPEVRRQ  372

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKAS  279
             S  E+QIF+ RW+ AV++DK WVDPY  S
Sbjct  373   SYIEMQIFRNRWKHAVEDDKCWVDPYGQS  401



>ref|XP_009384293.1| PREDICTED: uncharacterized protein LOC103971874 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=409

 Score =   385 bits (989),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 189/321 (59%), Positives = 233/321 (73%), Gaps = 8/321 (2%)
 Frame = -3

Query  1250  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1071
             S + +C++   S  LP+GI+   SD+E+ PL        K N     +LLAMPVGIKQK+
Sbjct  88    SCKSTCISS-GSEPLPKGIVCQTSDMEMVPL--WGPPNGKENNILQKSLLAMPVGIKQKE  144

Query  1070  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  891
              VN+II KF S +FTIILFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V
Sbjct  145   IVNQIIIKFASSDFTIILFHYDGVVDEWKDLQWSGSALHISAINQTKWWFAKRFLHPDIV  204

Query  890   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  711
             + Y Y+FLWDEDL VENFHP +YL IV+ EGLEISQPAL+P    IHH+ITVRSR    H
Sbjct  205   APYKYVFLWDEDLEVENFHPEKYLAIVEREGLEISQPALEPAKSRIHHQITVRSRKGDVH  264

Query  710   RRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGY  531
             RR+YK  G +KC   S  PPC+G+VE MAPVFSR+AWRC WH+IQ+DL+H WG+DMKLGY
Sbjct  265   RRMYKFNGGSKCYQNSSAPPCTGWVELMAPVFSRAAWRCAWHMIQSDLIHAWGLDMKLGY  324

Query  530   CAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYEL  351
             CAQGDR+ NVG+VDSEY+VH G+ +LG    K  SS  E P   A + R  +R++S  E 
Sbjct  325   CAQGDRSKNVGVVDSEYIVHKGLPTLGWFDEKTVSS--ERP---AANNRYAVRQRSYVES  379

Query  350   QIFKERWEEAVKEDKNWVDPY  288
             +IF++RW++AV ED  W DPY
Sbjct  380   EIFRKRWQKAVSEDNCWSDPY  400



>ref|XP_008650834.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=369

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 198/387 (51%), Positives = 254/387 (66%), Gaps = 58/387 (15%)
 Frame = -3

Query  1367  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1209
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1208  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1032
              LP GI+ES SD++LKPL   + ++SK                            FL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSK----------------------------FLPEN  92

Query  1031  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  852
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  93    FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  152

Query  851   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKD----KGS  684
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FH  VY D    + +
Sbjct  153   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFH-SVYFDRRVSRAN  211

Query  683   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  504
              KCS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N
Sbjct  212   KKCSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKN  269

Query  503   VGIVDSEYLVHLGIQSLGGSS-------------LKRASSPQELPKGRA--VDLRVEIRR  369
             +G+VDSE++VH G+Q+LGGS+             L + ++  +  +GRA  +D+R +IRR
Sbjct  270   IGVVDSEFIVHRGVQTLGGSTITKDGIRGKNAKPLGQKAAQIQRSRGRAPGLDMRTKIRR  329

Query  368   QSTYELQIFKERWEEAVKEDKNWVDPY  288
             +S  EL+ F++RW+ A +ED+ WVDP+
Sbjct  330   KSRSELRDFQKRWDRAAREDRTWVDPF  356



>ref|XP_009404257.1| PREDICTED: uncharacterized protein LOC103987631 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=369

 Score =   384 bits (985),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 232/326 (71%), Gaps = 16/326 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMS-ISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             S  LP GII   S+LE++P+  +S  SK+K       +LLAM VGIKQK+ VN+I++KF 
Sbjct  35    SEPLPEGIIRRTSNLEMRPICGLSQSSKTKETKRASRSLLAMAVGIKQKEVVNQIVEKFS  94

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S  FT++LFHYDG VD W DL WS   IH+ A +QTKWWFAKRFLHPD+V+ YDYIFLWD
Sbjct  95    SSKFTVMLFHYDGVVDEWRDLRWSDSTIHVSAINQTKWWFAKRFLHPDIVAEYDYIFLWD  154

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVE+FHP RY+ I+  EGLE+SQPALD     +HH+IT R R    HRRVYK K S 
Sbjct  155   EDLGVEHFHPQRYISIIDKEGLEVSQPALDTSKSEVHHQITARGRKGDVHRRVYKVKSSG  214

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
              C   S  PPC+G+VE MAPVFSR++W CVW++IQNDL+H WG+DMKLGYC QGDR+ N+
Sbjct  215   GCYENSTAPPCTGWVEMMAPVFSRTSWHCVWNMIQNDLIHAWGLDMKLGYCVQGDRSKNI  274

Query  500   GIVDSEYLVHLGIQSLGGS-----SLKRASSPQE---------LPKG-RAVDLRVEIRRQ  366
             G+VDSEY+VH+GI +LGGS     + + +S P E         +P G  + + R  IRRQ
Sbjct  275   GVVDSEYIVHMGIPTLGGSDENKPNAETSSPPSESEQPYLGTMVPSGSSSYNDRSAIRRQ  334

Query  365   STYELQIFKERWEEAVKEDKNWVDPY  288
             S  EL IF+ RW+ AV +D+ W+DPY
Sbjct  335   SYAELMIFQRRWKRAVAKDECWIDPY  360



>ref|XP_003548344.1| PREDICTED: uncharacterized protein LOC100797710 isoform X1 [Glycine 
max]
Length=385

 Score =   384 bits (986),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 234/319 (73%), Gaps = 16/319 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL----KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQ  1050
             S +LP GII   S+LE++PL    K   I K  +N      LLAM VG++QK+ VN+I++
Sbjct  76    SEALPEGIIARTSNLEMRPLWDSGKDNGILKRPLN------LLAMAVGLEQKEIVNKIVE  129

Query  1049  KFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIF  870
             KFLS +F ++LFHYDG VDGW  LAWS  AIH+ A +QTKWWFAKRFLHPD+V  Y+YIF
Sbjct  130   KFLSSDFVVMLFHYDGFVDGWKSLAWSSRAIHVSAINQTKWWFAKRFLHPDIVVEYNYIF  189

Query  869   LWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDK  690
             LWDEDL V+NF P RYL IVK EGLEISQPALDP    +HH +TV    +K HRR YK K
Sbjct  190   LWDEDLLVDNFDPKRYLSIVKEEGLEISQPALDPTKSEVHHPLTVHKAGSKVHRRYYKLK  249

Query  689   GSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  510
             GS +C ++S  PPC G+VE MAPVFS+ +W+CVWHLIQNDL+H WG+D +LGYCAQGDR 
Sbjct  250   GSGRCDDKSTAPPCIGWVEMMAPVFSKKSWQCVWHLIQNDLIHAWGLDRQLGYCAQGDRM  309

Query  509   TNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
              NVG+VDSEY+VHLG+ +LGG      S+  E P G + D R ++R QS  E+Q+F +RW
Sbjct  310   QNVGVVDSEYIVHLGLPTLGG------SNGNEAPSGSSGDNRAKVRMQSYIEMQVFGKRW  363

Query  329   EEAVKEDKNWVDPYKASQR  273
             ++A ++DK W+DPY+ + +
Sbjct  364   KDAAEKDKCWIDPYEKANK  382



>ref|XP_006598790.1| PREDICTED: uncharacterized protein LOC100797710 isoform X4 [Glycine 
max]
Length=387

