BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7160_g1_i1 len=1709 path=[1596:0-376 3212:377-467 1973:468-1708]

Length=1709
                                                                      Score     E

ref|XP_006347092.1|  PREDICTED: uncharacterized protein LOC102580388    532   0.0      
ref|XP_011096284.1|  PREDICTED: uncharacterized protein LOC105175522    530   0.0      
ref|XP_009763335.1|  PREDICTED: uncharacterized protein LOC104215273    531   0.0      
ref|XP_004232824.1|  PREDICTED: uncharacterized protein LOC101260688    529   0.0      
ref|XP_009603719.1|  PREDICTED: uncharacterized protein LOC104098641    528   0.0      
gb|EYU27955.1|  hypothetical protein MIMGU_mgv1a007977mg                511   3e-174   
ref|XP_011086083.1|  PREDICTED: uncharacterized protein LOC105167912    511   6e-174   
ref|XP_010092612.1|  hypothetical protein L484_006374                   509   1e-173   
ref|XP_010327022.1|  PREDICTED: uncharacterized protein LOC101254...    506   3e-172   
ref|XP_009631143.1|  PREDICTED: uncharacterized protein LOC104120968    506   3e-172   
ref|XP_009766485.1|  PREDICTED: uncharacterized protein LOC104217853    502   2e-170   
ref|XP_010327027.1|  PREDICTED: uncharacterized protein LOC101254...    499   2e-169   
gb|KHG08288.1|  hypothetical protein F383_16150                         494   5e-168   
emb|CDO99608.1|  unnamed protein product                                495   8e-168   
ref|XP_007025742.1|  Uncharacterized protein TCM_029952                 498   3e-166   
ref|XP_007211954.1|  hypothetical protein PRUPE_ppa006425mg             490   6e-166   
ref|XP_008224979.1|  PREDICTED: uncharacterized protein LOC103324663    489   3e-165   
ref|XP_010646775.1|  PREDICTED: uncharacterized protein LOC100257753    486   2e-164   
ref|XP_011027923.1|  PREDICTED: uncharacterized protein LOC105128...    484   1e-163   
ref|XP_006449262.1|  hypothetical protein CICLE_v10015451mg             484   2e-163   
ref|XP_011043338.1|  PREDICTED: uncharacterized protein LOC105138816    483   2e-163   
ref|XP_006467869.1|  PREDICTED: uncharacterized protein LOC102620...    483   2e-163   
ref|XP_009378251.1|  PREDICTED: uncharacterized protein LOC103966743    484   2e-163   
ref|XP_006384013.1|  hypothetical protein POPTR_0004s03700g             483   3e-163   
ref|XP_006467868.1|  PREDICTED: uncharacterized protein LOC102620...    481   3e-162   
ref|XP_008355992.1|  PREDICTED: uncharacterized protein LOC103419671    481   3e-162   
ref|XP_006449263.1|  hypothetical protein CICLE_v10015451mg             481   3e-162   
ref|XP_002316643.2|  hypothetical protein POPTR_0011s04510g             480   4e-162   Populus trichocarpa [western balsam poplar]
ref|XP_006361017.1|  PREDICTED: uncharacterized protein LOC102578...    480   4e-162   
ref|XP_008383799.1|  PREDICTED: uncharacterized protein LOC103446457    480   5e-162   
ref|XP_002305670.2|  hypothetical protein POPTR_0004s03700g             479   9e-162   Populus trichocarpa [western balsam poplar]
gb|AES63728.2|  lysine ketoglutarate reductase trans-splicing-lik...    478   3e-161   
ref|XP_003593477.1|  Lysine ketoglutarate reductase trans-splicin...    478   4e-161   
gb|EYU43400.1|  hypothetical protein MIMGU_mgv1a022983mg                476   7e-161   
gb|KEH36526.1|  lysine ketoglutarate reductase trans-splicing-lik...    476   1e-160   
ref|XP_006449259.1|  hypothetical protein CICLE_v10015451mg             474   1e-160   
gb|KDO75805.1|  hypothetical protein CISIN_1g015555mg                   474   2e-160   
ref|XP_006449260.1|  hypothetical protein CICLE_v10015451mg             474   2e-160   
gb|EPS65991.1|  hypothetical protein M569_08784                         475   4e-160   
gb|KHG04115.1|  GTPase Der                                              474   7e-160   
ref|XP_003593478.1|  Lysine ketoglutarate reductase trans-splicin...    472   1e-159   
ref|XP_004293534.1|  PREDICTED: uncharacterized protein LOC101292191    473   2e-159   
ref|XP_010278334.1|  PREDICTED: uncharacterized protein LOC104612...    471   5e-159   
gb|KEH36527.1|  lysine ketoglutarate reductase trans-splicing-lik...    469   5e-159   
ref|XP_004146635.1|  PREDICTED: uncharacterized protein LOC101217607    471   2e-158   
gb|KGN64636.1|  hypothetical protein Csa_1G072470                       471   4e-158   
ref|XP_010268785.1|  PREDICTED: uncharacterized protein LOC104605639    469   4e-158   
ref|XP_010278336.1|  PREDICTED: uncharacterized protein LOC104612...    468   5e-158   
ref|XP_004158032.1|  PREDICTED: uncharacterized protein LOC101230572    470   5e-158   
ref|XP_006594612.1|  PREDICTED: uncharacterized protein LOC100776...    468   5e-157   
ref|XP_006594617.1|  PREDICTED: uncharacterized protein LOC100776...    468   5e-157   
gb|KHG05934.1|  26S proteasome regulatory subunit rpn-1                 467   7e-157   
ref|XP_010059328.1|  PREDICTED: uncharacterized protein LOC104447263    467   1e-156   
ref|XP_006597406.1|  PREDICTED: uncharacterized protein LOC100778...    465   4e-156   
ref|XP_006594619.1|  PREDICTED: uncharacterized protein LOC100776...    465   4e-156   
gb|KHN08570.1|  hypothetical protein glysoja_014335                     464   4e-156   
ref|XP_006597405.1|  PREDICTED: uncharacterized protein LOC100778...    465   4e-156   
ref|XP_006597401.1|  PREDICTED: uncharacterized protein LOC100778...    465   5e-156   
ref|XP_006594618.1|  PREDICTED: uncharacterized protein LOC100776...    464   7e-156   
gb|KCW74645.1|  hypothetical protein EUGRSUZ_E03369                     463   2e-155   
ref|XP_010696585.1|  PREDICTED: uncharacterized protein LOC104909088    463   3e-155   
ref|XP_006597407.1|  PREDICTED: uncharacterized protein LOC100778...    460   4e-155   
ref|XP_006583798.1|  PREDICTED: uncharacterized protein LOC100792...    460   3e-154   
gb|KHN07305.1|  hypothetical protein glysoja_027395                     459   6e-154   
ref|XP_007159269.1|  hypothetical protein PHAVU_002G223800g             458   1e-153   
ref|XP_008442108.1|  PREDICTED: uncharacterized protein LOC103486065    457   3e-153   
ref|XP_007148219.1|  hypothetical protein PHAVU_006G190100g             456   8e-153   
ref|XP_007148218.1|  hypothetical protein PHAVU_006G190100g             456   2e-152   
ref|XP_004485727.1|  PREDICTED: uncharacterized protein LOC101506...    455   2e-152   
ref|XP_009104492.1|  PREDICTED: uncharacterized protein LOC103830...    454   1e-151   
ref|XP_004485732.1|  PREDICTED: uncharacterized protein LOC101506...    452   1e-151   
ref|XP_004504995.1|  PREDICTED: uncharacterized protein LOC101512967    451   7e-151   
ref|XP_009104564.1|  PREDICTED: uncharacterized protein LOC103830...    452   9e-151   
ref|XP_003541558.1|  PREDICTED: uncharacterized protein LOC100807...    450   1e-150   
emb|CDY03814.1|  BnaC01g29310D                                          451   3e-150   
emb|CDY52220.1|  BnaA01g35920D                                          450   7e-150   
ref|XP_002521414.1|  conserved hypothetical protein                     447   1e-149   Ricinus communis
emb|CDY12891.1|  BnaA09g13830D                                          449   2e-149   
ref|XP_010905352.1|  PREDICTED: uncharacterized protein LOC105032...    447   3e-149   
ref|XP_010533870.1|  PREDICTED: uncharacterized protein LOC104809554    447   5e-149   
ref|XP_009113143.1|  PREDICTED: uncharacterized protein LOC103838453    447   7e-149   
emb|CDY40958.1|  BnaCnng10010D                                          446   2e-148   
ref|XP_006392027.1|  hypothetical protein EUTSA_v10023474mg             446   2e-148   
ref|XP_006417384.1|  hypothetical protein EUTSA_v10007686mg             444   2e-147   
ref|XP_006301321.1|  hypothetical protein CARUB_v10021730mg             443   3e-147   
ref|XP_010905328.1|  PREDICTED: uncharacterized protein LOC105032...    441   3e-147   
ref|XP_010473328.1|  PREDICTED: uncharacterized protein LOC104752...    442   9e-147   
ref|XP_002889853.1|  predicted protein                                  442   2e-146   
ref|XP_010418093.1|  PREDICTED: uncharacterized protein LOC104703720    441   3e-146   
ref|XP_010430128.1|  PREDICTED: uncharacterized protein LOC104714458    441   3e-146   
ref|NP_172583.2|  uncharacterized protein                               441   3e-146   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002888096.1|  hypothetical protein ARALYDRAFT_475199             439   1e-145   
ref|NP_176319.1|  uncharacterized protein                               439   1e-145   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307555.1|  hypothetical protein CARUB_v10009178mg             436   2e-145   
ref|XP_008809916.1|  PREDICTED: uncharacterized protein LOC103721469    436   3e-145   
ref|XP_006307556.1|  hypothetical protein CARUB_v10009178mg             437   8e-145   
emb|CDY20982.1|  BnaA08g25430D                                          434   4e-144   
ref|XP_010458502.1|  PREDICTED: uncharacterized protein LOC104739...    434   5e-144   
gb|KDO75810.1|  hypothetical protein CISIN_1g015555mg                   431   5e-144   
ref|XP_006449261.1|  hypothetical protein CICLE_v10015451mg             433   6e-144   
ref|XP_010458500.1|  PREDICTED: uncharacterized protein LOC104739...    435   7e-144   
ref|XP_010492461.1|  PREDICTED: uncharacterized protein LOC104769...    435   9e-144   
ref|XP_006449264.1|  hypothetical protein CICLE_v10015451mg             431   9e-144   
ref|XP_010492476.1|  PREDICTED: uncharacterized protein LOC104769...    433   1e-143   
emb|CDY20585.1|  BnaC08g14730D                                          434   2e-143   
emb|CDY19346.1|  BnaC05g08550D                                          434   2e-143   
gb|KDP20910.1|  hypothetical protein JCGZ_21381                         430   3e-143   
ref|XP_010458503.1|  PREDICTED: uncharacterized protein LOC104739...    429   4e-142   
ref|XP_010458501.1|  PREDICTED: uncharacterized protein LOC104739...    431   4e-142   
ref|XP_010278338.1|  PREDICTED: uncharacterized protein LOC104612...    424   1e-141   
gb|KEH31135.1|  lysine ketoglutarate reductase trans-splicing-rel...    439   1e-141   
ref|XP_010278337.1|  PREDICTED: uncharacterized protein LOC104612...    425   1e-141   
emb|CDX97937.1|  BnaA06g06880D                                          429   1e-141   
ref|XP_009148446.1|  PREDICTED: uncharacterized protein LOC103871881    429   2e-141   
ref|XP_009110741.1|  PREDICTED: uncharacterized protein LOC103836245    427   2e-141   
ref|XP_010476020.1|  PREDICTED: uncharacterized protein LOC104755...    428   3e-141   
ref|XP_010476024.1|  PREDICTED: uncharacterized protein LOC104755...    427   3e-141   
gb|ABK25584.1|  unknown                                                 427   8e-141   Picea sitchensis
ref|XP_010278339.1|  PREDICTED: uncharacterized protein LOC104612...    421   2e-140   
ref|XP_007148221.1|  hypothetical protein PHAVU_006G190100g             420   2e-139   
ref|XP_010473332.1|  PREDICTED: uncharacterized protein LOC104752...    415   2e-137   
ref|XP_010040735.1|  PREDICTED: uncharacterized protein LOC104429587    415   2e-137   
ref|XP_006848620.1|  hypothetical protein AMTR_s00171p00031600          416   8e-137   
ref|XP_006574635.1|  PREDICTED: uncharacterized protein LOC100807...    414   4e-136   
gb|AAN63500.1|AF317555_1  lysine ketoglutarate reductase trans-sp...    410   4e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006574639.1|  PREDICTED: uncharacterized protein LOC100807...    409   4e-135   
ref|XP_009395413.1|  PREDICTED: uncharacterized protein LOC103980679    409   9e-135   
ref|XP_010274911.1|  PREDICTED: uncharacterized protein LOC104610...    405   7e-133   
ref|XP_008802583.1|  PREDICTED: uncharacterized protein LOC103716...    403   1e-132   
ref|XP_010274912.1|  PREDICTED: uncharacterized protein LOC104610...    403   3e-132   
ref|XP_008802591.1|  PREDICTED: uncharacterized protein LOC103716...    401   9e-132   
ref|XP_010935614.1|  PREDICTED: uncharacterized protein LOC105055...    400   2e-131   
ref|NP_973809.1|  uncharacterized protein                               394   1e-129   Arabidopsis thaliana [mouse-ear cress]
gb|KDO75811.1|  hypothetical protein CISIN_1g015555mg                   389   5e-128   
ref|XP_008778200.1|  PREDICTED: uncharacterized protein LOC103698...    390   1e-127   
ref|NP_001060006.1|  Os07g0564800                                       391   2e-127   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009392032.1|  PREDICTED: uncharacterized protein LOC103978053    386   4e-127   
ref|XP_004958045.1|  PREDICTED: uncharacterized protein LOC101761...    387   7e-126   
gb|EEC77985.1|  hypothetical protein OsI_17370                          392   8e-126   Oryza sativa Indica Group [Indian rice]
ref|XP_006657845.1|  PREDICTED: uncharacterized protein LOC102704...    386   2e-125   
ref|XP_006657844.1|  PREDICTED: uncharacterized protein LOC102704...    387   2e-125   
ref|XP_004958044.1|  PREDICTED: uncharacterized protein LOC101761...    386   2e-125   
ref|XP_002439080.1|  hypothetical protein SORBIDRAFT_10g031220          385   2e-125   Sorghum bicolor [broomcorn]
tpg|DAA63156.1|  TPA: hypothetical protein ZEAMMB73_938040              383   4e-125   
ref|NP_001130789.1|  uncharacterized protein LOC100191893               384   9e-125   Zea mays [maize]
ref|XP_008650832.1|  PREDICTED: hypothetical protein isoform X1         383   2e-124   
ref|XP_004966564.1|  PREDICTED: uncharacterized protein LOC101765...    380   2e-123   
ref|XP_006657376.1|  PREDICTED: uncharacterized protein LOC102704535    380   2e-123   
tpg|DAA63157.1|  TPA: hypothetical protein ZEAMMB73_938040              379   1e-122   
ref|XP_009396162.1|  PREDICTED: uncharacterized protein LOC103981234    374   2e-122   
ref|XP_008650833.1|  PREDICTED: hypothetical protein isoform X2         378   2e-122   
ref|XP_008668561.1|  PREDICTED: uncharacterized protein LOC100502...    378   3e-122   
ref|XP_008650835.1|  PREDICTED: hypothetical protein isoform X4         377   4e-122   
ref|NP_001058667.1|  Os06g0731900                                       375   2e-121   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006574640.1|  PREDICTED: uncharacterized protein LOC100807...    372   4e-121   
ref|XP_006574638.1|  PREDICTED: uncharacterized protein LOC100807...    373   1e-120   
dbj|BAJ99055.1|  predicted protein                                      373   2e-120   
ref|XP_006574636.1|  PREDICTED: uncharacterized protein LOC100807...    373   2e-120   
ref|XP_008668562.1|  PREDICTED: uncharacterized protein LOC100502...    373   3e-120   
gb|AFW69650.1|  hypothetical protein ZEAMMB73_069164                    367   1e-119   
ref|XP_010248201.1|  PREDICTED: uncharacterized protein LOC104590...    369   2e-119   
ref|XP_010248154.1|  PREDICTED: uncharacterized protein LOC104590...    369   4e-119   
ref|XP_010236939.1|  PREDICTED: uncharacterized protein LOC100833...    369   1e-118   
dbj|BAD62500.1|  putative lysine ketoglutarate reductase trans-sp...    367   2e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010247917.1|  PREDICTED: uncharacterized protein LOC104590...    369   3e-118   
ref|XP_010248082.1|  PREDICTED: uncharacterized protein LOC104590...    368   4e-118   
gb|EMS62996.1|  hypothetical protein TRIUR3_26204                       366   1e-117   
gb|KHN10306.1|  hypothetical protein glysoja_040534                     361   1e-116   
ref|XP_009410632.1|  PREDICTED: uncharacterized protein LOC103992...    363   1e-116   
ref|XP_009410631.1|  PREDICTED: uncharacterized protein LOC103992...    363   2e-116   
gb|EEE66410.1|  hypothetical protein OsJ_22755                          362   2e-116   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010236941.1|  PREDICTED: uncharacterized protein LOC100833...    361   1e-115   
gb|EEE67421.1|  hypothetical protein OsJ_24761                          362   2e-115   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003608157.1|  Lysine ketoglutarate reductase trans-splicin...    357   2e-115   
ref|XP_010236937.1|  PREDICTED: uncharacterized protein LOC100833...    361   2e-115   
ref|XP_010657948.1|  PREDICTED: uncharacterized protein LOC100255...    360   4e-115   
ref|XP_010657947.1|  PREDICTED: uncharacterized protein LOC100255...    360   4e-115   
ref|XP_010657946.1|  PREDICTED: uncharacterized protein LOC100255...    360   5e-115   
ref|XP_002265374.2|  PREDICTED: uncharacterized protein LOC100255...    360   5e-115   Vitis vinifera
ref|XP_006285943.1|  hypothetical protein CARUB_v10007463mg             358   6e-115   
ref|XP_009139663.1|  PREDICTED: uncharacterized protein LOC103863...    358   1e-114   
ref|XP_006602841.1|  PREDICTED: uncharacterized protein LOC100798633    358   1e-114   
ref|XP_010935615.1|  PREDICTED: uncharacterized protein LOC105055...    355   2e-114   
ref|XP_009139659.1|  PREDICTED: uncharacterized protein LOC103863...    358   2e-114   
ref|XP_009139661.1|  PREDICTED: uncharacterized protein LOC103863...    358   2e-114   
ref|XP_010557744.1|  PREDICTED: uncharacterized protein LOC104826...    356   4e-114   
ref|XP_009139660.1|  PREDICTED: uncharacterized protein LOC103863...    357   5e-114   
emb|CDY60485.1|  BnaC04g55870D                                          357   5e-114   
ref|XP_010557742.1|  PREDICTED: uncharacterized protein LOC104826...    356   6e-114   
ref|XP_006414995.1|  hypothetical protein EUTSA_v10025444mg             355   9e-114   
ref|XP_009384294.1|  PREDICTED: uncharacterized protein LOC103971...    353   2e-113   
ref|XP_010527349.1|  PREDICTED: uncharacterized protein LOC104804...    354   2e-113   
ref|XP_010527348.1|  PREDICTED: uncharacterized protein LOC104804...    355   2e-113   
ref|XP_002527278.1|  conserved hypothetical protein                     355   2e-113   Ricinus communis
ref|XP_002982728.1|  hypothetical protein SELMODRAFT_116806             353   2e-113   
ref|XP_010929765.1|  PREDICTED: uncharacterized protein LOC105051...    353   4e-113   
ref|XP_009384293.1|  PREDICTED: uncharacterized protein LOC103971...    355   4e-113   
gb|KDO75812.1|  hypothetical protein CISIN_1g015555mg                   350   4e-113   
ref|XP_009385148.1|  PREDICTED: uncharacterized protein LOC103972515    353   6e-113   
gb|KCW57155.1|  hypothetical protein EUGRSUZ_I02788                     353   6e-113   
ref|XP_010929762.1|  PREDICTED: uncharacterized protein LOC105051...    354   9e-113   
ref|XP_010929761.1|  PREDICTED: uncharacterized protein LOC105051...    353   1e-112   
ref|XP_010030218.1|  PREDICTED: uncharacterized protein LOC104420...    353   1e-112   
ref|XP_010030219.1|  PREDICTED: uncharacterized protein LOC104420...    353   1e-112   
ref|XP_009404257.1|  PREDICTED: uncharacterized protein LOC103987...    352   1e-112   
ref|XP_010030213.1|  PREDICTED: uncharacterized protein LOC104420...    353   1e-112   
ref|XP_010929763.1|  PREDICTED: uncharacterized protein LOC105051...    352   2e-112   
ref|XP_010274913.1|  PREDICTED: uncharacterized protein LOC104610...    348   2e-112   
ref|XP_007139737.1|  hypothetical protein PHAVU_008G055100g             351   3e-112   
ref|XP_007222756.1|  hypothetical protein PRUPE_ppa006529mg             352   5e-112   
ref|XP_009404256.1|  PREDICTED: uncharacterized protein LOC103987...    352   5e-112   
ref|XP_002463031.1|  hypothetical protein SORBIDRAFT_02g036520          348   6e-112   Sorghum bicolor [broomcorn]
ref|XP_008218669.1|  PREDICTED: uncharacterized protein LOC103318...    351   7e-112   
ref|XP_008218666.1|  PREDICTED: uncharacterized protein LOC103318...    351   8e-112   
ref|XP_008368197.1|  PREDICTED: uncharacterized protein LOC103431805    352   1e-111   
ref|XP_009341364.1|  PREDICTED: uncharacterized protein LOC103933...    348   2e-111   
gb|KCW57157.1|  hypothetical protein EUGRSUZ_I02788                     348   2e-111   
ref|XP_007049550.1|  Uncharacterized protein TCM_002621                 349   3e-111   
ref|XP_002972149.1|  hypothetical protein SELMODRAFT_96555              346   3e-111   
ref|XP_010039032.1|  PREDICTED: uncharacterized protein LOC104427672    353   3e-111   
gb|ABR17377.1|  unknown                                                 347   4e-111   Picea sitchensis
gb|KDO42574.1|  hypothetical protein CISIN_1g014004mg                   348   4e-111   
ref|XP_008650834.1|  PREDICTED: hypothetical protein isoform X3         348   5e-111   
ref|XP_010450248.1|  PREDICTED: uncharacterized protein LOC104732...    348   5e-111   
ref|XP_008794583.1|  PREDICTED: uncharacterized protein LOC103710...    350   5e-111   
ref|XP_010450249.1|  PREDICTED: uncharacterized protein LOC104732...    348   5e-111   
ref|XP_008794581.1|  PREDICTED: uncharacterized protein LOC103710...    350   5e-111   
ref|XP_010450250.1|  PREDICTED: uncharacterized protein LOC104732...    348   5e-111   
ref|XP_009341362.1|  PREDICTED: uncharacterized protein LOC103933...    349   6e-111   
ref|XP_008794582.1|  PREDICTED: uncharacterized protein LOC103710...    350   6e-111   
ref|XP_010682054.1|  PREDICTED: uncharacterized protein LOC104896...    349   7e-111   
ref|XP_009341361.1|  PREDICTED: uncharacterized protein LOC103933...    348   8e-111   
gb|KDO42569.1|  hypothetical protein CISIN_1g014004mg                   347   8e-111   
ref|XP_010440627.1|  PREDICTED: uncharacterized protein LOC104723886    348   9e-111   
ref|XP_010682053.1|  PREDICTED: uncharacterized protein LOC104896...    348   1e-110   
ref|XP_011009620.1|  PREDICTED: uncharacterized protein LOC105114...    347   1e-110   
ref|XP_008802242.1|  PREDICTED: uncharacterized protein LOC103716...    348   1e-110   
ref|XP_009381324.1|  PREDICTED: uncharacterized protein LOC103969504    349   1e-110   
gb|KDO42568.1|  hypothetical protein CISIN_1g014004mg                   348   1e-110   
ref|XP_008778204.1|  PREDICTED: uncharacterized protein LOC103698...    346   1e-110   
ref|XP_006848445.1|  hypothetical protein AMTR_s00013p00243430          352   1e-110   
ref|XP_006592650.1|  PREDICTED: uncharacterized protein LOC100526...    346   1e-110   
ref|XP_006470988.1|  PREDICTED: uncharacterized protein LOC102624954    348   2e-110   
gb|KHG18284.1|  GTPase Der                                              348   2e-110   
ref|XP_009355359.1|  PREDICTED: uncharacterized protein LOC103946...    348   2e-110   
gb|KDO42573.1|  hypothetical protein CISIN_1g014004mg                   349   2e-110   
ref|XP_010435350.1|  PREDICTED: uncharacterized protein LOC104719...    346   2e-110   
ref|NP_001154227.2|  uncharacterized protein                            347   2e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002977469.1|  hypothetical protein SELMODRAFT_14072              342   2e-110   
ref|XP_008382541.1|  PREDICTED: uncharacterized protein LOC103445...    347   3e-110   
ref|XP_002528866.1|  conserved hypothetical protein                     346   3e-110   Ricinus communis
ref|XP_008382542.1|  PREDICTED: uncharacterized protein LOC103445...    347   3e-110   
ref|XP_011009619.1|  PREDICTED: uncharacterized protein LOC105114...    346   3e-110   
ref|XP_011009618.1|  PREDICTED: uncharacterized protein LOC105114...    346   4e-110   
ref|NP_193020.6|  uncharacterized protein                               347   4e-110   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009342401.1|  PREDICTED: uncharacterized protein LOC103934377    349   4e-110   
ref|XP_010926741.1|  PREDICTED: uncharacterized protein LOC105048...    345   4e-110   
ref|XP_009355356.1|  PREDICTED: uncharacterized protein LOC103946...    347   4e-110   
gb|EMS58914.1|  hypothetical protein TRIUR3_00657                       345   5e-110   
ref|XP_003548344.1|  PREDICTED: uncharacterized protein LOC100797...    346   5e-110   
ref|XP_004292326.1|  PREDICTED: uncharacterized protein LOC101291991    348   5e-110   
ref|XP_006592649.1|  PREDICTED: uncharacterized protein LOC100526...    346   6e-110   
ref|XP_006598790.1|  PREDICTED: uncharacterized protein LOC100797...    346   6e-110   
ref|XP_008357685.1|  PREDICTED: uncharacterized protein LOC103421429    347   7e-110   
ref|XP_010926740.1|  PREDICTED: uncharacterized protein LOC105048...    345   8e-110   
ref|XP_008788901.1|  PREDICTED: uncharacterized protein LOC103706547    346   8e-110   
ref|XP_010435349.1|  PREDICTED: uncharacterized protein LOC104719...    345   1e-109   
ref|XP_002863207.1|  hypothetical protein ARALYDRAFT_359088             345   1e-109   
ref|XP_010926739.1|  PREDICTED: uncharacterized protein LOC105048...    345   1e-109   
ref|XP_010435348.1|  PREDICTED: uncharacterized protein LOC104719...    345   2e-109   
ref|XP_009139662.1|  PREDICTED: uncharacterized protein LOC103863...    345   2e-109   
ref|XP_006431495.1|  hypothetical protein CICLE_v10001347mg             343   2e-109   
ref|XP_010435347.1|  PREDICTED: uncharacterized protein LOC104719...    345   2e-109   
ref|XP_006587812.1|  PREDICTED: uncharacterized protein LOC100814260    344   3e-109   
ref|XP_010927700.1|  PREDICTED: uncharacterized protein LOC105049...    347   3e-109   
ref|XP_009601482.1|  PREDICTED: uncharacterized protein LOC104096...    345   4e-109   
ref|XP_010070146.1|  PREDICTED: uncharacterized protein LOC104456...    345   4e-109   
ref|XP_006431494.1|  hypothetical protein CICLE_v10001347mg             345   4e-109   
ref|XP_008218437.1|  PREDICTED: uncharacterized protein LOC103318783    344   4e-109   
gb|EYU46099.1|  hypothetical protein MIMGU_mgv1a007624mg                344   4e-109   
ref|XP_008218668.1|  PREDICTED: uncharacterized protein LOC103318...    344   5e-109   
ref|XP_007143978.1|  hypothetical protein PHAVU_007G118700g             343   6e-109   
ref|XP_011077191.1|  PREDICTED: uncharacterized protein LOC105161254    344   7e-109   
ref|XP_006349291.1|  PREDICTED: uncharacterized protein LOC102579...    345   7e-109   
ref|XP_006589226.1|  PREDICTED: uncharacterized protein LOC100807...    342   8e-109   
ref|XP_009601481.1|  PREDICTED: uncharacterized protein LOC104096...    345   8e-109   
ref|XP_004301559.1|  PREDICTED: uncharacterized protein LOC101306243    343   8e-109   
ref|XP_007205391.1|  hypothetical protein PRUPE_ppa007419mg             342   9e-109   
ref|XP_006589225.1|  PREDICTED: uncharacterized protein LOC100807...    343   1e-108   
ref|XP_006349292.1|  PREDICTED: uncharacterized protein LOC102579...    344   1e-108   
gb|ABE91850.1|  Protein of unknown function DUF707                      341   1e-108   
ref|XP_006606436.1|  PREDICTED: uncharacterized protein LOC100802...    342   2e-108   
ref|XP_009791978.1|  PREDICTED: uncharacterized protein LOC104239...    343   2e-108   
ref|XP_002456843.1|  hypothetical protein SORBIDRAFT_03g043920          342   2e-108   
ref|XP_009791977.1|  PREDICTED: uncharacterized protein LOC104239...    343   3e-108   
gb|AES63134.2|  lysine ketoglutarate reductase trans-splicing-lik...    342   3e-108   
ref|XP_011080806.1|  PREDICTED: uncharacterized protein LOC105163967    339   4e-108   
gb|ACL54625.1|  unknown                                                 338   4e-108   
ref|XP_010314350.1|  PREDICTED: uncharacterized protein LOC101259...    341   6e-108   
gb|KCW58743.1|  hypothetical protein EUGRSUZ_H01384                     343   7e-108   
ref|XP_006598789.1|  PREDICTED: uncharacterized protein LOC100797...    341   8e-108   
ref|XP_007148587.1|  hypothetical protein PHAVU_006G221000g             340   8e-108   
ref|XP_009626423.1|  PREDICTED: uncharacterized protein LOC104117127    341   9e-108   
gb|KEH42946.1|  lysine ketoglutarate reductase trans-splicing-lik...    340   1e-107   
gb|KCW58742.1|  hypothetical protein EUGRSUZ_H01384                     344   1e-107   
emb|CDP03985.1|  unnamed protein product                                340   1e-107   
ref|XP_006598788.1|  PREDICTED: uncharacterized protein LOC100797...    340   1e-107   
ref|XP_011028387.1|  PREDICTED: uncharacterized protein LOC105128...    338   1e-107   
ref|XP_009355358.1|  PREDICTED: uncharacterized protein LOC103946...    340   1e-107   
gb|KEH42947.1|  lysine ketoglutarate reductase trans-splicing-lik...    340   2e-107   
ref|XP_004230425.1|  PREDICTED: uncharacterized protein LOC101259...    341   2e-107   
emb|CDY68706.1|  BnaAnng28070D                                          338   2e-107   
ref|XP_006375602.1|  hypothetical protein POPTR_0014s17420g             336   2e-107   
ref|XP_008443712.1|  PREDICTED: uncharacterized protein LOC103487...    339   2e-107   
ref|XP_006353831.1|  PREDICTED: uncharacterized protein LOC102586...    340   2e-107   
ref|XP_008235931.1|  PREDICTED: uncharacterized protein LOC103334736    340   2e-107   
ref|XP_006385071.1|  hypothetical protein POPTR_0004s23630g             339   2e-107   
ref|XP_010314348.1|  PREDICTED: uncharacterized protein LOC101259...    340   3e-107   
ref|XP_009775315.1|  PREDICTED: uncharacterized protein LOC104225252    340   3e-107   
gb|KCW58744.1|  hypothetical protein EUGRSUZ_H01384                     342   3e-107   
gb|KEH42948.1|  lysine ketoglutarate reductase trans-splicing-lik...    340   3e-107   
ref|XP_006353830.1|  PREDICTED: uncharacterized protein LOC102586...    339   3e-107   
ref|XP_007041143.1|  Uncharacterized protein isoform 2                  340   3e-107   
gb|EYU39432.1|  hypothetical protein MIMGU_mgv1a009958mg                337   4e-107   
ref|XP_011028386.1|  PREDICTED: uncharacterized protein LOC105128...    338   4e-107   
gb|EMT10964.1|  hypothetical protein F775_16647                         343   5e-107   
gb|EYU33290.1|  hypothetical protein MIMGU_mgv1a022895mg                336   5e-107   
ref|XP_002981263.1|  hypothetical protein SELMODRAFT_420787             335   6e-107   
ref|XP_010533215.1|  PREDICTED: uncharacterized protein LOC104809032    338   7e-107   
ref|XP_011047856.1|  PREDICTED: uncharacterized protein LOC105142...    338   8e-107   
ref|XP_010030221.1|  PREDICTED: uncharacterized protein LOC104420...    336   8e-107   
ref|XP_004966565.1|  PREDICTED: uncharacterized protein LOC101765...    337   9e-107   
ref|XP_009136939.1|  PREDICTED: uncharacterized protein LOC103861001    338   9e-107   
ref|XP_011047857.1|  PREDICTED: uncharacterized protein LOC105142...    337   1e-106   
gb|KCW44964.1|  hypothetical protein EUGRSUZ_L01443                     332   1e-106   
ref|XP_011047855.1|  PREDICTED: uncharacterized protein LOC105142...    337   2e-106   
ref|XP_007200003.1|  hypothetical protein PRUPE_ppa024775mg             334   2e-106   
ref|XP_004142563.1|  PREDICTED: uncharacterized protein LOC101221459    337   2e-106   
ref|XP_011047859.1|  PREDICTED: uncharacterized protein LOC105142...    335   3e-106   
ref|XP_004495539.1|  PREDICTED: uncharacterized protein LOC101501...    337   3e-106   
ref|XP_004495538.1|  PREDICTED: uncharacterized protein LOC101501...    337   3e-106   
ref|XP_009589414.1|  PREDICTED: uncharacterized protein LOC104086...    335   5e-106   
emb|CDY01549.1|  BnaC07g35390D                                          335   7e-106   
ref|XP_006646614.1|  PREDICTED: uncharacterized protein LOC102709336    338   8e-106   
ref|XP_006598791.1|  PREDICTED: uncharacterized protein LOC100797...    332   8e-106   
emb|CDM85670.1|  unnamed protein product                                338   9e-106   
ref|XP_006389481.1|  hypothetical protein POPTR_0022s00250g             332   1e-105   
ref|XP_010434520.1|  PREDICTED: uncharacterized protein LOC104718463    335   1e-105   
gb|KDO42571.1|  hypothetical protein CISIN_1g014004mg                   332   1e-105   
ref|XP_001755444.1|  predicted protein                                  334   1e-105   
gb|KDO42572.1|  hypothetical protein CISIN_1g014004mg                   332   1e-105   
ref|XP_011092273.1|  PREDICTED: uncharacterized protein LOC105172...    335   2e-105   
ref|XP_009589411.1|  PREDICTED: uncharacterized protein LOC104086...    335   2e-105   
ref|XP_009589410.1|  PREDICTED: uncharacterized protein LOC104086...    335   2e-105   
ref|XP_010326243.1|  PREDICTED: uncharacterized protein LOC101263...    335   2e-105   
ref|XP_009589413.1|  PREDICTED: uncharacterized protein LOC104086...    335   2e-105   
ref|XP_004246997.2|  PREDICTED: uncharacterized protein LOC101263...    335   2e-105   
ref|XP_010439840.1|  PREDICTED: uncharacterized protein LOC104723209    334   3e-105   
ref|XP_010649248.1|  PREDICTED: uncharacterized protein LOC100244...    335   3e-105   
ref|XP_011092272.1|  PREDICTED: uncharacterized protein LOC105172...    335   3e-105   
ref|XP_009589412.1|  PREDICTED: uncharacterized protein LOC104086...    335   4e-105   
ref|XP_009800331.1|  PREDICTED: uncharacterized protein LOC104246...    335   4e-105   
ref|XP_009800332.1|  PREDICTED: uncharacterized protein LOC104246...    334   5e-105   
ref|XP_010245969.1|  PREDICTED: uncharacterized protein LOC104589...    333   5e-105   
emb|CDX76518.1|  BnaA08g08820D                                          333   6e-105   
ref|XP_010099777.1|  hypothetical protein L484_010964                   332   8e-105   
ref|XP_007041145.1|  Uncharacterized protein isoform 4                  332   8e-105   
ref|XP_010496238.1|  PREDICTED: uncharacterized protein LOC104773...    333   8e-105   
gb|KGN49567.1|  hypothetical protein Csa_5G003110                       332   9e-105   
ref|XP_003592882.1|  hypothetical protein MTR_2g005330                  332   1e-104   
ref|XP_006414091.1|  hypothetical protein EUTSA_v10025410mg             333   1e-104   
ref|XP_007143979.1|  hypothetical protein PHAVU_007G118700g             330   1e-104   
ref|XP_008668563.1|  PREDICTED: uncharacterized protein LOC100502...    332   1e-104   
ref|XP_007041142.1|  Uncharacterized protein isoform 1                  333   1e-104   
ref|XP_007029399.1|  Uncharacterized protein isoform 2                  331   2e-104   
ref|XP_010496239.1|  PREDICTED: uncharacterized protein LOC104773...    332   2e-104   
ref|XP_004164722.1|  PREDICTED: uncharacterized LOC101205845            332   2e-104   
ref|XP_003592883.1|  hypothetical protein MTR_2g005330                  332   2e-104   
ref|XP_009800327.1|  PREDICTED: uncharacterized protein LOC104246...    335   2e-104   
ref|XP_009131922.1|  PREDICTED: uncharacterized protein LOC103856...    330   2e-104   
ref|XP_009800329.1|  PREDICTED: uncharacterized protein LOC104246...    335   2e-104   
ref|XP_009338004.1|  PREDICTED: uncharacterized protein LOC103930...    332   2e-104   
emb|CDX99459.1|  BnaC01g10930D                                          332   2e-104   
ref|XP_006431493.1|  hypothetical protein CICLE_v10001347mg             329   3e-104   
ref|XP_004149136.1|  PREDICTED: uncharacterized protein LOC101205845    332   3e-104   
ref|XP_007041144.1|  Uncharacterized protein isoform 3                  333   3e-104   
ref|XP_009800328.1|  PREDICTED: uncharacterized protein LOC104246...    334   3e-104   
ref|XP_007029398.1|  Uncharacterized protein isoform 1                  330   6e-104   
ref|XP_006606437.1|  PREDICTED: uncharacterized protein LOC100802...    327   6e-104   
ref|XP_010245967.1|  PREDICTED: uncharacterized protein LOC104589...    332   6e-104   
ref|NP_193588.5|  uncharacterized protein                               330   6e-104   
gb|KHN29282.1|  hypothetical protein glysoja_005006                     327   6e-104   
ref|XP_009131914.1|  PREDICTED: uncharacterized protein LOC103856...    331   6e-104   
ref|XP_009338003.1|  PREDICTED: uncharacterized protein LOC103930...    331   7e-104   
ref|NP_001045212.1|  Os01g0919600                                       332   7e-104   
ref|XP_009131909.1|  PREDICTED: uncharacterized protein LOC103856...    331   7e-104   
gb|EEC72047.1|  hypothetical protein OsI_04953                          331   8e-104   
ref|NP_001130892.1|  hypothetical protein                               328   9e-104   
ref|XP_009108367.1|  PREDICTED: uncharacterized protein LOC103834066    330   1e-103   
ref|XP_006283920.1|  hypothetical protein CARUB_v10005038mg             329   1e-103   
ref|XP_004485423.1|  PREDICTED: uncharacterized protein LOC101494...    330   1e-103   
ref|XP_004485425.1|  PREDICTED: uncharacterized protein LOC101494...    329   1e-103   
ref|XP_008370820.1|  PREDICTED: uncharacterized protein LOC103434...    330   2e-103   
ref|XP_008672058.1|  PREDICTED: hypothetical protein isoform X2         330   2e-103   
gb|ACG28658.1|  hypothetical protein                                    329   2e-103   
ref|XP_008464732.1|  PREDICTED: uncharacterized protein LOC103502548    330   2e-103   
emb|CDX78869.1|  BnaA01g09360D                                          333   2e-103   
ref|XP_004304811.1|  PREDICTED: uncharacterized protein LOC101306449    330   3e-103   
ref|XP_002271156.1|  PREDICTED: uncharacterized protein LOC100266956    330   3e-103   
ref|XP_008370819.1|  PREDICTED: uncharacterized protein LOC103434...    329   3e-103   
ref|XP_008672057.1|  PREDICTED: hypothetical protein isoform X1         329   4e-103   
ref|XP_004304814.1|  PREDICTED: uncharacterized protein LOC101307323    328   4e-103   
ref|XP_010673921.1|  PREDICTED: uncharacterized protein LOC104890221    328   4e-103   
ref|XP_010678991.1|  PREDICTED: uncharacterized protein LOC104894459    328   5e-103   
gb|EAZ14639.1|  hypothetical protein OsJ_04563                          329   5e-103   
ref|XP_010070147.1|  PREDICTED: uncharacterized protein LOC104456...    325   7e-103   
gb|KHN11049.1|  hypothetical protein glysoja_044073                     323   1e-102   
ref|XP_011087633.1|  PREDICTED: uncharacterized protein LOC105169064    328   2e-102   
ref|XP_004971069.1|  PREDICTED: uncharacterized protein LOC101761...    327   2e-102   
ref|XP_004971068.1|  PREDICTED: uncharacterized protein LOC101761...    327   2e-102   
ref|XP_006469340.1|  PREDICTED: uncharacterized protein LOC102608...    325   2e-102   
ref|XP_004485424.1|  PREDICTED: uncharacterized protein LOC101494...    326   3e-102   
ref|XP_008371677.1|  PREDICTED: uncharacterized protein LOC103435056    322   3e-102   
gb|EPS68506.1|  hypothetical protein M569_06262                         323   4e-102   
gb|KDO43503.1|  hypothetical protein CISIN_1g040488mg                   324   4e-102   
ref|XP_006469339.1|  PREDICTED: uncharacterized protein LOC102608...    325   4e-102   
ref|XP_004304813.1|  PREDICTED: uncharacterized protein LOC101307034    326   6e-102   
ref|XP_008656938.1|  PREDICTED: uncharacterized protein LOC103636...    324   6e-102   
ref|XP_002512624.1|  conserved hypothetical protein                     325   7e-102   
ref|XP_011013916.1|  PREDICTED: uncharacterized protein LOC105117...    323   8e-102   
ref|XP_002325467.2|  hypothetical protein POPTR_0019s08010g             324   1e-101   
ref|XP_006428575.1|  hypothetical protein CICLE_v10011929mg             325   1e-101   
ref|XP_008656937.1|  PREDICTED: uncharacterized protein LOC103636...    325   2e-101   
ref|XP_011013915.1|  PREDICTED: uncharacterized protein LOC105117...    323   2e-101   
emb|CDP04217.1|  unnamed protein product                                324   4e-101   
emb|CBI23338.3|  unnamed protein product                                322   7e-101   
ref|XP_009803513.1|  PREDICTED: uncharacterized protein LOC104248864    320   7e-100   
ref|XP_006480410.1|  PREDICTED: uncharacterized protein LOC102618...    320   7e-100   
gb|EYU35025.1|  hypothetical protein MIMGU_mgv1a021997mg                317   2e-99    
gb|KDP42486.1|  hypothetical protein JCGZ_00283                         316   2e-99    
ref|XP_010649249.1|  PREDICTED: uncharacterized protein LOC100244...    316   3e-99    
ref|XP_008802245.1|  PREDICTED: uncharacterized protein LOC103716...    317   3e-99    
gb|KDO75813.1|  hypothetical protein CISIN_1g015555mg                   313   3e-99    
ref|XP_009611370.1|  PREDICTED: uncharacterized protein LOC104104888    318   4e-99    
gb|KDP23295.1|  hypothetical protein JCGZ_23128                         318   5e-99    
ref|XP_006353285.1|  PREDICTED: uncharacterized protein LOC102586299    317   9e-99    
gb|KHG02335.1|  Protein kinase US3                                      316   1e-98    
ref|XP_001763826.1|  predicted protein                                  313   2e-98    
ref|XP_003564937.1|  PREDICTED: uncharacterized protein LOC100845...    317   2e-98    
ref|XP_010232750.1|  PREDICTED: uncharacterized protein LOC100845...    317   3e-98    
ref|XP_003567406.1|  PREDICTED: uncharacterized protein LOC100846500    316   8e-98    
ref|XP_008794584.1|  PREDICTED: uncharacterized protein LOC103710...    314   2e-97    
gb|EMT30823.1|  hypothetical protein F775_04800                         315   2e-97    
ref|XP_006447951.1|  hypothetical protein CICLE_v10017835mg             311   2e-97    
ref|XP_010527351.1|  PREDICTED: uncharacterized protein LOC104804...    312   5e-97    
gb|KDO47606.1|  hypothetical protein CISIN_1g021847mg                   309   6e-97    
ref|XP_010312628.1|  PREDICTED: uncharacterized protein LOC101258517    311   2e-96    
gb|KDO42575.1|  hypothetical protein CISIN_1g014004mg                   307   8e-96    
gb|EMT15209.1|  hypothetical protein F775_10952                         309   1e-95    
ref|XP_001765350.1|  predicted protein                                  305   2e-95    
ref|XP_004959218.1|  PREDICTED: uncharacterized protein LOC101754548    308   4e-95    
gb|KHN40464.1|  hypothetical protein glysoja_000962                     305   4e-95    
emb|CDO97641.1|  unnamed protein product                                303   2e-94    
gb|KDP45213.1|  hypothetical protein JCGZ_15078                         305   2e-94    
gb|KEH42945.1|  lysine ketoglutarate reductase trans-splicing-lik...    303   3e-94    
gb|KHN39687.1|  hypothetical protein glysoja_020765                     301   6e-94    
ref|XP_008443713.1|  PREDICTED: uncharacterized protein LOC103487...    300   2e-92    
tpg|DAA60453.1|  TPA: hypothetical protein ZEAMMB73_554322              300   4e-92    
gb|KEH36409.1|  lysine ketoglutarate reductase trans-splicing-lik...    295   5e-92    
gb|KHN14778.1|  hypothetical protein glysoja_020951                     296   2e-91    
ref|XP_010927701.1|  PREDICTED: uncharacterized protein LOC105049...    299   5e-91    
ref|XP_010095592.1|  hypothetical protein L484_007431                   295   1e-90    
ref|XP_004959216.1|  PREDICTED: uncharacterized protein LOC101753344    296   2e-90    
gb|KHN04979.1|  hypothetical protein glysoja_013886                     294   3e-90    
ref|XP_006658519.1|  PREDICTED: uncharacterized protein LOC102704541    294   4e-90    
gb|EPS71893.1|  hypothetical protein M569_02866                         288   7e-90    
ref|XP_008652315.1|  PREDICTED: uncharacterized protein LOC103632283    288   9e-89    
gb|AAD49998.1|AC007259_11  Hypothetical protein                         286   1e-88    
gb|EAZ03604.1|  hypothetical protein OsI_25741                          291   1e-88    
gb|KHF99765.1|  Protein Wnt-3a                                          285   2e-87    
ref|NP_001059457.1|  Os07g0414700                                       286   6e-87    
ref|XP_002461919.1|  hypothetical protein SORBIDRAFT_02g010630          286   1e-86    
ref|XP_008794585.1|  PREDICTED: uncharacterized protein LOC103710...    285   2e-86    
ref|XP_010111065.1|  hypothetical protein L484_015120                   283   6e-86    
ref|XP_003560257.1|  PREDICTED: uncharacterized protein LOC100824859    279   3e-84    
ref|XP_010929764.1|  PREDICTED: uncharacterized protein LOC105051...    266   2e-79    
ref|XP_008370821.1|  PREDICTED: uncharacterized protein LOC103434...    260   1e-77    
dbj|BAC20862.1|  hypothetical protein                                   261   2e-77    
gb|ACN36331.1|  unknown                                                 253   6e-77    
ref|XP_009338005.1|  PREDICTED: uncharacterized protein LOC103930...    257   2e-76    
ref|XP_009371751.1|  PREDICTED: uncharacterized protein LOC103960971    258   5e-76    
ref|XP_006841747.1|  hypothetical protein AMTR_s00003p00261400          254   5e-76    
ref|XP_001767366.1|  predicted protein                                  263   5e-76    
gb|ADN33847.1|  hypothetical protein                                    254   1e-75    
gb|EMT15642.1|  hypothetical protein F775_21925                         256   1e-75    
ref|XP_011089275.1|  PREDICTED: uncharacterized protein LOC105170284    256   1e-75    
ref|XP_008360119.1|  PREDICTED: uncharacterized protein LOC103423...    256   1e-75    
ref|XP_008360116.1|  PREDICTED: uncharacterized protein LOC103423...    257   2e-75    
ref|XP_008230511.1|  PREDICTED: uncharacterized protein LOC103329778    256   2e-75    
ref|XP_004502391.1|  PREDICTED: uncharacterized protein LOC101511...    256   2e-75    