 Score =   384 bits (986),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 234/319 (73%), Gaps = 16/319 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL----KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQ  1050
             S +LP GII   S+LE++PL    K   I K  +N      LLAM VG++QK+ VN+I++
Sbjct  78    SEALPEGIIARTSNLEMRPLWDSGKDNGILKRPLN------LLAMAVGLEQKEIVNKIVE  131

Query  1049  KFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIF  870
             KFLS +F ++LFHYDG VDGW  LAWS  AIH+ A +QTKWWFAKRFLHPD+V  Y+YIF
Sbjct  132   KFLSSDFVVMLFHYDGFVDGWKSLAWSSRAIHVSAINQTKWWFAKRFLHPDIVVEYNYIF  191

Query  869   LWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDK  690
             LWDEDL V+NF P RYL IVK EGLEISQPALDP    +HH +TV    +K HRR YK K
Sbjct  192   LWDEDLLVDNFDPKRYLSIVKEEGLEISQPALDPTKSEVHHPLTVHKAGSKVHRRYYKLK  251

Query  689   GSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  510
             GS +C ++S  PPC G+VE MAPVFS+ +W+CVWHLIQNDL+H WG+D +LGYCAQGDR 
Sbjct  252   GSGRCDDKSTAPPCIGWVEMMAPVFSKKSWQCVWHLIQNDLIHAWGLDRQLGYCAQGDRM  311

Query  509   TNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
              NVG+VDSEY+VHLG+ +LGG      S+  E P G + D R ++R QS  E+Q+F +RW
Sbjct  312   QNVGVVDSEYIVHLGLPTLGG------SNGNEAPSGSSGDNRAKVRMQSYIEMQVFGKRW  365

Query  329   EEAVKEDKNWVDPYKASQR  273
             ++A ++DK W+DPY+ + +
Sbjct  366   KDAAEKDKCWIDPYEKANK  384



>ref|XP_010926739.1| PREDICTED: uncharacterized protein LOC105048935 isoform X1 [Elaeis 
guineensis]
Length=396

 Score =   384 bits (986),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 180/310 (58%), Positives = 222/310 (72%), Gaps = 7/310 (2%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S  LP+GII   S+ E++PL      K K N     +LLA+PVGI+QK+ VN+I+ KF  
Sbjct  85    SEPLPKGIISQTSNFEMQPL--WGSPKRKGNTKSSKSLLAIPVGIRQKEVVNQIVTKFPP  142

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ Y+YIFLWDE
Sbjct  143   NYFMVMLFHYDGVVDEWRDLQWSDSALHISAINQTKWWFAKRFLHPDIVAEYNYIFLWDE  202

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DL VENFHP  YL I+K EGLEISQPALD     +HHRIT R R    HRR+YK  G  +
Sbjct  203   DLEVENFHPLTYLSIIKREGLEISQPALDISKSEVHHRITARLRKGAVHRRIYKFTGGGR  262

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C   S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL+H WG+D KLGYCAQGDR+ NVG
Sbjct  263   CYENSTAPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIHAWGLDRKLGYCAQGDRSKNVG  322

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +VDSEY+VH GI +LGG   K+       P+    + R  +R++S  EL+IF++RW+ AV
Sbjct  323   VVDSEYIVHKGIPTLGGVDEKKVH-----PRSPTFNDRFAVRKRSYVELEIFRKRWQMAV  377

Query  317   KEDKNWVDPY  288
             KEDK W+DPY
Sbjct  378   KEDKCWIDPY  387



>ref|XP_006587812.1| PREDICTED: uncharacterized protein LOC100814260 [Glycine max]
Length=382

 Score =   384 bits (985),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 182/334 (54%), Positives = 242/334 (72%), Gaps = 10/334 (3%)
 Frame = -3

Query  1280  EMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYH-NL  1104
             +M +K     + ++ C  G  + +LP GII + SDLE++ L  + ++K+  N      NL
Sbjct  57    KMNTKKLGNDNCKNQCRPG-GNHALPEGIISNTSDLEMRHLWDLHMTKTIENKENTSTNL  115

Query  1103  LAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWW  924
              AM VGIKQKD VN++++KFL  NF ++LFHYDG VD W D  W+ + IH+   +Q+KWW
Sbjct  116   FAMAVGIKQKDLVNKMVKKFLVSNFVVMLFHYDGIVDEWNDFEWNNQVIHVAVANQSKWW  175

Query  923   FAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHR  744
             FAKRFLHPD+V+ Y YIFLWDEDLGVE+FHP RY+ I+KSEGLEISQPALD +   +HH+
Sbjct  176   FAKRFLHPDIVAEYGYIFLWDEDLGVEHFHPDRYVSIIKSEGLEISQPALDSEKSEVHHQ  235

Query  743   ITVRSRTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDL  567
             IT R R +  HRR+YK   S K C   S  PPC+G+VE MAPVFSR+AWRC+W++IQNDL
Sbjct  236   ITARGRRSNVHRRIYKSGVSGKRCDGSSTAPPCTGWVEMMAPVFSRAAWRCIWYMIQNDL  295

Query  566   VHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDL  387
             +H WG+DM+LGYCAQGDRT NVG+VD+EY+VH G  +LGG  +   SS       R  D 
Sbjct  296   IHAWGLDMQLGYCAQGDRTKNVGVVDAEYIVHYGHPTLGGLDVHEVSS-------RTKDH  348

Query  386   RVEIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
             RV++RR S  ELQ+F++RW++AV+ED+ WVDP++
Sbjct  349   RVDVRRLSYRELQVFRKRWQKAVEEDECWVDPFQ  382



>ref|XP_006285943.1| hypothetical protein CARUB_v10007463mg [Capsella rubella]
 gb|EOA18841.1| hypothetical protein CARUB_v10007463mg [Capsella rubella]
Length=382

 Score =   384 bits (985),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 232/323 (72%), Gaps = 18/323 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ S SDLE++PL        K N     NLLAM  GIKQK++VN+I++KFLS
Sbjct  65    SETLPRGIVASTSDLEMRPLWG-----GKRNTKPKLNLLAMAAGIKQKESVNKIVKKFLS  119

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   SEFVVMLFHYDGAVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  179

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R + ++ HRR YK  G T+
Sbjct  180   DLGVDHFDARRYVSIIKEEGLEISQPALDPNFSEVHHQLTSRDKKSRVHRRTYKVIGRTR  239

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CNENSTGPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTRNIG  299

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA---VDL---------RVEIRRQSTYE  354
             IVDSEY++H+G+ +LGGS+  +  S Q L K +     D+         R E+R+Q+  E
Sbjct  300   IVDSEYILHMGLPTLGGSAENKTGSDQ-LEKTKTQHDSDISKPSPTSSGRSEVRKQTYAE  358

Query  353   LQIFKERWEEAVKEDKNWVDPYK  285
             L+ FK RW  AVK D+ W+D ++
Sbjct  359   LETFKHRWRNAVKNDECWIDRFQ  381



>ref|XP_009381324.1| PREDICTED: uncharacterized protein LOC103969504 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   385 bits (989),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 182/317 (57%), Positives = 230/317 (73%), Gaps = 7/317 (2%)
 Frame = -3

Query  1238  SCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNE  1059
             S  T   S +LP+GI+  +SDLE+ PL      K  V++    +LLA+PVGI QK  VN+
Sbjct  114   SPCTSLGSEALPKGIVSPKSDLEMVPLWGSRRGKDGVSLQ--KSLLAIPVGINQKAMVNQ  171

Query  1058  IIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYD  879
             I+ KF+S +FT++LFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ Y 
Sbjct  172   IVMKFVSSDFTVMLFHYDGVVDEWKDLQWSDSALHISAINQTKWWFAKRFLHPDIVAPYK  231

Query  878   YIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVY  699
             YIFLWDED+ VENFHP RYL IV+ EGLEISQPALD     IHH+IT R      HRR+Y
Sbjct  232   YIFLWDEDIEVENFHPKRYLMIVEREGLEISQPALDLVKSRIHHQITARLSKRVVHRRMY  291

Query  698   KDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQG  519
             K  G  KC + S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL+H WG+DMKLGYCAQG
Sbjct  292   KFSGDKKCDDNSSQPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIHAWGLDMKLGYCAQG  351

Query  518   DRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFK  339
             D++ N+G+VDSEY+VH G+ +LGG   K  S+     K R+      +RR+S+ EL+IF+
Sbjct  352   DQSKNIGVVDSEYIVHKGLPTLGGFDEKMGSTGSPAAKDRSA-----VRRRSSVELEIFR  406

Query  338   ERWEEAVKEDKNWVDPY  288
             +RW++AV ED  W+DPY
Sbjct  407   KRWQKAVTEDNCWIDPY  423



>ref|XP_008218668.1| PREDICTED: uncharacterized protein LOC103318970 isoform X2 [Prunus 
mume]
Length=401

 Score =   384 bits (986),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/324 (57%), Positives = 237/324 (73%), Gaps = 14/324 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGI QK+ V+ I++KFLS
Sbjct  79    SEALPEGIVAQTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGINQKEIVDRIVKKFLS  136

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  137   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  196

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K H R YK KGS +
Sbjct  197   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVH-RFYKFKGSGR  255

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  256   CDDHSSAPPCAGWVEMMAPVFSRAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  315

Query  497   IVDSEYLVHLGIQSLG---GSSLKRASSPQEL--PKGRA------VDLRVEIRRQSTYEL  351
             +VDSEY+VHLG+ +LG   G+ +  A +P +   P+  A      V+ R ++R QS  ++
Sbjct  316   VVDSEYIVHLGLPTLGVSDGNKVTNAPAPPQKGDPEALAPSASDKVNDRAKVRMQSFIDM  375

Query  350   QIFKERWEEAVKEDKNWVDPYKAS  279
             QIFKERW  AVKEDK WVDP++ S
Sbjct  376   QIFKERWSNAVKEDKCWVDPFQLS  399



>ref|XP_006414995.1| hypothetical protein EUTSA_v10025444mg [Eutrema salsugineum]
 gb|ESQ56448.1| hypothetical protein EUTSA_v10025444mg [Eutrema salsugineum]
Length=385

 Score =   383 bits (984),  Expect = 8e-125, Method: Compositional matrix adjust.
 Identities = 180/326 (55%), Positives = 229/326 (70%), Gaps = 19/326 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ S+SDLE++PL       +K N     NLLAM  GIKQK++VN+I+ KF S
Sbjct  65    SETLPRGIVASKSDLEMRPLWG-----AKRNKKPKQNLLAMAAGIKQKESVNKIVNKFSS  119

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG+VD W +  WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   SEFVVMLFHYDGSVDEWKEFEWSETAIHISVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  179

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV+NF   RY+ I+K EGLEISQPALDP    +HH+ T R   ++ HRR YK  G  +
Sbjct  180   DLGVDNFDARRYVSIIKEEGLEISQPALDPHLSEVHHQHTSRENKSRVHRRTYKVIGRAR  239

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CNENSTGPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  299

Query  497   IVDSEYLVHLGIQSLGGSSLKRASS--------------PQELPKGRAVDLRVEIRRQST  360
             IVDSEY++HLG+ +LGGS+  +  S               +  P  +    R E+R+Q+ 
Sbjct  300   IVDSEYILHLGLPTLGGSAENKTDSGELDQTKSQHSSDKTKPSPISQMSSGRSEVRKQTY  359

Query  359   YELQIFKERWEEAVKEDKNWVDPYKA  282
              EL+ FK RW+ AVK D+ W+D ++A
Sbjct  360   AELETFKHRWKNAVKNDECWIDRFRA  385



>ref|XP_009404256.1| PREDICTED: uncharacterized protein LOC103987631 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   384 bits (985),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/326 (56%), Positives = 232/326 (71%), Gaps = 16/326 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMS-ISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             S  LP GII   S+LE++P+  +S  SK+K       +LLAM VGIKQK+ VN+I++KF 
Sbjct  76    SEPLPEGIIRRTSNLEMRPICGLSQSSKTKETKRASRSLLAMAVGIKQKEVVNQIVEKFS  135

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S  FT++LFHYDG VD W DL WS   IH+ A +QTKWWFAKRFLHPD+V+ YDYIFLWD
Sbjct  136   SSKFTVMLFHYDGVVDEWRDLRWSDSTIHVSAINQTKWWFAKRFLHPDIVAEYDYIFLWD  195

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVE+FHP RY+ I+  EGLE+SQPALD     +HH+IT R R    HRRVYK K S 
Sbjct  196   EDLGVEHFHPQRYISIIDKEGLEVSQPALDTSKSEVHHQITARGRKGDVHRRVYKVKSSG  255

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
              C   S  PPC+G+VE MAPVFSR++W CVW++IQNDL+H WG+DMKLGYC QGDR+ N+
Sbjct  256   GCYENSTAPPCTGWVEMMAPVFSRTSWHCVWNMIQNDLIHAWGLDMKLGYCVQGDRSKNI  315

Query  500   GIVDSEYLVHLGIQSLGGS-----SLKRASSPQE---------LPKG-RAVDLRVEIRRQ  366
             G+VDSEY+VH+GI +LGGS     + + +S P E         +P G  + + R  IRRQ
Sbjct  316   GVVDSEYIVHMGIPTLGGSDENKPNAETSSPPSESEQPYLGTMVPSGSSSYNDRSAIRRQ  375

Query  365   STYELQIFKERWEEAVKEDKNWVDPY  288
             S  EL IF+ RW+ AV +D+ W+DPY
Sbjct  376   SYAELMIFQRRWKRAVAKDECWIDPY  401



>ref|XP_008357685.1| PREDICTED: uncharacterized protein LOC103421429 [Malus domestica]
Length=421

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/332 (57%), Positives = 235/332 (71%), Gaps = 21/332 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP GII   SDLE  PL   S+     N     +LLA+ VGI+QK+ V++I++KFLS
Sbjct  90    SEALPEGIIAKTSDLEPLPLWGSSVXNE--NSKPSKSLLAIAVGIRQKEIVDKIVKKFLS  147

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  148   SDFVVMLFHYDGAVDKWRDLPWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYKYIFLWDE  207

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF+P RY+ IV+ E LEISQPALDP    ++H IT R + +K HRR +K KGS +
Sbjct  208   DLGVENFNPKRYVSIVQEEVLEISQPALDPDKSEVYHPITARVKKSKVHRRFHKYKGSAR  267

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC+G+VE MAPVFSRSAW+CVW++IQNDLVH WG+D++LGYCAQGDRT NVG
Sbjct  268   CDDHSSAPPCAGWVEMMAPVFSRSAWQCVWYMIQNDLVHAWGLDVQLGYCAQGDRTQNVG  327

Query  497   IVDSEYLVHLGIQSLGGSSLKRAS---------SPQELPKGRA----------VDLRVEI  375
             +VDSEY+VHLG+ +LG S   +AS          P    KG +          V+ R ++
Sbjct  328   VVDSEYIVHLGLSTLGVSDGNKASIMASWVVXNXPDPSQKGDSKALAPSSSDKVNDRSKV  387