>ref|XP_006347092.1| PREDICTED: uncharacterized protein LOC102580388 [Solanum tuberosum]
Length=405

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/339 (75%), Positives = 288/339 (85%), Gaps = 2/339 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             GTC +KM+ + F+ + C+ MLFI+YRTT YQYQQ EMES+ DP YS++DS +  RS  SL
Sbjct  16    GTCGLKMRQLPFMWIICIVMLFIVYRTTNYQYQQTEMESRLDPFYSSKDSSMDMRSLHSL  75

Query  1296  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             PRGII++RSDLELKPL     S SK+K + +  HNLLA+PVGIKQK NV+ ++QKFLS N
Sbjct  76    PRGIIQARSDLELKPLWSTTSSKSKAKASNSSSHNLLAVPVGIKQKSNVDALVQKFLSAN  135

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
              ESEGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   AESEGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  582   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             DSEY+VH  IQ+LGG SLKR S+P+E  K   VD+R E+
Sbjct  316   DSEYVVHQSIQTLGGQSLKRDSNPEESVKRHVVDVRSEI  354


 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQSTYELQIFK+RWE AVK DKNW DP+KASQR R+ +
Sbjct  353  EIRRQSTYELQIFKDRWERAVKLDKNWADPFKASQRRRQLY  393



>ref|XP_011096284.1| PREDICTED: uncharacterized protein LOC105175522 [Sesamum indicum]
 ref|XP_011096285.1| PREDICTED: uncharacterized protein LOC105175522 [Sesamum indicum]
Length=374

 Score =   530 bits (1366),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 243/331 (73%), Positives = 282/331 (85%), Gaps = 0/331 (0%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             M+ + F+G+ C  MLFI+YRTT YQYQQ EMESK  P Y+ ++S +  +S  SLPRGIIE
Sbjct  1     MRQLPFMGVVCTIMLFIIYRTTKYQYQQTEMESKLYPFYTLQESGMESKSLESLPRGIIE  60

Query  1278  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
             +RSDLELKPL   S SKS V+V   +NLLAMPVGI+QK NV+ I+QKFLSENFTI+LFHY
Sbjct  61    ARSDLELKPLWTTSSSKSMVSVRSSNNLLAMPVGIEQKQNVDTIVQKFLSENFTIVLFHY  120

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGN+DGWW+L WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDLGVENFHP 
Sbjct  121   DGNLDGWWELEWSKKAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVENFHPG  180

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RYL+IV+SEGLEISQPALDP S GIHHRIT+R+R N FHRRVY  +GS KCS++SEGPPC
Sbjct  181   RYLDIVRSEGLEISQPALDPNSTGIHHRITIRNRMNIFHRRVYDVRGSIKCSDDSEGPPC  240

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +GFVEGMAPVFSRSAWRC WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSEY+VH 
Sbjct  241   TGFVEGMAPVFSRSAWRCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSEYIVHQ  300

Query  558   GIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
              IQ+LGG+S ++ + P+E  K  AVD+R E+
Sbjct  301   SIQTLGGASARKVAKPEETTKRHAVDVRSEI  331


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 1/41 (2%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQS  ELQ FK+RWE AVKEDKNWVDP+ AS  +R  W
Sbjct  330  EIRRQSAIELQKFKDRWERAVKEDKNWVDPF-ASTHFRYFW  369



>ref|XP_009763335.1| PREDICTED: uncharacterized protein LOC104215273 [Nicotiana sylvestris]
 ref|XP_009763336.1| PREDICTED: uncharacterized protein LOC104215273 [Nicotiana sylvestris]
Length=404

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/339 (74%), Positives = 290/339 (86%), Gaps = 2/339 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C VKM+ + F+G+ C+ MLFI+YRTT YQYQQ E+ES+ DP YS++D  +  RS +SL
Sbjct  16    GACGVKMRQLPFMGIICIVMLFIVYRTTNYQYQQTEIESRLDPFYSSQDPSLDMRSLNSL  75

Query  1296  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             PRGII++RSDLELKPL   + S SK+K + +  HNLLA+PVGI QK NV+ ++QKFLSEN
Sbjct  76    PRGIIQARSDLELKPLWSTSSSKSKAKASNSSCHNLLAVPVGINQKSNVDALVQKFLSEN  135

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             +ESEGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   DESEGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  582   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             DSEY+VH  IQ+LGG SLK+ S+P+E  K   VD+R E+
Sbjct  316   DSEYVVHQSIQTLGGQSLKKDSNPEESVKRHVVDVRSEI  354


 Score = 60.8 bits (146),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 1/41 (2%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQSTYELQIFK+RW  AVKEDK W DP+K  QR RK W
Sbjct  353  EIRRQSTYELQIFKDRWARAVKEDKKWSDPFKTRQR-RKQW  392



>ref|XP_004232824.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum]
 ref|XP_010316708.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum]
 ref|XP_010316709.1| PREDICTED: uncharacterized protein LOC101260688 [Solanum lycopersicum]
Length=405

 Score =   529 bits (1362),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/339 (74%), Positives = 288/339 (85%), Gaps = 2/339 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             GTC VKM+ + F+ + C+ MLFI+YRTT YQYQQ EMES+ DP YS++DS +  RS  SL
Sbjct  16    GTCGVKMRQLPFMWIICIVMLFIVYRTTNYQYQQTEMESRLDPFYSSKDSSMDMRSLHSL  75

Query  1296  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             PRGII++RSDLELKPL     S SK+K + +  HNLLA+PVGIKQK NV+ ++QKFLS N
Sbjct  76    PRGIIQARSDLELKPLWSTTSSKSKAKASNSSSHNLLAVPVGIKQKSNVDALVQKFLSAN  135

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             +ESEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   DESEGPPCTGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  582   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             DSEY+VH  IQ+LGG SLK+ S+ +E  K   VD+R E+
Sbjct  316   DSEYVVHQSIQTLGGQSLKKDSNSEESVKRHVVDVRSEI  354


 Score = 69.3 bits (168),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQSTYELQIFK+RWE AVK+DKNW DP+KASQR R+ +
Sbjct  353  EIRRQSTYELQIFKDRWERAVKQDKNWADPFKASQRRRQLY  393



>ref|XP_009603719.1| PREDICTED: uncharacterized protein LOC104098641 [Nicotiana tomentosiformis]
 ref|XP_009603720.1| PREDICTED: uncharacterized protein LOC104098641 [Nicotiana tomentosiformis]
Length=404

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/339 (74%), Positives = 289/339 (85%), Gaps = 2/339 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C VKM+ + F+ + C+ MLFI+YRTT YQYQQ E+ES+ DP YS++D  +  RS +SL
Sbjct  16    GACGVKMRQLPFMWIICIVMLFIVYRTTNYQYQQTEIESRLDPFYSSQDPSLDMRSLNSL  75

Query  1296  PRGIIESRSDLELKPL--KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             PRGII++RSDLELKPL   + S SK+K + +  HNLLA+PVGI QK NV+ ++QKFLSEN
Sbjct  76    PRGIIQARSDLELKPLWSTSSSKSKAKASNSSCHNLLAVPVGINQKSNVDALVQKFLSEN  135

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT+ILFHYDGNVDGW DL WSK+AIHIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDL
Sbjct  136   FTVILFHYDGNVDGWEDLQWSKDAIHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDL  195

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+RSRTN+FHRRVY  +GSTKCS
Sbjct  196   GVENFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRSRTNRFHRRVYDIRGSTKCS  255

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             +ESEGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+V
Sbjct  256   DESEGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVV  315

Query  582   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             DSEY+VH  IQ+LGG SLK+ S+P+E  K   VD+R E+
Sbjct  316   DSEYVVHQSIQTLGGQSLKKDSNPEESVKRHVVDVRSEI  354


 Score = 63.2 bits (152),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQSTYELQIFK+RW  AVKEDKNW DP+K  QR R+
Sbjct  353  EIRRQSTYELQIFKDRWARAVKEDKNWSDPFKTRQRRRQ  391



>gb|EYU27955.1| hypothetical protein MIMGU_mgv1a007977mg [Erythranthe guttata]
 gb|EYU27956.1| hypothetical protein MIMGU_mgv1a007977mg [Erythranthe guttata]
Length=389

 Score =   511 bits (1315),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 237/332 (71%), Positives = 274/332 (83%), Gaps = 0/332 (0%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             KMK + F+   C+ ML I+Y +T YQYQQ EM+S   P Y+ ++S V  +S  SLPRGII
Sbjct  26    KMKQLPFMVAVCIIMLLIIYTSTKYQYQQTEMDSTFYPFYTFKESGVDSKSLDSLPRGII  85

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             E+RSDLELKPL   S S+SKV+     NLLAMPVG+KQK NV+ I+QKFLSENFTIILFH
Sbjct  86    EARSDLELKPLWTTSSSRSKVSDRSSSNLLAMPVGVKQKQNVDTIVQKFLSENFTIILFH  145

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDGN+DGWWDL WSK+A+HI AH+QTKWWFAKRFLHP +VS+YDYIFLWDEDLGVENFHP
Sbjct  146   YDGNLDGWWDLEWSKKAVHIAAHNQTKWWFAKRFLHPAIVSMYDYIFLWDEDLGVENFHP  205

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  742
              RYL+IV+SEG EISQPALDP S GIHHRITVR+R N FHRRVY+ +GS KCS++SEGPP
Sbjct  206   GRYLDIVRSEGFEISQPALDPNSTGIHHRITVRNRMNIFHRRVYEVRGSIKCSDDSEGPP  265

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             CSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDSEY+VH
Sbjct  266   CSGFVEGMAPVFSRSAWHCAWHLIQNDLVHGWGMDMKLGYCAQGDRTEKVGIVDSEYIVH  325

Query  561   LGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
               IQ+LGG+S  + S+ +E  K   VD+R E+
Sbjct  326   QSIQTLGGASATKVSNHEETVKRHGVDVRSEI  357


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/32 (72%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
            +IRRQS+ ELQ FKERWE+AVK+D+NWVDP+ 
Sbjct  356  EIRRQSSIELQKFKERWEQAVKDDENWVDPFS  387



>ref|XP_011086083.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
 ref|XP_011086084.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
 ref|XP_011086085.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
 ref|XP_011086086.1| PREDICTED: uncharacterized protein LOC105167912 [Sesamum indicum]
Length=405

 Score =   511 bits (1315),  Expect = 6e-174, Method: Compositional matrix adjust.
 Identities = 242/337 (72%), Positives = 274/337 (81%), Gaps = 0/337 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C  KMK M F+G  C  MLFI+YRTT YQYQQ E+ESK  P Y  + S V     +SL
Sbjct  21    GICGTKMKQMPFMGFICTVMLFIIYRTTNYQYQQTEVESKLLPFYKPKASVVATSGLNSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGIIE RSDLEL+PL   S SKSK+     + LLAMPVGIKQK NV+ I++KFL ENFT
Sbjct  81    PRGIIEPRSDLELRPLWTTSSSKSKMRSRSSNYLLAMPVGIKQKQNVDTIVRKFLPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGN+DGWWDL WS+EA+HIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNLDGWWDLEWSREAVHIVAHNQTKWWFAKRFLHPSVVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             +NFHP RYLEIVKSEGLEISQPALDP S GIHHRIT+R RT  FHRRVY  +GSTKCS++
Sbjct  201   QNFHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITIRKRTKIFHRRVYDARGSTKCSDD  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWHCAWNLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+VH  IQ+LGG S ++ S+ ++  K   VD+R E+
Sbjct  321   EYIVHQSIQTLGGQSARKVSNLEQTVKSHTVDVRSEI  357


 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST EL+ FKERWE AVKEDK WVDP+ ++
Sbjct  356  EIRRQSTIELKKFKERWERAVKEDKKWVDPFPST  389



>ref|XP_010092612.1| hypothetical protein L484_006374 [Morus notabilis]
 gb|EXB51801.1| hypothetical protein L484_006374 [Morus notabilis]
Length=378

 Score =   509 bits (1310),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 238/335 (71%), Positives = 280/335 (84%), Gaps = 6/335 (2%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             MK + F+G+ C  MLFI+YRTT YQ++Q EME+K  P     +  +  R  + LPRGII 
Sbjct  1     MKQLPFMGIVCTVMLFIVYRTTNYQHRQTEMETKIHPF--GTEFLLASRELNGLPRGIIH  58

Query  1278  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
             ++SDLEL+PL + S S+SKVNV  + NLLA+PVGI+QKDNV+ I+QKFL ENFTIILFHY
Sbjct  59    TKSDLELRPLWSTSSSRSKVNVYSHRNLLAIPVGIEQKDNVDAIVQKFLPENFTIILFHY  118

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGV+NF+P 
Sbjct  119   DGNVDGWWDLDWSNEAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVKNFNPG  178

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RYL+IVK+EGLEISQPALDP S  IHHRIT+R+RT +FHRRVY  +GSTKCS+ SEGPPC
Sbjct  179   RYLKIVKTEGLEISQPALDPNSTDIHHRITIRARTKRFHRRVYDLRGSTKCSDASEGPPC  238

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +GFVEGMAPVFSR+AWRC WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+VH 
Sbjct  239   TGFVEGMAPVFSRAAWRCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIVHK  298

Query  558   GIQSLGG--SSLKRASSPQELPK--GRAVDLRVEV  466
             GIQSLGG  SS ++AS+ +EL K  G A D+R E+
Sbjct  299   GIQSLGGASSSARKASNSEELTKRHGAAADVRTEI  333


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST+ELQ+FKERW  AV+EDKNWVDP+
Sbjct  332  EIRRQSTWELQVFKERWNRAVEEDKNWVDPF  362



>ref|XP_010327022.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_004248459.2| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327023.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327024.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327025.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010327026.1| PREDICTED: uncharacterized protein LOC101254342 isoform X1 [Solanum 
lycopersicum]
Length=409

 Score =   506 bits (1304),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 243/337 (72%), Positives = 278/337 (82%), Gaps = 0/337 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
              TC VK+K + F+G+ C  M  I+YRTT YQY+Q EMESKSDP YS++DS V   S +SL
Sbjct  21    ATCGVKVKQIAFMGIICTIMFLIVYRTTNYQYRQTEMESKSDPFYSSKDSDVDITSFNSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII + SDLELKPL + S SKSK +V+   NLLAM VGIKQK NV+ ++QKFLSENFT
Sbjct  81    PRGIIHASSDLELKPLWSTSNSKSKDSVSSSRNLLAMAVGIKQKKNVDTLVQKFLSENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDG+VDGWWDL WSKEA+HIVA++QTKWWFAKRFLHP  VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGHVDGWWDLKWSKEAVHIVANNQTKWWFAKRFLHPAAVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             +NFHP RYL+IVKSEGLEISQPALD  S  IHHR+T+RS+  +FHRRVY  +GSTKCS E
Sbjct  201   KNFHPGRYLKIVKSEGLEISQPALDRNSTEIHHRLTIRSKRKRFHRRVYDSRGSTKCSGE  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPCSGFVEGMAPVFS SAW C WHLIQNDLVHGWGMDMK GYCAQGDR   VG+VDS
Sbjct  261   SEGPPCSGFVEGMAPVFSISAWVCAWHLIQNDLVHGWGMDMKFGYCAQGDRNKKVGVVDS  320

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+VH GIQ+LGG SLK+ S+ +E  K   VD+R E+
Sbjct  321   EYIVHQGIQTLGGPSLKKPSNLEESTKRHVVDVRSEI  357


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWV  297
            +IRRQS YELQIFKERWE AV+EDKNWV
Sbjct  356  EIRRQSMYELQIFKERWERAVEEDKNWV  383



>ref|XP_009631143.1| PREDICTED: uncharacterized protein LOC104120968 [Nicotiana tomentosiformis]
Length=411

 Score =   506 bits (1304),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 242/336 (72%), Positives = 281/336 (84%), Gaps = 0/336 (0%)
 Frame = -3

Query  1473  TCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLP  1294
             T  +K+K + F+G+ C  MLFI+YRTT YQYQQ EMESK DP YS++DS V     +SLP
Sbjct  22    TWGIKVKQLPFMGIMCTVMLFIVYRTTNYQYQQTEMESKLDPFYSSKDSDVDITRLNSLP  81

Query  1293  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1114
             RGII+  SDLEL PL + S S+SK +++   NLLA+ VG+KQK NV+ ++QKFLSENFTI
Sbjct  82    RGIIQPSSDLELMPLWSTSGSRSKASISSSRNLLAIAVGVKQKSNVDALVQKFLSENFTI  141

Query  1113  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  934
             +LFHYDG+VDGWWDL WSKEAIHIVA++QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV+
Sbjct  142   VLFHYDGHVDGWWDLQWSKEAIHIVANNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVK  201

Query  933   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  754
             NFHP RYL+IVKSEGLEISQPALD  S  IHHRIT+RS+  +FHRRVY  +GSTKCS+ES
Sbjct  202   NFHPGRYLKIVKSEGLEISQPALDRNSTDIHHRITIRSKKKRFHRRVYDSRGSTKCSDES  261

Query  753   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  574
             EGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSE
Sbjct  262   EGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSE  321

Query  573   YLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             Y+VH GIQ+LGG SLK+ S+ +E  K   VD+R E+
Sbjct  322   YIVHQGIQTLGGPSLKKRSNLEESVKRHDVDVRSEI  357


 Score = 61.2 bits (147),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 33/35 (94%), Gaps = 0/35 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
            +IRRQST+ELQIFK+RWE AV+ED+NWVDP++AS 
Sbjct  356  EIRRQSTHELQIFKDRWERAVEEDQNWVDPFEASS  390



>ref|XP_009766485.1| PREDICTED: uncharacterized protein LOC104217853 [Nicotiana sylvestris]
Length=411

 Score =   502 bits (1292),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 239/336 (71%), Positives = 280/336 (83%), Gaps = 0/336 (0%)
 Frame = -3

Query  1473  TCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLP  1294
             T  +K+K + F+G+ C  MLFI+YRTT YQYQQ E+ESK DP YS++DS V     +SLP
Sbjct  22    TWGIKVKQLPFMGIMCTVMLFIVYRTTNYQYQQTEIESKLDPFYSSKDSDVDITRLNSLP  81

Query  1293  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1114
             RGI +  SDLEL PL + S S+SK +++   NLLA+ VG+KQK NV+ ++QKFLSENFTI
Sbjct  82    RGISQPSSDLELMPLWSTSGSRSKASISSSRNLLAIAVGVKQKSNVDALVQKFLSENFTI  141

Query  1113  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  934
             +LFHYDG+VDGWWDL WSKEA+HIVA++QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV+
Sbjct  142   VLFHYDGHVDGWWDLQWSKEAVHIVANNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVK  201

Query  933   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  754
             NFHP RYL+IVKSEGLEISQPALD  S  IHHRIT+RS+  +FHRRVY  +GSTKCS+ES
Sbjct  202   NFHPGRYLKIVKSEGLEISQPALDRNSTDIHHRITIRSKKKRFHRRVYDSRGSTKCSDES  261

Query  753   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  574
             EGPPCSGFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSE
Sbjct  262   EGPPCSGFVEGMAPVFSRSAWLCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSE  321

Query  573   YLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             Y+VH GIQ+LGG SLK+ S+ +E  K   VD+R E+
Sbjct  322   YIVHQGIQTLGGPSLKKRSNLEESVKRHDVDVRSEI  357


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 33/34 (97%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST+ELQIFK+RWE AV+EDKNWVDP++AS
Sbjct  356  EIRRQSTHELQIFKDRWERAVEEDKNWVDPFEAS  389



>ref|XP_010327027.1| PREDICTED: uncharacterized protein LOC101254342 isoform X2 [Solanum 
lycopersicum]
Length=400

 Score =   499 bits (1284),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 240/329 (73%), Positives = 273/329 (83%), Gaps = 0/329 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
              TC VK+K + F+G+ C  M  I+YRTT YQY+Q EMESKSDP YS++DS V   S +SL
Sbjct  21    ATCGVKVKQIAFMGIICTIMFLIVYRTTNYQYRQTEMESKSDPFYSSKDSDVDITSFNSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII + SDLELKPL + S SKSK +V+   NLLAM VGIKQK NV+ ++QKFLSENFT
Sbjct  81    PRGIIHASSDLELKPLWSTSNSKSKDSVSSSRNLLAMAVGIKQKKNVDTLVQKFLSENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDG+VDGWWDL WSKEA+HIVA++QTKWWFAKRFLHP  VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGHVDGWWDLKWSKEAVHIVANNQTKWWFAKRFLHPAAVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             +NFHP RYL+IVKSEGLEISQPALD  S  IHHR+T+RS+  +FHRRVY  +GSTKCS E
Sbjct  201   KNFHPGRYLKIVKSEGLEISQPALDRNSTEIHHRLTIRSKRKRFHRRVYDSRGSTKCSGE  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPCSGFVEGMAPVFS SAW C WHLIQNDLVHGWGMDMK GYCAQGDR   VG+VDS
Sbjct  261   SEGPPCSGFVEGMAPVFSISAWVCAWHLIQNDLVHGWGMDMKFGYCAQGDRNKKVGVVDS  320

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGR  490
             EY+VH GIQ+LGG SLK+ S+ +E  K R
Sbjct  321   EYIVHQGIQTLGGPSLKKPSNLEESTKIR  349


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/28 (86%), Positives = 26/28 (93%), Gaps = 0/28 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWV  297
            +IRRQS YELQIFKERWE AV+EDKNWV
Sbjct  347  KIRRQSMYELQIFKERWERAVEEDKNWV  374



>gb|KHG08288.1| hypothetical protein F383_16150 [Gossypium arboreum]
Length=371

 Score =   494 bits (1272),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 229/337 (68%), Positives = 271/337 (80%), Gaps = 1/337 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C  KM+ + F+G+ C  MLFI+YRTT YQY + EME++  P  + +D  +       L
Sbjct  21    GNCGFKMRQLPFMGVICTVMLFIVYRTTDYQYHKTEMETRFHPFATVKDYHLHLGKLRGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI+++RSDLEL+PL + S S+SK +VT   NLLAMPVGIKQKD V+++++KFL+ NFT
Sbjct  81    PRGIMQARSDLELRPLWS-SNSQSKASVTTNKNLLAMPVGIKQKDYVDDVVKKFLAANFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWWDL W ++AIHIVAH+QTKWWFAKRFLHPD+VS+YDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWDLGWGEKAIHIVAHNQTKWWFAKRFLHPDIVSVYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRIT+R+RT KFHRR+Y  +G TKCSN 
Sbjct  200   EHFDPTRYLEIVKSEGLEISQPALDPNSTEIHHRITIRARTKKFHRRIYDLRGKTKCSNS  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDR+  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGVDMKLGYCAQGDRSKKVGVVDS  319

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+VH GIQSLGGS      +  +     + DLR EV
Sbjct  320   EYIVHKGIQSLGGSGHPTMRTTMKRHGASSFDLRTEV  356



>emb|CDO99608.1| unnamed protein product [Coffea canephora]
Length=404

 Score =   495 bits (1274),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 231/337 (69%), Positives = 273/337 (81%), Gaps = 0/337 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             GTC  KMK + F+ + C  MLF++YRTT YQY+Q EMES+  P +  +DS +   S ++L
Sbjct  21    GTCGAKMKPLPFMVVICTLMLFVVYRTTNYQYRQTEMESRLRPFFMLKDSGIPTTSLNAL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGIIE+RSDLELKPL +   S+ ++N      LLA+PVGIKQK NV+ I+QKFL ENFT
Sbjct  81    PRGIIEARSDLELKPLWSSDSSRKELNTPSSQCLLAIPVGIKQKHNVDRIVQKFLPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             I+LFHYDGNVDGWW+L WSK+AIH+VA +QTKWWFAKRFLHP VVS YDYIFLWDEDLGV
Sbjct  141   IVLFHYDGNVDGWWNLEWSKKAIHMVAFNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P RYLEIVK+EGLEISQPALDP S GIHHRIT+R R+ KFH+RVY+ +GSTKCS+ 
Sbjct  201   EHFCPRRYLEIVKAEGLEISQPALDPNSTGIHHRITIRQRSKKFHQRVYETRGSTKCSDA  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             S+GPPC+GFVEGMAPVFSR+AW C WHLIQ+DLVHGWGMDMKLGYCAQGDRT NVG+VDS
Sbjct  261   SDGPPCAGFVEGMAPVFSRAAWHCSWHLIQSDLVHGWGMDMKLGYCAQGDRTKNVGVVDS  320

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+VH  IQ+LGG S K+ S      K   VD+R EV
Sbjct  321   EYIVHQSIQTLGGKSAKKTSIAGGSTKRHEVDVRSEV  357


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
            ++RRQST ELQ F++RWE A+KED+ WVDPYK SQ
Sbjct  356  EVRRQSTSELQTFEDRWERAIKEDRYWVDPYKGSQ  390



>ref|XP_007025742.1| Uncharacterized protein TCM_029952 [Theobroma cacao]
 gb|EOY28364.1| Uncharacterized protein TCM_029952 [Theobroma cacao]
Length=592

 Score =   498 bits (1282),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 231/337 (69%), Positives = 270/337 (80%), Gaps = 0/337 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C  KMK + F+G+ C  MLFI+YRTT YQY + EMESK  P  + +D  +      SL
Sbjct  21    GNCGFKMKQLPFMGVICAVMLFIVYRTTNYQYHETEMESKLHPFETVKDYRLPSGKLKSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI+ + SDLEL+PL + S  +SKVNVT   NLLAMPVGIKQK+NV++I+QKFL+ENFT
Sbjct  81    PRGIMHAHSDLELRPLWSRSSLRSKVNVTMNKNLLAMPVGIKQKENVDDIVQKFLAENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDG+VDGW DL W  +A+HIVAH+QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGHVDGWLDLEWGDKAVHIVAHNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ++F P RYLEIVK+EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +G TKC++ 
Sbjct  201   QHFDPGRYLEIVKAEGLEISQPALDPNSTEIHHRITIRARMKKFHRRVYDLRGKTKCTSA  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG++DS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVIDS  320

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+VH GIQSLGGS     ++  + P     DLR E+
Sbjct  321   EYIVHKGIQSLGGSGHSTMTTTIKSPGASGFDLRTEI  357