Query  374   RRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
             R QS  ++QIFKERW  AVKEDK WVDPY+ S
Sbjct  388   RMQSFIDMQIFKERWSAAVKEDKCWVDPYQLS  419



>ref|XP_006592650.1| PREDICTED: uncharacterized protein LOC100526994 isoform X2 [Glycine 
max]
Length=345

 Score =   381 bits (979),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 232/319 (73%), Gaps = 16/319 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL----KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQ  1050
             S +LP GII   S+LE++PL    K   I K  +N      LLAM VG+KQK+ VN+I++
Sbjct  36    SEALPEGIIARTSNLEMRPLWDSGKDNRILKRPLN------LLAMAVGLKQKEIVNKIVE  89

Query  1049  KFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIF  870
             KFLS  F ++LFHYDG VDGW  LAWS  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIF
Sbjct  90    KFLSSGFVVMLFHYDGFVDGWKSLAWSSCAIHVSAINQTKWWFAKRFLHPDIVAEYNYIF  149

Query  869   LWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDK  690
             LWDEDL V+NF P RYL IVK EGLEISQPALDP    +HH +TV    +K HRR YK K
Sbjct  150   LWDEDLLVDNFDPKRYLSIVKEEGLEISQPALDPTKSEVHHPLTVHKAVSKVHRRYYKLK  209

Query  689   GSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  510
             GS +C ++S  PPC G+VE MAPVFS+ +W+CVWHLIQNDL+H WG+D +LGYCAQGDR 
Sbjct  210   GSGRCDDKSTAPPCIGWVEMMAPVFSKKSWQCVWHLIQNDLIHAWGLDRQLGYCAQGDRM  269

Query  509   TNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
              NVG+VDSEY+VHLG+ +LGG      S+  E P     D R ++R QS  E+Q+F +RW
Sbjct  270   RNVGVVDSEYIVHLGLPTLGG------SNGNEAPSDSPGDNRAKVRMQSYIEMQVFGKRW  323

Query  329   EEAVKEDKNWVDPYKASQR  273
             ++A ++DK W+DPY+ + +
Sbjct  324   KDAAEKDKCWIDPYEQANK  342



>ref|XP_010929765.1| PREDICTED: uncharacterized protein LOC105051150 isoform X5 [Elaeis 
guineensis]
Length=369

 Score =   382 bits (981),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 233/334 (70%), Gaps = 16/334 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  35    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  94

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  95    SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  154

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  155   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  214

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  215   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  274

Query  500   GIVDSEYLVHLGIQSLGGSSLKRASSPQE--------------LPKGRA-VDLRVEIRRQ  366
             G+VDSEY+VH+G  +LGG    ++++ Q               +P G + V  R  +RR+
Sbjct  275   GVVDSEYIVHMGTPTLGGFDENKSNAEQRGHAPVSESSYLGTVVPHGSSGVKDRYAVRRR  334

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
             S  EL+IF  RW+ AV ED+ W DPY  + +  K
Sbjct  335   SYVELRIFLTRWKNAVAEDQCWNDPYPEAGKKLK  368



>ref|XP_010929762.1| PREDICTED: uncharacterized protein LOC105051150 isoform X2 [Elaeis 
guineensis]
Length=407

 Score =   383 bits (983),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 181/333 (54%), Positives = 233/333 (70%), Gaps = 15/333 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  74    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  133

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  134   SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  193

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  194   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  253

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  254   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  313

Query  500   GIVDSEYLVHLGIQSLGGSSLKRASSPQE-------------LPKGRA-VDLRVEIRRQS  363
             G+VDSEY+VH+G  +LGG    ++++ Q              +P G + V  R  +RR+S
Sbjct  314   GVVDSEYIVHMGTPTLGGFDENKSNAEQRGHAPVSESSYLGTVPHGSSGVKDRYAVRRRS  373

Query  362   TYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
               EL+IF  RW+ AV ED+ W DPY  + +  K
Sbjct  374   YVELRIFLTRWKNAVAEDQCWNDPYPEAGKKLK  406



>ref|XP_006592649.1| PREDICTED: uncharacterized protein LOC100526994 isoform X1 [Glycine 
max]
Length=385

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 183/319 (57%), Positives = 232/319 (73%), Gaps = 16/319 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL----KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQ  1050
             S +LP GII   S+LE++PL    K   I K  +N      LLAM VG+KQK+ VN+I++
Sbjct  76    SEALPEGIIARTSNLEMRPLWDSGKDNRILKRPLN------LLAMAVGLKQKEIVNKIVE  129

Query  1049  KFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIF  870
             KFLS  F ++LFHYDG VDGW  LAWS  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIF
Sbjct  130   KFLSSGFVVMLFHYDGFVDGWKSLAWSSCAIHVSAINQTKWWFAKRFLHPDIVAEYNYIF  189

Query  869   LWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDK  690
             LWDEDL V+NF P RYL IVK EGLEISQPALDP    +HH +TV    +K HRR YK K
Sbjct  190   LWDEDLLVDNFDPKRYLSIVKEEGLEISQPALDPTKSEVHHPLTVHKAVSKVHRRYYKLK  249

Query  689   GSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  510
             GS +C ++S  PPC G+VE MAPVFS+ +W+CVWHLIQNDL+H WG+D +LGYCAQGDR 
Sbjct  250   GSGRCDDKSTAPPCIGWVEMMAPVFSKKSWQCVWHLIQNDLIHAWGLDRQLGYCAQGDRM  309

Query  509   TNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERW  330
              NVG+VDSEY+VHLG+ +LGG      S+  E P     D R ++R QS  E+Q+F +RW
Sbjct  310   RNVGVVDSEYIVHLGLPTLGG------SNGNEAPSDSPGDNRAKVRMQSYIEMQVFGKRW  363

Query  329   EEAVKEDKNWVDPYKASQR  273
             ++A ++DK W+DPY+ + +
Sbjct  364   KDAAEKDKCWIDPYEQANK  382



>ref|XP_009139661.1| PREDICTED: uncharacterized protein LOC103863665 isoform X3 [Brassica 
rapa]
Length=395

 Score =   382 bits (980),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 229/326 (70%), Gaps = 21/326 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  75    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  129

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  130   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  189

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  190   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  249

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  250   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  309

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA---------------VDLRVEIRRQS  363
             IVDSEY++HLG+ +LGGS+  +  S Q L K +                   R E+R+Q+
Sbjct  310   IVDSEYILHLGLPTLGGSAENKIDSEQ-LDKTKTEDSSDKSKPSSTSQMSSARSEVRKQT  368

Query  362   TYELQIFKERWEEAVKEDKNWVDPYK  285
               EL+ FK RW  AVK D+ W+D ++
Sbjct  369   YAELETFKHRWRNAVKNDECWIDRFQ  394



>ref|XP_006606436.1| PREDICTED: uncharacterized protein LOC100802412 isoform X1 [Glycine 
max]
Length=389

 Score =   382 bits (980),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 187/369 (51%), Positives = 242/369 (66%), Gaps = 22/369 (6%)
 Frame = -3

Query  1346  GLFCVSMLFILYRTT---------IYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1194
              L CV + F+    T         +     A+     DP+     +      S +LP GI
Sbjct  28    SLICVVLFFMTSAFTQEPKLSSWKMDTAVDADQNVIVDPVIDKCKNQCRPSGSEALPAGI  87

Query  1193  IESRSDLELKPLKAMSISKS-----KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1029
             +   S+LEL+PL    + K      ++ V    NL AM VGIKQKD VN++++KF+  NF
Sbjct  88    VSITSNLELRPLWNPPMPKKGRHTIELKVNASTNLFAMVVGIKQKDLVNKMVKKFIDSNF  147

Query  1028  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  849
              ++LFHYDG VD W DL WS   IH+ A  Q+KWWFAKRFLHPD+V+ YDYIFLWDEDLG
Sbjct  148   VVMLFHYDGIVDEWKDLEWSSRVIHVSAIDQSKWWFAKRFLHPDIVAEYDYIFLWDEDLG  207

Query  848   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CS  672
             VE+FHP +Y+ I+K EGLEISQPALDPK   +HH+IT R R +  HRR Y+     K C 
Sbjct  208   VEHFHPDKYVSIIKREGLEISQPALDPKKSEVHHQITARGRRSSVHRRTYRASNDGKGCD  267

Query  671   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  492
               S  PPC+G++E MAPVFSR+AWRCVW++IQNDL+H WG+DM+LGYCAQGDRT  VG+V
Sbjct  268   KSSTAPPCTGWIEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMQLGYCAQGDRTKKVGVV  327

Query  491   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKE  312
             D+EY+VH    +LGG      SS ++       D RV++RR S  EL IF++RWE+AV+E
Sbjct  328   DAEYIVHYNRPTLGGIDKTMVSSQEK-------DHRVDVRRLSYQELDIFRKRWEKAVEE  380

Query  311   DKNWVDPYK  285
             DK WVDP++
Sbjct  381   DKCWVDPFQ  389



>ref|XP_010929761.1| PREDICTED: uncharacterized protein LOC105051150 isoform X1 [Elaeis 
guineensis]
Length=408

 Score =   382 bits (981),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 233/334 (70%), Gaps = 16/334 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1041
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  74    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  133

Query  1040  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  861
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  134   SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  193

Query  860   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  681
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  194   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  253

Query  680   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  501
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  254   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  313

Query  500   GIVDSEYLVHLGIQSLGGSSLKRASSPQE--------------LPKGRA-VDLRVEIRRQ  366
             G+VDSEY+VH+G  +LGG    ++++ Q               +P G + V  R  +RR+
Sbjct  314   GVVDSEYIVHMGTPTLGGFDENKSNAEQRGHAPVSESSYLGTVVPHGSSGVKDRYAVRRR  373

Query  365   STYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
             S  EL+IF  RW+ AV ED+ W DPY  + +  K
Sbjct  374   SYVELRIFLTRWKNAVAEDQCWNDPYPEAGKKLK  407



>ref|XP_009139659.1| PREDICTED: uncharacterized protein LOC103863665 isoform X1 [Brassica 
rapa]
 emb|CDY39713.1| BnaA04g07220D [Brassica napus]
Length=400

 Score =   382 bits (980),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 229/326 (70%), Gaps = 21/326 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  254

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA---------------VDLRVEIRRQS  363
             IVDSEY++HLG+ +LGGS+  +  S Q L K +                   R E+R+Q+
Sbjct  315   IVDSEYILHLGLPTLGGSAENKIDSEQ-LDKTKTEDSSDKSKPSSTSQMSSARSEVRKQT  373

Query  362   TYELQIFKERWEEAVKEDKNWVDPYK  285
               EL+ FK RW  AVK D+ W+D ++
Sbjct  374   YAELETFKHRWRNAVKNDECWIDRFQ  399



>ref|XP_006589226.1| PREDICTED: uncharacterized protein LOC100807140 isoform X2 [Glycine 
max]
Length=351

 Score =   380 bits (975),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 230/317 (73%), Gaps = 13/317 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKS-----KVNVTGYHNLLAMPVGIKQKDNVNEII  1053
             S +LP GI+ + S LEL+PL    ++K      ++ V    NL AM VGIKQKD V++++
Sbjct  42    SEALPAGIVSTTSSLELRPLWNPPVTKKGHHKIELKVNASTNLFAMAVGIKQKDLVSKMV  101

Query  1052  QKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYI  873
             +KF+  NF ++LFHYDG VD W DL WS   IH+ A  Q+KWWFAKRFLHPD+V+ YDYI
Sbjct  102   KKFIDSNFVVMLFHYDGIVDEWKDLEWSSLVIHVSAIDQSKWWFAKRFLHPDIVTEYDYI  161

Query  872   FLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKD  693
             FLWDEDLGVE+FHP +Y+ I+K EGLEISQPALDPK   +HH+IT R R +  HRR YK 
Sbjct  162   FLWDEDLGVEHFHPDKYVSIIKREGLEISQPALDPKKSEVHHQITARGRRSSVHRRTYKA  221

Query  692   KGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGD  516
                 K C   S  PPC+G++E MAPVFSR+AWRCVW++IQNDL+H WG+D++LGYCAQGD
Sbjct  222   SNDGKGCDKSSTAPPCTGWIEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDIQLGYCAQGD  281

Query  515   RTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKE  336
             RT NVG+VD+EY+VH    +LGG      SS ++       D RV++RR S  EL +F++
Sbjct  282   RTKNVGVVDAEYIVHYNRPTLGGIDNTMVSSQEK-------DHRVDVRRLSYQELDVFRK  334

Query  335   RWEEAVKEDKNWVDPYK  285
             RWE+AV+EDK WVDP++
Sbjct  335   RWEKAVEEDKCWVDPFQ  351



>ref|XP_010533215.1| PREDICTED: uncharacterized protein LOC104809032 [Tarenaya hassleriana]
Length=394

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/324 (56%), Positives = 235/324 (73%), Gaps = 16/324 (5%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             + +LP+GII   S+LE++ L +  + KSK N +   +LLAM VGIKQK+ VN+II KF  
Sbjct  73    TEALPQGIITKTSNLEMQRLWSYDMKKSKPNHS--MSLLAMAVGIKQKEVVNKIIPKFPP  130

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W    W++  IH+   +QTKWWFAKRFL+PD+V+ Y+YIFLWDE
Sbjct  131   RDFAVMLFHYDGVVDEWKQFPWNEHVIHVSVMNQTKWWFAKRFLYPDIVAEYEYIFLWDE  190

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             D+GVENF+P RYL IVK EGL+ISQPALD     +HH IT R R ++ HRR+YK KGS +
Sbjct  191   DIGVENFNPKRYLSIVKDEGLQISQPALDTTKSEVHHPITARQRNSRVHRRMYKYKGSGR  250

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C + S  PPC G+VE MAPVFS++AWRC WH++QNDL+H WG+DM+LGYCAQG+R  NVG
Sbjct  251   CDDHSTAPPCIGWVEMMAPVFSQAAWRCAWHMVQNDLIHAWGLDMQLGYCAQGNRMKNVG  310

Query  497   IVDSEYLVHLGIQSLG----GSSLKRAS-------SPQELP---KGRAVDLRVEIRRQST  360
             +VD+EY+VH G+ +LG     SS  R S       S QE P   + R VD R E+RRQS 
Sbjct  311   VVDAEYIVHYGLPTLGVTESESSPSRVSFAQKETLSDQEAPAPSESREVDNRPEVRRQSY  370

Query  359   YELQIFKERWEEAVKEDKNWVDPY  288
              E+Q+FKERW+ AV+ DK WVDPY
Sbjct  371   IEMQMFKERWKNAVRNDKCWVDPY  394