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
            +IRRQST+ELQ+FK+RW +AV+EDK+WVDP+  + 
Sbjct  356  EIRRQSTWELQVFKDRWNQAVEEDKSWVDPFSPTH  390



>ref|XP_007211954.1| hypothetical protein PRUPE_ppa006425mg [Prunus persica]
 gb|EMJ13153.1| hypothetical protein PRUPE_ppa006425mg [Prunus persica]
Length=412

 Score =   490 bits (1262),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 231/345 (67%), Positives = 273/345 (79%), Gaps = 8/345 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1306
             G C +KMK + F+G+ C  MLFI+YRTT YQYQ   Q EM++K +P  + +D  VT +  
Sbjct  21    GKCGLKMKQLSFMGVVCTVMLFIVYRTTNYQYQAYQQTEMDAKWNPFDTVKDIFVTSKKL  80

Query  1305  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              SLPRGII++RSDLEL+PL   S S+ KV+   + NLLA+PVGIKQKD+V+ I++KFL E
Sbjct  81    DSLPRGIIQARSDLELRPLWLTSGSRLKVDDYSHRNLLAIPVGIKQKDSVDAIVEKFLPE  140

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NFTIILFHYDGNVDGWWDL WS  AIHIVA +QTKWWFAKRFLHPD+VSIYDY+FLWDED
Sbjct  141   NFTIILFHYDGNVDGWWDLEWSSNAIHIVAQNQTKWWFAKRFLHPDIVSIYDYVFLWDED  200

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RYLEIV+  GLEISQPAL P S  IHHRIT+R+R  KFHRRVY  +GS KC
Sbjct  201   LGVENFHPGRYLEIVRQAGLEISQPALHPNSTDIHHRITIRARKKKFHRRVYDIRGSVKC  260

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
             +  S+ PPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRTT VG+
Sbjct  261   TEASQTPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTTKVGV  320

Query  585   VDSEYLVHLGIQSL--GGSSLKRASSPQELPKGRAV---DLRVEV  466
             VDSEY+VH GIQ+L  GG S ++ SS  +  K R     D+R E+
Sbjct  321   VDSEYVVHKGIQTLGDGGLSARKVSSRGKTSKKRGASGFDVRTEI  365


 Score = 56.6 bits (135),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST E  IFKERW  AV ED NW DP+K+S R RK
Sbjct  364  EIRRQSTREFSIFKERWNNAVDEDMNWTDPFKSSIRRRK  402



>ref|XP_008224979.1| PREDICTED: uncharacterized protein LOC103324663 [Prunus mume]
Length=413

 Score =   489 bits (1258),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 230/346 (66%), Positives = 273/346 (79%), Gaps = 9/346 (3%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1306
             G C +KMK + F+G+ C  MLFI+YRTT YQYQ   Q EM++K +P  + +D  VT +  
Sbjct  21    GKCGLKMKQLSFMGVVCTVMLFIVYRTTNYQYQAYRQTEMDAKWNPFDTVKDIFVTSKKL  80

Query  1305  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              SLP GII++RSDLEL+PL   S S+ KVN   + NLLA+PVGIKQKD+V+ I++KFL E
Sbjct  81    DSLPHGIIQARSDLELRPLWLTSGSRLKVNDYSHRNLLAIPVGIKQKDSVDAIVEKFLPE  140

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NFTIILFHYDGNVDGWWDL WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDY+FLWDED
Sbjct  141   NFTIILFHYDGNVDGWWDLEWSSDAIHIVAQNQTKWWFAKRFLHPDIVSIYDYVFLWDED  200

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RYLEIV+  GLEISQPAL P S  IHHRIT+R+R  KFHRRVY  +GS KC
Sbjct  201   LGVENFHPGRYLEIVREAGLEISQPALHPNSTDIHHRITIRARKKKFHRRVYDIRGSVKC  260

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
             +  S+ PPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRTT VG+
Sbjct  261   TEASQTPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTTKVGV  320

Query  585   VDSEYLVHLGIQSL--GGSSLKRASSPQELPKGR----AVDLRVEV  466
             VDSEY+VH GIQ+L  GG S ++ SS  +  K +      D+R E+
Sbjct  321   VDSEYIVHKGIQTLGDGGLSARKVSSRGKTSKKKHGASGFDVRTEI  366


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST E  IFKERW  AV ED NW DP+K+S R RK
Sbjct  365  EIRRQSTREFSIFKERWNNAVDEDMNWTDPFKSSIRRRK  403



>ref|XP_010646775.1| PREDICTED: uncharacterized protein LOC100257753 [Vitis vinifera]
Length=412

 Score =   486 bits (1252),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 233/347 (67%), Positives = 272/347 (78%), Gaps = 24/347 (7%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             KMK + F+G+ C+ ML I+YRTT YQYQQ EME+K  P  + E   +   +  +LPRGII
Sbjct  30    KMKQLPFMGIVCIVMLVIVYRTTNYQYQQTEMETKFQPFGTVEG--LASMTLVNLPRGII  87

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             ++RSDLEL+PL + S S+SKV+ +  HNLLA+PVGIKQK NV+ I++KFL ENFTIILFH
Sbjct  88    QARSDLELRPLWSTSSSRSKVDDSSEHNLLAIPVGIKQKYNVDAIVEKFLPENFTIILFH  147

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDGNVDGWWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYD+IFLWDEDLGVENFHP
Sbjct  148   YDGNVDGWWDLDWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDHIFLWDEDLGVENFHP  207

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  742
              RYL+I+KSEGLEISQPALDP S  IHHRIT+R R  K HRRV+  +GS KCSN SEGPP
Sbjct  208   RRYLDIMKSEGLEISQPALDPNSTDIHHRITIRKRMKKVHRRVWDLRGSVKCSNISEGPP  267

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             C+GFVEGMAPVFSRSAWRC WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG++DSE++VH
Sbjct  268   CTGFVEGMAPVFSRSAWRCTWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVIDSEFIVH  327

Query  561   LGIQSLGGSS---------------LKRASSPQELPKGRAVDLRVEV  466
              GIQ+LGG S               +KR  +P       AVD R E+
Sbjct  328   QGIQTLGGGSPSAKKVSKDTFLDETVKRQGAP-------AVDTRSEI  367


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYR  267
            +IRRQST+EL +F++RW++AVKED+ WVDP+K  QR R
Sbjct  366  EIRRQSTWELHVFRDRWDKAVKEDRKWVDPFKKIQRRR  403



>ref|XP_011027923.1| PREDICTED: uncharacterized protein LOC105128100 isoform X1 [Populus 
euphratica]
 ref|XP_011027924.1| PREDICTED: uncharacterized protein LOC105128100 isoform X2 [Populus 
euphratica]
 ref|XP_011027925.1| PREDICTED: uncharacterized protein LOC105128100 isoform X2 [Populus 
euphratica]
 ref|XP_011027926.1| PREDICTED: uncharacterized protein LOC105128100 isoform X2 [Populus 
euphratica]
Length=403

 Score =   484 bits (1247),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 272/338 (80%), Gaps = 5/338 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             +KMK + F+G+ C +MLF++YRTTIYQY   EM+ K  P    ++S +       LP GI
Sbjct  23    LKMKLLPFMGVLCTAMLFVVYRTTIYQYHHTEMDEKLYPFEILKESALASGLLGGLPHGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             I + SDLELKPL + S S+SKV+ +  H LLA+P GIKQKDNV+ I+QKFL ENFT+ILF
Sbjct  83    IRASSDLELKPLWSTSSSRSKVDPSTRHYLLAIPAGIKQKDNVDHIVQKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLG+E+F+
Sbjct  143   HYDGNVDGWWDLDWSNEAIHIVAKNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGIEHFN  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P +YL+IV+ EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +GSTKCS+ SEGP
Sbjct  203   PGKYLKIVRFEGLEISQPALDPNSTDIHHRITIRARMKKFHRRVYDSRGSTKCSDISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  322

Query  564   HLGIQSLGG--SSLKRASSPQELPK---GRAVDLRVEV  466
             H GIQ+LGG  ++ ++AS+ +EL K     +VD R+E+
Sbjct  323   HKGIQTLGGRKTARRKASNTEELTKRYSAASVDPRMEI  360


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            ++IRRQST+ELQIFK+RW++AVKEDKNWVDP+
Sbjct  358  MEIRRQSTWELQIFKDRWKQAVKEDKNWVDPF  389



>ref|XP_006449262.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62502.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=402

 Score =   484 bits (1245),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 263/337 (78%), Gaps = 4/337 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKRASSPQELPKGR----AVDLRVEV  466
             H GIQ+LGG    R S+ +E    R     VDLR E+
Sbjct  323   HQGIQTLGGQRPTRKSTKREELAKRHGPAPVDLRAEI  359


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST ELQIFK+RW EA+++DK+WVDP+
Sbjct  358  EIRRQSTMELQIFKKRWNEAIEQDKSWVDPF  388



>ref|XP_011043338.1| PREDICTED: uncharacterized protein LOC105138816, partial [Populus 
euphratica]
Length=396

 Score =   483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/339 (68%), Positives = 268/339 (79%), Gaps = 5/339 (1%)
 Frame = -3

Query  1467  RVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRG  1288
             R+KMK + F+G    +MLFI+YRTT YQY+  EME K  P  S ++S +       LP G
Sbjct  21    RLKMKQLPFMGFLFTTMLFIVYRTTTYQYKHTEMEEKLYPFDSLKESALASGLLVGLPHG  80

Query  1287  IIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1108
             II + SDLELKPL + S SK K   +    LLA+PVGIKQKDNVN I+QKFL ENFT+IL
Sbjct  81    IIRANSDLELKPLWSTSSSKLKAYPSTRRFLLAIPVGIKQKDNVNRIVQKFLPENFTVIL  140

Query  1107  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  928
             FHYDG VDGWWDLAWS E IHI A +QTKWWFAKRFLHP VVSIYDY+FLWDEDLGVE+F
Sbjct  141   FHYDGKVDGWWDLAWSNEVIHIAAKNQTKWWFAKRFLHPAVVSIYDYVFLWDEDLGVEHF  200

Query  927   HPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  748
             +P RYL+IV+ EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GSTKCS+ SEG
Sbjct  201   NPGRYLKIVRYEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTKCSDVSEG  260

Query  747   PPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYL  568
             PPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSEY+
Sbjct  261   PPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSEYI  320

Query  567   VHLGIQSLGGSSL--KRASSPQELPK---GRAVDLRVEV  466
             VH GIQ+LGG+    ++AS+ +EL K      +D R+E+
Sbjct  321   VHKGIQTLGGNGPPERKASNTEELTKRHSATGMDPRMEI  359


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            ++IRRQST+ELQIFK+RW +AVKEDKNWVDP+
Sbjct  357  MEIRRQSTWELQIFKDRWNQAVKEDKNWVDPF  388



>ref|XP_006467869.1| PREDICTED: uncharacterized protein LOC102620672 isoform X2 [Citrus 
sinensis]
 gb|KDO75802.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=402

 Score =   483 bits (1244),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 227/337 (67%), Positives = 264/337 (78%), Gaps = 4/337 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKRASSPQELPKGR----AVDLRVEV  466
             H GIQ+LGG    R S+ +E    R     VDLR E+
Sbjct  323   HQGIQTLGGQPPTRKSTKREELAKRHGPAPVDLRAEI  359


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST ELQIFK+RW EA+++DK+WVDP+
Sbjct  358  EIRRQSTMELQIFKKRWNEAIEQDKSWVDPF  388



>ref|XP_009378251.1| PREDICTED: uncharacterized protein LOC103966743 [Pyrus x bretschneideri]
Length=410

 Score =   484 bits (1245),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 226/343 (66%), Positives = 266/343 (78%), Gaps = 6/343 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1306
             G   +KMK + F+G+ C  MLF++YRTT YQYQ   Q EM++K +P  + ++  VT R  
Sbjct  21    GKSGMKMKQLSFMGVVCTVMLFVVYRTTNYQYQAYQQTEMDAKWNPFDTVKEIFVTSRKL  80

Query  1305  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
               LPRGII+ RSDLE +PL   S S+ KV      NLLA+PVGIKQKD+V+ I+ KFL E
Sbjct  81    DGLPRGIIQPRSDLEQRPLWLTSSSRLKVGDYSSRNLLAIPVGIKQKDSVDAIVGKFLPE  140

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NFT+ILFHYDGNVDGWWDL WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDED
Sbjct  141   NFTVILFHYDGNVDGWWDLEWSNDAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDED  200

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RYLEIVK  GLEISQPAL P S  IHHRIT+R++  KFHRRVY  +GSTKC
Sbjct  201   LGVENFHPGRYLEIVKEAGLEISQPALHPNSTDIHHRITIRAKKKKFHRRVYDTRGSTKC  260

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
             +  S+GPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+
Sbjct  261   TEASQGPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTKKVGV  320

Query  585   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV---DLRVEV  466
             VDSEY+VH GIQ+LG         P++  K RA    D+R+E+
Sbjct  321   VDSEYIVHKGIQTLGEGGSSTNKVPEKKSKKRAAPGHDMRIEI  363


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            I+IRRQST E   FKERW  AV+ED NW+DP+K+S
Sbjct  361  IEIRRQSTREYTTFKERWNNAVEEDLNWIDPFKSS  395



>ref|XP_006384013.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 ref|XP_006384014.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 gb|ERP61810.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 gb|ERP61811.1| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
Length=403

 Score =   483 bits (1243),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 227/338 (67%), Positives = 272/338 (80%), Gaps = 5/338 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             +KMK + F+G+ C +MLF++YRTTIYQY   EM+ K  P    ++S +       LP GI
Sbjct  23    LKMKLLPFMGVLCTAMLFVVYRTTIYQYHHTEMDEKLYPFEILKESALASGLLGGLPHGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             I + SDLELKPL + S S+SKV+ +  H LLA+PVGIKQKDNV+ I+QKFL ENFT+ILF
Sbjct  83    IRASSDLELKPLWSTSSSRSKVDPSTRHYLLAIPVGIKQKDNVDHIVQKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLG+E+F+
Sbjct  143   HYDGNVDGWWDLDWSNEAIHIVAKNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGIEHFN  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P +YL+IV+ EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +GSTKCS+ SEGP
Sbjct  203   PGKYLKIVRFEGLEISQPALDPNSTDIHHRITIRARMKKFHRRVYDSRGSTKCSDISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  322

Query  564   HLGIQSLGG--SSLKRASSPQELPK---GRAVDLRVEV  466
             H GIQ+LGG  +  +++S+ +EL K     +VD R+E+
Sbjct  323   HKGIQTLGGRKTPRRKSSNTEELTKRHSAASVDPRMEI  360


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            ++IRRQST+ELQIFK+RW++AVKEDKNWVDP+
Sbjct  358  MEIRRQSTWELQIFKDRWKQAVKEDKNWVDPF  389



>ref|XP_006467868.1| PREDICTED: uncharacterized protein LOC102620672 isoform X1 [Citrus 
sinensis]
 gb|KDO75803.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75804.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=405

 Score =   481 bits (1238),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 264/340 (78%), Gaps = 7/340 (2%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKRAS----SPQELPKGRA---VDLRVEV  466
             H GIQ+LGG    R S      +EL K      VDLR E+
Sbjct  323   HQGIQTLGGQPPTRKSLQSTKREELAKRHGPAPVDLRAEI  362


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST ELQIFK+RW EA+++DK+WVDP+
Sbjct  361  EIRRQSTMELQIFKKRWNEAIEQDKSWVDPF  391



>ref|XP_008355992.1| PREDICTED: uncharacterized protein LOC103419671 [Malus domestica]
Length=410

 Score =   481 bits (1238),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 225/343 (66%), Positives = 264/343 (77%), Gaps = 6/343 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1306
             G   +KMK + F+G+ C  MLF++YRTT YQYQ   Q EM++K +P  + ++  V+ R  
Sbjct  21    GKSGIKMKQLSFMGVVCTVMLFVVYRTTNYQYQAYQQTEMDAKWNPFDTVKEIFVSSRKL  80

Query  1305  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              SLPRGII+ RSDLE +PL   S S  KV      NLLA+PVGIKQKD+V+ I+ KFL E
Sbjct  81    DSLPRGIIQPRSDLEQRPLWLTSSSMLKVGDXSNRNLLAIPVGIKQKDSVDAIVGKFLPE  140

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NFT+ILFHYDGNVDGWWDL WS EA HIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDED
Sbjct  141   NFTVILFHYDGNVDGWWDLEWSNEAXHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDED  200

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RYLEIVK  GLEISQPAL P S  IHHRIT+R++  KFHRRVY  +GSTKC
Sbjct  201   LGVENFHPGRYLEIVKEAGLEISQPALHPNSTDIHHRITIRAKKKKFHRRVYDTRGSTKC  260

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
             +  S+GPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+
Sbjct  261   TEASQGPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMKLGYCAQGDRTKKVGV  320

Query  585   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV---DLRVEV  466
             VDSEY+VH GIQ+LG         P++  K RA     +R+E+
Sbjct  321   VDSEYIVHKGIQTLGEGGSSTDKVPEKKSKKRAAPGHXMRIEI  363


 Score = 52.4 bits (124),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            I+IRRQST E   FKERW  AV+ED  W+DP+K+S + RK
Sbjct  361  IEIRRQSTREYTTFKERWNNAVEEDLKWIDPFKSSLKRRK  400



>ref|XP_006449263.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62503.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=405

 Score =   481 bits (1237),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 228/340 (67%), Positives = 263/340 (77%), Gaps = 7/340 (2%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKRAS----SPQELPKGRA---VDLRVEV  466
             H GIQ+LGG    R S      +EL K      VDLR E+
Sbjct  323   HQGIQTLGGQRPTRKSLQSTKREELAKRHGPAPVDLRAEI  362


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST ELQIFK+RW EA+++DK+WVDP+
Sbjct  361  EIRRQSTMELQIFKKRWNEAIEQDKSWVDPF  391



>ref|XP_002316643.2| hypothetical protein POPTR_0011s04510g [Populus trichocarpa]
 gb|EEE97255.2| hypothetical protein POPTR_0011s04510g [Populus trichocarpa]
Length=401

 Score =   480 bits (1236),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 229/338 (68%), Positives = 267/338 (79%), Gaps = 5/338 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             +KMK + F+G    +MLFI+YRTT YQY+  EME K  P  S ++S +       LP GI
Sbjct  22    LKMKQLPFMGFLFTTMLFIVYRTTTYQYKHTEMEEKLYPFDSLKESALASGLLVGLPHGI  81

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             I + SDLELKPL + S S+SK + +    LLA+PVGIKQKDNVN I+QKFL ENFT+ILF
Sbjct  82    IRASSDLELKPLWSTSSSRSKADPSTRRFLLAIPVGIKQKDNVNRIVQKFLPENFTVILF  141

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG VDGWWDL WS E IHI A +QTKWWFAKRFLHP VVSIYDYIFLWDEDLGVE+F+
Sbjct  142   HYDGKVDGWWDLDWSNEVIHIAAKNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVEHFN  201

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYL+IV+ EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GSTKCS+ SEGP
Sbjct  202   PGRYLKIVRYEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTKCSDVSEGP  261

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSEY+V
Sbjct  262   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSEYIV  321

Query  564   HLGIQSLGGSSL--KRASSPQELPK---GRAVDLRVEV  466
             H GIQ+LGG     ++AS+ +EL K      +D R+E+
Sbjct  322   HKGIQTLGGHGPPGRKASNTEELTKRHSATGMDPRMEI  359


 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 31/32 (97%), Gaps = 0/32 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            ++IRRQST+ELQIFK+RW +AVKEDKNWVDP+
Sbjct  357  MEIRRQSTWELQIFKDRWNQAVKEDKNWVDPF  388



>ref|XP_006361017.1| PREDICTED: uncharacterized protein LOC102578269 isoform X1 [Solanum 
tuberosum]
 ref|XP_006361018.1| PREDICTED: uncharacterized protein LOC102578269 isoform X2 [Solanum 
tuberosum]
Length=408

 Score =   480 bits (1236),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 242/336 (72%), Positives = 276/336 (82%), Gaps = 0/336 (0%)
 Frame = -3

Query  1473  TCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLP  1294
             TC +K+K + F+G+ C  M  I+YRTT YQYQQ EMESKSDP YS++DS V     +SLP
Sbjct  22    TCGIKVKQIAFMGIICTIMFLIVYRTTNYQYQQTEMESKSDPFYSSKDSDVDITRLNSLP  81

Query  1293  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1114
             RGII++ SDLELKPL + S SKSK +V+   NLLAM VGIKQK NV+ ++QKFLSENFTI
Sbjct  82    RGIIQASSDLELKPLWSTSNSKSKGSVSSSRNLLAMAVGIKQKKNVDTLVQKFLSENFTI  141

Query  1113  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  934
             ILFHYDG+VDGWWDL WSKEA+HI A++QTKWWFAKRFLHP  VSIYDYIFLWDEDLGV+
Sbjct  142   ILFHYDGHVDGWWDLQWSKEAVHIAANNQTKWWFAKRFLHPAAVSIYDYIFLWDEDLGVK  201

Query  933   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  754
             NFHP RYLEIVKSEGLEISQPALD  S  IHHRIT+R +  +FHRRVY  +GSTKCS ES
Sbjct  202   NFHPGRYLEIVKSEGLEISQPALDRNSTEIHHRITIRRKRKRFHRRVYDSRGSTKCSGES  261

Query  753   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  574
             EGPPCSGFVEGMAPVFS +AW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDSE
Sbjct  262   EGPPCSGFVEGMAPVFSIAAWVCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSE  321

Query  573   YLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             Y+VH  IQ+LGG SLK+ S  +E  K   VD+R E+
Sbjct  322   YIVHQSIQTLGGPSLKKRSDLEESTKRHVVDVRSEI  357


 Score = 58.9 bits (141),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKA  282
            +IRRQS YELQIFK+RWE AV+EDKNWVDP +A
Sbjct  356  EIRRQSMYELQIFKDRWERAVEEDKNWVDPVEA  388



>ref|XP_008383799.1| PREDICTED: uncharacterized protein LOC103446457 [Malus domestica]
Length=409

 Score =   480 bits (1236),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 223/343 (65%), Positives = 267/343 (78%), Gaps = 6/343 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSS  1306
             G   +KMK + F+G+ C  MLFI+YRTT +QYQ   Q E+++K +P  + ++   T R  
Sbjct  21    GKSGMKMKQLSFMGVTCTVMLFIVYRTTNFQYQAYQQTEIDAKWNPFDTVKEIFATSRKL  80

Query  1305  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              SLPRGII+ RSDLE +PL   S S+ KV+     NLLA+PVGIKQKD+V+ I++KFL E
Sbjct  81    DSLPRGIIQPRSDLEQRPLWLTSSSRLKVDDYSNRNLLAIPVGIKQKDSVDAIVRKFLPE  140

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NFT ILFHYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHPD+VSIYDY+FLWDED
Sbjct  141   NFTFILFHYDGNVDGWWDLEWSNEAIHIVAQNQTKWWFAKRFLHPDIVSIYDYVFLWDED  200

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGV+NFHP RYLEIVK  GLEISQPAL P S  IHHRIT+R++  KFHRRVY  +GSTKC
Sbjct  201   LGVDNFHPGRYLEIVKEAGLEISQPALHPNSTDIHHRITIRAKNKKFHRRVYDTRGSTKC  260

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
             +  S+GPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DM+LGYCAQGDRT  VG+
Sbjct  261   TEASQGPPCTGFVEGMAPVFSRAAWHCTWHLIQNDLVHGWGLDMRLGYCAQGDRTKKVGV  320

Query  585   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV---DLRVEV  466
             VDSEY+VH GIQ+LG         P++  K RA    D+R+E+
Sbjct  321   VDSEYIVHKGIQTLGYGGSSTNKVPEKKSKKRAASGHDVRIEI  363



>ref|XP_002305670.2| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
 gb|EEE86181.2| hypothetical protein POPTR_0004s03700g [Populus trichocarpa]
Length=394

 Score =   479 bits (1233),  Expect = 9e-162, Method: Compositional matrix adjust.
 Identities = 224/333 (67%), Positives = 266/333 (80%), Gaps = 4/333 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             +KMK + F+G+ C +MLF++YRTTIYQY   EM+ K  P    ++S +       LP GI
Sbjct  23    LKMKLLPFMGVLCTAMLFVVYRTTIYQYHHTEMDEKLYPFEILKESALASGLLGGLPHGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             I + SDLELKPL + S S+SKV+ +  H LLA+PVGIKQKDNV+ I+QKFL ENFT+ILF
Sbjct  83    IRASSDLELKPLWSTSSSRSKVDPSTRHYLLAIPVGIKQKDNVDHIVQKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGWWDL WS EAIHIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLG+E+F+
Sbjct  143   HYDGNVDGWWDLDWSNEAIHIVAKNQTKWWFAKRFLHPAVVSAYDYIFLWDEDLGIEHFN  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P +YL+IV+ EGLEISQPALDP S  IHHRIT+R+R  KFHRRVY  +GSTKCS+ SEGP
Sbjct  203   PGKYLKIVRFEGLEISQPALDPNSTDIHHRITIRARMKKFHRRVYDSRGSTKCSDISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  322

Query  564   HLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             H GIQ+LGG    R +  ++     +VD R+E+
Sbjct  323   HKGIQTLGG----RKTPRRKRHSAASVDPRMEI  351


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/32 (78%), Positives = 32/32 (100%), Gaps = 0/32 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            ++IRRQST+ELQIFK+RW++AVKEDKNWVDP+
Sbjct  349  MEIRRQSTWELQIFKDRWKQAVKEDKNWVDPF  380



>gb|AES63728.2| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=402

 Score =   478 bits (1231),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 228/345 (66%), Positives = 265/345 (77%), Gaps = 11/345 (3%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    +MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    L
Sbjct  21    GKSSFRMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDA  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  576   EYLVHLGIQSLGG--------SSLKRASSPQELPKGRAVDLRVEV  466
             +Y+VH GIQ+LGG        S LK+ ++ Q    G  VD+R E+
Sbjct  321   QYVVHKGIQTLGGSDHGATKVSKLKKTTTKQ---GGATVDVRSEI  362


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
            +IRRQST+EL++FKERW +A+ +DKNWVDP+K
Sbjct  361  EIRRQSTWELEVFKERWNQAIAKDKNWVDPFK  392



>ref|XP_003593477.1| Lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=403

 Score =   478 bits (1229),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 227/345 (66%), Positives = 266/345 (77%), Gaps = 10/345 (3%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    +MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    L
Sbjct  21    GKSSFRMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDA  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  576   EYLVHLGIQSLGG--------SSLKRASSPQELPKGRAVDLRVEV  466
             +Y+VH GIQ+LGG        S LK+ ++ ++   G  VD+R E+
Sbjct  321   QYVVHKGIQTLGGSDHGATKVSKLKKTTTQKQ--GGATVDVRSEI  363


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
            +IRRQST+EL++FKERW +A+ +DKNWVDP+K
Sbjct  362  EIRRQSTWELEVFKERWNQAIAKDKNWVDPFK  393



>gb|EYU43400.1| hypothetical protein MIMGU_mgv1a022983mg [Erythranthe guttata]
Length=377

 Score =   476 bits (1226),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 237/337 (70%), Positives = 266/337 (79%), Gaps = 19/337 (6%)
 Frame = -3

Query  1470  CRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPR  1291
             C  KMK + F+G+ C  MLFI+YRTT YQ+QQ E        Y  ED+  TG +S  LPR
Sbjct  25    CGAKMKQLPFMGVVCTVMLFIIYRTTNYQHQQTE--------YIGEDT--TGLNS--LPR  72

Query  1290  GIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTII  1111
             GIIE++SDL+LKPL   S SKS++NV    NLLAMPVGIKQK NV+ I+QKFL ENFTII
Sbjct  73    GIIEAKSDLDLKPLWTTSSSKSQINVRSSSNLLAMPVGIKQKQNVDTIVQKFLPENFTII  132

Query  1110  LFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVEN  931
             LFHYDGNV+GW DL WS+EA+HIVAH+QTKWWFAKRFLHP VVSIYDYIFLWDEDLGV N
Sbjct  133   LFHYDGNVNGWSDLEWSREAVHIVAHNQTKWWFAKRFLHPAVVSIYDYIFLWDEDLGVNN  192

Query  930   FHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESE  751
             FHP RYLEIVKSEGLEISQPALDP S GIHHRITVR RT  FHRRVY  +GSTKC ++SE
Sbjct  193   FHPGRYLEIVKSEGLEISQPALDPNSTGIHHRITVRKRTKIFHRRVYDYRGSTKCLDDSE  252

Query  750   GPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEY  571
             GP C+GFVEGMAPVFS+SAW+C WHLIQNDLVHGWGMD+KLGYCAQGD T  VG+VDSEY
Sbjct  253   GPSCTGFVEGMAPVFSKSAWQCAWHLIQNDLVHGWGMDIKLGYCAQGDPTKKVGVVDSEY  312

Query  570   LVHLGIQSLGGSSLK--RASSPQELPK-----GRAVD  481
             ++H  IQ+LGG S    R  S  EL K      RAVD
Sbjct  313   VLHQSIQTLGGPSATKIRRQSTIELQKFKERWERAVD  349


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST ELQ FKERWE AV EDK WVDP+  +++
Sbjct  328  KIRRQSTIELQKFKERWERAVDEDKKWVDPFPLTRK  363



>gb|KEH36526.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=376

 Score =   476 bits (1224),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 227/339 (67%), Positives = 263/339 (78%), Gaps = 11/339 (3%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    LPRGII+
Sbjct  1     MKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGLPRGIIQ  60

Query  1278  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
               SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFTIILFHY
Sbjct  61    DSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFTIILFHY  120

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGVE+F P+
Sbjct  121   DGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGVEHFSPS  180

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ SEGPPC
Sbjct  181   RYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDASEGPPC  240

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS+Y+VH 
Sbjct  241   TGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSQYVVHK  300

Query  558   GIQSLGG--------SSLKRASSPQELPKGRAVDLRVEV  466
             GIQ+LGG        S LK+ ++ Q    G  VD+R E+
Sbjct  301   GIQTLGGSDHGATKVSKLKKTTTKQ---GGATVDVRSEI  336


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
            +IRRQST+EL++FKERW +A+ +DKNWVDP+K
Sbjct  335  EIRRQSTWELEVFKERWNQAIAKDKNWVDPFK  366



>ref|XP_006449259.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62499.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=349

 Score =   474 bits (1221),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKR  523
             H GIQ+LGG    R
Sbjct  323   HQGIQTLGGQRPTR  336



>gb|KDO75805.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75806.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75807.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75808.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
 gb|KDO75809.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=350

 Score =   474 bits (1220),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 253/314 (81%), Gaps = 0/314 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKR  523
             H GIQ+LGG    R
Sbjct  323   HQGIQTLGGQPPTR  336



>ref|XP_006449260.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62500.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=350

 Score =   474 bits (1220),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 219/314 (70%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  322

Query  564   HLGIQSLGGSSLKR  523
             H GIQ+LGG    R
Sbjct  323   HQGIQTLGGQRPTR  336



>gb|EPS65991.1| hypothetical protein M569_08784, partial [Genlisea aurea]
Length=398

 Score =   475 bits (1223),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 222/338 (66%), Positives = 269/338 (80%), Gaps = 2/338 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G+CR KMK +  +G+ C +MLF++YRT  YQY++  MES     +S+ D  ++     SL
Sbjct  25    GSCRGKMKQLPLMGIICTAMLFVIYRTAYYQYRETMMESTLPFYWSSNDQGLSISRFRSL  84

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGIIE+++DLELKPL   S  K +   +  + LLAMPVGI QK NV+ ++++FL ENFT
Sbjct  85    PRGIIEAKTDLELKPLWRTSHFKPRKTQSSRY-LLAMPVGIMQKQNVDLVVKRFLPENFT  143

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYD N++GWW+L WS+EAIH+VA +QTKWWFAKRFLHP VVS+YDYIFLWDEDLGV
Sbjct  144   VILFHYDENLEGWWNLDWSREAIHVVARNQTKWWFAKRFLHPAVVSMYDYIFLWDEDLGV  203

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+FHP RYL+IVKSEGLEISQPALDP S  IHHRITVR+R + FHRRVY  +GS KC  +
Sbjct  204   EHFHPGRYLDIVKSEGLEISQPALDPNSTEIHHRITVRNRMHAFHRRVYDSRGSIKCVED  263

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDS
Sbjct  264   SEGPPCTGFVEGMAPVFSRSAWHCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGIVDS  323

Query  576   EYLVHLGIQSLGGSSLKRASSPQELP-KGRAVDLRVEV  466
             EY++H GIQ+LGGSS K+A  P+E   K  + D R+E+
Sbjct  324   EYVIHQGIQTLGGSSAKKAPIPEEAAIKKHSYDSRIEI  361



>gb|KHG04115.1| GTPase Der [Gossypium arboreum]
Length=403

 Score =   474 bits (1221),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 218/314 (69%), Positives = 257/314 (82%), Gaps = 1/314 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+G+ C   L+I+YRTT YQY + +ME+K  P  S ED+ +       L
Sbjct  16    GNSGFKMKQLPFMGVICSVTLYIVYRTTNYQYYETQMETKLHPFDSVEDNELPSGKLKDL  75

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI+ +RSDLEL+P    S+ +S V V    NLLAMPVGIKQK++V+++++KF +ENFT
Sbjct  76    PRGIMHTRSDLELRPQWRKSL-RSAVKVNTNKNLLAMPVGIKQKEHVDDVVKKFRTENFT  134

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             I+LFHYDG VDGWWDL W  +AIHIVAH+QTKWWFAKRFLHPD+VS YDYIFLWDEDLGV
Sbjct  135   IVLFHYDGKVDGWWDLDWCDKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYIFLWDEDLGV  194

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F+P RYLEIVKSEGLEISQPALDP S  IHHRIT+RSR  KFHRRVY+ +G T+CSN 
Sbjct  195   EHFNPGRYLEIVKSEGLEISQPALDPNSTEIHHRITIRSRMKKFHRRVYELRGKTRCSNI  254

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPCSGFVEGMAPVFSR+AWRC WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++D 
Sbjct  255   SEGPPCSGFVEGMAPVFSRAAWRCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDR  314

Query  576   EYLVHLGIQSLGGS  535
             EY+VH GIQ+LGG+
Sbjct  315   EYIVHKGIQTLGGT  328


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST+EL+IFKERW +AV +DK+W+DP+
Sbjct  353  EIRRQSTWELKIFKERWNQAVTQDKDWIDPF  383



>ref|XP_003593478.1| Lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
 gb|AES63729.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=355

 Score =   472 bits (1215),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 220/314 (70%), Positives = 252/314 (80%), Gaps = 0/314 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    +MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    L
Sbjct  21    GKSSFRMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDA  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDS  320

Query  576   EYLVHLGIQSLGGS  535
             +Y+VH GIQ+LGGS
Sbjct  321   QYVVHKGIQTLGGS  334



>ref|XP_004293534.1| PREDICTED: uncharacterized protein LOC101292191 [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   473 bits (1218),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 224/312 (72%), Positives = 259/312 (83%), Gaps = 7/312 (2%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQ---QAEMESKSDPLYSAEDSCVTGRSSSSLP  1294
             +KMK + F+G+ C  MLFI+YRTT YQYQ   +AEME K  P    ++  ++ R+   LP
Sbjct  29    LKMKQVSFMGVVCTVMLFIVYRTTNYQYQAYKEAEMEGKMHPF--NQEILLSSRALDGLP  86

Query  1293  RGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTI  1114
             RGI+++RSDLEL+PL  +S SK KV+ +   NLLAMPVGIKQKDNV+EI+QKFL ENFTI
Sbjct  87    RGIVQARSDLELRPL-WLSSSKLKVDYSN-RNLLAMPVGIKQKDNVDEIVQKFLPENFTI  144

Query  1113  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  934
             ILFHYDG+V GWWDL WS EAIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE
Sbjct  145   ILFHYDGDVKGWWDLEWSDEAIHIVARNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  204

Query  933   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  754
             NF+PARYLEIV+  GLEISQPAL P S  IHHRITVR++  KFHRR+Y  +GS KC+ ES
Sbjct  205   NFNPARYLEIVRGAGLEISQPALHPNSTEIHHRITVRAKKKKFHRRIYDSRGSVKCTEES  264

Query  753   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  574
             +GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDR+ NVG+VD E
Sbjct  265   QGPPCTGFVEGMAPVFSRSAWDCTWHLIQNDLVHGWGLDMKLGYCAQGDRSKNVGVVDVE  324

Query  573   YLVHLGIQSLGG  538
             Y+ H GIQSLGG
Sbjct  325   YIFHKGIQSLGG  336



>ref|XP_010278334.1| PREDICTED: uncharacterized protein LOC104612579 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010278335.1| PREDICTED: uncharacterized protein LOC104612579 isoform X1 [Nelumbo 
nucifera]
Length=355

 Score =   471 bits (1211),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/341 (64%), Positives = 266/341 (78%), Gaps = 6/341 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             GT   KMK + F+G+ C +MLFI+YRTT YQYQ  EME++  P    ++S         L
Sbjct  13    GTHGFKMKQLPFMGIVCATMLFIVYRTTNYQYQHTEMEARLHPFADVKESQEDSMKVDYL  72

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI++S SD+E++PL   S SK KVN+    +LLA+P GIKQK  V+ I+QKF+SENFT
Sbjct  73    PRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLAIPAGIKQKRYVDAIVQKFVSENFT  132

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             ++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFAKRFLHPDVVS+YDYIFLWDEDL V
Sbjct  133   VVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFAKRFLHPDVVSVYDYIFLWDEDLRV  192

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             +NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT+R ++   HRRVY  +GS KCS+ 
Sbjct  193   DNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRITIRKKSKILHRRVYDRRGSVKCSDA  252

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DS
Sbjct  253   SQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDS  312

Query  576   EYLVHLGIQSLGGSSLK------RASSPQELPKGRAVDLRV  472
             E++VH GIQ+LGGSS +      R ++  ++ +   +DLR+
Sbjct  313   EFIVHKGIQTLGGSSARKVSKDIRGNNSMQIRRQSTLDLRI  353



>gb|KEH36527.1| lysine ketoglutarate reductase trans-splicing-like protein [Medicago 
truncatula]
Length=329

 Score =   469 bits (1208),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 219/308 (71%), Positives = 250/308 (81%), Gaps = 0/308 (0%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             MK + F+ + C  MLFI+YRTT YQY Q E++ K      AE    T +    LPRGII+
Sbjct  1     MKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKAEAYLTTSQKLKGLPRGIIQ  60

Query  1278  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
               SDLEL+PL   S S+SK       NLLA+PVGIKQK NVN ++QKFL ENFTIILFHY
Sbjct  61    DSSDLELRPLWLRSNSRSKSRDYSNRNLLAIPVGIKQKHNVNAMVQKFLPENFTIILFHY  120

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGVE+F P+
Sbjct  121   DGNVDGWWNLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGVEHFSPS  180

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RY++IVK EGLEISQPALDP S  IHHRITVR+R  KFHRRVY+ +GST+CS+ SEGPPC
Sbjct  181   RYVKIVKEEGLEISQPALDPNSTEIHHRITVRARNKKFHRRVYERRGSTRCSDASEGPPC  240

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG+VDS+Y+VH 
Sbjct  241   TGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVVDSQYVVHK  300

Query  558   GIQSLGGS  535
             GIQ+LGGS
Sbjct  301   GIQTLGGS  308



>ref|XP_004146635.1| PREDICTED: uncharacterized protein LOC101217607 [Cucumis sativus]
Length=419

 Score =   471 bits (1213),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 219/323 (68%), Positives = 257/323 (80%), Gaps = 0/323 (0%)
 Frame = -3

Query  1482  LEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS  1303
             ++G    KMK + F+G+ C  MLFI+YRTT YQY Q ++E+   P  +A+D     ++ +
Sbjct  28    VQGKYGFKMKQLPFMGVICSVMLFIIYRTTNYQYLQTKIETALQPFDTAKDYPEESQNLN  87

Query  1302  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LPRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK+NVN I+QKF+ EN
Sbjct  88    GLPRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKENVNSIVQKFIPEN  147

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FTIILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDL
Sbjct  148   FTIILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDL  207

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVE+F P RYLEIVKSEGLEISQPALDP S  IHHRITVR+RT K HRRVY  +G+ KCS
Sbjct  208   GVEHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITVRARTKKIHRRVYDLRGNVKCS  267

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             +ESE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++
Sbjct  268   DESEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVI  327

Query  582   DSEYLVHLGIQSLGGSSLKRASS  514
             DS+Y+VH GIQ+LGG   K   S
Sbjct  328   DSQYIVHKGIQTLGGGGTKSKPS  350


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST+ELQIFKERW +AV ED++WVDP+K +
Sbjct  369  EIRRQSTWELQIFKERWNKAVAEDQSWVDPFKTN  402



>gb|KGN64636.1| hypothetical protein Csa_1G072470 [Cucumis sativus]
Length=410

 Score =   471 bits (1211),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 255/321 (79%), Gaps = 0/321 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+G+ C  MLFI+YRTT YQY Q ++E+   P  +A+D     ++ + L
Sbjct  21    GKYGFKMKQLPFMGVICSVMLFIIYRTTNYQYLQTKIETALQPFDTAKDYPEESQNLNGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK+NVN I+QKF+ ENFT
Sbjct  81    PRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKENVNSIVQKFIPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRITVR+RT K HRRVY  +G+ KCS+E
Sbjct  201   EHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITVRARTKKIHRRVYDLRGNVKCSDE  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++DS
Sbjct  261   SEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDS  320

Query  576   EYLVHLGIQSLGGSSLKRASS  514
             +Y+VH GIQ+LGG   K   S
Sbjct  321   QYIVHKGIQTLGGGGTKSKPS  341


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST+ELQIFKERW +AV ED++WVDP+K +
Sbjct  360  EIRRQSTWELQIFKERWNKAVAEDQSWVDPFKTN  393



>ref|XP_010268785.1| PREDICTED: uncharacterized protein LOC104605639 [Nelumbo nucifera]
Length=369

 Score =   469 bits (1206),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 220/337 (65%), Positives = 263/337 (78%), Gaps = 6/337 (2%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             MK + F+G+ C+ MLFI+YR T YQ+Q  EME +  P  + ++  V     + LPRGI++
Sbjct  1     MKQLPFMGMVCMVMLFIVYRMTNYQFQHTEMEDRLHPFGNIKEPQVASMKMNYLPRGIVQ  60

Query  1278  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
             S SD+E+KPL   S S+ KV V    +LLA+P GIKQK NV+ I+QKF+SENFTIILFHY
Sbjct  61    SSSDMEMKPLWLTSSSRLKVKVPKNKSLLAIPAGIKQKQNVDAIVQKFISENFTIILFHY  120

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGNVDGW DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP 
Sbjct  121   DGNVDGWRDLEWSNKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPG  180

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RYL+I+KSE LEISQPALDP S  IHHRIT+R R+   HRRVY  +GS KCS+ SEGPPC
Sbjct  181   RYLKIMKSENLEISQPALDPNSSDIHHRITIRKRSKIVHRRVYDSRGSVKCSDASEGPPC  240

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +G+VEGMAPVFSR AWRCVW+LIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSE++ H 
Sbjct  241   TGWVEGMAPVFSRYAWRCVWNLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEFIFHK  300

Query  558   GIQSLGGSSLKRASS------PQELPKGRAVDLRVEV  466
             GIQ+LGGSS ++ S+        +     AVD+R E+
Sbjct  301   GIQTLGGSSARKVSNNIHHEESMQRRGAAAVDVRSEI  337


 Score = 54.3 bits (129),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST ELQIF +RW+ A++EDK+WVDP++ S
Sbjct  336  EIRRQSTSELQIFGQRWDHAIREDKDWVDPFQRS  369



>ref|XP_010278336.1| PREDICTED: uncharacterized protein LOC104612579 isoform X2 [Nelumbo 
nucifera]
Length=343

 Score =   468 bits (1203),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 217/335 (65%), Positives = 263/335 (79%), Gaps = 6/335 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             GT   KMK + F+G+ C +MLFI+YRTT YQYQ  EME++  P    ++S         L
Sbjct  13    GTHGFKMKQLPFMGIVCATMLFIVYRTTNYQYQHTEMEARLHPFADVKESQEDSMKVDYL  72

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI++S SD+E++PL   S SK KVN+    +LLA+P GIKQK  V+ I+QKF+SENFT
Sbjct  73    PRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLAIPAGIKQKRYVDAIVQKFVSENFT  132

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             ++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFAKRFLHPDVVS+YDYIFLWDEDL V
Sbjct  133   VVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFAKRFLHPDVVSVYDYIFLWDEDLRV  192

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             +NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT+R ++   HRRVY  +GS KCS+ 
Sbjct  193   DNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRITIRKKSKILHRRVYDRRGSVKCSDA  252

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DS
Sbjct  253   SQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDS  312

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRV  472
             E++VH GIQ+LGGSS ++      + +   +DLR+
Sbjct  313   EFIVHKGIQTLGGSSARK------IRRQSTLDLRI  341



>ref|XP_004158032.1| PREDICTED: uncharacterized protein LOC101230572 [Cucumis sativus]
Length=410

 Score =   470 bits (1210),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 219/321 (68%), Positives = 255/321 (79%), Gaps = 0/321 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+G+ C  MLFI+YRTT YQY Q ++E+   P  +A+D     ++ + L
Sbjct  21    GKYGFKMKQLPFMGVICSVMLFIIYRTTNYQYLQTKIETALQPFDTAKDYPEESQNLNGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK+NVN I+QKF+ ENFT
Sbjct  81    PRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKENVNSIVQKFIPENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRITVR+RT K HRRVY  +G+ KCS+E
Sbjct  201   EHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITVRARTKKIHRRVYDLRGNVKCSDE  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++DS
Sbjct  261   SEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDS  320

Query  576   EYLVHLGIQSLGGSSLKRASS  514
             +Y+VH GIQ+LGG   K   S
Sbjct  321   QYIVHKGIQTLGGGGTKSKPS  341


 Score = 55.1 bits (131),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST+ELQIFKERW +AV ED +WVDP+K +
Sbjct  360  EIRRQSTWELQIFKERWNKAVAEDLSWVDPFKTN  393



>ref|XP_006594612.1| PREDICTED: uncharacterized protein LOC100776750 isoform X1 [Glycine 
max]
 ref|XP_006594613.1| PREDICTED: uncharacterized protein LOC100776750 isoform X2 [Glycine 
max]
 ref|XP_006594614.1| PREDICTED: uncharacterized protein LOC100776750 isoform X3 [Glycine 
max]
 ref|XP_006594615.1| PREDICTED: uncharacterized protein LOC100776750 isoform X4 [Glycine 
max]
 ref|XP_006594616.1| PREDICTED: uncharacterized protein LOC100776750 isoform X5 [Glycine 
max]
Length=412

 Score =   468 bits (1204),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 264/343 (77%), Gaps = 7/343 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGGSS--LKRASSPQ----ELPKGRAVDLRVEV  466
             EY+ H GIQ+LGGS   + + S PQ    +   G  +D+R E+
Sbjct  320   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMQKQGGVGIDVRTEI  362


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E +IFKERW EA+  DKNWVDP+K+ QR
Sbjct  361  EIRRQSTWEFEIFKERWNEAIAADKNWVDPFKSDQR  396



>ref|XP_006594617.1| PREDICTED: uncharacterized protein LOC100776750 isoform X6 [Glycine 
max]
Length=411

 Score =   468 bits (1203),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 224/342 (65%), Positives = 263/342 (77%), Gaps = 6/342 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGGSS--LKRASSPQELPK---GRAVDLRVEV  466
             EY+ H GIQ+LGGS   + + S PQ       G  +D+R E+
Sbjct  320   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMKQGGVGIDVRTEI  361


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E +IFKERW EA+  DKNWVDP+K+ QR
Sbjct  360  EIRRQSTWEFEIFKERWNEAIAADKNWVDPFKSDQR  395



>gb|KHG05934.1| 26S proteasome regulatory subunit rpn-1 [Gossypium arboreum]
Length=401

 Score =   467 bits (1201),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 217/337 (64%), Positives = 260/337 (77%), Gaps = 1/337 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+G+ C+ MLFI+YRTT+YQY + EME K       +D         SL
Sbjct  21    GKIGFKMKQLPFMGVICIVMLFIVYRTTVYQYHKTEMEMKLYRFEMVKDYQQPSGKLRSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI++ RSDLE++PL  MS S  + +V    NLLAMPVGI QK+NV+++++KFL+ NFT
Sbjct  81    PRGIMQVRSDLEIRPL-WMSSSSRQASVNTNKNLLAMPVGIMQKENVDDVVEKFLAANFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWWDL W  +AIH+VAH+QTKWWFAKRFLHP+VVSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWDLDWGDKAIHVVAHNQTKWWFAKRFLHPNVVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ++F P RYL+IVK+ GLEISQPALDP S  IHH+IT+RSRT + HRRVY+ +G TKCS  
Sbjct  200   DHFDPKRYLQIVKTAGLEISQPALDPDSTEIHHKITIRSRTKELHRRVYELRGKTKCSKA  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPCSGFVEGMAPVF+RSAW C WHLIQNDLVHGWGMDMKLGYCAQG R+  VG++DS
Sbjct  260   SEGPPCSGFVEGMAPVFTRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGVRSKKVGVIDS  319

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+VH GIQSLGGS      +  +       DLR ++
Sbjct  320   EYIVHKGIQSLGGSGYPATRTTVKRNGASGFDLRTQI  356


 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/31 (77%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            QIRRQST+EL++FKERW  AV+EDKNWVDP+
Sbjct  355  QIRRQSTWELEVFKERWNRAVEEDKNWVDPF  385



>ref|XP_010059328.1| PREDICTED: uncharacterized protein LOC104447263, partial [Eucalyptus 
grandis]
Length=412

 Score =   467 bits (1201),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 228/356 (64%), Positives = 265/356 (74%), Gaps = 26/356 (7%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C  KMK + F+G+ CV MLFI+YRTT YQY+Q EME    P  + ++S    R   SL
Sbjct  21    GLCGFKMKQLPFMGIICVVMLFIVYRTTKYQYRQTEMEINLHPFDTLKESQGLSRRLGSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTG-------YHNLLAMPVGIKQKDNVNEIIQK  1138
             PRGII++RSDLEL+PL + S S+SKV+V+        Y  LLA+ VGIKQK NVN I+QK
Sbjct  81    PRGIIQARSDLELRPLWSTSSSRSKVDVSSNEVDAPRYRYLLAIAVGIKQKYNVNAIVQK  140

Query  1137  FLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFL  958
             F  +NFT++LFHYDG VD W DL WS  AIHIVA +QTKWWFAKRFLHP +VS YDYIFL
Sbjct  141   FRPDNFTVMLFHYDGKVDAWGDLNWSNNAIHIVARNQTKWWFAKRFLHPSIVSAYDYIFL  200

Query  957   WDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKG  778
             WDEDLGV+NFHP RYL+IVKSEGLEISQPAL P S  IHHRIT+RSRT KFHRRVY  +G
Sbjct  201   WDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRITIRSRTKKFHRRVYDVRG  260

Query  777   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  598
             STKC+N S GPPC+GFVEGMAPVFSRSAW C WHL+QNDL+HGWGMDMKLGYCAQGDRT 
Sbjct  261   STKCTNVSWGPPCTGFVEGMAPVFSRSAWFCTWHLLQNDLIHGWGMDMKLGYCAQGDRTK  320

Query  597   NVGIVDSEYLVHLGIQSL------------GGSSLKRASSPQELPKGRAVDLRVEV  466
              VG++DSEY+ H GIQ+L               S KR S+P       +VD+R EV
Sbjct  321   KVGVIDSEYIFHKGIQTLGGGGPPGKKGSNSEESTKRHSTP-------SVDMRAEV  369



>ref|XP_006597406.1| PREDICTED: uncharacterized protein LOC100778191 isoform X6 [Glycine 
max]
Length=402

 Score =   465 bits (1196),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 262/337 (78%), Gaps = 5/337 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+ H GIQ+LGGS   R +  Q    G  +D+R E+
Sbjct  320   EYVFHKGIQTLGGSG-HRMTKKQ---GGVGIDVRTEI  352


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQST+E +IFKERW +A+  DKNWVDP+K+ QR  + W
Sbjct  351  EIRRQSTWEFEIFKERWNKAIGADKNWVDPFKSDQRRIRKW  391



>ref|XP_006594619.1| PREDICTED: uncharacterized protein LOC100776750 isoform X8 [Glycine 
max]
 ref|XP_006594620.1| PREDICTED: uncharacterized protein LOC100776750 isoform X9 [Glycine 
max]
Length=400

 Score =   465 bits (1196),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 224/343 (65%), Positives = 264/343 (77%), Gaps = 19/343 (6%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q E       +Y +    + G     L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEE-------VYPSTSGKLKG-----L  68

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  69    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  127

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  128   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  187

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  188   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  247

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  248   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  307

Query  576   EYLVHLGIQSLGGSS--LKRASSPQ----ELPKGRAVDLRVEV  466
             EY+ H GIQ+LGGS   + + S PQ    +   G  +D+R E+
Sbjct  308   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMQKQGGVGIDVRTEI  350


 Score = 59.7 bits (143),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E +IFKERW EA+  DKNWVDP+K+ QR
Sbjct  349  EIRRQSTWEFEIFKERWNEAIAADKNWVDPFKSDQR  384



>gb|KHN08570.1| hypothetical protein glysoja_014335, partial [Glycine soja]
Length=379

 Score =   464 bits (1194),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 224/342 (65%), Positives = 263/342 (77%), Gaps = 18/342 (5%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q E       +Y +    + G     L
Sbjct  1     GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEE-------VYPSTSGKLKG-----L  48

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  49    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  107

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  108   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  167

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  168   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  227

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  228   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  287

Query  576   EYLVHLGIQSLGGSS--LKRASSPQELPK---GRAVDLRVEV  466
             EY+ H GIQ+LGGS   + + S PQ       G  +D+R E+
Sbjct  288   EYVFHQGIQTLGGSGHRMTKVSKPQRTTMKQGGVGIDVRTEI  329


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E +IFKERW EA+  DKNWVDP+K+ QR
Sbjct  328  EIRRQSTWEFEIFKERWNEAIAADKNWVDPFKSDQR  363



>ref|XP_006597405.1| PREDICTED: uncharacterized protein LOC100778191 isoform X5 [Glycine 
max]
Length=411

 Score =   465 bits (1197),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 224/345 (65%), Positives = 264/345 (77%), Gaps = 12/345 (3%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGG--------SSLKRASSPQELPKGRAVDLRVEV  466
             EY+ H GIQ+LGG        S L+R +  Q    G  +D+R E+
Sbjct  320   EYVFHKGIQTLGGSGHRMTKVSKLQRTTMKQ---GGVGIDVRTEI  361


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQST+E +IFKERW +A+  DKNWVDP+K+ QR  + W
Sbjct  360  EIRRQSTWEFEIFKERWNKAIGADKNWVDPFKSDQRRIRKW  400



>ref|XP_006597401.1| PREDICTED: uncharacterized protein LOC100778191 isoform X1 [Glycine 
max]
 ref|XP_006597402.1| PREDICTED: uncharacterized protein LOC100778191 isoform X2 [Glycine 
max]
 ref|XP_006597403.1| PREDICTED: uncharacterized protein LOC100778191 isoform X3 [Glycine 
max]
 ref|XP_006597404.1| PREDICTED: uncharacterized protein LOC100778191 isoform X4 [Glycine 
max]
Length=412

 Score =   465 bits (1196),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 223/345 (65%), Positives = 265/345 (77%), Gaps = 11/345 (3%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGG--------SSLKRASSPQELPKGRAVDLRVEV  466
             EY+ H GIQ+LGG        S L+R +  ++   G  +D+R E+
Sbjct  320   EYVFHKGIQTLGGSGHRMTKVSKLQRTTMQKQ--GGVGIDVRTEI  362


 Score = 58.5 bits (140),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTW  258
            +IRRQST+E +IFKERW +A+  DKNWVDP+K+ QR  + W
Sbjct  361  EIRRQSTWEFEIFKERWNKAIGADKNWVDPFKSDQRRIRKW  401



>ref|XP_006594618.1| PREDICTED: uncharacterized protein LOC100776750 isoform X7 [Glycine 
max]
Length=402

 Score =   464 bits (1195),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 261/337 (77%), Gaps = 5/337 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKQLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSNSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLRENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIVARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHH+IT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHKITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+ H GIQ+LGGS   R +  Q    G  +D+R E+
Sbjct  320   EYVFHQGIQTLGGSG-HRMTKKQ---GGVGIDVRTEI  352


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E +IFKERW EA+  DKNWVDP+K+ QR
Sbjct  351  EIRRQSTWEFEIFKERWNEAIAADKNWVDPFKSDQR  386



>gb|KCW74645.1| hypothetical protein EUGRSUZ_E03369 [Eucalyptus grandis]
Length=404

 Score =   463 bits (1192),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/318 (69%), Positives = 252/318 (79%), Gaps = 7/318 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G C  KMK + F+G+ CV MLFI+YRTT YQY+Q EME    P  + ++S    R   SL
Sbjct  21    GLCGFKMKQLPFMGIICVVMLFIVYRTTKYQYRQTEMEINLHPFDTLKESQGLSRRLGSL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTG-------YHNLLAMPVGIKQKDNVNEIIQK  1138
             PRGII++RSDLEL+PL + S S+SKV+V+        Y  LLA+ VGIKQK NVN I+QK
Sbjct  81    PRGIIQARSDLELRPLWSTSSSRSKVDVSSNEVDAPRYRYLLAIAVGIKQKYNVNAIVQK  140

Query  1137  FLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFL  958
             F  +NFT++LFHYDG VD W DL WS  AIHIVA +QTKWWFAKRFLHP +VS YDYIFL
Sbjct  141   FRPDNFTVMLFHYDGKVDAWGDLNWSNNAIHIVARNQTKWWFAKRFLHPSIVSAYDYIFL  200

Query  957   WDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKG  778
             WDEDLGV+NFHP RYL+IVKSEGLEISQPAL P S  IHHRIT+RSRT KFHRRVY  +G
Sbjct  201   WDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRITIRSRTKKFHRRVYDVRG  260

Query  777   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  598
             STKC+N S GPPC+GFVEGMAPVFSRSAW C WHL+QNDL+HGWGMDMKLGYCAQGDRT 
Sbjct  261   STKCTNVSWGPPCTGFVEGMAPVFSRSAWFCTWHLLQNDLIHGWGMDMKLGYCAQGDRTK  320

Query  597   NVGIVDSEYLVHLGIQSL  544
              VG++DSEY+ H GIQ+L
Sbjct  321   KVGVIDSEYIFHKGIQTL  338



>ref|XP_010696585.1| PREDICTED: uncharacterized protein LOC104909088 [Beta vulgaris 
subsp. vulgaris]
Length=409

 Score =   463 bits (1191),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 266/342 (78%), Gaps = 5/342 (1%)
 Frame = -3

Query  1488  VGLEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRS  1309
              G  G    +M+ + F+G  C++M+FI+YRTT YQYQQ E+++K  P  S E+S      
Sbjct  22    AGPHGAHGFRMRQLAFMGFVCIAMMFIVYRTTNYQYQQTEIDAKRHPFDSIENSRTL--E  79

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
              + LP+GII++RSDLELKPL   S ++ KV+ +  HNLLA+  GIKQK NV+ I QKFL+
Sbjct  80    LNRLPQGIIQARSDLELKPL--WSRTRDKVDDSTNHNLLAIAAGIKQKHNVDSIAQKFLA  137

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
             ENFTI+LFHYDGN++ WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDYIFLWDE
Sbjct  138   ENFTIMLFHYDGNMNSWWDLDWSNKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYIFLWDE  197

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV +FHP RYL+IVK+E  +ISQPALD  S  IHHRIT+R +T  +HRR+Y  +G TK
Sbjct  198   DLGVRHFHPGRYLKIVKAERFDISQPALDSNSTEIHHRITIRKKTKMYHRRIYDSRGFTK  257

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C++ S GPPC+G+VEGMAPVFSRSAWRC WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG
Sbjct  258   CTSSSMGPPCTGWVEGMAPVFSRSAWRCAWHLIQNDLVHGWGLDMKLGYCAQGDRTKRVG  317

Query  588   IVDSEYLVHLGIQSLGGSSLKRA-SSPQELPKGRAVDLRVEV  466
             I+DSEY+VH GIQ+LGG+S K+  +    L K   VD R  +
Sbjct  318   IIDSEYVVHQGIQTLGGASAKKVLNKDGSLKKRSGVDHRAWI  359


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 11/56 (20%)
 Frame = -1

Query  377  IRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRKTWNYW*NLKPIFINTQKI  210
            IRRQST+EL++FKERWE+AVKED +W+DPY          N W N   IF  T+KI
Sbjct  359  IRRQSTWELEVFKERWEKAVKEDTSWIDPYSR--------NSWFN---IFARTRKI  403



>ref|XP_006597407.1| PREDICTED: uncharacterized protein LOC100778191 isoform X7 [Glycine 
max]
Length=349

 Score =   460 bits (1184),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 217/314 (69%), Positives = 252/314 (80%), Gaps = 1/314 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMKH+ F+ + C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKMKHLPFLAVLCTIMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTYGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII   SDLEL+PL + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHDNSDLELRPLWSRSSSRSKA-VYSNSNLLAVPVGIKQKQNVDAMVQKFLQENFT  139

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWW+L WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  140   IILFHYDGNVDGWWNLDWSSKAIHIIARNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  199

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  200   EHFSPSRYVEIIKREGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDL  259

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWG+DMKLGYCAQGDRT  VG+VDS
Sbjct  260   SEGPPCTGFVEGMAPVFSQSAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKKVGVVDS  319

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  320   EYVFHKGIQTLGGS  333



>ref|XP_006583798.1| PREDICTED: uncharacterized protein LOC100792028 isoform X1 [Glycine 
max]
 ref|XP_006583799.1| PREDICTED: uncharacterized protein LOC100792028 isoform X2 [Glycine 
max]
 ref|XP_006583800.1| PREDICTED: uncharacterized protein LOC100792028 isoform X3 [Glycine 
max]
 ref|XP_006583801.1| PREDICTED: uncharacterized protein LOC100792028 isoform X4 [Glycine 
max]
Length=388

 Score =   460 bits (1183),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 217/341 (64%), Positives = 265/341 (78%), Gaps = 4/341 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G   +KMK + F+ + C+ MLF++YRT  YQ  Q E++ + +     + S  T  +   L
Sbjct  2     GKSSLKMKQLPFMAVVCIVMLFVVYRTLKYQSYQEEIDKQWNFREDEKASSETSGNLKGL  61

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII++ SD EL+PL + S  +SKV+V    NLLA+PVGIKQK NV+ ++QKFL +NFT
Sbjct  62    PRGIIQATSDFELRPLWSPSSLRSKVSVYSNRNLLAVPVGIKQKHNVDAMVQKFLPDNFT  121

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYD N+DGWWDL W+ +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  122   IILFHYDANMDGWWDLNWTSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  181

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +GST+CS  
Sbjct  182   EHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGSTRCSEA  241

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+K+GYCAQGDRT NVG+VDS
Sbjct  242   SKGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDIKIGYCAQGDRTQNVGVVDS  301

Query  576   EYLVHLGIQSLGGSS--LKRASSPQELPKG--RAVDLRVEV  466
             EY+VH  IQ+LGGS    K ++  +  PK    A D RVE+
Sbjct  302   EYVVHKAIQTLGGSDDPTKVSNRQRTTPKHGVAAFDQRVEI  342


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            ++IRRQST+EL++FKERW  A+ EDKNWV+P+K+ ++
Sbjct  340  VEIRRQSTWELEVFKERWNRAIAEDKNWVNPFKSDKK  376



>gb|KHN07305.1| hypothetical protein glysoja_027395 [Glycine soja]
Length=385

 Score =   459 bits (1180),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 215/338 (64%), Positives = 262/338 (78%), Gaps = 5/338 (1%)
 Frame = -3

Query  1479  EGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSS  1300
             +G   +KMK + F+ + C+ MLF++YRT  YQ  Q E++ + +     + S  T  +   
Sbjct  7     QGKSSLKMKQLPFMAVVCIVMLFVVYRTLKYQSYQEEIDKQWNFREDEKASSETSGNLKG  66

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LPRGII++ SD EL+PL + S  +SKV+V    NLLA+PVGIKQK NV+ ++QKFL +NF
Sbjct  67    LPRGIIQATSDFELRPLWSPSSLRSKVSVYSNRNLLAVPVGIKQKHNVDAMVQKFLPDNF  126

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             TIILFHYD N+DGWWDL W+ +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLG
Sbjct  127   TIILFHYDANMDGWWDLNWTSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLG  186

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  760
             VE+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +GST+CS 
Sbjct  187   VEHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGSTRCSE  246

Query  759   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  580
              S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+K+GYCAQGDRT NVG+VD
Sbjct  247   ASKGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGVDIKIGYCAQGDRTQNVGVVD  306

Query  579   SEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             SEY+VH  IQ+LGGS       P +     A D RVE+
Sbjct  307   SEYVVHKAIQTLGGS-----DDPTKKHGVAAFDQRVEI  339


 Score = 57.0 bits (136),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            ++IRRQST+EL++FKERW  A+ EDKNWV+P+K+ ++
Sbjct  337  VEIRRQSTWELEVFKERWNRAIAEDKNWVNPFKSDKK  373



>ref|XP_007159269.1| hypothetical protein PHAVU_002G223800g [Phaseolus vulgaris]
 gb|ESW31263.1| hypothetical protein PHAVU_002G223800g [Phaseolus vulgaris]
Length=390

 Score =   458 bits (1178),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 218/342 (64%), Positives = 264/342 (77%), Gaps = 5/342 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G   +KMK + F+ + C  MLF++YRT  YQY Q E++ K   L        T  +   L
Sbjct  2     GKSILKMKQLPFMIVVCTVMLFVVYRTLKYQYYQEEIDKKWSILEEDRPYPDTSGNLKGL  61

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII+  SDLE +PL + S  +SK +V  + NLLA+PVG+KQK NV+ ++QKFL ENFT
Sbjct  62    PRGIIQDTSDLEFRPLWSPSNLRSKASVYSHRNLLAIPVGMKQKHNVDAMVQKFLPENFT  121

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYD N+DGWWDL WS +AIHI+A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  122   IILFHYDANLDGWWDLKWSSKAIHIIAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  181

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +G+T+CS  
Sbjct  182   EHFSPSRYIEIVKEEGLEISQPALDPDSTEIHHRITVRARTKKVHRRVYELRGNTRCSES  241

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMK+GYCAQGDRT NVG+VD 
Sbjct  242   SKGPPCTGFVEGMAPVFSRSAWDCTWHLIQNDLVHGWGVDMKIGYCAQGDRTKNVGVVDR  301

Query  576   EYLVHLGIQSLGGS---SLKRASSPQELPK--GRAVDLRVEV  466
             EY+VH GIQ+LGGS   ++K  +  +  P+    A D RVE+
Sbjct  302   EYVVHKGIQTLGGSGDETVKIFNRRRPTPRHGASAFDERVEI  343



>ref|XP_008442108.1| PREDICTED: uncharacterized protein LOC103486065 [Cucumis melo]
 ref|XP_008442114.1| PREDICTED: uncharacterized protein LOC103486065 [Cucumis melo]
Length=409

 Score =   457 bits (1177),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 214/321 (67%), Positives = 250/321 (78%), Gaps = 0/321 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q ++E+   P  + ++      + + L
Sbjct  21    GKYGFKMKQLPFMAVICSVMLFIVYRTTNYQYLQTKIETTLLPFDTTKEFPEESLNLNGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGI+E+RSDLEL+PL   S S+ K +     NLLA+PVGIKQK NVN I+QKF+  NFT
Sbjct  81    PRGIVEARSDLELRPLWGTSSSRLKGHDYSNRNLLAIPVGIKQKKNVNSIVQKFIPANFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGWWDL W  +AIHI   +QTKWW+AKRFL P VVSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWWDLDWCNDAIHIAVRNQTKWWYAKRFLQPAVVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P RYLEIVKSEGLEISQPALDP S  IHHRIT+R+RT K HRRVY  +G+ KCS+E
Sbjct  201   EHFSPRRYLEIVKSEGLEISQPALDPNSTDIHHRITIRARTKKIHRRVYDLRGNVKCSDE  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SE PPC+GFVEGMAPVFS+SAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVG++DS
Sbjct  261   SEEPPCTGFVEGMAPVFSKSAWHCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGVIDS  320

Query  576   EYLVHLGIQSLGGSSLKRASS  514
             +Y+VH GIQ+LGG   K   S
Sbjct  321   QYIVHKGIQTLGGGGTKSKPS  341


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
            +IRRQST+ELQIFKERW +AV EDK+WVDP+K + 
Sbjct  360  EIRRQSTWELQIFKERWNKAVAEDKSWVDPFKPNS  394



>ref|XP_007148219.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20213.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
Length=400

 Score =   456 bits (1174),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 222/337 (66%), Positives = 263/337 (78%), Gaps = 4/337 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    K+K + F+ L C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKIKQLPFMALLCTVMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII + SDLEL+PL + S S+SK +V+   NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHADSDLELRPLWSRSSSRSKASVSSNRNLLAVPVGIKQKQNVDVMVQKFLRENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDG VDGW +L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGTVDGWLNLGWSSQAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVEIIKQEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDS  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT NVG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRAAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKNVGVVDS  320

Query  576   EYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             EY+ H GIQ+LGGS   R +  Q    G  +D+R E+
Sbjct  321   EYVFHKGIQTLGGSG-HRMTKRQS---GTGIDVRTEI  353


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E ++FKERW EA+ +DKNWVDP+K+ QR
Sbjct  352  EIRRQSTWEFEMFKERWNEAISQDKNWVDPFKSDQR  387



>ref|XP_007148218.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 ref|XP_007148220.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20212.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20214.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
Length=407

 Score =   456 bits (1173),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 221/340 (65%), Positives = 264/340 (78%), Gaps = 3/340 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    K+K + F+ L C  MLFI+YRTT YQY Q E++ K       +    T      L
Sbjct  21    GKSSFKIKQLPFMALLCTVMLFIVYRTTKYQYHQEEIDKKWSFWGQPKVYPSTSGKLKGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII + SDLEL+PL + S S+SK +V+   NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIHADSDLELRPLWSRSSSRSKASVSSNRNLLAVPVGIKQKQNVDVMVQKFLRENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDG VDGW +L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGTVDGWLNLGWSSQAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVEIIKQEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSDS  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT NVG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRAAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKNVGVVDS  320

Query  576   EYLVHLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEV  466
             EY+ H GIQ+LGGS     K ++   +   G  +D+R E+
Sbjct  321   EYVFHKGIQTLGGSGHRMTKVSNLHSKRQSGTGIDVRTEI  360


 Score = 59.3 bits (142),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E ++FKERW EA+ +DKNWVDP+K+ QR
Sbjct  359  EIRRQSTWEFEMFKERWNEAISQDKNWVDPFKSDQR  394



>ref|XP_004485727.1| PREDICTED: uncharacterized protein LOC101506019 isoform X1 [Cicer 
arietinum]
 ref|XP_004485728.1| PREDICTED: uncharacterized protein LOC101506019 isoform X2 [Cicer 
arietinum]
 ref|XP_004485729.1| PREDICTED: uncharacterized protein LOC101506019 isoform X3 [Cicer 
arietinum]
 ref|XP_004485730.1| PREDICTED: uncharacterized protein LOC101506019 isoform X4 [Cicer 
arietinum]
 ref|XP_004485731.1| PREDICTED: uncharacterized protein LOC101506019 isoform X5 [Cicer 
arietinum]
Length=403

 Score =   455 bits (1171),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/314 (68%), Positives = 247/314 (79%), Gaps = 0/314 (0%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK + F+ + C  MLFI+YRTT YQY Q E++ K       E    T      L
Sbjct  21    GKSSFKMKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKTEAYSATSVKLRGL  80

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             PRGII+  SDLEL+PL   S S+SK       NLLA+PVGIKQK NV+ ++QKFL ENFT
Sbjct  81    PRGIIQDSSDLELRPLWLRSNSRSKSRDYSNRNLLAVPVGIKQKHNVDVMVQKFLRENFT  140

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYDGNVDGW  L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  141   IILFHYDGNVDGWLSLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  200

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY++IVK EGLEISQPALDP S  IHHRIT+R+R  + HRRVY+ +GST+CS+ 
Sbjct  201   EHFSPSRYVKIVKEEGLEISQPALDPNSTEIHHRITIRARNKQVHRRVYERRGSTRCSDA  260

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+VDS
Sbjct  261   SEGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVVDS  320

Query  576   EYLVHLGIQSLGGS  535
             +Y+VH GIQ+LGGS
Sbjct  321   QYVVHKGIQTLGGS  334



>ref|XP_009104492.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104501.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104508.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104517.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104525.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104533.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104541.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104548.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
 ref|XP_009104556.1| PREDICTED: uncharacterized protein LOC103830459 isoform X1 [Brassica 
rapa]
Length=428

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 213/316 (67%), Positives = 246/316 (78%), Gaps = 2/316 (1%)
 Frame = -3

Query  1482  LEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS  1303
             L+G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S        
Sbjct  26    LQGKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLK  83

Query  1302  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNVN ++QKFL  N
Sbjct  84    GLPFGIIQPRSDLELKPLWSSTSLRSKGGELTNRNLLAMPVGLKQKDNVNAVVQKFLPAN  143

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT+ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDL
Sbjct  144   FTVILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDL  203

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENF+P +YL+IVK  GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCS
Sbjct  204   GVENFNPQKYLKIVKKAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCS  263

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             N SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIV
Sbjct  264   NTSEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIV  323

Query  582   DSEYLVHLGIQSLGGS  535
             DSEY+ H GIQ+LGGS
Sbjct  324   DSEYIFHQGIQTLGGS  339



>ref|XP_004485732.1| PREDICTED: uncharacterized protein LOC101506019 isoform X6 [Cicer 
arietinum]
Length=377

 Score =   452 bits (1164),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 212/308 (69%), Positives = 245/308 (80%), Gaps = 0/308 (0%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             MK + F+ + C  MLFI+YRTT YQY Q E++ K       E    T      LPRGII+
Sbjct  1     MKQLPFMAVVCTVMLFIVYRTTKYQYHQEEIDKKWSLWGKTEAYSATSVKLRGLPRGIIQ  60

Query  1278  SRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
               SDLEL+PL   S S+SK       NLLA+PVGIKQK NV+ ++QKFL ENFTIILFHY
Sbjct  61    DSSDLELRPLWLRSNSRSKSRDYSNRNLLAVPVGIKQKHNVDVMVQKFLRENFTIILFHY  120

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGNVDGW  L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGVE+F P+
Sbjct  121   DGNVDGWLSLDWSSKAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGVEHFSPS  180

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RY++IVK EGLEISQPALDP S  IHHRIT+R+R  + HRRVY+ +GST+CS+ SEGPPC
Sbjct  181   RYVKIVKEEGLEISQPALDPNSTEIHHRITIRARNKQVHRRVYERRGSTRCSDASEGPPC  240

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+  VG+VDS+Y+VH 
Sbjct  241   TGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRSKKVGVVDSQYVVHK  300

Query  558   GIQSLGGS  535
             GIQ+LGGS
Sbjct  301   GIQTLGGS  308



>ref|XP_004504995.1| PREDICTED: uncharacterized protein LOC101512967 [Cicer arietinum]
Length=382

 Score =   451 bits (1160),  Expect = 7e-151, Method: Compositional matrix adjust.
 Identities = 221/342 (65%), Positives = 260/342 (76%), Gaps = 12/342 (4%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQY--QQAEMESKSDPLYSAEDSCVTGRSSS  1303
             G   +K+K + F+ + C  MLF++YRT  YQY  +QAE++ K       E          
Sbjct  2     GKSSLKIKRLPFMAVACTVMLFVVYRTLKYQYNQEQAEIDKKWSIWGEVEPYNSHSGKLK  61

Query  1302  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LPRGII++ SD EL+PL + S  +SKVNV    +LLA+PVGIKQK NV+ ++QKFL+ N
Sbjct  62    GLPRGIIDATSDFELRPLWSPSNLRSKVNVYSDRSLLAVPVGIKQKHNVDAMVQKFLTGN  121

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FTIILFHYD NVDGW DL WS +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDL
Sbjct  122   FTIILFHYDANVDGWLDLDWSGKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDL  181

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVE F P+RY+EIVK EGLEISQPALDP S  IHHRIT+R+RT K HRRVY+ +G T+CS
Sbjct  182   GVEYFSPSRYIEIVKEEGLEISQPALDPDSTEIHHRITIRARTKKVHRRVYELRGKTRCS  241

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             +ES+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+ NVG+V
Sbjct  242   DESDGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGMDMKLGYCAQGDRSQNVGVV  301

Query  582   DSEYLVHLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEV  466
             DSEY+VH GI +LGGSS    KR  S        AVD R E+
Sbjct  302   DSEYIVHKGIPTLGGSSHDTTKRHGST-------AVDQRTEI  336


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 0/35 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
            +IRRQST+EL+IFKERW +A+ ED++WV+P K+ Q
Sbjct  335  EIRRQSTWELEIFKERWNQAIAEDRSWVNPSKSDQ  369



>ref|XP_009104564.1| PREDICTED: uncharacterized protein LOC103830459 isoform X2 [Brassica 
rapa]
Length=425

 Score =   452 bits (1163),  Expect = 9e-151, Method: Compositional matrix adjust.
 Identities = 212/314 (68%), Positives = 244/314 (78%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNVN ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSTSLRSKGGELTNRNLLAMPVGLKQKDNVNAVVQKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL+IVK  GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLKIVKKAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCSNT  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|XP_003541558.1| PREDICTED: uncharacterized protein LOC100807744 isoform X1 [Glycine 
max]
 ref|XP_006594339.1| PREDICTED: uncharacterized protein LOC100807744 isoform X2 [Glycine 
max]
 ref|XP_006594340.1| PREDICTED: uncharacterized protein LOC100807744 isoform X3 [Glycine 
max]
Length=388

 Score =   450 bits (1158),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 212/341 (62%), Positives = 265/341 (78%), Gaps = 4/341 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G   +KM  + F+ + C+ MLF++YRT  YQ  Q +++ + +     +    T  +   L
Sbjct  2     GKSSLKMTQLPFMAVVCIVMLFVVYRTLKYQSYQEQIDKQWNIREEEKAYTETSGNLKGL  61

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P+GII++ SDLEL+ L + S  +SK +V    NLLA+ VGIKQK NV+ ++QKFL +NFT
Sbjct  62    PQGIIQATSDLELRRLWSPSNLRSKASVYSNRNLLAVAVGIKQKHNVDVMVQKFLPDNFT  121

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             IILFHYD N+DGWWDL+WS +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLGV
Sbjct  122   IILFHYDANLDGWWDLSWSSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLGV  181

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             E+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +G+TKCS+ 
Sbjct  182   EHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGNTKCSDA  241

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+DMK+GYCAQG+RT NVG+VDS
Sbjct  242   SKGPPCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDMKVGYCAQGERTQNVGVVDS  301

Query  576   EYLVHLGIQSLGGSS--LKRASSPQELPK--GRAVDLRVEV  466
             E++VH GIQ+LGGS    K +S  ++ P+    A D RVE+
Sbjct  302   EFVVHKGIQTLGGSDDPTKVSSQKRKTPRHGAAAFDQRVEI  342


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            ++IRRQST+EL++F ERW  A+ EDKNWV+P+K+ ++
Sbjct  340  VEIRRQSTWELEVFNERWNRAIAEDKNWVNPFKSDKK  376



>emb|CDY03814.1| BnaC01g29310D [Brassica napus]
Length=425

 Score =   451 bits (1160),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 245/314 (78%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSTSLRSKGGELTNRNLLAMPVGLKQKDNVDAVVQKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL+IVK+ GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLKIVKTAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCSNT  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>emb|CDY52220.1| BnaA01g35920D [Brassica napus]
Length=425

 Score =   450 bits (1157),  Expect = 7e-150, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 244/314 (78%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QYQQ ++E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTLLLIFWYKTTNIQYQQTQIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + +  +SK       NLLAMPVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSTNLRSKGGELTNRNLLAMPVGLKQKDNVDAVVQKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL+IVK  GLEISQPAL P S  +HHRITVRSRTN FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLKIVKKAGLEISQPALHPNSTEVHHRITVRSRTNVFHRRVYDSRGNMKCSNT  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|XP_002521414.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40904.1| conserved hypothetical protein [Ricinus communis]
Length=358

 Score =   447 bits (1149),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 205/288 (71%), Positives = 239/288 (83%), Gaps = 0/288 (0%)
 Frame = -3

Query  1407  LYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISK  1228
             L RTT+YQ+Q  +ME+K  P  + +DS +       LP GII + SDLE+KPL + S S+
Sbjct  4     LIRTTMYQFQHTQMEAKVHPFGTLKDSALASGLLGGLPVGIIRASSDLEMKPLWSSSSSR  63

Query  1227  SKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAI  1048
              KV+ +   NLLA+PVGI QK NV+ I+QKFL ENFT+ILFHYDG++DGWWDL WSKEAI
Sbjct  64    LKVDTSMRRNLLAIPVGINQKHNVDTIVQKFLPENFTVILFHYDGHLDGWWDLEWSKEAI  123

Query  1047  HIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPA  868
             HIVA +QTKWWFAKRFLHP VVS YDYIFLWDEDLGV++F P RYL IV+SEGLEISQPA
Sbjct  124   HIVAQNQTKWWFAKRFLHPAVVSTYDYIFLWDEDLGVKHFDPGRYLRIVRSEGLEISQPA  183

Query  867   LDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWR  688
             LDP S  IHHRIT+RSRT +FHRRVY  +GSTKCS++SEGPPC+GFVEGMAPVFSR+AW 
Sbjct  184   LDPNSTDIHHRITIRSRTKRFHRRVYDKRGSTKCSDDSEGPPCTGFVEGMAPVFSRAAWY  243

Query  687   CVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++DSEY+VH GIQ+L
Sbjct  244   CAWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVIDSEYIVHQGIQTL  291


 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 32/34 (94%), Gaps = 0/34 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKAS  279
            +IRRQST+ELQIFKERW EAVKED++WVDP++ S
Sbjct  312  EIRRQSTWELQIFKERWNEAVKEDEDWVDPFRGS  345



>emb|CDY12891.1| BnaA09g13830D [Brassica napus]
Length=425

 Score =   449 bits (1155),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 254/342 (74%), Gaps = 7/342 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK   F+ L C  +L   Y+TT  QY+Q + E    P   A++S         L
Sbjct  25    GKLSWKMK--PFMALMCTVLLIFWYKTTNIQYEQTQFEESDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + +  +SK       NLLA+PVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PYGIIQPRSDLELKPLWSSNTLRSKGGKLTNRNLLAIPVGLKQKDNVDALVQKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKAAGLEISQPALHPNSTEVHHRITVRSRTKVFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGSSL--KRASSPQELPKGR---AVDLRVEV  466
             EY+ H GIQ+LGGS    K+ S+   + + R   A D R E+
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSVVNRRRGSPAFDSRTEI  364



>ref|XP_010905352.1| PREDICTED: uncharacterized protein LOC105032557 isoform X2 [Elaeis 
guineensis]
 ref|XP_010905361.1| PREDICTED: uncharacterized protein LOC105032557 isoform X2 [Elaeis 
guineensis]
Length=379

 Score =   447 bits (1149),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 220/347 (63%), Positives = 259/347 (75%), Gaps = 16/347 (5%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYS--AEDSCVTGRSSSSLPRGI  1285
             MK   ++ + CV ML I Y TT +QYQQ E E++S P  S    +S +T      LPRGI
Sbjct  1     MKQKLYLSVLCVVMLCIFYTTTNFQYQQTEFEARSRPFDSDLMTESYMTTSRIGYLPRGI  60

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             + S SD+ELKPL     S+SK     + NLL +PVGIKQK NV+ I+ KFL ENFT+ILF
Sbjct  61    VHSNSDMELKPLWVTKNSESKEPDQSHQNLLGIPVGIKQKKNVDAIVSKFLPENFTVILF  120

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGW DL WS   IHI A +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH
Sbjct  121   HYDGNVDGWHDLHWSNSLIHIAAPNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  180

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYL+I+KSEGLEISQPALDPK   IHHRIT+R +  K HRRV+  +GS  CSN SEGP
Sbjct  181   PGRYLQIMKSEGLEISQPALDPKLSEIHHRITIRRKKGKVHRRVHGTRGSGYCSNASEGP  240

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+G+VEGMAPVFSR+AWRC W+LIQNDL+HGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  241   PCTGWVEGMAPVFSRAAWRCAWYLIQNDLIHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  300

Query  564   HLGIQSLGGSS-----LKRAS--SPQELPK------GRA-VDLRVEV  466
             H G+++LGGSS     ++R S  S + LPK      GR   D R+E+
Sbjct  301   HQGVETLGGSSNEKKAVRRTSGRSKRLLPKATLQMRGRTPFDARIEI  347



>ref|XP_010533870.1| PREDICTED: uncharacterized protein LOC104809554 [Tarenaya hassleriana]
 ref|XP_010533872.1| PREDICTED: uncharacterized protein LOC104809554 [Tarenaya hassleriana]
 ref|XP_010533873.1| PREDICTED: uncharacterized protein LOC104809554 [Tarenaya hassleriana]
Length=414

 Score =   447 bits (1150),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 213/309 (69%), Positives = 242/309 (78%), Gaps = 2/309 (1%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             KMK   F+ + C  +L + Y+TT  QY+Q EME +  PL  A++S         LP GI 
Sbjct  33    KMK--PFMAILCTVLLIVWYKTTNIQYEQTEMEEQDYPLEMAKESEPDNEWLKGLPLGIR  90

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
              SRSDLELKPL + S S+ K       NLLAMPVGI QKDNV+ ++QKFL  NFT+ILFH
Sbjct  91    HSRSDLELKPLWSRSSSRLKEGELTNRNLLAMPVGITQKDNVDTVVQKFLPSNFTVILFH  150

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG +D W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV+NF+P
Sbjct  151   YDGKMDNWSDLVWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVKNFNP  210

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  742
              RYL I+KSEGLEISQPALDP S  IHHRITVRSR+ + HRRVY  +G+ KCSN SEGPP
Sbjct  211   ERYLRIIKSEGLEISQPALDPNSTEIHHRITVRSRSKRVHRRVYDHRGNMKCSNASEGPP  270

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             C+GFVEGMAPVFSR+AW C WHLIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDSEY+ H
Sbjct  271   CTGFVEGMAPVFSRAAWFCTWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGIVDSEYVFH  330

Query  561   LGIQSLGGS  535
              GIQ+LGGS
Sbjct  331   HGIQTLGGS  339



>ref|XP_009113143.1| PREDICTED: uncharacterized protein LOC103838453 [Brassica rapa]
 ref|XP_009113144.1| PREDICTED: uncharacterized protein LOC103838453 [Brassica rapa]
Length=425

 Score =   447 bits (1150),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK   F+ L C  +L   Y+TT  QY+Q + E    P   A++S         L
Sbjct  25    GKLSWKMK--PFMALMCTVLLIFWYKTTNIQYEQTQFEESDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + +  +SK       NLLA+PVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PYGIIQPRSDLELKPLWSSNTLRSKGGKLTNRNLLAIPVGLKQKDNVDALVQKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKAAGLEISQPALHPNSTEVHHRITVRSRTKVFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>emb|CDY40958.1| BnaCnng10010D [Brassica napus]
Length=425

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 217/342 (63%), Positives = 253/342 (74%), Gaps = 7/342 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QY+Q E E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEFEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ ++QKFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSSTLRSKGGELMNRNLLAMPVGLKQKDNVDSLVQKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCS  
Sbjct  203   ENFNPQKYLRIVKAAGLEISQPALHPNSTEVHHRITVRSRTKVFHRRVYDSRGNMKCSIA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGSSL--KRASSPQELPKGR---AVDLRVEV  466
             EY+ H GIQ+LGGS    K+ S+   + + R   A D R E+
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSVVNRRRGSPAFDSRTEI  364



>ref|XP_006392027.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
 ref|XP_006392028.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
 gb|ESQ29313.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
 gb|ESQ29314.1| hypothetical protein EUTSA_v10023474mg [Eutrema salsugineum]
Length=425

 Score =   446 bits (1148),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 211/314 (67%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QYQQ E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYQQTELEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GII+ RSDLELKPL + S  +SK       NLLA+PVG+KQKDNV+ I++KFL  NFT
Sbjct  83    PFGIIQPRSDLELKPLWSSSSLRSKGGELTNRNLLAIPVGLKQKDNVDAIVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL IVKS GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKSAGLEISQPALHPNSTEVHHRITVRSRTKIFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQG R+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGARSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|XP_006417384.1| hypothetical protein EUTSA_v10007686mg [Eutrema salsugineum]
 gb|ESQ35737.1| hypothetical protein EUTSA_v10007686mg [Eutrema salsugineum]
Length=432

 Score =   444 bits (1142),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 248/317 (78%), Gaps = 4/317 (1%)
 Frame = -3

Query  1455  KHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1276
             K   F+ L C  +L   Y+TT  Q++Q E+E    P   A +S         LPRGII+ 
Sbjct  33    KMKPFLALMCTVLLIFWYKTTNIQFEQTELEEADYPFDMATESKTVDEKLKGLPRGIIQP  92

Query  1275  RSDLELKPLKAMSISKSK-VNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
             RSDLELKPL + S  +SK V++T   NLLAMPVGIKQK NV+ I++KFL  NFT++LFHY
Sbjct  93    RSDLELKPLWSSSSLRSKGVDMTN-RNLLAMPVGIKQKVNVDAIVKKFLPANFTVVLFHY  151

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DGN+D WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV+NF P 
Sbjct  152   DGNMDKWWDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVKNFSPE  211

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPC  739
             RYL+IVKS+G EISQPALD  S  IHH+IT+RSRT KFHRRVY ++GS +CSN SE PPC
Sbjct  212   RYLKIVKSQGFEISQPALDSNSTEIHHKITLRSRTKKFHRRVYINRGSKRCSNASEDPPC  271

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
             +GFVEGMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT  VGIVDSEY+ H 
Sbjct  272   TGFVEGMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKKVGIVDSEYIFHQ  331

Query  558   GIQSLGGS--SLKRASS  514
             GIQ+LG S  S K+A++
Sbjct  332   GIQTLGESVHSEKKATA  348


 Score = 52.8 bits (125),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  377  IRRQSTYELQIFKERWEEAVKEDKNWVDP  291
            IRRQST+ELQ FKERW  AV+EDKNW+DP
Sbjct  367  IRRQSTWELQTFKERWNRAVEEDKNWIDP  395



>ref|XP_006301321.1| hypothetical protein CARUB_v10021730mg [Capsella rubella]
 gb|EOA34219.1| hypothetical protein CARUB_v10021730mg [Capsella rubella]
Length=425

 Score =   443 bits (1140),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 216/342 (63%), Positives = 255/342 (75%), Gaps = 7/342 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P RYL+IVKS GLEISQPAL P S  +HHR+TVRSRT KFHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLKIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKKFHRRVYDSRGNMKCSNT  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGSSL--KRASSPQELPKGR---AVDLRVEV  466
             EY+ H GIQ+LGGS    K+ S    + + R   A D R E+
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSGRGGVTRKRGSAAFDSRTEI  364



>ref|XP_010905328.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
 ref|XP_010905337.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
 ref|XP_010905342.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
 ref|XP_010905348.1| PREDICTED: uncharacterized protein LOC105032557 isoform X1 [Elaeis 
guineensis]
Length=382

 Score =   441 bits (1135),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 220/350 (63%), Positives = 259/350 (74%), Gaps = 19/350 (5%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYS--AEDSCVTGRSSSSLPRGI  1285
             MK   ++ + CV ML I Y TT +QYQQ E E++S P  S    +S +T      LPRGI
Sbjct  1     MKQKLYLSVLCVVMLCIFYTTTNFQYQQTEFEARSRPFDSDLMTESYMTTSRIGYLPRGI  60

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQK---FLSENFTI  1114
             + S SD+ELKPL     S+SK     + NLL +PVGIKQK NV+ I+ K   FL ENFT+
Sbjct  61    VHSNSDMELKPLWVTKNSESKEPDQSHQNLLGIPVGIKQKKNVDAIVSKGMQFLPENFTV  120

Query  1113  ILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  934
             ILFHYDGNVDGW DL WS   IHI A +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE
Sbjct  121   ILFHYDGNVDGWHDLHWSNSLIHIAAPNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVE  180

Query  933   NFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNES  754
             NFHP RYL+I+KSEGLEISQPALDPK   IHHRIT+R +  K HRRV+  +GS  CSN S
Sbjct  181   NFHPGRYLQIMKSEGLEISQPALDPKLSEIHHRITIRRKKGKVHRRVHGTRGSGYCSNAS  240

Query  753   EGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSE  574
             EGPPC+G+VEGMAPVFSR+AWRC W+LIQNDL+HGWGMDMKLGYCAQGDRT  VG++DSE
Sbjct  241   EGPPCTGWVEGMAPVFSRAAWRCAWYLIQNDLIHGWGMDMKLGYCAQGDRTKKVGVIDSE  300

Query  573   YLVHLGIQSLGGSS-----LKRAS--SPQELPK------GRA-VDLRVEV  466
             Y+VH G+++LGGSS     ++R S  S + LPK      GR   D R+E+
Sbjct  301   YIVHQGVETLGGSSNEKKAVRRTSGRSKRLLPKATLQMRGRTPFDARIEI  350



>ref|XP_010473328.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
 ref|XP_010473329.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
 ref|XP_010473330.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
 ref|XP_010473331.1| PREDICTED: uncharacterized protein LOC104752789 isoform X1 [Camelina 
sativa]
Length=425

 Score =   442 bits (1136),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 209/314 (67%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|XP_002889853.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66112.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=436

 Score =   442 bits (1136),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 212/336 (63%), Positives = 253/336 (75%), Gaps = 6/336 (2%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             KMK   F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LP GII
Sbjct  33    KMK--PFLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESETVNDKLKVLPHGII  90

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             + RSDLELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFH
Sbjct  91    QPRSDLELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFH  150

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDGN+D WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P
Sbjct  151   YDGNMDKWWDLDWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNP  210

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  742
              RYL IVKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G  +CSN S  PP
Sbjct  211   ERYLRIVKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGHKRCSNTSADPP  270

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             C+GFVEGMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+VH
Sbjct  271   CTGFVEGMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIVH  330

Query  561   LGIQSLGGSSLKRASSPQELPKGR----AVDLRVEV  466
              GIQ+LG S  ++ ++ +++   R      D R E+
Sbjct  331   QGIQTLGESVPEKKTTARDVRPRRHGHTTFDSRTEI  366


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW +AV+ED NW+DP  +S   ++
Sbjct  365  EIRRQSTWELQTFKERWSKAVEEDNNWIDPSSSSSMTKR  403



>ref|XP_010418093.1| PREDICTED: uncharacterized protein LOC104703720 [Camelina sativa]
 ref|XP_010418094.1| PREDICTED: uncharacterized protein LOC104703720 [Camelina sativa]
Length=425

 Score =   441 bits (1133),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MALMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMK+GYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKIGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|XP_010430128.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430129.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430130.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430131.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430132.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430133.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430134.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430135.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430136.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
 ref|XP_010430137.1| PREDICTED: uncharacterized protein LOC104714458 [Camelina sativa]
Length=425

 Score =   441 bits (1133),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 242/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + + C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--MAVMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS YDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSTYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|NP_172583.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AAL77664.1| At1g11170/T28P6_16 [Arabidopsis thaliana]
 gb|AAM70519.1| At1g11170/T28P6_16 [Arabidopsis thaliana]
 gb|AEE28693.1| uncharacterized protein AT1G11170 [Arabidopsis thaliana]
Length=438

 Score =   441 bits (1134),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 206/330 (62%), Positives = 251/330 (76%), Gaps = 4/330 (1%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGII+SRSDL
Sbjct  37    FLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIQSRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL +    +SK       NLLA+PVG+KQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRGSLRSKGVEMTNRNLLAIPVGLKQKGNVDALVKKFLPANFTIVLFHYDGNMD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              WWDL WS ++IHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWWDLEWSSKSIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G  +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSKTKKFHRRVYINRGHKRCSNTSSDPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY++H GIQ+L
Sbjct  277   GMAPVFSKAAWLCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYILHQGIQTL  336

Query  543   GGSSLKRASSPQELPKGR----AVDLRVEV  466
             G S  ++  + +++   R      D R E+
Sbjct  337   GESVPEKKKTARDVGTRRQGHTTFDSRTEI  366



>ref|XP_002888096.1| hypothetical protein ARALYDRAFT_475199 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64355.1| hypothetical protein ARALYDRAFT_475199 [Arabidopsis lyrata subsp. 
lyrata]
Length=425

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 215/342 (63%), Positives = 253/342 (74%), Gaps = 7/342 (2%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--VVLMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P  YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQMYLRIVKTAGLEISQPALHPNSTEVHHRITVRSRTKIFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGSSL--KRASSPQELPKGRA---VDLRVEV  466
             EY+ H GIQ+LGGS    K+ S+   + + R     D R E+
Sbjct  323   EYIFHQGIQTLGGSGYPDKKNSARSRVNRRRGSATFDSRTEI  364



>ref|NP_176319.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974064.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001077754.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001117527.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42054.1| unknown protein [Arabidopsis thaliana]
 gb|ABG48406.1| At1g61240 [Arabidopsis thaliana]
 gb|AEE33807.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
 gb|AEE33808.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
 gb|AEE33809.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
 gb|AEE33810.1| uncharacterized protein AT1G61240 [Arabidopsis thaliana]
Length=425

 Score =   439 bits (1129),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/314 (66%), Positives = 243/314 (77%), Gaps = 2/314 (1%)
 Frame = -3

Query  1476  GTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSL  1297
             G    KMK +  + L C  +L   Y+TT  QY+Q E+E    P   A++S         L
Sbjct  25    GKSSWKMKPV--VVLMCTVLLIFWYKTTNIQYEQTEIEETDYPFEMAKESEPVSEKLKGL  82

Query  1296  PRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFT  1117
             P GI++ +SDLELKPL + S  +SK       NLLAMPVG+KQKDNV+ +++KFL  NFT
Sbjct  83    PFGIMQPKSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDNVDAVVKKFLPANFT  142

Query  1116  IILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGV  937
             +ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VSIYDY+FLWDEDLGV
Sbjct  143   VILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVSIYDYVFLWDEDLGV  202

Query  936   ENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNE  757
             ENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHRRVY  +G+ KCSN 
Sbjct  203   ENFNPQKYLRIVKTAGLEISQPALHPNSTEVHHRITVRSRTKIFHRRVYDSRGNMKCSNA  262

Query  756   SEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDS  577
             SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYCAQGDR+  VGIVDS
Sbjct  263   SEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRSKKVGIVDS  322

Query  576   EYLVHLGIQSLGGS  535
             EY+ H GIQ+LGGS
Sbjct  323   EYIFHQGIQTLGGS  336



>ref|XP_006307555.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
 gb|EOA40453.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
Length=368

 Score =   436 bits (1122),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/337 (63%), Positives = 249/337 (74%), Gaps = 5/337 (1%)
 Frame = -3

Query  1455  KHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1276
             K   F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGIIE 
Sbjct  33    KMKPFLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIEP  92

Query  1275  RSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYD  1096
             RSDLELKPL + S  +SK       NLLA+ VGIKQK NVN I++KFL  NFTI+LFHYD
Sbjct  93    RSDLELKPLWSRSSLRSKGVEMTNRNLLAISVGIKQKGNVNAIVKKFLPANFTIVLFHYD  152

Query  1095  GNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPAR  916
             GN+D W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P R
Sbjct  153   GNMDKWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPER  212

Query  915   YLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCS  736
             YL+IVKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY  +G+ +CSN S  PPC+
Sbjct  213   YLKIVKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYIKRGTKRCSNSSADPPCT  272

Query  735   GFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLG  556
             GFVEGMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H G
Sbjct  273   GFVEGMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQG  332

Query  555   IQSLGGSSLKRASSPQELPKGRAVDLRVEVG*CGHYY  445
             IQ+LG S       P++    R V  +V +    H++
Sbjct  333   IQTLGES-----VHPEKKTTSRNVGTKVSLIVRFHFF  364



>ref|XP_008809916.1| PREDICTED: uncharacterized protein LOC103721469 [Phoenix dactylifera]
 ref|XP_008809917.1| PREDICTED: uncharacterized protein LOC103721469 [Phoenix dactylifera]
Length=379

 Score =   436 bits (1122),  Expect = 3e-145, Method: Compositional matrix adjust.
 Identities = 218/347 (63%), Positives = 256/347 (74%), Gaps = 16/347 (5%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYS--AEDSCVTGRSSSSLPRGI  1285
             MK   ++ +  V ML I Y TT +QYQQ E E++S P  S    +S +T      LPRGI
Sbjct  1     MKQKLYLSVLSVVMLCIFYTTTNFQYQQTEFEARSHPFDSDLLMESDMTTSRIGYLPRGI  60

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             + S SD+ELKPL     S SK     + NLLA+PVGIKQK NV+ I+ KFL ENFT+ILF
Sbjct  61    VHSNSDMELKPLWVTKNSGSKELDQSHQNLLAIPVGIKQKKNVDAIVLKFLPENFTVILF  120

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGW DL WS   IHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGV NFH
Sbjct  121   HYDGNVDGWHDLHWSNSVIHIAAPNQTKWWFAKRFLHPDVVSTYDYIFLWDEDLGVANFH  180

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYL+I+KSEGLEISQPALDPK   IHHRIT+R +  K HRRVY  +GS  CS+ SEGP
Sbjct  181   PGRYLQIMKSEGLEISQPALDPKLSEIHHRITIRRKKGKVHRRVYGTRGSGYCSSASEGP  240

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+G+VEGMAPVFSR+AWRC W+LIQNDL+HGWGMDMKLGYCAQGDRT  VG++DSEY+V
Sbjct  241   PCTGWVEGMAPVFSRAAWRCAWYLIQNDLIHGWGMDMKLGYCAQGDRTKKVGVIDSEYIV  300

Query  564   HLGIQSLGGSS-----LKRAS--SPQELPK------GRA-VDLRVEV  466
             H G+++LGGSS     + RAS  S + +PK      GR   D R+E+
Sbjct  301   HQGVETLGGSSSEKKAVGRASGRSKRLIPKATLQKRGRTPFDARIEI  347



>ref|XP_006307556.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
 gb|EOA40454.1| hypothetical protein CARUB_v10009178mg [Capsella rubella]
Length=438

 Score =   437 bits (1125),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 206/303 (68%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGIIE RSDL
Sbjct  37    FLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIEPRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+ VGIKQK NVN I++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRSSLRSKGVEMTNRNLLAISVGIKQKGNVNAIVKKFLPANFTIVLFHYDGNMD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY  +G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYIKRGTKRCSNSSADPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  543   GGS  535
             G S
Sbjct  337   GES  339


 Score = 58.2 bits (139),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW +AV+EDKNW+DP  AS    K
Sbjct  366  EIRRQSTWELQTFKERWNKAVEEDKNWIDPSAASSSMTK  404



>emb|CDY20982.1| BnaA08g25430D [Brassica napus]
Length=398

 Score =   434 bits (1116),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 206/303 (68%), Positives = 236/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q++  ++E    P+  A++S    +    LPRGII+ RSDL
Sbjct  33    FLALICTALLIFWYKTTHIQFEDTDLEESDYPIDMAKESEPVDQKLKGLPRGIIQPRSDL  92

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + SI  SK       NLLA+PVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  93    ELKPLWSSSILSSKGVEMATRNLLAIPVGIKQKSNVDAIVKKFLPANFTVVLFHYDGNMD  152

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA  QTKWWFAKRFLHPDVVSIYDYIF+WDEDLGVENF P  YLEI
Sbjct  153   QWLDLEWSSKAIHIVAQDQTKWWFAKRFLHPDVVSIYDYIFIWDEDLGVENFSPESYLEI  212

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKSEGLEISQPALD  S GIHH+ITVRS T  FHRRVY  KG+ KCSN S  PPC+GFVE
Sbjct  213   VKSEGLEISQPALDSNSSGIHHKITVRSSTEIFHRRVYISKGNRKCSNASVDPPCTGFVE  272

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  273   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  332

Query  543   GGS  535
             G S
Sbjct  333   GES  335



>ref|XP_010458502.1| PREDICTED: uncharacterized protein LOC104739751 isoform X3 [Camelina 
sativa]
Length=406

 Score =   434 bits (1117),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q++Q E+E    P   A +S         LP+GII+ RSDL
Sbjct  4     FIALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMATESEAVNDKLKGLPQGIIQPRSDL  63

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  64    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  123

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  124   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  183

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  184   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  243

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  244   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  303

Query  543   GGS  535
             G S
Sbjct  304   GES  306


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV EDKNW+DP  +S    K
Sbjct  333  EIRRQSTWELQTFKERWNRAVDEDKNWIDPSASSSMTTK  371



>gb|KDO75810.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=332

 Score =   431 bits (1109),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 229/284 (81%), Gaps = 0/284 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  613
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQ
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQ  306



>ref|XP_006449261.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62501.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=383

 Score =   433 bits (1114),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 213/340 (63%), Positives = 245/340 (72%), Gaps = 29/340 (9%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHR                  
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHR------------------  244

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
                 FVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDRT NVGI+DSEY+V
Sbjct  245   ----FVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIIDSEYVV  300

Query  564   HLGIQSLGGSSLKRAS----SPQELPKGRA---VDLRVEV  466
             H GIQ+LGG    R S      +EL K      VDLR E+
Sbjct  301   HQGIQTLGGQRPTRKSLQSTKREELAKRHGPAPVDLRAEI  340


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/31 (71%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST ELQIFK+RW EA+++DK+WVDP+
Sbjct  339  EIRRQSTMELQIFKKRWNEAIEQDKSWVDPF  369



>ref|XP_010458500.1| PREDICTED: uncharacterized protein LOC104739751 isoform X1 [Camelina 
sativa]
Length=439

 Score =   435 bits (1118),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q++Q E+E    P   A +S         LP+GII+ RSDL
Sbjct  37    FIALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMATESEAVNDKLKGLPQGIIQPRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  97    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  543   GGS  535
             G S
Sbjct  337   GES  339


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV EDKNW+DP  +S    K
Sbjct  366  EIRRQSTWELQTFKERWNRAVDEDKNWIDPSASSSMTTK  404



>ref|XP_010492461.1| PREDICTED: uncharacterized protein LOC104769846 isoform X1 [Camelina 
sativa]
 ref|XP_010492470.1| PREDICTED: uncharacterized protein LOC104769846 isoform X1 [Camelina 
sativa]
Length=437

 Score =   435 bits (1118),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 239/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q+++ E+E    P   A +S         LP+GII+ RSDL
Sbjct  37    FIALMCTALLIFWYKTTNIQFERTEIEETDYPFDMATESEGIDNKLKGLPQGIIQPRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  97    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNMD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DLAWS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  157   KWRDLAWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  217   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  277   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  336

Query  543   GGS  535
             G S
Sbjct  337   GES  339


 Score = 56.2 bits (134),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV+EDKNW+DP  +S    K
Sbjct  366  EIRRQSTWELQTFKERWNRAVEEDKNWIDPSASSSMATK  404



>ref|XP_006449264.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
 gb|ESR62504.1| hypothetical protein CICLE_v10015451mg [Citrus clementina]
Length=347

 Score =   431 bits (1109),  Expect = 9e-144, Method: Compositional matrix adjust.
 Identities = 198/284 (70%), Positives = 228/284 (80%), Gaps = 0/284 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S        SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFFSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNTSEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  613
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQ
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHGWGMDMKLGYCAQ  306



>ref|XP_010492476.1| PREDICTED: uncharacterized protein LOC104769846 isoform X2 [Camelina 
sativa]
 ref|XP_010492484.1| PREDICTED: uncharacterized protein LOC104769846 isoform X2 [Camelina 
sativa]
Length=404

 Score =   433 bits (1114),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 239/303 (79%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q+++ E+E    P   A +S         LP+GII+ RSDL
Sbjct  4     FIALMCTALLIFWYKTTNIQFERTEIEETDYPFDMATESEGIDNKLKGLPQGIIQPRSDL  63

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN+D
Sbjct  64    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNMD  123

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DLAWS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  124   KWRDLAWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  183

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  184   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  243

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  244   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  303

Query  543   GGS  535
             G S
Sbjct  304   GES  306


 Score = 55.8 bits (133),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV+EDKNW+DP  +S    K
Sbjct  333  EIRRQSTWELQTFKERWNRAVEEDKNWIDPSASSSMATK  371



>emb|CDY20585.1| BnaC08g14730D [Brassica napus]
Length=431

 Score =   434 bits (1116),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/303 (68%), Positives = 237/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q++  ++E    P+  A++S    +    LPRGIIE R+DL
Sbjct  33    FLALICTALLIFWYKTTHIQFEDTDLEESDYPIDMAKESEPVDQKLKGLPRGIIEPRTDL  92

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  93    ELKPLWSSSSLRSKGVEMTNRNLLAIPVGIKQKSNVDAIVKKFLPANFTVVLFHYDGNMD  152

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA  QTKWWFAKRFLHPDVVSIYDYIF+WDEDLGVENF P RYLEI
Sbjct  153   QWLDLEWSSKAIHIVAQDQTKWWFAKRFLHPDVVSIYDYIFIWDEDLGVENFSPERYLEI  212

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKSEGLEISQPALD  S GIHH+ITVRS +  FHRRVY  KG+ KCSN S  PPC+GFVE
Sbjct  213   VKSEGLEISQPALDSNSSGIHHKITVRSSSEIFHRRVYISKGNRKCSNASVDPPCTGFVE  272

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  273   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  332

Query  543   GGS  535
             G S
Sbjct  333   GES  335



>emb|CDY19346.1| BnaC05g08550D [Brassica napus]
Length=433

 Score =   434 bits (1115),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 205/324 (63%), Positives = 243/324 (75%), Gaps = 7/324 (2%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   YRTT  Q+++ E+E    P   A +S         LPRGI++ RSDL
Sbjct  37    FLALICTALLIFWYRTTNIQFEETELEEADYPFDMAMESEPVDAKLKGLPRGILQPRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + +  ++K       NLLA+PVGIKQK NV+ +++KFL  NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSNSLRAKGVEMTNRNLLAVPVGIKQKGNVDAMVKKFLPANFTVVLFHYDGNMD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGVENF P RYL+I
Sbjct  157   KWWDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVENFTPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VK EGLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G+ KCSN SE PPC+GFVE
Sbjct  217   VKVEGLEISQPALDRNSTEIHHKITLRSKTKKFHRRVYINRGTKKCSNTSEDPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR   VGIVD EY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRKMKVGIVDREYIFHQGIQTL  336

Query  543   GGSSLKRASSPQELPKGRAVDLRV  472
             G        S Q   K RA D+R 
Sbjct  337   G-------ESVQSDKKTRARDVRT  353



>gb|KDP20910.1| hypothetical protein JCGZ_21381 [Jatropha curcas]
Length=349

 Score =   430 bits (1105),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 206/306 (67%), Positives = 240/306 (78%), Gaps = 5/306 (2%)
 Frame = -3

Query  1368  MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLA  1189
             ME K  P  +  +S +     + LP GI+ + SDLELKPL + S S+SKV+      LLA
Sbjct  1     MEEKMHPFDTLTESALATGLLAGLPAGIVRATSDLELKPLWSSSNSRSKVDTRSSRYLLA  60

Query  1188  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  1009
             +PVGI+QK NV+ ++QKFL ENFT+ILFHYDGN+DGWWDL WS +AIHIVA +QTKWWFA
Sbjct  61    VPVGIRQKHNVDAMVQKFLPENFTVILFHYDGNMDGWWDLNWSDKAIHIVAQNQTKWWFA  120

Query  1008  KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRIT  829
             KRFLHP VVSIYDY+FLWDEDLGVE F P RYLEIVKS GLEISQPAL P S GIHHRIT
Sbjct  121   KRFLHPAVVSIYDYVFLWDEDLGVEKFDPRRYLEIVKSRGLEISQPALGPNSTGIHHRIT  180

Query  828   VRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  649
             +RSR+ ++H RVY  +GSTKCS+ S+GPPC+GFVEGMAPVFSRSAW C WHLIQNDLVHG
Sbjct  181   IRSRSKEYHTRVYDHRGSTKCSDVSQGPPCTGFVEGMAPVFSRSAWYCAWHLIQNDLVHG  240