>ref|XP_006589225.1| PREDICTED: uncharacterized protein LOC100807140 isoform X1 [Glycine 
max]
Length=389

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 230/317 (73%), Gaps = 13/317 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKS-----KVNVTGYHNLLAMPVGIKQKDNVNEII  1053
             S +LP GI+ + S LEL+PL    ++K      ++ V    NL AM VGIKQKD V++++
Sbjct  80    SEALPAGIVSTTSSLELRPLWNPPVTKKGHHKIELKVNASTNLFAMAVGIKQKDLVSKMV  139

Query  1052  QKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYI  873
             +KF+  NF ++LFHYDG VD W DL WS   IH+ A  Q+KWWFAKRFLHPD+V+ YDYI
Sbjct  140   KKFIDSNFVVMLFHYDGIVDEWKDLEWSSLVIHVSAIDQSKWWFAKRFLHPDIVTEYDYI  199

Query  872   FLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKD  693
             FLWDEDLGVE+FHP +Y+ I+K EGLEISQPALDPK   +HH+IT R R +  HRR YK 
Sbjct  200   FLWDEDLGVEHFHPDKYVSIIKREGLEISQPALDPKKSEVHHQITARGRRSSVHRRTYKA  259

Query  692   KGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGD  516
                 K C   S  PPC+G++E MAPVFSR+AWRCVW++IQNDL+H WG+D++LGYCAQGD
Sbjct  260   SNDGKGCDKSSTAPPCTGWIEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDIQLGYCAQGD  319

Query  515   RTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKE  336
             RT NVG+VD+EY+VH    +LGG      SS ++       D RV++RR S  EL +F++
Sbjct  320   RTKNVGVVDAEYIVHYNRPTLGGIDNTMVSSQEK-------DHRVDVRRLSYQELDVFRK  372

Query  335   RWEEAVKEDKNWVDPYK  285
             RWE+AV+EDK WVDP++
Sbjct  373   RWEKAVEEDKCWVDPFQ  389



>emb|CDY60485.1| BnaC04g55870D [Brassica napus]
Length=400

 Score =   381 bits (979),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 179/326 (55%), Positives = 229/326 (70%), Gaps = 21/326 (6%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDAKRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDSKSRVHRRTYKVIGKAR  254

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA---------------VDLRVEIRRQS  363
             IVDSEY++HLG+ +LGGS+  +  S Q L K +                   R E+R+Q+
Sbjct  315   IVDSEYILHLGLPTLGGSAENKIDSEQ-LDKTKTEDSSDKSKPSSTSQISSARSEVRKQT  373

Query  362   TYELQIFKERWEEAVKEDKNWVDPYK  285
               EL+ FK RW  AVK D+ W+D ++
Sbjct  374   YAELETFKHRWRNAVKNDECWIDRFQ  399



>ref|XP_010070146.1| PREDICTED: uncharacterized protein LOC104456934 isoform X1 [Eucalyptus 
grandis]
Length=408

 Score =   381 bits (979),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 186/343 (54%), Positives = 237/343 (69%), Gaps = 19/343 (6%)
 Frame = -3

Query  1274  ESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAM  1095
             +S+S    +  + C   R S  LP GI+ S SDLE++PL       +K + +   NL A+
Sbjct  61    KSQSTKTSTCANQC-RPRGSEVLPEGIVASSSDLEMRPL----WDSAKGSPSSSSNLFAV  115

Query  1094  PVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAK  915
              VGIKQKD VN+++ KFLS +F ++LFHYDG VD W DL WS   IH+ A +QTKWWFAK
Sbjct  116   AVGIKQKDLVNKMVTKFLSNDFVVMLFHYDGAVDEWKDLEWSDRVIHVSASNQTKWWFAK  175

Query  914   RFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITV  735
             RFLHPD+V+ Y+YIFLWDEDLGVE+FHP +Y+ I+K+EGLEISQPALDP    +HH+IT 
Sbjct  176   RFLHPDIVAEYNYIFLWDEDLGVEDFHPNKYISIIKTEGLEISQPALDPTKSEVHHQITA  235

Query  734   RSRTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  558
             R R    HRR YK  G  K C + S  PPC+G++E MAPVFSR AWRCVW++IQNDL+H 
Sbjct  236   RGRRTVVHRRTYKPGGHGKGCGSNSTAPPCTGWIEMMAPVFSRVAWRCVWYMIQNDLIHA  295

Query  557   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS------------PQE  414
             WG+D +LGYCAQGDRT NVGIVD+EY+VH    +LGG +  ++ S              E
Sbjct  296   WGLDTQLGYCAQGDRTKNVGIVDAEYIVHYNRPTLGGGNENKSDSQSHHDASETEKMESE  355

Query  413   LP-KGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
              P +    D RVE+RRQS  EL +F++RW++AVKED  W DPY
Sbjct  356   APSRSHKHDPRVEVRRQSYIELAVFRKRWKKAVKEDVCWTDPY  398



>ref|XP_009342401.1| PREDICTED: uncharacterized protein LOC103934377 [Pyrus x bretschneideri]
Length=471

 Score =   383 bits (984),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 239/333 (72%), Gaps = 15/333 (5%)
 Frame = -3

Query  1250  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1071
             S E  C     + +LP+GI+   SDL ++PL      ++K N     NLLAM VG+KQK+
Sbjct  137   SCETQC-KPEGTEALPKGIVSKTSDLLMQPLWG---PRNKKNSKSSTNLLAMAVGLKQKE  192

Query  1070  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  891
             +VN+I++KF+S +F ++LFHYDG+V+ W DL WS +AIH+ A +QTKWW+AKRFLHPD+V
Sbjct  193   SVNKIVKKFMSSDFVLMLFHYDGHVNEWRDLEWSGKAIHVSAMNQTKWWYAKRFLHPDIV  252

Query  890   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  711
             S Y++IFLWDEDLG+ENF+  RYL I++ EGLEISQPALDP +  +HH +T R    + H
Sbjct  253   SEYEFIFLWDEDLGIENFNAGRYLSIIRKEGLEISQPALDPDNSEVHHLLTARDNRTEVH  312

Query  710   RRVYKD-KGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLG  534
             R++ K  +G  KC   S  PPC+GFVE MAPVFSR++WRC+WH+IQNDLVH WG+D +LG
Sbjct  313   RKINKTLRGGRKCDENSTDPPCTGFVEMMAPVFSRASWRCIWHMIQNDLVHAWGLDFQLG  372

Query  533   YCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS-----PQE---LPKGR--AVDLR  384
             YCAQGDRT N+GIVDSEY++H GI SLGGS+  +  +     P +   LP       D R
Sbjct  373   YCAQGDRTKNIGIVDSEYIIHYGIPSLGGSAANKTHADANDQPAQNISLPSSEQPVSDPR  432

Query  383   VEIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
              E+R+ S  EL+IFK RW+ A++ED  W+DP++
Sbjct  433   TEVRKLSLAELEIFKNRWKRAIREDNCWIDPFQ  465



>ref|XP_008794582.1| PREDICTED: uncharacterized protein LOC103710580 isoform X2 [Phoenix 
dactylifera]
Length=423

 Score =   382 bits (980),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 188/353 (53%), Positives = 239/353 (68%), Gaps = 19/353 (5%)
 Frame = -3

Query  1295  QYQQAEMESKSDPLYSAEDSCVTG---RSSSSLPRGIIESRSDLELKPLKAMSISKSKVN  1125
             Q  Q  +E+K +   +    C +      S  LP+GII   S+ E++PL      + KV 
Sbjct  72    QNSQTNLETKRNLETTKSSLCESQWKPAGSEPLPKGIISQTSNFEMQPL--WGSPERKVK  129