Query  648   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL--GGSSLKRASSPQELPK---GRAV  484
             WGMDMKLGYCAQGDRT  VGIVD EY+VH GIQ+L  GGS  K+ S+ +EL K       
Sbjct  241   WGMDMKLGYCAQGDRTKKVGIVDREYIVHQGIQTLGGGGSPTKKGSNSEELTKRHGASVT  300

Query  483   DLRVEV  466
             D R+E+
Sbjct  301   DPRMEI  306


 Score = 56.6 bits (135),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -1

Query  383  IQIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQ  276
            ++IRRQST+ELQIFKERW +AV  D++W DP+K S+
Sbjct  304  MEIRRQSTWELQIFKERWNKAVNGDRHWFDPFKGSE  339



>ref|XP_010458503.1| PREDICTED: uncharacterized protein LOC104739751 isoform X4 [Camelina 
sativa]
Length=404

 Score =   429 bits (1104),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 238/303 (79%), Gaps = 2/303 (1%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q++Q E+E    P +  E   V  +    LP+GII+ RSDL
Sbjct  4     FIALMCTALLIFWYKTTNIQFEQTEIEETDYP-FDMESEAVNDKLKG-LPQGIIQPRSDL  61

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  62    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  121

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  122   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  181

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  182   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  241

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  242   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  301

Query  543   GGS  535
             G S
Sbjct  302   GES  304


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV EDKNW+DP  +S    K
Sbjct  331  EIRRQSTWELQTFKERWNRAVDEDKNWIDPSASSSMTTK  369



>ref|XP_010458501.1| PREDICTED: uncharacterized protein LOC104739751 isoform X2 [Camelina 
sativa]
Length=437

 Score =   431 bits (1107),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 238/303 (79%), Gaps = 2/303 (1%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q++Q E+E    P +  E   V  +    LP+GII+ RSDL
Sbjct  37    FIALMCTALLIFWYKTTNIQFEQTEIEETDYP-FDMESEAVNDKLKG-LPQGIIQPRSDL  94

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDGN D
Sbjct  95    ELKPLWSRSSVRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGNTD  154

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  155   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  214

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  215   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  274

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  275   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  334

Query  543   GGS  535
             G S
Sbjct  335   GES  337


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV EDKNW+DP  +S    K
Sbjct  364  EIRRQSTWELQTFKERWNRAVDEDKNWIDPSASSSMTTK  402



>ref|XP_010278338.1| PREDICTED: uncharacterized protein LOC104612579 isoform X4 [Nelumbo 
nucifera]
Length=307

 Score =   424 bits (1091),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 240/305 (79%), Gaps = 6/305 (2%)
 Frame = -3

Query  1368  MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLA  1189
             ME++  P    ++S         LPRGI++S SD+E++PL   S SK KVN+    +LLA
Sbjct  1     MEARLHPFADVKESQEDSMKVDYLPRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLA  60

Query  1188  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  1009
             +P GIKQK  V+ I+QKF+SENFT++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFA
Sbjct  61    IPAGIKQKRYVDAIVQKFVSENFTVVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFA  120

Query  1008  KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRIT  829
             KRFLHPDVVS+YDYIFLWDEDL V+NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT
Sbjct  121   KRFLHPDVVSVYDYIFLWDEDLRVDNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRIT  180

Query  828   VRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  649
             +R ++   HRRVY  +GS KCS+ S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHG
Sbjct  181   IRKKSKILHRRVYDRRGSVKCSDASQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHG  240

Query  648   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLK------RASSPQELPKGRA  487
             WGMDMKLGYCAQGDRT  VG++DSE++VH GIQ+LGGSS +      R ++  ++ +   
Sbjct  241   WGMDMKLGYCAQGDRTKKVGVIDSEFIVHKGIQTLGGSSARKVSKDIRGNNSMQIRRQST  300

Query  486   VDLRV  472
             +DLR+
Sbjct  301   LDLRI  305



>gb|KEH31135.1| lysine ketoglutarate reductase trans-splicing-related protein, 
putative [Medicago truncatula]
Length=734

 Score =   439 bits (1130),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 216/336 (64%), Positives = 253/336 (75%), Gaps = 22/336 (7%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             +K+K + F+ + C+ MLF+LYRT  YQY+Q E+       YS     + G     LPRGI
Sbjct  386   LKIKRLPFMAVACIVMLFVLYRTLKYQYKQEEIR------YSTHFEELKG-----LPRGI  434

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             I + SD EL+PL   S  +SKV+V    NLLA+ VGIKQK NV+ ++QKFL+ NFTIILF
Sbjct  435   IHTTSDFELRPLWLRS--RSKVSVYTKRNLLAVAVGIKQKYNVDAMVQKFLTGNFTIILF  492

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYD NVDGW DL WS + IHI A  QTKWWFAKRFLHPD+V IYDYIFLWDEDL VENF 
Sbjct  493   HYDANVDGWQDLDWSSKVIHIAAKKQTKWWFAKRFLHPDIVYIYDYIFLWDEDLEVENFS  552

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P+RY++IV+ EGLEISQPAL P S  IHHRITVR+RT K HRRVY+ +G TKCS+ES+GP
Sbjct  553   PSRYVKIVREEGLEISQPALHPNSTEIHHRITVRARTKKVHRRVYERRGKTKCSDESDGP  612

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWGMDMKLGYCAQGDR+ NVG+VDSEY+ 
Sbjct  613   PCTGFVEGMAPVFSRSAWFCTWHLIQNDLVHGWGMDMKLGYCAQGDRSQNVGVVDSEYVF  672

Query  564   HLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEV  466
             H  I +LGGSS   +KR  SP       AVD R E+
Sbjct  673   HKAIPTLGGSSHYIIKRRGSPP------AVDPRTEI  702



>ref|XP_010278337.1| PREDICTED: uncharacterized protein LOC104612579 isoform X3 [Nelumbo 
nucifera]
Length=319

 Score =   425 bits (1092),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 197/305 (65%), Positives = 240/305 (79%), Gaps = 6/305 (2%)
 Frame = -3

Query  1368  MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLA  1189
             ME++  P    ++S         LPRGI++S SD+E++PL   S SK KVN+    +LLA
Sbjct  13    MEARLHPFADVKESQEDSMKVDYLPRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLA  72

Query  1188  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  1009
             +P GIKQK  V+ I+QKF+SENFT++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFA
Sbjct  73    IPAGIKQKRYVDAIVQKFVSENFTVVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFA  132

Query  1008  KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRIT  829
             KRFLHPDVVS+YDYIFLWDEDL V+NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT
Sbjct  133   KRFLHPDVVSVYDYIFLWDEDLRVDNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRIT  192

Query  828   VRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHG  649
             +R ++   HRRVY  +GS KCS+ S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHG
Sbjct  193   IRKKSKILHRRVYDRRGSVKCSDASQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHG  252

Query  648   WGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLK------RASSPQELPKGRA  487
             WGMDMKLGYCAQGDRT  VG++DSE++VH GIQ+LGGSS +      R ++  ++ +   
Sbjct  253   WGMDMKLGYCAQGDRTKKVGVIDSEFIVHKGIQTLGGSSARKVSKDIRGNNSMQIRRQST  312

Query  486   VDLRV  472
             +DLR+
Sbjct  313   LDLRI  317



>emb|CDX97937.1| BnaA06g06880D [Brassica napus]
Length=433

 Score =   429 bits (1103),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 236/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q+++ E+E    P   A +S         LPRGI++ RSDL
Sbjct  37    FLLLMCTALLIFWYKTTNIQFEETELEEADYPFDMAVESEPVDEKLKGLPRGILQPRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + +  ++K       NLLA+PVGIKQK NV+ +++KFL  NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSNSLRAKGVEMTNRNLLAVPVGIKQKGNVDAMVKKFLPANFTVVLFHYDGNMD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              WWDL WS  AIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGVENF P RYL+I
Sbjct  157   KWWDLEWSSRAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVENFTPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VK+EGLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G+ KCSN SE PPC+GFVE
Sbjct  217   VKAEGLEISQPALDRNSTEIHHKITLRSKTKKFHRRVYINRGTKKCSNTSEDPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR   VGIVD EY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRKMKVGIVDREYIFHQGIQTL  336

Query  543   GGS  535
             G S
Sbjct  337   GES  339



>ref|XP_009148446.1| PREDICTED: uncharacterized protein LOC103871881 [Brassica rapa]
 ref|XP_009148447.1| PREDICTED: uncharacterized protein LOC103871881 [Brassica rapa]
 ref|XP_009148448.1| PREDICTED: uncharacterized protein LOC103871881 [Brassica rapa]
Length=433

 Score =   429 bits (1102),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 198/303 (65%), Positives = 236/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q+++ E+E    P   A +S         LPRGI++ RSDL
Sbjct  37    FLLLMCTALLIFWYKTTNIQFEETELEEADYPFDMAVESEPVDEKLKGLPRGILQPRSDL  96

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + +  ++K       NLLA+PVGIKQK NV+ +++KF   NFT++LFHYDGN+D
Sbjct  97    ELKPLWSSNSLRAKGVEMTNRNLLAVPVGIKQKGNVDAMVKKFRPANFTVVLFHYDGNMD  156

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              WWDL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDY+FLWDEDLGVENF P RYL+I
Sbjct  157   KWWDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYVFLWDEDLGVENFTPERYLKI  216

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VK+EGLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ KCSN SE PPC+GFVE
Sbjct  217   VKAEGLEISQPALDRNSTEIHHKITLRSRTKKFHRRVYINRGTKKCSNTSEDPPCTGFVE  276

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDR   VGIVD EY+ H GIQ+L
Sbjct  277   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRKMKVGIVDREYIFHQGIQTL  336

Query  543   GGS  535
             G S
Sbjct  337   GES  339



>ref|XP_009110741.1| PREDICTED: uncharacterized protein LOC103836245 [Brassica rapa]
Length=398

 Score =   427 bits (1098),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 204/303 (67%), Positives = 234/303 (77%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             F+ L C ++L   Y+TT  Q++  ++E    P+   ++S    +    LPRGII+ RSDL
Sbjct  33    FLALICTALLIFWYKTTHIQFEDTDLEESDYPIDMTKESEPVDQKLEGLPRGIIQPRSDL  92

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S   SK       NLLA+PVGIKQK NV+ I++KFL  NFT++LFHYDGN+D
Sbjct  93    ELKPLWSSSSLSSKGVEMATRNLLAIPVGIKQKSNVDAIVKKFLPANFTVVLFHYDGNMD  152

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA  QTKWWFAKRFLHPDVVSIYDYIF+WDEDLGVENF P  YLEI
Sbjct  153   QWLDLEWSSKAIHIVAQDQTKWWFAKRFLHPDVVSIYDYIFIWDEDLGVENFSPESYLEI  212

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKSEGLEISQPALD  S GIHH+ITVRS T  FHRRVY  KG+ KCSN S  PPC+GFVE
Sbjct  213   VKSEGLEISQPALDSNSSGIHHKITVRSSTEIFHRRVYISKGNRKCSNASVDPPCTGFVE  272

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFSR+AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  273   GMAPVFSRAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  332

Query  543   GGS  535
             G S
Sbjct  333   GES  335



>ref|XP_010476020.1| PREDICTED: uncharacterized protein LOC104755357 isoform X1 [Camelina 
sativa]
 ref|XP_010476021.1| PREDICTED: uncharacterized protein LOC104755357 isoform X1 [Camelina 
sativa]
 ref|XP_010476023.1| PREDICTED: uncharacterized protein LOC104755357 isoform X1 [Camelina 
sativa]
Length=437

 Score =   428 bits (1101),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 203/307 (66%), Positives = 237/307 (77%), Gaps = 0/307 (0%)
 Frame = -3

Query  1455  KHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1276
             K   FI L C ++L   Y+TT  Q++Q  +E    P   A +S         LP+GII+ 
Sbjct  33    KMKPFIALICTALLIFWYKTTNIQFEQTAIEETDYPFDMATESEGVDNKLKGLPQGIIQP  92

Query  1275  RSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYD  1096
             RSDLELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYD
Sbjct  93    RSDLELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYD  152

Query  1095  GNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPAR  916
             G +D W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P R
Sbjct  153   GIMDKWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPER  212

Query  915   YLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCS  736
             YL+IVKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+
Sbjct  213   YLKIVKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCT  272

Query  735   GFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLG  556
             GFVEGMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H G
Sbjct  273   GFVEGMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQG  332

Query  555   IQSLGGS  535
             IQ+LG S
Sbjct  333   IQTLGES  339


 Score = 55.8 bits (133),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV EDKNW+DP  +S    K
Sbjct  366  EIRRQSTWELQTFKERWNRAVDEDKNWIDPSASSSMTTK  404



>ref|XP_010476024.1| PREDICTED: uncharacterized protein LOC104755357 isoform X2 [Camelina 
sativa]
Length=404

 Score =   427 bits (1097),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 202/303 (67%), Positives = 236/303 (78%), Gaps = 0/303 (0%)
 Frame = -3

Query  1443  FIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             FI L C ++L   Y+TT  Q++Q  +E    P   A +S         LP+GII+ RSDL
Sbjct  4     FIALICTALLIFWYKTTNIQFEQTAIEETDYPFDMATESEGVDNKLKGLPQGIIQPRSDL  63

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL + S  +SK       NLLA+PVGIKQK NV+ +++KFL  NFTI+LFHYDG +D
Sbjct  64    ELKPLWSRSSLRSKGVEMTNRNLLAIPVGIKQKGNVDALVKKFLPANFTIVLFHYDGIMD  123

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W DL WS +AIHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P RYL+I
Sbjct  124   KWRDLEWSSKAIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPERYLKI  183

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKS GLEISQPALD  S  IHH+IT+RSRT KFHRRVY ++G+ +CSN S  PPC+GFVE
Sbjct  184   VKSVGLEISQPALDHNSTEIHHKITLRSRTKKFHRRVYINRGTKRCSNTSADPPCTGFVE  243

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQGDRT NVGIVDSEY+ H GIQ+L
Sbjct  244   GMAPVFSKAAWFCTWNLIQNDLVHGWGMDMKLGYCAQGDRTKNVGIVDSEYIFHQGIQTL  303

Query  543   GGS  535
             G S
Sbjct  304   GES  306


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQRYRK  264
            +IRRQST+ELQ FKERW  AV EDKNW+DP  +S    K
Sbjct  333  EIRRQSTWELQTFKERWNRAVDEDKNWIDPSASSSMTTK  371



>gb|ABK25584.1| unknown [Picea sitchensis]
Length=441

 Score =   427 bits (1098),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 210/373 (56%), Positives = 264/373 (71%), Gaps = 38/373 (10%)
 Frame = -3

Query  1482  LEGTCRVKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG----  1315
             + G+  +++K +  +G+  V MLF++  T   QY+Q   E +  P  SA++S +T     
Sbjct  25    VSGSKGLRIKTIPSLGILTVLMLFLIAMTMKEQYEQTRAEGRWQPFDSAKNSNLTASNHR  84

Query  1314  ----------------------RSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTG--  1207
                                   +   SLPRGI++  SDLELKPL       S++  TG  
Sbjct  85    KYLSKNLQEEWRITDQLNTDNKKGIESLPRGIVQETSDLELKPL----WRNSRIKDTGKQ  140

Query  1206  YHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQ  1027
             + NL+AM +GIKQK NVN I+QKFLS NF+IILFHYDGNVDGW DL WS++ +HI A +Q
Sbjct  141   HRNLMAMTIGIKQKANVNLIVQKFLSANFSIILFHYDGNVDGWNDLEWSRKTVHIGAQNQ  200

Query  1026  TKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIG  847
             TKWWFAKRFLHP VVS+YDYIF+WDEDLGVENFHP RYL I+K+EGLEISQPALDPKS  
Sbjct  201   TKWWFAKRFLHPAVVSVYDYIFIWDEDLGVENFHPGRYLRIMKAEGLEISQPALDPKSSE  260

Query  846   IHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQ  667
             IHHRIT+R++T + HRR+Y  +GST CS  S GPPC+G+VEGMAPVF+R+AW+C WHLIQ
Sbjct  261   IHHRITIRNKTRRVHRRLYNLRGSTNCSATSIGPPCTGWVEGMAPVFTRAAWQCAWHLIQ  320

Query  666   NDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS---SPQELPK  496
             NDL+HGWGMDMKLGYCAQGD T NVG++DSEY+VH G+QSLGG S  ++S   SP +   
Sbjct  321   NDLIHGWGMDMKLGYCAQGDHTKNVGVIDSEYIVHQGLQSLGGPSANKSSVAVSPSQRSV  380

Query  495   GRA---VDLRVEV  466
              +A   VD R E+
Sbjct  381   TKAASEVDPRSEI  393


 Score = 52.0 bits (123),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 5/45 (11%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY-----KASQRYRKT  261
            +IRRQS  EL IF+ RW+ AV+EDKNWVDP+     K S  Y+K+
Sbjct  392  EIRRQSVAELTIFRRRWQRAVEEDKNWVDPFEDLRKKKSHLYKKS  436



>ref|XP_010278339.1| PREDICTED: uncharacterized protein LOC104612579 isoform X5 [Nelumbo 
nucifera]
Length=299

 Score =   421 bits (1081),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 193/282 (68%), Positives = 232/282 (82%), Gaps = 6/282 (2%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LPRGI++S SD+E++PL   S SK KVN+    +LLA+P GIKQK  V+ I+QKF+SENF
Sbjct  16    LPRGIVQSSSDMEMRPLWLTSWSKLKVNIPNNKSLLAIPAGIKQKRYVDAIVQKFVSENF  75

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             T++LFHYDGNVDGW DL WS  AIHIVA +QTKWWFAKRFLHPDVVS+YDYIFLWDEDL 
Sbjct  76    TVVLFHYDGNVDGWLDLEWSNNAIHIVAQNQTKWWFAKRFLHPDVVSVYDYIFLWDEDLR  135

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  760
             V+NFHP RYL+IVKSEGLEISQPALDPKS  I+HRIT+R ++   HRRVY  +GS KCS+
Sbjct  136   VDNFHPGRYLKIVKSEGLEISQPALDPKSSDIYHRITIRKKSKILHRRVYDRRGSVKCSD  195

Query  759   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  580
              S+ PPC+G+VEGM PVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRT  VG++D
Sbjct  196   ASQEPPCTGWVEGMTPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTKKVGVID  255

Query  579   SEYLVHLGIQSLGGSSLK------RASSPQELPKGRAVDLRV  472
             SE++VH GIQ+LGGSS +      R ++  ++ +   +DLR+
Sbjct  256   SEFIVHKGIQTLGGSSARKVSKDIRGNNSMQIRRQSTLDLRI  297



>ref|XP_007148221.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
 gb|ESW20215.1| hypothetical protein PHAVU_006G190100g [Phaseolus vulgaris]
Length=341

 Score =   420 bits (1080),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 200/281 (71%), Positives = 236/281 (84%), Gaps = 3/281 (1%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LPRGII + SDLEL+PL + S S+SK +V+   NLLA+PVGIKQK NV+ ++QKFL ENF
Sbjct  14    LPRGIIHADSDLELRPLWSRSSSRSKASVSSNRNLLAVPVGIKQKQNVDVMVQKFLRENF  73

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             TIILFHYDG VDGW +L WS +AIHIVA +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLG
Sbjct  74    TIILFHYDGTVDGWLNLGWSSQAIHIVAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLG  133

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  760
             VE+F P+RY+EI+K EGLEISQPALDP S  IHHRIT+R+RT KFHRRVY+ +GST+CS+
Sbjct  134   VEHFSPSRYVEIIKQEGLEISQPALDPNSTEIHHRITIRARTKKFHRRVYERRGSTRCSD  193

Query  759   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  580
              SEGPPC+GFVEGMAPVFSR+AW C WHLIQNDLVHGWG+DMKLGYCAQGDRT NVG+VD
Sbjct  194   SSEGPPCTGFVEGMAPVFSRAAWYCTWHLIQNDLVHGWGVDMKLGYCAQGDRTKNVGVVD  253

Query  579   SEYLVHLGIQSLGGSS---LKRASSPQELPKGRAVDLRVEV  466
             SEY+ H GIQ+LGGS     K ++   +   G  +D+R E+
Sbjct  254   SEYVFHKGIQTLGGSGHRMTKVSNLHSKRQSGTGIDVRTEI  294


 Score = 59.3 bits (142),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 32/36 (89%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST+E ++FKERW EA+ +DKNWVDP+K+ QR
Sbjct  293  EIRRQSTWEFEMFKERWNEAISQDKNWVDPFKSDQR  328



>ref|XP_010473332.1| PREDICTED: uncharacterized protein LOC104752789 isoform X2 [Camelina 
sativa]
Length=358

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 193/268 (72%), Positives = 220/268 (82%), Gaps = 0/268 (0%)
 Frame = -3

Query  1338  AEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDN  1159
             A++S         LP GI++ RSDLELKPL + S  +SK       NLLAMPVG+KQKDN
Sbjct  2     AKESEPVSEKLKGLPFGIMQPRSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDN  61

Query  1158  VNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVS  979
             V+ +++KFL  NFT+ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS
Sbjct  62    VDAVVKKFLPANFTVILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVS  121

Query  978   IYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHR  799
              YDY+FLWDEDLGVENF+P RYL IVKS GLEISQPAL P S  +HHR+TVRSRT  FHR
Sbjct  122   TYDYVFLWDEDLGVENFNPQRYLRIVKSAGLEISQPALHPNSTEVHHRLTVRSRTKTFHR  181

Query  798   RVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYC  619
             RVY  +G+ KCSN SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLGYC
Sbjct  182   RVYDSRGNMKCSNASEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGYC  241

Query  618   AQGDRTTNVGIVDSEYLVHLGIQSLGGS  535
             AQGDR+  VGIVDSEY+ H GIQ+LGGS
Sbjct  242   AQGDRSKKVGIVDSEYIFHQGIQTLGGS  269



>ref|XP_010040735.1| PREDICTED: uncharacterized protein LOC104429587, partial [Eucalyptus 
grandis]
Length=359

 Score =   415 bits (1067),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 205/307 (67%), Positives = 239/307 (78%), Gaps = 12/307 (4%)
 Frame = -3

Query  1350  PLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTG-------YHNLL  1192
             P    ++S    R   SLPRGII++RSDLEL+PL + S S+SKV+V+        Y  LL
Sbjct  4     PFCFLQESQGLSRRLGSLPRGIIQARSDLELRPLWSTSSSRSKVDVSSNEVDAPRYRYLL  63

Query  1191  AMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWF  1012
             A+ VGIKQK NVN I+QKF  +NFT++LFHYDG VD W DL WS  AIHIVA +QTKWWF
Sbjct  64    AIAVGIKQKYNVNAIVQKFRPDNFTVMLFHYDGKVDAWGDLNWSNNAIHIVARNQTKWWF  123

Query  1011  AKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRI  832
             AKRFLHP +VS YDYIFLWDEDLGV+NFHP RYL+IVKSEGLEISQPAL P S  IHHRI
Sbjct  124   AKRFLHPSIVSAYDYIFLWDEDLGVDNFHPGRYLKIVKSEGLEISQPALHPNSTDIHHRI  183

Query  831   TVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVH  652
             T+RSRT KFHRRVY  +GSTKC+N S GPPC+GFVEGMAPVFSRSAW C WHL+QNDL+H
Sbjct  184   TIRSRTKKFHRRVYDVRGSTKCTNVSWGPPCTGFVEGMAPVFSRSAWFCTWHLLQNDLIH  243

Query  651   GWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL--GGSSLKRASSPQELPK---GRA  487
             GWGMDMKLGYCAQGDRT  VG++DSEY+ H GIQ+L  GG   K+ S+ +EL K     +
Sbjct  244   GWGMDMKLGYCAQGDRTKKVGVIDSEYIFHKGIQTLGGGGPPGKKGSNSEELTKRHSAPS  303

Query  486   VDLRVEV  466
             VD+R E+
Sbjct  304   VDMRAEI  310


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPY  288
            +IRRQST+ELQ+FKERW +AVK DKNW+DP+
Sbjct  309  EIRRQSTWELQVFKERWNKAVKMDKNWIDPF  339



>ref|XP_006848620.1| hypothetical protein AMTR_s00171p00031600 [Amborella trichopoda]
 gb|ERN10201.1| hypothetical protein AMTR_s00171p00031600 [Amborella trichopoda]
Length=412

 Score =   416 bits (1069),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 200/329 (61%), Positives = 244/329 (74%), Gaps = 20/329 (6%)
 Frame = -3

Query  1398  TTIYQYQQAEMESKSDPLYSAEDSCVTGRSS----SSLPRGIIESRSDLELKPLKAMSIS  1231
             T  +QY+  +M++   P  S +       +      SLPRGI+ES SD+ELKPL   S  
Sbjct  49    TMKHQYEHIKMDNTWYPFASTKQRPQIMMTHFDHIHSLPRGIVESTSDMELKPLWETSTL  108

Query  1230  KSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEA  1051
               K     +  LLA+PVGIKQK NVN ++QKFL+ENF+IILFHYDGNVDGW DL WS  A
Sbjct  109   TDKNQ--NHKALLAIPVGIKQKKNVNAMVQKFLAENFSIILFHYDGNVDGWHDLGWSDRA  166

Query  1050  IHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQP  871
             IHI+AH+QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP RYL I+K+EGLEISQP
Sbjct  167   IHILAHNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPGRYLRIMKAEGLEISQP  226

Query  870   ALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAW  691
             ALDP    IHHRIT+R++T K HRR+Y  +GS  CS+ S GPPC+G+VEGMAPVFSR++W
Sbjct  227   ALDPNQSEIHHRITIRNKTGKVHRRMYASRGSLNCSDASMGPPCTGWVEGMAPVFSRASW  286

Query  690   RCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKR----  523
              C WHLIQNDL+HGWG+DMKLGYC+QGDRT NVG++DSE+++HLGI SLGGSS  +    
Sbjct  287   HCTWHLIQNDLIHGWGLDMKLGYCSQGDRTKNVGVIDSEFIIHLGIPSLGGSSANKQLSS  346

Query  522   ----ASSPQE------LPKGRAVDLRVEV  466
                 A+ P +      +   R +DLR ++
Sbjct  347   ESNEAAGPADQSMVTKVQGERVIDLRSQI  375


 Score = 53.1 bits (126),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYK  285
            QIRRQST EL+IF++RW+ AV++DK W DPYK
Sbjct  374  QIRRQSTAELEIFRKRWDRAVRDDKEWADPYK  405



>ref|XP_006574635.1| PREDICTED: uncharacterized protein LOC100807505 isoform X1 [Glycine 
max]
Length=412

 Score =   414 bits (1064),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 207/339 (61%), Positives = 251/339 (74%), Gaps = 10/339 (3%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  745
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQG RT  VG+VDSEY+ 
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQGRRTKKVGVVDSEYVF  323

Query  564   HLGIQSLGGSSLKRASSPQELPK------GRAVDLRVEV  466
             H GIQ+LGGS   R +   +L K      G  +D+R E+
Sbjct  324   HKGIQTLGGSG-HRMTKVSKLQKTTMKQGGVGIDVRTEI  361


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST E +IF+ERW +A+ EDK WVDP+K+ QR
Sbjct  360  EIRRQSTREFEIFQERWNQAISEDKTWVDPFKSDQR  395



>gb|AAN63500.1|AF317555_1 lysine ketoglutarate reductase trans-splicing related 1 [Arabidopsis 
thaliana]
Length=358

 Score =   410 bits (1053),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 191/268 (71%), Positives = 220/268 (82%), Gaps = 0/268 (0%)
 Frame = -3

Query  1338  AEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDN  1159
             A++S         LP GI++ +SDLELKPL + S  +SK       NLLAMPVG+KQKDN
Sbjct  2     AKESEPVSEKLKGLPFGIMQPKSDLELKPLWSSSSLRSKSGELTNRNLLAMPVGLKQKDN  61

Query  1158  VNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVS  979
             V+ +++KFL  NFT+ILFHYDGN+D WWDL WS +AIHIVAH+QTKWWFAKRFLHPD+VS
Sbjct  62    VDAVVKKFLPANFTVILFHYDGNMDQWWDLEWSSKAIHIVAHNQTKWWFAKRFLHPDIVS  121

Query  978   IYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHR  799
             IYDY+FLWDEDLGVENF+P +YL IVK+ GLEISQPAL P S  +HHRITVRSRT  FHR
Sbjct  122   IYDYVFLWDEDLGVENFNPQKYLRIVKTAGLEISQPALHPNSTEVHHRITVRSRTKIFHR  181

Query  798   RVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYC  619
             RVY  +G+ KCSN SEGPPC+GFVEGMAPVFSRSAW C W+LIQNDLVHGWGMDMKLG C
Sbjct  182   RVYDSRGNMKCSNASEGPPCTGFVEGMAPVFSRSAWFCTWNLIQNDLVHGWGMDMKLGSC  241

Query  618   AQGDRTTNVGIVDSEYLVHLGIQSLGGS  535
             AQGDR+  VGIVDSEY+ H GIQ+LGGS
Sbjct  242   AQGDRSKKVGIVDSEYIFHQGIQTLGGS  269



>ref|XP_006574639.1| PREDICTED: uncharacterized protein LOC100807505 isoform X5 [Glycine 
max]
Length=358

 Score =   409 bits (1052),  Expect = 4e-135, Method: Compositional matrix adjust.
 Identities = 200/310 (65%), Positives = 239/310 (77%), Gaps = 3/310 (1%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  745
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQG RT  VG+VDSEY+ 
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQGRRTKKVGVVDSEYVF  323

Query  564   HLGIQSLGGS  535
             H GIQ+LGGS
Sbjct  324   HKGIQTLGGS  333



>ref|XP_009395413.1| PREDICTED: uncharacterized protein LOC103980679 [Musa acuminata 
subsp. malaccensis]
Length=362

 Score =   409 bits (1050),  Expect = 9e-135, Method: Compositional matrix adjust.
 Identities = 197/321 (61%), Positives = 242/321 (75%), Gaps = 4/321 (1%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKS-DPLYSAEDSCVTGRSSSSLPRGII  1282
             MK    +GL  +     L  T   Q++  +++ +  +P  S E     G +   LPRGI+
Sbjct  1     MKKRTSLGLVALFTSLTLLITMNLQFEHLKIDVQHHEPFVSTERPW--GGALQGLPRGIV  58

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             ES SDL+LKPL   S  +SK     Y  LLAM VGI QK+NV+ +++KFL EN +IILFH
Sbjct  59    ESTSDLKLKPLWMSSSFESKETGGSYSALLAMAVGISQKENVDSVVRKFLQENCSIILFH  118

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDGNVDGW DL W+ +AIHIVA++QTKWWFAKRFLHPD+V  YDY+FLWDEDLGVENFHP
Sbjct  119   YDGNVDGWRDLEWNSKAIHIVAYNQTKWWFAKRFLHPDIVFFYDYLFLWDEDLGVENFHP  178

Query  921   ARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
              RYL+++ SEGLEISQPALDP  S  IHHRITVR+R  K HRR+Y  +GS +CSNES+ P
Sbjct  179   GRYLQVMSSEGLEISQPALDPDLSSDIHHRITVRNRMKKVHRRIYNRRGSLRCSNESKEP  238

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+G+VEGMAPVFSR+AW+CVWHLIQNDLVHGWG+DMKLGYCAQGDRT  VG++DSE++V
Sbjct  239   PCTGWVEGMAPVFSRAAWQCVWHLIQNDLVHGWGLDMKLGYCAQGDRTKKVGVIDSEFIV  298

Query  564   HLGIQSLGGSSLKRASSPQEL  502
             H GI SLGG S  +A + + L
Sbjct  299   HKGIPSLGGPSANKARNRRSL  319



>ref|XP_010274911.1| PREDICTED: uncharacterized protein LOC104610123 isoform X1 [Nelumbo 
nucifera]
Length=385

 Score =   405 bits (1040),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 199/345 (58%), Positives = 251/345 (73%), Gaps = 18/345 (5%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG------RSSS  1303
              K+K    +GL    M  +++ TT  QY+  ++E++  P  S   S           S  
Sbjct  2     TKVKSRTSLGLLTTLMFVVIFVTTKLQYEHVKVENRWHPFVSTRGSSGLASGEDRFESLD  61

Query  1302  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             SL +G++E  S+LELKPL     S S +N      LLA+PVGIKQK NV+ ++QKFLSEN
Sbjct  62    SLRQGVVEWASNLELKPLWQ---SSSSLNCNA---LLAIPVGIKQKQNVDIMVQKFLSEN  115

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
              +I+LFHYDG+VDGW DL WS +A+HI+AH+QTKWWFAKRFLHPDVVS YD+IFLWDEDL
Sbjct  116   CSILLFHYDGSVDGWNDLEWSNKAVHILAHNQTKWWFAKRFLHPDVVSPYDFIFLWDEDL  175

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP R+LEI+ SEGLEISQPALDP+   +HHRIT+R++T K HR+VY  +GS  CS
Sbjct  176   GVENFHPGRFLEIMISEGLEISQPALDPELSEVHHRITLRNKTVKVHRQVYVSRGSFNCS  235

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             + S GPPC+G+VEGMAPVFSR+AW CVWHLIQNDL+HGWG+DMKLGYCAQGD T  VG++
Sbjct  236   DNSTGPPCTGWVEGMAPVFSRAAWHCVWHLIQNDLIHGWGLDMKLGYCAQGDPTKTVGVI  295

Query  582   DSEYLVHLGIQSLGGSSLKRA----SSPQELP--KGRAVDLRVEV  466
             DSEY+VH GI +LGG+S  +      SP+  P    R++DLR  +
Sbjct  296   DSEYIVHRGIPTLGGASATKPPPDRKSPEHSPVKSDRSIDLRTHI  340



>ref|XP_008802583.1| PREDICTED: uncharacterized protein LOC103716387 isoform X1 [Phoenix 
dactylifera]
Length=363

 Score =   403 bits (1036),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 246/335 (73%), Gaps = 13/335 (4%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             MK     G+  + M  +L+   T   Q +  +M+ +     S +           LPRG+
Sbjct  1     MKKRASCGIVALLMALVLFGVMTMKIQNENLKMDMRHQSFESPKRRLRN--RIDGLPRGV  58

Query  1284  IESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1108
             ++S SD+ELK L A S  K   +++G Y  LLAM VGI QK NV+ +++KFL +N +IIL
Sbjct  59    VQSTSDMELKRLWASSSQKYLQDISGNYTALLAMAVGISQKQNVDILVRKFLIDNCSIIL  118

Query  1107  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  928
             FHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF
Sbjct  119   FHYDGNVDGWRDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDLGVENF  178

Query  927   HPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESE  751
             H  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  CS+ES 
Sbjct  179   HLGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHRRVYDFRGSLNCSDESR  238

Query  750   GPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEY  571
             GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D+EY
Sbjct  239   GPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDTEY  298

Query  570   LVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             ++H GI SLGG+S+ +A S       +++DLR  +
Sbjct  299   IIHQGIPSLGGASINKAPS-------KSLDLRTHI  326



>ref|XP_010274912.1| PREDICTED: uncharacterized protein LOC104610123 isoform X2 [Nelumbo 
nucifera]
Length=384

 Score =   403 bits (1036),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 198/345 (57%), Positives = 250/345 (72%), Gaps = 19/345 (6%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG------RSSS  1303
              K+K    +GL    M  +++ TT  QY+  ++E++  P  S   S           S  
Sbjct  2     TKVKSRTSLGLLTTLMFVVIFVTTKLQYEHVKVENRWHPFVSTRGSSGLASGEDRFESLD  61

Query  1302  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             SL +G++E  S+LELKPL       S +N      LLA+PVGIKQK NV+ ++QKFLSEN
Sbjct  62    SLRQGVVEWASNLELKPL----WQSSSLNCNA---LLAIPVGIKQKQNVDIMVQKFLSEN  114

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
              +I+LFHYDG+VDGW DL WS +A+HI+AH+QTKWWFAKRFLHPDVVS YD+IFLWDEDL
Sbjct  115   CSILLFHYDGSVDGWNDLEWSNKAVHILAHNQTKWWFAKRFLHPDVVSPYDFIFLWDEDL  174

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP R+LEI+ SEGLEISQPALDP+   +HHRIT+R++T K HR+VY  +GS  CS
Sbjct  175   GVENFHPGRFLEIMISEGLEISQPALDPELSEVHHRITLRNKTVKVHRQVYVSRGSFNCS  234

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
             + S GPPC+G+VEGMAPVFSR+AW CVWHLIQNDL+HGWG+DMKLGYCAQGD T  VG++
Sbjct  235   DNSTGPPCTGWVEGMAPVFSRAAWHCVWHLIQNDLIHGWGLDMKLGYCAQGDPTKTVGVI  294

Query  582   DSEYLVHLGIQSLGGSSLKRA----SSPQELP--KGRAVDLRVEV  466
             DSEY+VH GI +LGG+S  +      SP+  P    R++DLR  +
Sbjct  295   DSEYIVHRGIPTLGGASATKPPPDRKSPEHSPVKSDRSIDLRTHI  339



>ref|XP_008802591.1| PREDICTED: uncharacterized protein LOC103716387 isoform X2 [Phoenix 
dactylifera]
Length=360

 Score =   401 bits (1030),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 199/335 (59%), Positives = 247/335 (74%), Gaps = 16/335 (5%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             MK     G+  + M  +L+   T   Q +  +M+ +     S +           LPRG+
Sbjct  1     MKKRASCGIVALLMALVLFGVMTMKIQNENLKMDMRHQSFESPKRRLRN--RIDGLPRGV  58

Query  1284  IESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1108
             ++S SD+ELK L A   S S+ +++G Y  LLAM VGI QK NV+ +++KFL +N +IIL
Sbjct  59    VQSTSDMELKRLWA---SSSQKDISGNYTALLAMAVGISQKQNVDILVRKFLIDNCSIIL  115

Query  1107  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  928
             FHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF
Sbjct  116   FHYDGNVDGWRDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDLGVENF  175

Query  927   HPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESE  751
             H  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  CS+ES 
Sbjct  176   HLGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHRRVYDFRGSLNCSDESR  235

Query  750   GPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEY  571
             GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D+EY
Sbjct  236   GPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDTEY  295

Query  570   LVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             ++H GI SLGG+S+ +A S       +++DLR  +
Sbjct  296   IIHQGIPSLGGASINKAPS-------KSLDLRTHI  323



>ref|XP_010935614.1| PREDICTED: uncharacterized protein LOC105055478 isoform X1 [Elaeis 
guineensis]
Length=360

 Score =   400 bits (1028),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 190/280 (68%), Positives = 229/280 (82%), Gaps = 12/280 (4%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             LPRG+++S SD+ELKPL     S S+ +++G Y  LLAM VGI QK NV+ +++KFL +N
Sbjct  54    LPRGVVQSTSDMELKPLWK---SSSQKDISGKYTALLAMAVGISQKQNVDILVRKFLIDN  110

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
              +IILFHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDL
Sbjct  111   CSIILFHYDGNVDGWHDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDL  170

Query  942   GVENFHPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             GVENFH  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  C
Sbjct  171   GVENFHLGRYLQIMASEGLEISQPALDPDQSSEIHHRITVRDRKAKVHRRVYDFRGSLNC  230

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
             S+ES GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG+
Sbjct  231   SDESRGPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGV  290

Query  585   VDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             +D+EY++H GI SLGG+S+ +A S       +++DLR  +
Sbjct  291   IDTEYIIHQGIPSLGGASVNKAPS-------KSLDLRTHI  323



>ref|NP_973809.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE28694.1| uncharacterized protein AT1G11170 [Arabidopsis thaliana]
Length=335

 Score =   394 bits (1013),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 183/281 (65%), Positives = 218/281 (78%), Gaps = 0/281 (0%)
 Frame = -3

Query  1455  KHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1276
             K   F+ L C ++L   Y+TT  Q++Q E+E    P   A++S         LPRGII+S
Sbjct  33    KMKPFLALMCTALLIFWYKTTNIQFEQTEIEETDYPFDMAKESEAVNDKLKGLPRGIIQS  92

Query  1275  RSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYD  1096
             RSDLELKPL +    +SK       NLLA+PVG+KQK NV+ +++KFL  NFTI+LFHYD
Sbjct  93    RSDLELKPLWSRGSLRSKGVEMTNRNLLAIPVGLKQKGNVDALVKKFLPANFTIVLFHYD  152

Query  1095  GNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPAR  916
             GN+D WWDL WS ++IHIVA +QTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF+P R
Sbjct  153   GNMDKWWDLEWSSKSIHIVAQNQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFNPER  212

Query  915   YLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCS  736
             YL+IVKS GLEISQPALD  S  IHH+IT+RS+T KFHRRVY ++G  +CSN S  PPC+
Sbjct  213   YLKIVKSVGLEISQPALDHNSTEIHHKITLRSKTKKFHRRVYINRGHKRCSNTSSDPPCT  272

Query  735   GFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  613
             GFVEGMAPVFS++AW C W+LIQNDLVHGWGMDMKLGYCAQ
Sbjct  273   GFVEGMAPVFSKAAWLCTWNLIQNDLVHGWGMDMKLGYCAQ  313



>gb|KDO75811.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=310

 Score =   389 bits (1000),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 211/266 (79%), Gaps = 0/266 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQ  667
             PC+GFVEGMAPVFSRSAW C WHLIQ
Sbjct  263   PCTGFVEGMAPVFSRSAWYCAWHLIQ  288



>ref|XP_008778200.1| PREDICTED: uncharacterized protein LOC103698025 isoform X1 [Phoenix 
dactylifera]
Length=360

 Score =   390 bits (1003),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 195/334 (58%), Positives = 237/334 (71%), Gaps = 14/334 (4%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             MK     GL  + M  +++   T   QY+   M+       S +           LPRG+
Sbjct  1     MKTQASFGLVFLLMTLVIFVAMTMKIQYENLTMDMGQQSFESTKRQWRN--RIDGLPRGV  58

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +ES +D+ LKPL     S  K     Y  LLAM VGI QK NV+ +++KFL +N +IILF
Sbjct  59    VESTTDMALKPL--WERSSRKDGSGNYAALLAMAVGISQKQNVDILVRKFLIDNCSIILF  116

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGW DL WS +AIHI+A++QTKWWFAKRFLHP+ VS YDYIFLWDEDLGVENFH
Sbjct  117   HYDGNVDGWHDLEWSGKAIHILAYNQTKWWFAKRFLHPNAVSAYDYIFLWDEDLGVENFH  176

Query  924   PARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  748
               RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  CS+ES G
Sbjct  177   LGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHRRVYDFRGSLNCSDESTG  236

Query  747   PPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYL  568
             PPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D EY+
Sbjct  237   PPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDVEYI  296

Query  567   VHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             VH GI SLGG S+ +A S       +++DLR  +
Sbjct  297   VHQGIPSLGGGSVNKAPS-------KSLDLRAHI  323



>ref|NP_001060006.1| Os07g0564800 [Oryza sativa Japonica Group]
 dbj|BAC79660.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAD30106.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAF21920.1| Os07g0564800 [Oryza sativa Japonica Group]
 dbj|BAG94802.1| unnamed protein product [Oryza sativa Japonica Group]
Length=390

 Score =   391 bits (1004),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 232/311 (75%), Gaps = 12/311 (4%)
 Frame = -3

Query  1407  LYRTTIYQYQQAEMESKSDPLYSAE-----DSCVTGRSSSS---LPRGIIESRSDLELKP  1252
             +Y    YQ++Q ++E+KS P  +        S V+ RS++    LP GI+E  SD+ELKP
Sbjct  18    VYNMASYQHKQTKLEAKSRPFDTITVSDKVSSKVSKRSANRVGFLPHGIVEPYSDMELKP  77

Query  1251  LKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWD  1072
             L     ++SK +      LLA+P GI QK +V+ I++KFL ENFT++LFHYDGNVDGW D
Sbjct  78    LWLTRSAQSKDSSQKDRCLLAIPAGIDQKRSVDAIMKKFLPENFTVMLFHYDGNVDGWND  137

Query  1071  LAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSE  892
             L WSK  IHI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NFHP RYL IVKSE
Sbjct  138   LPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFHPRRYLNIVKSE  197

Query  891   GLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAP  712
             GLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  C+   EGPPCSG+VEGMAP
Sbjct  198   GLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCAK--EGPPCSGWVEGMAP  253

Query  711   VFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  532
             VFSRSAWRC WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+LGG S
Sbjct  254   VFSRSAWRCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTLGGPS  313

Query  531   LKRASSPQELP  499
             +KR+      P
Sbjct  314   VKRSHGKNNDP  324



>ref|XP_009392032.1| PREDICTED: uncharacterized protein LOC103978053 [Musa acuminata 
subsp. malaccensis]
Length=276

 Score =   386 bits (991),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 186/259 (72%), Positives = 210/259 (81%), Gaps = 7/259 (3%)
 Frame = -3

Query  1287  IIESRSDLELKPLKAMSISKSKV----NVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             + +S+SDLELKPL     SKS V    N   +HNLLAM VGIKQK  V+ I++KFLSENF
Sbjct  1     MAQSKSDLELKPL---WFSKSHVTKQDNDQSHHNLLAMTVGIKQKLTVDAIVRKFLSENF  57

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
              IILFHYDG V+ W DL WS   IHI AHSQTKWWFAKRFLHPD VSIYDYIFLWDEDLG
Sbjct  58    AIILFHYDGIVNEWHDLWWSHIVIHIAAHSQTKWWFAKRFLHPDTVSIYDYIFLWDEDLG  117

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  760
             VENFHP RYL+I+KSEGLEISQPALDP    IHHRITVR +    HRRV+  +G+ +CS+
Sbjct  118   VENFHPGRYLKIMKSEGLEISQPALDPNLSEIHHRITVRRKKRTVHRRVFGTRGTGECSS  177

Query  759   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  580
              S GPPC+G+VEGMAPVFSRSAW C WHLIQNDL+HGWGMDMKLGYCAQGDRT  VGIVD
Sbjct  178   TSTGPPCTGWVEGMAPVFSRSAWHCAWHLIQNDLIHGWGMDMKLGYCAQGDRTKKVGIVD  237

Query  579   SEYLVHLGIQSLGGSSLKR  523
             SE++VH G+Q+LGGSS K+
Sbjct  238   SEFIVHQGVQTLGGSSAKK  256



>ref|XP_004958045.1| PREDICTED: uncharacterized protein LOC101761432 isoform X2 [Setaria 
italica]
Length=392

 Score =   387 bits (994),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 194/354 (55%), Positives = 245/354 (69%), Gaps = 27/354 (8%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAE--DSCVTGRSSSS-----  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P  +    D      S  +     
Sbjct  1     MKLRLHLLVLCVIIVFLVYNMANFQHKQTSLEAKSRPFDTVTVFDRAAVKVSQKAVARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GI+ES SD+ELKPL   + ++S+ +      L+A+  GI QK  V+ II+KFL EN
Sbjct  61    YLPHGIVESNSDMELKPLWLTTSAESQKSKQNDQFLIAIAAGINQKKTVDAIIKKFLPEN  120

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWDEDL
Sbjct  121   FTAMLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYQYIFLWDEDL  180

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
              V+NF+P RYL IVKSEGLEISQP LD K   IHHRITVR RT  FHRRV   + + +CS
Sbjct  181   EVDNFNPRRYLNIVKSEGLEISQPGLDSKLSEIHHRITVRKRTGSFHRRV--SRANKECS  238

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  239   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  296

Query  582   DSEYLVHLGIQSLGGSSL----KRASSPQEL---------PKGRA--VDLRVEV  466
             DSE++VH G+Q+LGGS+      R    Q+L          +GRA  +D+R ++
Sbjct  297   DSEFIVHRGVQTLGGSTTTKDGTRGKKAQQLRQKDAQVQKTRGRAAGLDMRTKI  350



>gb|EEC77985.1| hypothetical protein OsI_17370 [Oryza sativa Indica Group]
Length=535

 Score =   392 bits (1007),  Expect = 8e-126, Method: Compositional matrix adjust.
 Identities = 190/311 (61%), Positives = 232/311 (75%), Gaps = 12/311 (4%)
 Frame = -3

Query  1407  LYRTTIYQYQQAEMESKSDPLYSAE-----DSCVTGRSSSS---LPRGIIESRSDLELKP  1252
             +Y    YQ++Q ++E+KS P  +        S V+ RS++    LP GI+E  SD+ELKP
Sbjct  163   VYNMASYQHKQTKLEAKSRPFDTITVSDKVSSKVSKRSANRVGFLPHGIVEPYSDMELKP  222

Query  1251  LKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWD  1072
             L     ++SK +      LLA+P GI QK +V+ I++KFL ENFT++LFHYDGNVDGW D
Sbjct  223   LWLTRSAQSKDSSQKDRCLLAIPAGIDQKRSVDAIMKKFLPENFTVMLFHYDGNVDGWND  282

Query  1071  LAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSE  892
             L WSK  IHI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NFHP RYL IVKSE
Sbjct  283   LPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFHPRRYLNIVKSE  342

Query  891   GLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAP  712
             GLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  C+   EGPPCSG+VEGMAP
Sbjct  343   GLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCAK--EGPPCSGWVEGMAP  398

Query  711   VFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  532
             VFSRSAWRC WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+LGG S
Sbjct  399   VFSRSAWRCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTLGGPS  458

Query  531   LKRASSPQELP  499
             +KR+      P
Sbjct  459   VKRSHGKNNDP  469



>ref|XP_006657845.1| PREDICTED: uncharacterized protein LOC102704159 isoform X2 [Oryza 
brachyantha]
Length=387

 Score =   386 bits (991),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 234/320 (73%), Gaps = 12/320 (4%)
 Frame = -3

Query  1419  MLFILYRTTIYQYQQAEMESKSDPLYSAEDS-----CVTGRSSSS---LPRGIIESRSDL  1264
             ++F++Y    YQ++Q  +E+KS P  +   S      V  RS+     LP GI+E  SD+
Sbjct  14    IIFLVYNMASYQHRQTTLEAKSRPFDTITVSDKVPGKVPKRSADRVGFLPHGIVEPYSDM  73

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL     ++SK +      L+A+P GI QK +V+ I++KFL ENFT++LFHYDGNVD
Sbjct  74    ELKPLWLTRSAQSKESSQNDRCLIAIPAGINQKKSVDAILKKFLPENFTVMLFHYDGNVD  133

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
             GW DL WS+  +HI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NF+P RYL I
Sbjct  134   GWNDLPWSRSVVHISASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFNPRRYLNI  193

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKSEGLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  CS   EGPPCSG+VE
Sbjct  194   VKSEGLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCS--KEGPPCSGWVE  249

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS+SAW+C WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+L
Sbjct  250   GMAPVFSKSAWQCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTL  309

Query  543   GGSSLKRASSPQELPKGRAV  484
             GGSS KR       P G+  
Sbjct  310   GGSSSKRTHGKNIDPHGQTT  329



>ref|XP_006657844.1| PREDICTED: uncharacterized protein LOC102704159 isoform X1 [Oryza 
brachyantha]
Length=408

 Score =   387 bits (993),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 188/320 (59%), Positives = 234/320 (73%), Gaps = 12/320 (4%)
 Frame = -3

Query  1419  MLFILYRTTIYQYQQAEMESKSDPLYSAEDS-----CVTGRSSSS---LPRGIIESRSDL  1264
             ++F++Y    YQ++Q  +E+KS P  +   S      V  RS+     LP GI+E  SD+
Sbjct  35    IIFLVYNMASYQHRQTTLEAKSRPFDTITVSDKVPGKVPKRSADRVGFLPHGIVEPYSDM  94

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             ELKPL     ++SK +      L+A+P GI QK +V+ I++KFL ENFT++LFHYDGNVD
Sbjct  95    ELKPLWLTRSAQSKESSQNDRCLIAIPAGINQKKSVDAILKKFLPENFTVMLFHYDGNVD  154

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
             GW DL WS+  +HI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NF+P RYL I
Sbjct  155   GWNDLPWSRSVVHISASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFNPRRYLNI  214

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             VKSEGLEISQP LDPK   IHHRITVR +   FHR+V  ++G+  CS   EGPPCSG+VE
Sbjct  215   VKSEGLEISQPGLDPKLSEIHHRITVRKKGWSFHRKV--NRGNKDCS--KEGPPCSGWVE  270

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
             GMAPVFS+SAW+C WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+L
Sbjct  271   GMAPVFSKSAWQCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTL  330

Query  543   GGSSLKRASSPQELPKGRAV  484
             GGSS KR       P G+  
Sbjct  331   GGSSSKRTHGKNIDPHGQTT  350



>ref|XP_004958044.1| PREDICTED: uncharacterized protein LOC101761432 isoform X1 [Setaria 
italica]
Length=395

 Score =   386 bits (992),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/357 (55%), Positives = 245/357 (69%), Gaps = 30/357 (8%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAE--DSCVTGRSSSS-----  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P  +    D      S  +     
Sbjct  1     MKLRLHLLVLCVIIVFLVYNMANFQHKQTSLEAKSRPFDTVTVFDRAAVKVSQKAVARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHN---LLAMPVGIKQKDNVNEIIQKFL  1132
              LP GI+ES SD+ELKPL   + ++S+       N   L+A+  GI QK  V+ II+KFL
Sbjct  61    YLPHGIVESNSDMELKPLWLTTSAESQFQQKSKQNDQFLIAIAAGINQKKTVDAIIKKFL  120

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
              ENFT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWD
Sbjct  121   PENFTAMLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYQYIFLWD  180

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDL V+NF+P RYL IVKSEGLEISQP LD K   IHHRITVR RT  FHRRV   + + 
Sbjct  181   EDLEVDNFNPRRYLNIVKSEGLEISQPGLDSKLSEIHHRITVRKRTGSFHRRV--SRANK  238

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +CS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+
Sbjct  239   ECSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNI  296

Query  591   GIVDSEYLVHLGIQSLGGSSL----KRASSPQEL---------PKGRA--VDLRVEV  466
             G+VDSE++VH G+Q+LGGS+      R    Q+L          +GRA  +D+R ++
Sbjct  297   GVVDSEFIVHRGVQTLGGSTTTKDGTRGKKAQQLRQKDAQVQKTRGRAAGLDMRTKI  353



>ref|XP_002439080.1| hypothetical protein SORBIDRAFT_10g031220 [Sorghum bicolor]
 gb|EER90447.1| hypothetical protein SORBIDRAFT_10g031220 [Sorghum bicolor]
Length=380

 Score =   385 bits (990),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 227/283 (80%), Gaps = 8/283 (3%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHN-LLAMPVGIKQKDNVNEIIQKFL  1132
             + SLPRGI++  SD+ L+PL     + +  N  G H+ LLAM VGI Q  NV+ + +KFL
Sbjct  73    ADSLPRGIVQRHSDMSLRPLWEDDAASTHKNKNGDHSALLAMAVGISQIKNVDTMARKFL  132

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
              EN+ ++LFHYDGNVDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWD
Sbjct  133   KENYAVMLFHYDGNVDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWD  192

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGS  775
             EDLGVE+F+P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S
Sbjct  193   EDLGVESFNPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKMTKVHRRIYDNRPS  252

Query  774   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  595
               CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  
Sbjct  253   MNCSDESKGPPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEK  312

Query  594   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  +
Sbjct  313   VGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHI  349



>tpg|DAA63156.1| TPA: hypothetical protein ZEAMMB73_938040 [Zea mays]
Length=327

 Score =   383 bits (983),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 233/321 (73%), Gaps = 12/321 (4%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FHRRV   + + KCS
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHRRV--SRANKKCS  238

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  239   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  296

Query  582   DSEYLVHLGIQSLGGSSLKRA  520
             DSE++VH G+Q+LGGS++ + 
Sbjct  297   DSEFIVHRGVQTLGGSTITKV  317



>ref|NP_001130789.1| uncharacterized protein LOC100191893 [Zea mays]
 gb|ACF79143.1| unknown [Zea mays]
 gb|ACG29211.1| lysine ketoglutarate reductase trans-splicing related 1 [Zea 
mays]
 gb|ACR36421.1| unknown [Zea mays]
 gb|AFW69653.1| lysine ketoglutarate reductase trans-splicing 1 [Zea mays]
Length=372

 Score =   384 bits (985),  Expect = 9e-125, Method: Compositional matrix adjust.
 Identities = 179/283 (63%), Positives = 226/283 (80%), Gaps = 8/283 (3%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             + SLPRGI+   SD+ L+PL +  + S  K   + Y  LLAM VGI Q  N++ + +KFL
Sbjct  65    AHSLPRGIVHRHSDMSLRPLWEDDTASTHKNKNSDYSALLAMAVGISQIKNIDTMARKFL  124

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
              EN+ ++LFHYDGNVDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWD
Sbjct  125   KENYAVMLFHYDGNVDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWD  184

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGS  775
             EDLGVENF+P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S
Sbjct  185   EDLGVENFNPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKMAKVHRRIYDNRPS  244

Query  774   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  595
               CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  
Sbjct  245   MNCSDESKGPPCTGWVEGMAPVFSRTAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEK  304

Query  594   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  +
Sbjct  305   VGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHI  341



>ref|XP_008650832.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=392

 Score =   383 bits (984),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 185/320 (58%), Positives = 233/320 (73%), Gaps = 12/320 (4%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FHRRV   + + KCS
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHRRV--SRANKKCS  238

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  239   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  296

Query  582   DSEYLVHLGIQSLGGSSLKR  523
             DSE++VH G+Q+LGGS++ +
Sbjct  297   DSEFIVHRGVQTLGGSTITK  316



>ref|XP_004966564.1| PREDICTED: uncharacterized protein LOC101765020 isoform X1 [Setaria 
italica]
Length=374

 Score =   380 bits (977),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/282 (63%), Positives = 227/282 (80%), Gaps = 8/282 (3%)
 Frame = -3

Query  1305  SSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHN-LLAMPVGIKQKDNVNEIIQKFLS  1129
             +SLPRGI+E  SD+ L+PL   S + +  N     + LLAM VGI Q  NV+ + +KFL 
Sbjct  68    NSLPRGIVERHSDMYLRPLWDDSAAATHKNKNDDPSALLAMAVGISQIKNVDTMARKFLK  127

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
             EN+ ++LFHYDGNVDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWDE
Sbjct  128   ENYAVMLFHYDGNVDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWDE  187

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGST  772
             DLGV+NF+P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++ +K HRR+Y ++ S 
Sbjct  188   DLGVDNFNPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKLSKVHRRIYDNRPSM  247

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
              CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  V
Sbjct  248   NCSDESKGPPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEKV  307

Query  591   GIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             G++DSEY+VH GI SLGG SL  + +P+     R++DLR  +
Sbjct  308   GVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHI  343



>ref|XP_006657376.1| PREDICTED: uncharacterized protein LOC102704535 [Oryza brachyantha]
Length=369

 Score =   380 bits (976),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/283 (62%), Positives = 224/283 (79%), Gaps = 8/283 (3%)
 Frame = -3

Query  1311  SSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             +   LPRGI+ S SD+ L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL
Sbjct  63    AEGQLPRGIVHSHSDMYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFL  121

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             ++N+T++LFHYDGNVDGW +L WS +A+HI+AH+QTKWWFAKRFLHPDVV+IY++IFLWD
Sbjct  122   NQNYTVMLFHYDGNVDGWRNLEWSDKAVHILAHNQTKWWFAKRFLHPDVVAIYNFIFLWD  181

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGS  775
             EDLGV+NF P RYL+I+ SEGLEI+QPALDP  S  IHHRIT R++  K HRR+Y ++ S
Sbjct  182   EDLGVDNFDPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITTRNKMTKVHRRIYDNRAS  241

Query  774   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  595
               CS+ES+GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDR   
Sbjct  242   MNCSDESKGPPCTGWVEGMAPVFSRNAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRAEK  301

Query  594   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             VG++DSEY+VH GI SLGG SL  + +P+     R++DLR  +
Sbjct  302   VGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLRTHI  338



>tpg|DAA63157.1| TPA: hypothetical protein ZEAMMB73_938040 [Zea mays]
Length=410

 Score =   379 bits (974),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 187/338 (55%), Positives = 234/338 (69%), Gaps = 30/338 (9%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDP---------LYSAEDSCVTGRSS  1306
             MK    + + CV ++F++Y    +Q++Q  +E+KS P         L+   D C+  +  
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTRQVFLFLNYDMCLQCKHQ  60

Query  1305  SS-----------------LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVG  1177
              S                 LP GI+ES SD++LKPL   + ++SK      + L+A+  G
Sbjct  61    VSDRDAVKVPQKAEARIGYLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAG  120

Query  1176  IKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFL  997
             I QK  V+ I++KFL ENFT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFL
Sbjct  121   INQKKTVDAIMKKFLPENFTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFL  180

Query  996   HPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSR  817
             HP VVSIY YIFLWDEDL V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +
Sbjct  181   HPAVVSIYQYIFLWDEDLEVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKK  240

Query  816   TNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMD  637
                FHRRV   + + KCS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D
Sbjct  241   AGTFHRRV--SRANKKCSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGID  296

Query  636   MKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKR  523
              K GYCAQGDRT N+G+VDSE++VH G+Q+LGGS++ +
Sbjct  297   YKFGYCAQGDRTKNIGVVDSEFIVHRGVQTLGGSTITK  334



>ref|XP_009396162.1| PREDICTED: uncharacterized protein LOC103981234 [Musa acuminata 
subsp. malaccensis]
Length=265

 Score =   374 bits (959),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 171/242 (71%), Positives = 206/242 (85%), Gaps = 7/242 (3%)
 Frame = -3

Query  1188  MPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFA  1009
             M VGI QK+NV+  ++KFL EN +IILFHYDGNVDGW DL W+ +A+HIVA +QTKWWFA
Sbjct  1     MAVGILQKENVDCTVRKFLIENCSIILFHYDGNVDGWHDLQWNNKAVHIVARNQTKWWFA  60

Query  1008  KRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRI  832
             KRFLHPDVVS+YDYIFLWDEDLGVENFHP RYL ++ SEGLEISQPALDP  S  IHHRI
Sbjct  61    KRFLHPDVVSVYDYIFLWDEDLGVENFHPGRYLHVMSSEGLEISQPALDPDLSSDIHHRI  120

Query  831   TVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVH  652
             TVR+R  K HRR+Y  +GS +CS+ES+GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDLVH
Sbjct  121   TVRNRMTKVHRRIYDQRGSLRCSDESKGPPCTGWVEGMAPVFSRAAWQCVWHLIQNDLVH  180

Query  651   GWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRV  472
             GWG+DMKLGYCAQGDRT  VG++D+E++VH+GI SLGGSS+ +AS+       R++DLR 
Sbjct  181   GWGLDMKLGYCAQGDRTEKVGVIDTEFIVHMGIPSLGGSSINKASNH------RSLDLRT  234

Query  471   EV  466
              +
Sbjct  235   HI  236



>ref|XP_008650833.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=391

 Score =   378 bits (971),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 231/320 (72%), Gaps = 13/320 (4%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FHR     + + KCS
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHR---VSRANKKCS  237

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
                EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+V
Sbjct  238   R--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVV  295

Query  582   DSEYLVHLGIQSLGGSSLKR  523
             DSE++VH G+Q+LGGS++ +
Sbjct  296   DSEFIVHRGVQTLGGSTITK  315



>ref|XP_008668561.1| PREDICTED: uncharacterized protein LOC100502312 isoform X1 [Zea 
mays]
Length=392

 Score =   378 bits (970),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 233/323 (72%), Gaps = 18/323 (6%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPR----  1291
             MK    + + CV ++F++Y    +Q++Q   E+KS P    +   V+ R +  LP+    
Sbjct  1     MKLRLHLLVLCVIIIFLVYNMASFQHKQTSSEAKSHPF---DTVTVSDRDAVKLPQKAEV  57

Query  1290  -------GIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
                    GI+ES SD++LKPL   + ++SK +    H L+A+  GI QK +V+ I++KFL
Sbjct  58    RIGYLPHGIVESNSDMKLKPLWLTTSAQSKKSKQKDHFLIAIAAGINQKKSVDAIMKKFL  117

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
              ENFT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWD
Sbjct  118   PENFTAVLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYQYIFLWD  177

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDL V+NF+P RYL IV+SEGLEISQP LD K   IHHRITVR  T  FHRRV   + + 
Sbjct  178   EDLEVDNFNPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKNTGTFHRRV--SRANK  235

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C    EGPPCSG+VEGMAPVFS+ AW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+
Sbjct  236   RCLR--EGPPCSGWVEGMAPVFSKYAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNI  293

Query  591   GIVDSEYLVHLGIQSLGGSSLKR  523
             G+VDSE++VH G+Q+LGGS++ +
Sbjct  294   GVVDSEFIVHRGVQTLGGSTITK  316



>ref|XP_008650835.1| PREDICTED: hypothetical protein isoform X4 [Zea mays]
Length=397

 Score =   377 bits (969),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 185/325 (57%), Positives = 233/325 (72%), Gaps = 17/325 (5%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GI+ES SD++LKPL   + ++SK      + L+A+  GI QK  V+ I++KFL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSKKPKQNDNFLIAIAAGINQKKTVDAIMKKFLPEN  120

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  121   FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  180

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-----RRVYKDKG  778
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FH     RRV   + 
Sbjct  181   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHSVYFDRRV--SRA  238

Query  777   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  598
             + KCS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT 
Sbjct  239   NKKCSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTK  296

Query  597   NVGIVDSEYLVHLGIQSLGGSSLKR  523
             N+G+VDSE++VH G+Q+LGGS++ +
Sbjct  297   NIGVVDSEFIVHRGVQTLGGSTITK  321



>ref|NP_001058667.1| Os06g0731900 [Oryza sativa Japonica Group]
 dbj|BAD62499.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAF20581.1| Os06g0731900 [Oryza sativa Japonica Group]
 dbj|BAG89051.1| unnamed protein product [Oryza sativa Japonica Group]
Length=360

 Score =   375 bits (962),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 236/328 (72%), Gaps = 11/328 (3%)
 Frame = -3

Query  1437  GLFCVSMLFILYRTTIYQY---QQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSD  1267
             GL  V +  I+  +   Q+   ++  +        +  D       +  LPRGI+ S SD
Sbjct  9     GLLAVVVTLIVLASLQIQFHHLKEDRLTGDRTFATTTTDPVHWRTGAEGLPRGIVHSNSD  68

Query  1266  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  1087
             + L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL++N+T++LFHYDGNV
Sbjct  69    MYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFLNQNYTVMLFHYDGNV  127

Query  1086  DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  907
             DGW +L WS +AIHI+A +QTKWWFAKRFLHPDVV+IY +IFLWDEDLGV+NF P RYL+
Sbjct  128   DGWHNLEWSDKAIHILARNQTKWWFAKRFLHPDVVAIYGFIFLWDEDLGVDNFDPRRYLD  187

Query  906   IVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  730
             I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ S+GPPC+G+
Sbjct  188   IMVSEGLEITQPALDPDLSTDIHHRITIRNKMMKVHRRIYDNRASMNCSDGSKGPPCTGW  247

Query  729   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  550
             VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDR   VG++DSEY+VH GI 
Sbjct  248   VEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRAEKVGVIDSEYVVHQGIP  307

Query  549   SLGGSSLKRASSPQELPKGRAVDLRVEV  466
             SLGG SL  + +P+     R++DLR  +
Sbjct  308   SLGGPSLS-SKTPR-----RSLDLRTHI  329



>ref|XP_006574640.1| PREDICTED: uncharacterized protein LOC100807505 isoform X6 [Glycine 
max]
Length=316

 Score =   372 bits (955),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 182/284 (64%), Positives = 218/284 (77%), Gaps = 3/284 (1%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  745
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  613
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQ
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQ  307



>ref|XP_006574638.1| PREDICTED: uncharacterized protein LOC100807505 isoform X4 [Glycine 
max]
Length=380

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/284 (64%), Positives = 218/284 (77%), Gaps = 3/284 (1%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QKFL ENFTIILFH
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQKFLQENFTIILFH  143

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  144   YDGEVDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  203

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  745
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  204   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  263

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQ  613
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQ
Sbjct  264   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQ  307


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST E +IF+ERW +A+ EDK WVDP+K+ QR
Sbjct  328  EIRRQSTREFEIFQERWNQAISEDKTWVDPFKSDQR  363



>dbj|BAJ99055.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 177/284 (62%), Positives = 222/284 (78%), Gaps = 9/284 (3%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHN-LLAMPVGIKQKDNVNEIIQKF  1135
             +  LPRGI+E+ SD+ L+PL  + +   S  N    H  LLAM VGI Q  NV+ + +KF
Sbjct  80    AEGLPRGIVETSSDMFLRPLWDSTAKHASAKNKHDQHKALLAMAVGISQMQNVDIMARKF  139

Query  1134  LSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLW  955
             L+E++T++LFHYDGNVDGW  L WS +AIHI+A +QTKWWFAKRFLHP VV+IYD+IFLW
Sbjct  140   LNESYTVMLFHYDGNVDGWRSLEWSDKAIHILAPNQTKWWFAKRFLHPSVVAIYDFIFLW  199

Query  954   DEDLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKG  778
             DEDLGVENF P RY++I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRRVY ++ 
Sbjct  200   DEDLGVENFDPRRYIDIMVSEGLEITQPALDPDLSTDIHHRITIRNKLTKVHRRVYDNRS  259

Query  777   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  598
             S  CS++S GPPC+G+VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDR  
Sbjct  260   SMNCSDDSRGPPCTGWVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRAE  319

Query  597   NVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
              VG++DSEY+VH GI SLGG      S   +LP+ R++DLR  +
Sbjct  320   KVGVIDSEYVVHQGIPSLGGP-----SDTSKLPR-RSMDLRTHI  357



>ref|XP_006574636.1| PREDICTED: uncharacterized protein LOC100807505 isoform X2 [Glycine 
max]
 ref|XP_006574637.1| PREDICTED: uncharacterized protein LOC100807505 isoform X3 [Glycine 
max]
Length=396

 Score =   373 bits (958),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 193/339 (57%), Positives = 237/339 (70%), Gaps = 26/339 (8%)
 Frame = -3

Query  1461  KMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGII  1282
             K K + F+ +FC +++FI+YR T YQY Q E++ KS      +    T  +   LP+GI+
Sbjct  26    KTKQLSFLAVFC-TIMFIMYRITKYQYHQEEIDKKSSSWGEPKVYPTTSGNLKGLPQGIV  84

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
              + SDLELKP  + S S+SK  V    NLLA+PVGIKQK NV+ ++QK            
Sbjct  85    HANSDLELKPSWSTSSSRSKA-VFSNRNLLAVPVGIKQKHNVDVMVQK------------  131

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
                 VDGWW+L WS   I IVA +QTKWWFAKRFLHP++VSIYD+IFLWDEDLGVE+F P
Sbjct  132   ----VDGWWNLDWSSNVIQIVARNQTKWWFAKRFLHPNIVSIYDFIFLWDEDLGVEHFSP  187

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-RRVYKDKGSTKCSNESEGP  745
             +RY+EI+K EGLEISQPALDP S  IHHRIT+RS T KFH R   + K   +CS+ SE P
Sbjct  188   SRYIEIIKQEGLEISQPALDPHSTEIHHRITIRSITKKFHRRVYERRKRRARCSDSSEEP  247

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+GFVEGMAPVFSRSAW C WHLIQNDLVHGWG+D+KLGYCAQG RT  VG+VDSEY+ 
Sbjct  248   PCTGFVEGMAPVFSRSAWYCTWHLIQNDLVHGWGLDLKLGYCAQGRRTKKVGVVDSEYVF  307

Query  564   HLGIQSLGGSSLKRASSPQELPK------GRAVDLRVEV  466
             H GIQ+LGGS   R +   +L K      G  +D+R E+
Sbjct  308   HKGIQTLGGSG-HRMTKVSKLQKTTMKQGGVGIDVRTEI  345


 Score = 55.5 bits (132),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -1

Query  380  QIRRQSTYELQIFKERWEEAVKEDKNWVDPYKASQR  273
            +IRRQST E +IF+ERW +A+ EDK WVDP+K+ QR
Sbjct  344  EIRRQSTREFEIFQERWNQAISEDKTWVDPFKSDQR  379



>ref|XP_008668562.1| PREDICTED: uncharacterized protein LOC100502312 isoform X2 [Zea 
mays]
Length=391

 Score =   373 bits (957),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 180/323 (56%), Positives = 231/323 (72%), Gaps = 19/323 (6%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPR----  1291
             MK    + + CV ++F++Y    +Q++Q   E+KS P    +   V+ R +  LP+    
Sbjct  1     MKLRLHLLVLCVIIIFLVYNMASFQHKQTSSEAKSHPF---DTVTVSDRDAVKLPQKAEV  57

Query  1290  -------GIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
                    GI+ES SD++LKPL   + ++SK +    H L+A+  GI QK +V+ I++KFL
Sbjct  58    RIGYLPHGIVESNSDMKLKPLWLTTSAQSKKSKQKDHFLIAIAAGINQKKSVDAIMKKFL  117

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
              ENFT +LFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWD
Sbjct  118   PENFTAVLFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYQYIFLWD  177

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDL V+NF+P RYL IV+SEGLEISQP LD K   IHHRITVR  T  FHR     + + 
Sbjct  178   EDLEVDNFNPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKNTGTFHR---VSRANK  234

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C    EGPPCSG+VEGMAPVFS+ AW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+
Sbjct  235   RCLR--EGPPCSGWVEGMAPVFSKYAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNI  292

Query  591   GIVDSEYLVHLGIQSLGGSSLKR  523
             G+VDSE++VH G+Q+LGGS++ +
Sbjct  293   GVVDSEFIVHRGVQTLGGSTITK  315



>gb|AFW69650.1| hypothetical protein ZEAMMB73_069164 [Zea mays]
Length=294

 Score =   367 bits (943),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/269 (64%), Positives = 216/269 (80%), Gaps = 8/269 (3%)
 Frame = -3

Query  1266  LELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  1090
             + L+PL +  + S  K   + Y  LLAM VGI Q  N++ + +KFL EN+ ++LFHYDGN
Sbjct  1     MSLRPLWEDDTASTHKNKNSDYSALLAMAVGISQIKNIDTMARKFLKENYAVMLFHYDGN  60

Query  1089  VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  910
             VDGW  L WS +AIHI+AH+QTKWWFAKRFLHPDV++IYD+IFLWDEDLGVENF+P RYL
Sbjct  61    VDGWRHLEWSDKAIHILAHNQTKWWFAKRFLHPDVMAIYDFIFLWDEDLGVENFNPRRYL  120

Query  909   EIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSG  733
             +I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ES+GPPC+G
Sbjct  121   DIMVSEGLEITQPALDPDLSTDIHHRITIRNKMAKVHRRIYDNRPSMNCSDESKGPPCTG  180

Query  732   FVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGI  553
             +VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++DSEY+VH GI
Sbjct  181   WVEGMAPVFSRTAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTEKVGVIDSEYVVHQGI  240

Query  552   QSLGGSSLKRASSPQELPKGRAVDLRVEV  466
              SLGG SL  + +P+     R++DLR  +
Sbjct  241   PSLGGPSLS-SKTPR-----RSLDLRTHI  263



>ref|XP_010248201.1| PREDICTED: uncharacterized protein LOC104590836 isoform X4 [Nelumbo 
nucifera]
Length=342

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 172/292 (59%), Positives = 219/292 (75%), Gaps = 4/292 (1%)
 Frame = -3