Query  1124  VTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVA  945
                  +LLA+PVGIKQK  V++I++KF S NFT++LFHYDG VD W D+ WS  A+HI A
Sbjct  130   TKHSKSLLAIPVGIKQKGAVSQIVEKFPSNNFTVMLFHYDGVVDEWSDVRWSDSALHISA  189

Query  944   HSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK  765
              +QTKWWFAKRFLHPDVV+ Y+YIFLWDEDL VENFHP RYL I+K EGLEISQPALD  
Sbjct  190   INQTKWWFAKRFLHPDVVAEYNYIFLWDEDLEVENFHPLRYLSIIKREGLEISQPALDTA  249

Query  764   SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWH  585
                +HH IT R R    HRR+YK  G  +C   S  PPC+G+VE MAPVFSR AWRC WH
Sbjct  250   RSAVHHGITARWRKGDVHRRIYKLGGGGRCYENSTTPPCTGWVEMMAPVFSRDAWRCTWH  309

Query  584   LIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLG-------------GS  444
             +IQNDLVH WG+D KLGYCAQGDR+ NVG+VDSEY+VH GI +LG             G+
Sbjct  310   MIQNDLVHAWGLDTKLGYCAQGDRSKNVGVVDSEYIVHRGIPTLGGLDEKKRNADSASGA  369

Query  443   SLKRASSPQELPKGRAVDL-RVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
             S  + S+ +++  G +    R  +R++S +EL +F++RW++AV EDK WVDPY
Sbjct  370   SQTKPSNLEKVHHGSSTSKDRSAVRKRSYFELNLFRKRWQKAVTEDKCWVDPY  422



>ref|XP_008218437.1| PREDICTED: uncharacterized protein LOC103318783 [Prunus mume]
Length=388

 Score =   380 bits (976),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 181/319 (57%), Positives = 228/319 (71%), Gaps = 12/319 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL--KAMSISKSKVNV-----TGYHNLLAMPVGIKQKDNVNE  1059
             S +LP+ I+   S+LE++PL  +    SKS VN+         NL AM VGIKQKD V++
Sbjct  74    SEALPQDIVSKTSNLEMRPLWNEKKKRSKSSVNLLEKKGANSTNLFAMAVGIKQKDLVSK  133

Query  1058  IIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYD  879
             +++KFLS  F ++LFHYDG VD W +  W+   IH+ A +QTKWWFAKRFLHPD+V+ Y 
Sbjct  134   MVKKFLSSGFVVMLFHYDGIVDEWKEFQWNDLVIHVSAINQTKWWFAKRFLHPDIVAEYS  193

Query  878   YIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVY  699
             YIFLWDEDLGVENFHP RY+ IV+ EGLEISQPALD     +HH IT R R +  HRR Y
Sbjct  194   YIFLWDEDLGVENFHPKRYVSIVQKEGLEISQPALDYSKSEVHHLITARLRGSIAHRRTY  253

Query  698   K-DKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  522
             K       C   S  PPC+G++E MAPVFSR+AWRCVWH+IQNDL+H WG+DM+LGYCAQ
Sbjct  254   KASNNGNGCDGSSTAPPCTGWIEVMAPVFSRAAWRCVWHMIQNDLIHAWGLDMQLGYCAQ  313

Query  521   GDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIF  342
             GDRT NVG+VD+EY++H G  +LGGS     SS    PK    D RV++RR+S  E+++F
Sbjct  314   GDRTKNVGVVDAEYIIHYGRPTLGGSDENEESS----PKSSGKDHRVDVRRESYNEMKVF  369

Query  341   KERWEEAVKEDKNWVDPYK  285
             K +WE AVK+DK W+DPYK
Sbjct  370   KRKWERAVKDDKCWIDPYK  388



>ref|XP_007205391.1| hypothetical protein PRUPE_ppa007419mg [Prunus persica]
 gb|EMJ06590.1| hypothetical protein PRUPE_ppa007419mg [Prunus persica]
Length=368

 Score =   379 bits (974),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/319 (56%), Positives = 228/319 (71%), Gaps = 12/319 (4%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPL--KAMSISKSKVNV-----TGYHNLLAMPVGIKQKDNVNE  1059
             S +LP+ I+   S+LE++PL  +    SKS VN+         NL AM VGIKQKD V++
Sbjct  54    SEALPQDIVSKTSNLEMRPLWNEKKKRSKSSVNLLEKKGANSTNLFAMAVGIKQKDLVSK  113

Query  1058  IIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYD  879
             +++KFLS  F ++LFHYDG VD W +  WS   IH+ A +QTKWWFAKRFLHPD+V+ Y 
Sbjct  114   MVKKFLSSGFVVMLFHYDGIVDEWKEFQWSDLVIHVSAINQTKWWFAKRFLHPDIVAEYS  173

Query  878   YIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVY  699
             YIFLWDEDLGVENFHP RY+ IV+ EGLEISQPALD     +HH+IT R R +  HRR Y
Sbjct  174   YIFLWDEDLGVENFHPKRYVSIVQKEGLEISQPALDYSKSEVHHQITARLRGSIAHRRTY  233

Query  698   K-DKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  522
             K       C   S  PPC+G++E MAPVFSR+AWRCVWH+IQNDL+H WG+DM+LGYCAQ
Sbjct  234   KASNNGNGCHESSTAPPCTGWIEVMAPVFSRAAWRCVWHMIQNDLIHAWGLDMQLGYCAQ  293

Query  521   GDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIF  342
             GDRT NVG+VD+EY++H G+ +LGGS      S     K    D RV++RR+S  E+++F
Sbjct  294   GDRTKNVGVVDAEYIIHYGLPTLGGSDENEEPS----SKSSGKDHRVDVRRESYNEMKVF  349

Query  341   KERWEEAVKEDKNWVDPYK  285
             K +WE AVK+DK W+DPYK
Sbjct  350   KRKWERAVKDDKCWIDPYK  368



>ref|XP_008794581.1| PREDICTED: uncharacterized protein LOC103710580 isoform X1 [Phoenix 
dactylifera]
Length=424

 Score =   381 bits (979),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 237/354 (67%), Gaps = 20/354 (6%)
 Frame = -3

Query  1295  QYQQAEMESKSDPLYSAEDSCVTG---RSSSSLPRGIIESRSDLELKPLKAMSISKSKVN  1125
             Q  Q  +E+K +   +    C +      S  LP+GII   S+ E++PL      + KV 
Sbjct  72    QNSQTNLETKRNLETTKSSLCESQWKPAGSEPLPKGIISQTSNFEMQPL--WGSPERKVK  129

Query  1124  VTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVA  945
                  +LLA+PVGIKQK  V++I++KF S NFT++LFHYDG VD W D+ WS  A+HI A
Sbjct  130   TKHSKSLLAIPVGIKQKGAVSQIVEKFPSNNFTVMLFHYDGVVDEWSDVRWSDSALHISA  189

Query  944   HSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK  765
              +QTKWWFAKRFLHPDVV+ Y+YIFLWDEDL VENFHP RYL I+K EGLEISQPALD  
Sbjct  190   INQTKWWFAKRFLHPDVVAEYNYIFLWDEDLEVENFHPLRYLSIIKREGLEISQPALDTA  249

Query  764   SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWH  585
                +HH IT R R    HRR+YK  G  +C   S  PPC+G+VE MAPVFSR AWRC WH
Sbjct  250   RSAVHHGITARWRKGDVHRRIYKLGGGGRCYENSTTPPCTGWVEMMAPVFSRDAWRCTWH  309

Query  584   LIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKR--ASSPQEL  411
             +IQNDLVH WG+D KLGYCAQGDR+ NVG+VDSEY+VH GI +LGG   K+  A S    
Sbjct  310   MIQNDLVHAWGLDTKLGYCAQGDRSKNVGVVDSEYIVHRGIPTLGGLDEKKRNADSASGA  369

Query  410   PKGRAVDL-------------RVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
              + +  +L             R  +R++S +EL +F++RW++AV EDK WVDPY
Sbjct  370   SQTKPSNLEKVVHHGSSTSKDRSAVRKRSYFELNLFRKRWQKAVTEDKCWVDPY  423



>ref|XP_008794583.1| PREDICTED: uncharacterized protein LOC103710580 isoform X3 [Phoenix 
dactylifera]
Length=412

 Score =   381 bits (978),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 189/354 (53%), Positives = 236/354 (67%), Gaps = 20/354 (6%)
 Frame = -3

Query  1295  QYQQAEMESKSDPLYSAEDSCVTG---RSSSSLPRGIIESRSDLELKPLKAMSISKSKVN  1125
             Q  Q  +E+K +   +    C +      S  LP+GII   S+ E++PL      + KV 
Sbjct  60    QNSQTNLETKRNLETTKSSLCESQWKPAGSEPLPKGIISQTSNFEMQPL--WGSPERKVK  117

Query  1124  VTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVA  945
                  +LLA+PVGIKQK  V++I++KF S NFT++LFHYDG VD W D+ WS  A+HI A
Sbjct  118   TKHSKSLLAIPVGIKQKGAVSQIVEKFPSNNFTVMLFHYDGVVDEWSDVRWSDSALHISA  177

Query  944   HSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK  765
              +QTKWWFAKRFLHPDVV+ Y+YIFLWDEDL VENFHP RYL I+K EGLEISQPALD  
Sbjct  178   INQTKWWFAKRFLHPDVVAEYNYIFLWDEDLEVENFHPLRYLSIIKREGLEISQPALDTA  237

Query  764   SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWH  585
                +HH IT R R    HRR+YK  G  +C   S  PPC+G+VE MAPVFSR AWRC WH
Sbjct  238   RSAVHHGITARWRKGDVHRRIYKLGGGGRCYENSTTPPCTGWVEMMAPVFSRDAWRCTWH  297

Query  584   LIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS------  423
             +IQNDLVH WG+D KLGYCAQGDR+ NVG+VDSEY+VH GI +LGG   K+ ++      
Sbjct  298   MIQNDLVHAWGLDTKLGYCAQGDRSKNVGVVDSEYIVHRGIPTLGGLDEKKRNADSASGA  357

Query  422   ----PQELPK-----GRAVDLRVEIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
                 P  L K           R  +R++S +EL +F++RW++AV EDK WVDPY
Sbjct  358   SQTKPSNLEKVVHHGSSTSKDRSAVRKRSYFELNLFRKRWQKAVTEDKCWVDPY  411



>ref|XP_007143978.1| hypothetical protein PHAVU_007G118700g, partial [Phaseolus vulgaris]
 gb|ESW15972.1| hypothetical protein PHAVU_007G118700g, partial [Phaseolus vulgaris]
Length=383

 Score =   380 bits (975),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 182/367 (50%), Positives = 247/367 (67%), Gaps = 23/367 (6%)
 Frame = -3

Query  1343  LFCVSMLFILYRTTIYQYQQAEMESK-SDPLYSAEDSC---VTGRSSSSLPRGIIESRSD  1176
             L C ++ F+   ++I+  Q      K +D   +  D C      + S +LP G++ + S 
Sbjct  23    LICAALFFM---SSIFSSQPKLSSWKMNDEQTARADKCKNQCRPKGSEALPEGMVSTTSS  79

Query  1175  LELKPL---------KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1023
              +L+PL            +I  ++V +    +L AM VGIKQK+ V+++++KFL  NFT+
Sbjct  80    FDLRPLWDPPMPKKKGHHTIEAAQVKLNASSSLFAMAVGIKQKNLVDKMVKKFLQSNFTV  139

Query  1022  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  843
             +LFHYDG VDGW DL W+   IH+    Q KWWFAKRFLHPD+V+ YDYIFLWDEDLGV+
Sbjct  140   MLFHYDGIVDGWNDLEWNSRVIHVSVKGQGKWWFAKRFLHPDIVADYDYIFLWDEDLGVQ  199

Query  842   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNE  666
              FHP +Y+ I+K EGLEISQPALDPK   +HH+IT R R +  HRR Y+     K C+  
Sbjct  200   YFHPDKYVSIIKREGLEISQPALDPKKSEVHHQITARGRRSTVHRRTYRTGNDGKGCNKS  259

Query  665   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  486
             S  PPC+G++E MAPVFSR+AWRCVW++IQNDL+H WG+D++LGYCAQGDRT NVG+VD+
Sbjct  260   STAPPCTGWIEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDIQLGYCAQGDRTQNVGVVDA  319

Query  485   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAVKEDK  306
             EY++H    +LGG   K    PQE       D RV++RR S  EL IF++RWE+AV+ED+
Sbjct  320   EYIIHYNRPTLGGGDDKNVLKPQE------KDHRVDVRRLSYRELDIFRKRWEKAVEEDE  373

Query  305   NWVDPYK  285
              WVDP++
Sbjct  374   CWVDPFQ  380



>ref|XP_011028387.1| PREDICTED: uncharacterized protein LOC105128424 isoform X2 [Populus 
euphratica]
Length=344

 Score =   378 bits (970),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 177/309 (57%), Positives = 229/309 (74%), Gaps = 6/309 (2%)
 Frame = -3

Query  1217  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1038
             S +LP+GI+  +S+ +++PL   S+     N     +LLA+ VGIKQK  VN+I++KF  
Sbjct  32    SETLPQGIVTKKSNYKMRPLWGSSLKDD--NPLPSMSLLAIAVGIKQKAIVNQIVEKFPL  89

Query  1037  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  858
              +F ++LFHYDG VD W DL+WS  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWDE
Sbjct  90    SDFVVMLFHYDGVVDEWRDLSWSNSAIHVSAVNQTKWWFAKRFLHPDIVAEYNYIFLWDE  149

Query  857   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  678
             DLGVENF+P RYL IVK EGLE+SQPALDP    +HH+IT R R +  HR++ K +G+TK
Sbjct  150   DLGVENFNPRRYLSIVKDEGLEVSQPALDPSKSIVHHQITARIRNSIVHRKILKFRGNTK  209

Query  677   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  498
             C   S  PPC+G+VE MAPVFS++AW+C W +IQNDL+H WG+D KLGYCAQGD T NVG
Sbjct  210   CYGNSTSPPCTGWVEMMAPVFSKAAWQCTWFMIQNDLIHAWGLDRKLGYCAQGDWTKNVG  269

Query  497   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEIRRQSTYELQIFKERWEEAV  318
             +VD+EY+VHLG+ +LG  +     S   L K + VD R E+R QS+ E+ IF ERWE A+
Sbjct  270   VVDAEYIVHLGLSTLGVFN----GSEALLSKSKEVDKRPEVRTQSSVEMNIFHERWEAAI  325

Query  317   KEDKNWVDP  291
             KED+ WVDP
Sbjct  326   KEDRCWVDP  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4554914126840