Query  1359  KSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPV  1180
             K+ P ++ ++ C     S +LP+GI+ + +DLE++PL    +  +  NV    NLLA+ V
Sbjct  14    KNRPSHACKNQC-QPYGSEALPKGILSTTADLEMRPLWGTPMKMA--NVKPSMNLLAISV  70

Query  1179  GIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRF  1000
             GIKQK+ VN++++KFLS NF I+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRF
Sbjct  71    GIKQKEVVNQMVKKFLSSNFVIMLFHYDGVVDEWRDLEWSDRAVHVSAINQTKWWFAKRF  130

Query  999   LHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRS  820
             LHPD+V+ YDYIF+WDED+GVENFHP RYL I+K EGLEISQPALDP    +HH+ITVR 
Sbjct  131   LHPDIVAGYDYIFVWDEDIGVENFHPGRYLSIIKDEGLEISQPALDPTKSEVHHQITVRG  190

Query  819   RTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  643
             R +K HRR+YK KG  K C N S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG
Sbjct  191   RKSKVHRRIYKLKGKGKRCDNNSTAPPCIGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWG  250

Query  642   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA  487
             +DM+LGYCAQGDRT NVG+VDSEY+VHLG+ +LG     +A     +  GR+
Sbjct  251   LDMQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVVDENKAPFDSHVIDGRS  302



>ref|XP_010248154.1| PREDICTED: uncharacterized protein LOC104590836 isoform X3 [Nelumbo 
nucifera]
Length=382

 Score =   369 bits (948),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/324 (56%), Positives = 230/324 (71%), Gaps = 11/324 (3%)
 Frame = -3

Query  1437  GLFCVSMLFILYRTTIYQYQQ------AEMESKSDPLYSAEDSCVTGRSSSSLPRGIIES  1276
              L CV++L I    T   Y+       A    K+ P ++ ++ C     S +LP+GI+ +
Sbjct  23    ALICVALL-IGSAFTARNYKDKFSRWGAVDTQKNRPSHACKNQC-QPYGSEALPKGILST  80

Query  1275  RSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYD  1096
              +DLE++PL    +  +  NV    NLLA+ VGIKQK+ VN++++KFLS NF I+LFHYD
Sbjct  81    TADLEMRPLWGTPMKMA--NVKPSMNLLAISVGIKQKEVVNQMVKKFLSSNFVIMLFHYD  138

Query  1095  GNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPAR  916
             G VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ YDYIF+WDED+GVENFHP R
Sbjct  139   GVVDEWRDLEWSDRAVHVSAINQTKWWFAKRFLHPDIVAGYDYIFVWDEDIGVENFHPGR  198

Query  915   YLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNESEGPPC  739
             YL I+K EGLEISQPALDP    +HH+ITVR R +K HRR+YK KG  K C N S  PPC
Sbjct  199   YLSIIKDEGLEISQPALDPTKSEVHHQITVRGRKSKVHRRIYKLKGKGKRCDNNSTAPPC  258

Query  738   SGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHL  559
              G+VE MAPVFSR+AWRC W++IQNDL+H WG+DM+LGYCAQGDRT NVG+VDSEY+VHL
Sbjct  259   IGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWGLDMQLGYCAQGDRTKNVGVVDSEYIVHL  318

Query  558   GIQSLGGSSLKRASSPQELPKGRA  487
             G+ +LG     +A     +  GR+
Sbjct  319   GLPTLGVVDENKAPFDSHVIDGRS  342



>ref|XP_010236939.1| PREDICTED: uncharacterized protein LOC100833044 isoform X2 [Brachypodium 
distachyon]
 ref|XP_010236940.1| PREDICTED: uncharacterized protein LOC100833044 isoform X2 [Brachypodium 
distachyon]
Length=408

 Score =   369 bits (947),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/323 (56%), Positives = 227/323 (70%), Gaps = 28/323 (9%)
 Frame = -3

Query  1419  MLFILYRTTIYQYQQAEMESKSDPLYSAEDS-------------CVTGRSSSS-------  1300
             +LF++Y    YQ++Q  +E+KS P  +  +S              V+GR++         
Sbjct  14    ILFVVYSMASYQHRQTALEAKSRPFDTMIESDGAAVKVSDGAAVKVSGRAAVKVSERAAG  73

Query  1299  ----LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
                 LP GI+E  SD+ELKPL   S  +S+ +      L+A+P GI QK +V+ I++KFL
Sbjct  74    RIGFLPHGIVEPYSDMELKPLWLTSSVQSQKSNQNDRCLIAIPAGINQKKSVDAIMKKFL  133

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
              ENFT ILFHYDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+YDYIFLWD
Sbjct  134   PENFTAILFHYDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYDYIFLWD  193

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDL V+NF+P RYL IVKSE L ISQP LDPK   IHH ITVR +T  FHRRV   + + 
Sbjct  194   EDLEVDNFNPRRYLNIVKSERLVISQPGLDPKLSEIHHPITVRKKTGNFHRRV--SRANK  251

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
              CS   EGPPCSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT ++
Sbjct  252   DCSR--EGPPCSGWVEGMAPVFSKSAWKCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKHI  309

Query  591   GIVDSEYLVHLGIQSLGGSSLKR  523
             G+VDSE++VH G+Q+LGGS++ +
Sbjct  310   GVVDSEFVVHRGVQTLGGSAMTK  332



>dbj|BAD62500.1| putative lysine ketoglutarate reductase trans-splicing related 
1 [Oryza sativa Japonica Group]
 dbj|BAG93400.1| unnamed protein product [Oryza sativa Japonica Group]
Length=359

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 180/328 (55%), Positives = 235/328 (72%), Gaps = 12/328 (4%)
 Frame = -3

Query  1437  GLFCVSMLFILYRTTIYQY---QQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSD  1267
             GL  V +  I+  +   Q+   ++  +        +  D       +  LPRGI+ S SD
Sbjct  9     GLLAVVVTLIVLASLQIQFHHLKEDRLTGDRTFATTTTDPVHWRTGAEGLPRGIVHSNSD  68

Query  1266  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  1087
             + L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL++N+T++LFHYDGNV
Sbjct  69    MYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFLNQNYTVMLFHYDGNV  127

Query  1086  DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  907
             DGW +L WS +AIHI+A +QTKW FAKRFLHPDVV+IY +IFLWDEDLGV+NF P RYL+
Sbjct  128   DGWHNLEWSDKAIHILARNQTKW-FAKRFLHPDVVAIYGFIFLWDEDLGVDNFDPRRYLD  186

Query  906   IVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  730
             I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S  CS+ S+GPPC+G+
Sbjct  187   IMVSEGLEITQPALDPDLSTDIHHRITIRNKMMKVHRRIYDNRASMNCSDGSKGPPCTGW  246

Query  729   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  550
             VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQGDR   VG++DSEY+VH GI 
Sbjct  247   VEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQGDRAEKVGVIDSEYVVHQGIP  306

Query  549   SLGGSSLKRASSPQELPKGRAVDLRVEV  466
             SLGG SL  + +P+     R++DLR  +
Sbjct  307   SLGGPSLS-SKTPR-----RSLDLRTHI  328



>ref|XP_010247917.1| PREDICTED: uncharacterized protein LOC104590836 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010247971.1| PREDICTED: uncharacterized protein LOC104590836 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010248031.1| PREDICTED: uncharacterized protein LOC104590836 isoform X1 [Nelumbo 
nucifera]
Length=438

 Score =   369 bits (948),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 172/292 (59%), Positives = 219/292 (75%), Gaps = 4/292 (1%)
 Frame = -3

Query  1359  KSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPV  1180
             K+ P ++ ++ C     S +LP+GI+ + +DLE++PL    +  +  NV    NLLA+ V
Sbjct  110   KNRPSHACKNQC-QPYGSEALPKGILSTTADLEMRPLWGTPMKMA--NVKPSMNLLAISV  166

Query  1179  GIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRF  1000
             GIKQK+ VN++++KFLS NF I+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRF
Sbjct  167   GIKQKEVVNQMVKKFLSSNFVIMLFHYDGVVDEWRDLEWSDRAVHVSAINQTKWWFAKRF  226

Query  999   LHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRS  820
             LHPD+V+ YDYIF+WDED+GVENFHP RYL I+K EGLEISQPALDP    +HH+ITVR 
Sbjct  227   LHPDIVAGYDYIFVWDEDIGVENFHPGRYLSIIKDEGLEISQPALDPTKSEVHHQITVRG  286

Query  819   RTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  643
             R +K HRR+YK KG  K C N S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG
Sbjct  287   RKSKVHRRIYKLKGKGKRCDNNSTAPPCIGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWG  346

Query  642   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA  487
             +DM+LGYCAQGDRT NVG+VDSEY+VHLG+ +LG     +A     +  GR+
Sbjct  347   LDMQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVVDENKAPFDSHVIDGRS  398



>ref|XP_010248082.1| PREDICTED: uncharacterized protein LOC104590836 isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   368 bits (945),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/274 (62%), Positives = 213/274 (78%), Gaps = 4/274 (1%)
 Frame = -3

Query  1359  KSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPV  1180
             K+ P ++ ++ C     S +LP+GI+ + +DLE++PL    +  +  NV    NLLA+ V
Sbjct  110   KNRPSHACKNQC-QPYGSEALPKGILSTTADLEMRPLWGTPMKMA--NVKPSMNLLAISV  166

Query  1179  GIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRF  1000
             GIKQK+ VN++++KFLS NF I+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRF
Sbjct  167   GIKQKEVVNQMVKKFLSSNFVIMLFHYDGVVDEWRDLEWSDRAVHVSAINQTKWWFAKRF  226

Query  999   LHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRS  820
             LHPD+V+ YDYIF+WDED+GVENFHP RYL I+K EGLEISQPALDP    +HH+ITVR 
Sbjct  227   LHPDIVAGYDYIFVWDEDIGVENFHPGRYLSIIKDEGLEISQPALDPTKSEVHHQITVRG  286

Query  819   RTNKFHRRVYKDKGSTK-CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  643
             R +K HRR+YK KG  K C N S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG
Sbjct  287   RKSKVHRRIYKLKGKGKRCDNNSTAPPCIGWVEMMAPVFSRAAWRCTWYMIQNDLIHAWG  346

Query  642   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLG  541
             +DM+LGYCAQGDRT NVG+VDSEY+VHLG+ +LG
Sbjct  347   LDMQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLG  380



>gb|EMS62996.1| hypothetical protein TRIUR3_26204 [Triticum urartu]
Length=406

 Score =   366 bits (940),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 185/353 (52%), Positives = 237/353 (67%), Gaps = 39/353 (11%)
 Frame = -3

Query  1419  MLFILYRTTIYQYQQAEMESKSDPL-------YSAEDSCVTGRSSSS-------------  1300
             +LF++Y    YQ +Q  ++  + P         +A  +  TGR+++              
Sbjct  15    ILFVVYNMASYQRRQTVLDEDAPPFDTMMGSDRAAVKASGTGRATAKVSHGAASTARVGF  74

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LP GI+E  SD+ELKPL      +S  +      L+A+P GI QK +V+ +++KFL+ENF
Sbjct  75    LPHGIVEPYSDMELKPLWLTRSVQSPESNQKDRCLIAIPAGINQKKSVDALMKKFLAENF  134

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             T ILFHYDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWDEDL 
Sbjct  135   TAILFHYDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYKYIFLWDEDLE  194

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  760
             V+NF+P RYL IVKSE LEISQP LDPK   IHH ITVR +T  FHRRV   + +  CS 
Sbjct  195   VDNFNPRRYLNIVKSERLEISQPGLDPKLSEIHHPITVRKKTGSFHRRV--SRANKDCSR  252

Query  759   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  580
               EGPPCSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT N+G+VD
Sbjct  253   --EGPPCSGWVEGMAPVFSKSAWQCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKNIGVVD  310

Query  579   SEYLVHLGIQSLGGSSL-------------KRASSPQELPKGRA--VDLRVEV  466
             SE++VH G+Q+LGGS++             +R +  Q+  +G+A  +D+R +V
Sbjct  311   SEFVVHRGVQTLGGSAMTKRTRGKSSHALRQRTAQVQQQTRGKAASLDMRTKV  363



>gb|KHN10306.1| hypothetical protein glysoja_040534, partial [Glycine soja]
Length=326

 Score =   361 bits (927),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/253 (68%), Positives = 203/253 (80%), Gaps = 18/253 (7%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LP+GII++ SDLEL+ L + S  +SK +V    NLLA+ VGIKQK NV+ ++QKFL +NF
Sbjct  7     LPQGIIQATSDLELRRLWSPSNLRSKASVYSNRNLLAVAVGIKQKHNVDVMVQKFLPDNF  66

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             TIILFHYD N+DGWWDL+WS +AIHI A +QTKWWFAKRFLHPD+VSIYDYIFLWDEDLG
Sbjct  67    TIILFHYDANLDGWWDLSWSSKAIHITAQNQTKWWFAKRFLHPDIVSIYDYIFLWDEDLG  126

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSN  760
             VE+F P+RY+EIVK EGLEISQPALDP S  IHHRITVR+RT K HRRVY+ +G+TKCS+
Sbjct  127   VEHFSPSRYIEIVKEEGLEISQPALDPNSTEIHHRITVRARTKKVHRRVYELRGNTKCSD  186

Query  759   ESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVD  580
              S+GPPC+GFVEGMAPVFSRSAW C WHLI                  QG+RT NVG+VD
Sbjct  187   ASKGPPCTGFVEGMAPVFSRSAWYCTWHLI------------------QGERTQNVGVVD  228

Query  579   SEYLVHLGIQSLG  541
             SE++VH GIQ+LG
Sbjct  229   SEFVVHKGIQTLG  241


 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 5/85 (6%)
 Frame = -1

Query  527  KGLQVLKNCQRGVLLI*ELRLDNAAIIICFFCREFSFWFWVLSIEL*MIQIRRQSTYELQ  348
            KG+Q L     GVL +    L   +I+  F C  ++      +     ++IRRQST+EL+
Sbjct  235  KGIQTL-----GVLNVILFPLLTHSILTSFSCILYTNQRHGAAAFDQRVEIRRQSTWELE  289

Query  347  IFKERWEEAVKEDKNWVDPYKASQR  273
            +F ERW  A+ EDKNWV+P+K+ ++
Sbjct  290  VFNERWNRAIAEDKNWVNPFKSDKK  314



>ref|XP_009410632.1| PREDICTED: uncharacterized protein LOC103992585 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=403

 Score =   363 bits (933),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 209/276 (76%), Gaps = 3/276 (1%)
 Frame = -3

Query  1341  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1162
             S E  C++   S  LP+GI+  +SDLE+ PL      K+K +V+   +LLA+PVGIKQK+
Sbjct  88    SCESPCISS-GSEPLPKGIVMRKSDLEMVPL--WGPPKAKESVSSQKSLLAIPVGIKQKE  144

Query  1161  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  982
              VN+I+ KF S +FT++LFHYDG VD W DL WS+ A+HI A +QTKWWFAKRFLHPD+V
Sbjct  145   IVNKIVTKFASHDFTVMLFHYDGVVDEWKDLQWSEGALHISAINQTKWWFAKRFLHPDIV  204

Query  981   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  802
             + Y YIFLWDEDL V+NFHP RYL IV+ EGLEISQPALDP    IHH+IT R R    H
Sbjct  205   APYRYIFLWDEDLEVQNFHPERYLSIVEREGLEISQPALDPAKSQIHHQITARLRKGHVH  264

Query  801   RRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGY  622
             RR+YK  G  KCS +S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL++ WG+DM LGY
Sbjct  265   RRMYKFNGGGKCSKKSSSPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIYAWGLDMNLGY  324

Query  621   CAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS  514
             CAQGDRT  VG+VDSEY+VH G+ +LGGS  K  SS
Sbjct  325   CAQGDRTKKVGVVDSEYIVHTGLPTLGGSDEKMGSS  360



>ref|XP_009410631.1| PREDICTED: uncharacterized protein LOC103992585 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=404

 Score =   363 bits (933),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 171/276 (62%), Positives = 209/276 (76%), Gaps = 3/276 (1%)
 Frame = -3

Query  1341  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1162
             S E  C++   S  LP+GI+  +SDLE+ PL      K+K +V+   +LLA+PVGIKQK+
Sbjct  89    SCESPCISS-GSEPLPKGIVMRKSDLEMVPL--WGPPKAKESVSSQKSLLAIPVGIKQKE  145

Query  1161  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  982
              VN+I+ KF S +FT++LFHYDG VD W DL WS+ A+HI A +QTKWWFAKRFLHPD+V
Sbjct  146   IVNKIVTKFASHDFTVMLFHYDGVVDEWKDLQWSEGALHISAINQTKWWFAKRFLHPDIV  205

Query  981   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  802
             + Y YIFLWDEDL V+NFHP RYL IV+ EGLEISQPALDP    IHH+IT R R    H
Sbjct  206   APYRYIFLWDEDLEVQNFHPERYLSIVEREGLEISQPALDPAKSQIHHQITARLRKGHVH  265

Query  801   RRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGY  622
             RR+YK  G  KCS +S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL++ WG+DM LGY
Sbjct  266   RRMYKFNGGGKCSKKSSSPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIYAWGLDMNLGY  325

Query  621   CAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS  514
             CAQGDRT  VG+VDSEY+VH G+ +LGGS  K  SS
Sbjct  326   CAQGDRTKKVGVVDSEYIVHTGLPTLGGSDEKMGSS  361



>gb|EEE66410.1| hypothetical protein OsJ_22755 [Oryza sativa Japonica Group]
Length=381

 Score =   362 bits (930),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 222/303 (73%), Gaps = 29/303 (10%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             +  LPRGI+ S SD+ L+PL     +    N   ++ LLAM VGI Q  NV+ + +KFL+
Sbjct  55    AEGLPRGIVHSNSDMYLRPLWDSGANPKNKN-DNHNALLAMAVGISQMQNVDIMARKFLN  113

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
             +N+T++LFHYDGNVDGW +L WS +AIHI+A +QTKWWFAKRFLHPDVV+IY +IFLWDE
Sbjct  114   QNYTVMLFHYDGNVDGWHNLEWSDKAIHILARNQTKWWFAKRFLHPDVVAIYGFIFLWDE  173

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGST  772
             DLGV+NF P RYL+I+ SEGLEI+QPALDP  S  IHHRIT+R++  K HRR+Y ++ S 
Sbjct  174   DLGVDNFDPRRYLDIMVSEGLEITQPALDPDLSTDIHHRITIRNKMMKVHRRIYDNRASM  233

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCA--------  616
              CS+ S+GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCA        
Sbjct  234   NCSDGSKGPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQHMLIENE  293

Query  615   -------------QGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLR  475
                          QGDR   VG++DSEY+VH GI SLGG SL  + +P+     R++DLR
Sbjct  294   SNQNINECSAMGFQGDRAEKVGVIDSEYVVHQGIPSLGGPSLS-SKTPR-----RSLDLR  347

Query  474   VEV  466
               +
Sbjct  348   THI  350



>ref|XP_010236941.1| PREDICTED: uncharacterized protein LOC100833044 isoform X3 [Brachypodium 
distachyon]
Length=400

 Score =   361 bits (927),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 221/313 (71%), Gaps = 28/313 (9%)
 Frame = -3

Query  1389  YQYQQAEMESKSDPLYSAEDS-------------CVTGRSSSS-----------LPRGII  1282
             YQ++Q  +E+KS P  +  +S              V+GR++             LP GI+
Sbjct  16    YQHRQTALEAKSRPFDTMIESDGAAVKVSDGAAVKVSGRAAVKVSERAAGRIGFLPHGIV  75

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             E  SD+ELKPL   S  +S+ +      L+A+P GI QK +V+ I++KFL ENFT ILFH
Sbjct  76    EPYSDMELKPLWLTSSVQSQKSNQNDRCLIAIPAGINQKKSVDAIMKKFLPENFTAILFH  135

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+YDYIFLWDEDL V+NF+P
Sbjct  136   YDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYDYIFLWDEDLEVDNFNP  195

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  742
              RYL IVKSE L ISQP LDPK   IHH ITVR +T  FHRRV   + +  CS   EGPP
Sbjct  196   RRYLNIVKSERLVISQPGLDPKLSEIHHPITVRKKTGNFHRRV--SRANKDCSR--EGPP  251

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             CSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT ++G+VDSE++VH
Sbjct  252   CSGWVEGMAPVFSKSAWKCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKHIGVVDSEFVVH  311

Query  561   LGIQSLGGSSLKR  523
              G+Q+LGGS++ +
Sbjct  312   RGVQTLGGSAMTK  324



>gb|EEE67421.1| hypothetical protein OsJ_24761 [Oryza sativa Japonica Group]
Length=437

 Score =   362 bits (929),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 180/311 (58%), Positives = 217/311 (70%), Gaps = 30/311 (10%)
 Frame = -3

Query  1407  LYRTTIYQYQQAEMESKSDPLYSAE-----DSCVTGRSSSS---LPRGIIESRSDLELKP  1252
             +Y    YQ++Q ++E+KS P  +        S V+ RS++    LP GI+E  SD+ELKP
Sbjct  83    VYNMASYQHKQTKLEAKSRPFDTITVSDKVSSKVSKRSANRVGFLPHGIVEPYSDMELKP  142

Query  1251  LKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWD  1072
             L     ++SK +      LLA+P GI QK +V+ I++KFL ENFT++LFHYDGNVDGW D
Sbjct  143   LWLTRSAQSKDSSQKDRCLLAIPAGIDQKRSVDAIMKKFLPENFTVMLFHYDGNVDGWND  202

Query  1071  LAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSE  892
             L WSK  IHI A +QTKWWFAKRFLHP VVS+Y+YIFLWDEDL V+NFHP RYL IVKSE
Sbjct  203   LPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYEYIFLWDEDLEVDNFHPRRYLNIVKSE  262

Query  891   GLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAP  712
             GLEISQP LDPK   IHHRITVR +   FHR                      +VEGMAP
Sbjct  263   GLEISQPGLDPKLSEIHHRITVRKKGWSFHR----------------------WVEGMAP  300

Query  711   VFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  532
             VFSRSAWRC WHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSEY+VH G+Q+LGG S
Sbjct  301   VFSRSAWRCAWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEYIVHRGVQTLGGPS  360

Query  531   LKRASSPQELP  499
             +KR+      P
Sbjct  361   VKRSHGKNNDP  371



>ref|XP_003608157.1| Lysine ketoglutarate reductase trans-splicing-like protein, partial 
[Medicago truncatula]
Length=305

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 173/273 (63%), Positives = 208/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTG-RSSSSLPRG  1288
             +K+K + F+ + C+ MLF+LYRT  YQY+Q E+  K+  +   ++   T       LPRG
Sbjct  11    LKIKRLPFMAVACIVMLFVLYRTLKYQYKQEEIIDKNWSILREQERYSTHFEELKGLPRG  70

Query  1287  IIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIIL  1108
             II + SD EL+PL   S  +SKV+V    NLLA+ VGIKQK NV+ ++QKFL+ NFTIIL
Sbjct  71    IIHTTSDFELRPLWLRS--RSKVSVYTKRNLLAVAVGIKQKYNVDAMVQKFLTGNFTIIL  128

Query  1107  FHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENF  928
             FHYD NVDGW DL WS + IHI A  QTKWWFAKRFLHPD+V IYDYIFLWDEDL VENF
Sbjct  129   FHYDANVDGWQDLDWSSKVIHIAAKKQTKWWFAKRFLHPDIVYIYDYIFLWDEDLEVENF  188

Query  927   HPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  748
              P+RY++IV+ EGLEISQPAL P S  IHHRITVR+RT K HRRVY+ +G TKCS+ES+G
Sbjct  189   SPSRYVKIVREEGLEISQPALHPNSTEIHHRITVRARTKKVHRRVYERRGKTKCSDESDG  248

Query  747   PPCSGFVEGMAPVFSRSAWRCVWHLIQ-NDLVH  652
             PPC+GFVEGMAPVFSRSAW C WHLIQ N +VH
Sbjct  249   PPCTGFVEGMAPVFSRSAWFCTWHLIQVNSMVH  281



>ref|XP_010236937.1| PREDICTED: uncharacterized protein LOC100833044 isoform X1 [Brachypodium 
distachyon]
Length=420

 Score =   361 bits (927),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 179/313 (57%), Positives = 221/313 (71%), Gaps = 28/313 (9%)
 Frame = -3

Query  1389  YQYQQAEMESKSDPLYSAEDS-------------CVTGRSSSS-----------LPRGII  1282
             YQ++Q  +E+KS P  +  +S              V+GR++             LP GI+
Sbjct  36    YQHRQTALEAKSRPFDTMIESDGAAVKVSDGAAVKVSGRAAVKVSERAAGRIGFLPHGIV  95

Query  1281  ESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             E  SD+ELKPL   S  +S+ +      L+A+P GI QK +V+ I++KFL ENFT ILFH
Sbjct  96    EPYSDMELKPLWLTSSVQSQKSNQNDRCLIAIPAGINQKKSVDAIMKKFLPENFTAILFH  155

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG V+ W DL WSK  IHI A +QTKWWFAKRFLHP VVS+YDYIFLWDEDL V+NF+P
Sbjct  156   YDGKVNEWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSMYDYIFLWDEDLEVDNFNP  215

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPP  742
              RYL IVKSE L ISQP LDPK   IHH ITVR +T  FHRRV   + +  CS   EGPP
Sbjct  216   RRYLNIVKSERLVISQPGLDPKLSEIHHPITVRKKTGNFHRRV--SRANKDCSR--EGPP  271

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             CSG+VEGMAPVFS+SAW+C WHLIQNDLVHGWG+D K GYCAQGDRT ++G+VDSE++VH
Sbjct  272   CSGWVEGMAPVFSKSAWKCAWHLIQNDLVHGWGIDYKFGYCAQGDRTKHIGVVDSEFVVH  331

Query  561   LGIQSLGGSSLKR  523
              G+Q+LGGS++ +
Sbjct  332   RGVQTLGGSAMTK  344



>ref|XP_010657948.1| PREDICTED: uncharacterized protein LOC100255698 isoform X4 [Vitis 
vinifera]
Length=400

 Score =   360 bits (923),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 234/345 (68%), Gaps = 25/345 (7%)
 Frame = -3

Query  1443  FIG--LFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS-----------  1303
             FIG  LFC  + FI    T+  Y+      +     +A  + +    SS           
Sbjct  23    FIGACLFC-GVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPSGS  81

Query  1302  -SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+  
Sbjct  82    EALPEGIVVKTSNLEVQPLWGATLNGEKSSPS--KSLLAMAVGIKQKEIVNQIVEKFILS  139

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWDED
Sbjct  140   NFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWDED  199

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS +C
Sbjct  200   LGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSGRC  259

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
              ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NVG+
Sbjct  260   DDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNVGV  319

Query  585   VDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRAVDLR  475
             VDSEY+VHL + +LG        G     +S  ++LPK  A+  R
Sbjct  320   VDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVALVRR  364



>ref|XP_010657947.1| PREDICTED: uncharacterized protein LOC100255698 isoform X3 [Vitis 
vinifera]
Length=408

 Score =   360 bits (924),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 233/342 (68%), Gaps = 25/342 (7%)
 Frame = -3

Query  1443  FIG--LFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS-----------  1303
             FIG  LFC  + FI    T+  Y+      +     +A  + +    SS           
Sbjct  18    FIGACLFC-GVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPSGS  76

Query  1302  -SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+  
Sbjct  77    EALPEGIVVKTSNLEVQPLWGATLNGEKSSPSK--SLLAMAVGIKQKEIVNQIVEKFILS  134

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWDED
Sbjct  135   NFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWDED  194

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS +C
Sbjct  195   LGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSGRC  254

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
              ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NVG+
Sbjct  255   DDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNVGV  314

Query  585   VDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRAV  484
             VDSEY+VHL + +LG        G     +S  ++LPK  A+
Sbjct  315   VDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVAL  356



>ref|XP_010657946.1| PREDICTED: uncharacterized protein LOC100255698 isoform X2 [Vitis 
vinifera]
Length=410

 Score =   360 bits (923),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 233/342 (68%), Gaps = 25/342 (7%)
 Frame = -3

Query  1443  FIG--LFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS-----------  1303
             FIG  LFC  + FI    T+  Y+      +     +A  + +    SS           
Sbjct  20    FIGACLFC-GVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPSGS  78

Query  1302  -SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+  
Sbjct  79    EALPEGIVVKTSNLEVQPLWGATLNGEKSSPSK--SLLAMAVGIKQKEIVNQIVEKFILS  136

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWDED
Sbjct  137   NFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWDED  196

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS +C
Sbjct  197   LGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSGRC  256

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
              ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NVG+
Sbjct  257   DDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNVGV  316

Query  585   VDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRAV  484
             VDSEY+VHL + +LG        G     +S  ++LPK  A+
Sbjct  317   VDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVAL  358



>ref|XP_002265374.2| PREDICTED: uncharacterized protein LOC100255698 isoform X1 [Vitis 
vinifera]
 ref|XP_010657945.1| PREDICTED: uncharacterized protein LOC100255698 isoform X1 [Vitis 
vinifera]
 emb|CBI29673.3| unnamed protein product [Vitis vinifera]
Length=413

 Score =   360 bits (923),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 233/342 (68%), Gaps = 25/342 (7%)
 Frame = -3

Query  1443  FIG--LFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSS-----------  1303
             FIG  LFC  + FI    T+  Y+      +     +A  + +    SS           
Sbjct  23    FIGACLFC-GVYFIASEFTVKDYKDRSSRWQISVFQNAHSNSIQNTQSSKCKNQCRPSGS  81

Query  1302  -SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSE  1126
              +LP GI+   S+LE++PL   +++  K + +   +LLAM VGIKQK+ VN+I++KF+  
Sbjct  82    EALPEGIVVKTSNLEVQPLWGATLNGEKSSPS--KSLLAMAVGIKQKEIVNQIVEKFILS  139

Query  1125  NFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDED  946
             NF ++LFHYDG VD W + AWS  AIH+   +QTKWWFAKRFLHPD+V+ Y+YIFLWDED
Sbjct  140   NFVVMLFHYDGVVDEWREFAWSDHAIHVTVVNQTKWWFAKRFLHPDIVAEYNYIFLWDED  199

Query  945   LGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             LGVENFHP RY+ IV+ EGLEISQPALDPK   +HH+IT R R ++ HRR YK +GS +C
Sbjct  200   LGVENFHPGRYVSIVEDEGLEISQPALDPKKSRVHHQITARVRNSRVHRRTYKHRGSGRC  259

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGI  586
              ++S  PPC G+VE MAPVFS++AWRCVWH+IQN+L+H WG+DM+LGYCAQGDRT NVG+
Sbjct  260   DDQSTAPPCVGWVEMMAPVFSKAAWRCVWHMIQNELIHAWGVDMQLGYCAQGDRTKNVGV  319

Query  585   VDSEYLVHLGIQSLG--------GSSLKRASSPQELPKGRAV  484
             VDSEY+VHL + +LG        G     +S  ++LPK  A+
Sbjct  320   VDSEYVVHLALPTLGVLDENELRGEGHDHSSLREKLPKSVAL  361



>ref|XP_006285943.1| hypothetical protein CARUB_v10007463mg [Capsella rubella]
 gb|EOA18841.1| hypothetical protein CARUB_v10007463mg [Capsella rubella]
Length=382

 Score =   358 bits (920),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 162/267 (61%), Positives = 203/267 (76%), Gaps = 5/267 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL        K N     NLLAM  GIKQK++VN+I++KFLS
Sbjct  65    SETLPRGIVASTSDLEMRPLWG-----GKRNTKPKLNLLAMAAGIKQKESVNKIVKKFLS  119

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   SEFVVMLFHYDGAVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  179

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R + ++ HRR YK  G T+
Sbjct  180   DLGVDHFDARRYVSIIKEEGLEISQPALDPNFSEVHHQLTSRDKKSRVHRRTYKVIGRTR  239

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CNENSTGPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTRNIG  299

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             IVDSEY++H+G+ +LGGS+  +  S Q
Sbjct  300   IVDSEYILHMGLPTLGGSAENKTGSDQ  326



>ref|XP_009139663.1| PREDICTED: uncharacterized protein LOC103863665 isoform X5 [Brassica 
rapa]
Length=382

 Score =   358 bits (918),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/275 (59%), Positives = 207/275 (75%), Gaps = 6/275 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  254

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  588   IVDSEYLVHLGIQSLGGSSL-KRASSPQELPKGRA  487
             IVDSEY++HLG+ +LGGS+  K+ SS  ++   R+
Sbjct  315   IVDSEYILHLGLPTLGGSAENKKPSSTSQMSSARS  349



>ref|XP_006602841.1| PREDICTED: uncharacterized protein LOC100798633 [Glycine max]
Length=383

 Score =   358 bits (918),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 177/333 (53%), Positives = 229/333 (69%), Gaps = 19/333 (6%)
 Frame = -3

Query  1440  IGLFCVSMLFIL------YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIE  1279
             + L CV +LF        Y   + +++    + K+D   + ++ C TG  S +LP GII 
Sbjct  32    VSLLCVVLLFSTLFFAQRYNEKLLRWKMNIKKLKND---NCKNQCRTG-GSHALPEGIIS  87

Query  1278  SRSDLELKPLKAMSISKSKVNV-TGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFH  1102
             + SDLE++ L  + ++K+  N      NL AM VGIKQKD VN++++KFLS NF ++LFH
Sbjct  88    NTSDLEMRHLWDLPMTKTIENKENASTNLFAMAVGIKQKDLVNKLVKKFLSSNFVVMLFH  147

Query  1101  YDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHP  922
             YDG VD W D  W+   IH+   +Q+KWWFAKRFLHPD+V+ Y YIFLWDEDLGVE+FHP
Sbjct  148   YDGIVDEWNDFEWNNHVIHVAVANQSKWWFAKRFLHPDIVAEYGYIFLWDEDLGVEHFHP  207

Query  921   ARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNESEGP  745
              RY+ I+KSEGLEISQPALD     +HH+IT R R +  HRR+YK  GS K C   S  P
Sbjct  208   DRYVSIIKSEGLEISQPALDSNKSEVHHQITARGRRSNVHRRIYKTGGSGKRCDESSTAP  267

Query  744   PCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLV  565
             PC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DM+LGYCAQGDRT NVG+VD+EY+V
Sbjct  268   PCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMQLGYCAQGDRTKNVGVVDAEYIV  327

Query  564   HLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             H G  +LGG  +   SS       R  D RV+V
Sbjct  328   HYGHPTLGGLDVNEVSS-------RTKDHRVDV  353



>ref|XP_010935615.1| PREDICTED: uncharacterized protein LOC105055478 isoform X2 [Elaeis 
guineensis]
Length=330

 Score =   355 bits (912),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 195/232 (84%), Gaps = 5/232 (2%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTG-YHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             LPRG+++S SD+ELKPL     S S+ +++G Y  LLAM VGI QK NV+ +++KFL +N
Sbjct  54    LPRGVVQSTSDMELKPLWK---SSSQKDISGKYTALLAMAVGISQKQNVDILVRKFLIDN  110

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
              +IILFHYDGNVDGW DL WS +AIHI+AH+QTKWWFAKRFLHPDVVS YDYIFLWDEDL
Sbjct  111   CSIILFHYDGNVDGWHDLEWSDKAIHILAHNQTKWWFAKRFLHPDVVSTYDYIFLWDEDL  170

Query  942   GVENFHPARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKC  766
             GVENFH  RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HRRVY  +GS  C
Sbjct  171   GVENFHLGRYLQIMASEGLEISQPALDPDQSSEIHHRITVRDRKAKVHRRVYDFRGSLNC  230

Query  765   SNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQG  610
             S+ES GPPC+G+VEGMAPVFSR+AWRCVWHLIQNDL+HGWG+DMKLGYCAQ 
Sbjct  231   SDESRGPPCTGWVEGMAPVFSRAAWRCVWHLIQNDLIHGWGLDMKLGYCAQA  282



>ref|XP_009139659.1| PREDICTED: uncharacterized protein LOC103863665 isoform X1 [Brassica 
rapa]
 emb|CDY39713.1| BnaA04g07220D [Brassica napus]
Length=400

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 202/267 (76%), Gaps = 5/267 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  254

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             IVDSEY++HLG+ +LGGS+  +  S Q
Sbjct  315   IVDSEYILHLGLPTLGGSAENKIDSEQ  341



>ref|XP_009139661.1| PREDICTED: uncharacterized protein LOC103863665 isoform X3 [Brassica 
rapa]
Length=395

 Score =   358 bits (918),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 202/267 (76%), Gaps = 5/267 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  75    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  129

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  130   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  189

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  190   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  249

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  250   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  309

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             IVDSEY++HLG+ +LGGS+  +  S Q
Sbjct  310   IVDSEYILHLGLPTLGGSAENKIDSEQ  336



>ref|XP_010557744.1| PREDICTED: uncharacterized protein LOC104826643 isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010557745.1| PREDICTED: uncharacterized protein LOC104826643 isoform X2 [Tarenaya 
hassleriana]
Length=373

 Score =   356 bits (913),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/259 (62%), Positives = 201/259 (78%), Gaps = 5/259 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ + SDLE++PL  +  +K         NLLAM  GIKQK+NVN+I++KF S
Sbjct  65    SETLPRGIVANTSDLEMRPLWGIVRNKKP-----KLNLLAMATGIKQKENVNKIVKKFPS  119

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F +++FHYDG VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+VS Y Y+FLWDE
Sbjct  120   NEFVVMMFHYDGIVDEWKEFDWSETAIHVSAINQTKWWFAKRFLHPDIVSAYSYVFLWDE  179

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGVE+F   RYL IVK EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G  K
Sbjct  180   DLGVEHFDARRYLSIVKEEGLEISQPALDPRSSELHHQITARDSKSRVHRRTYKVIGRAK  239

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GF+E MAPVFS++AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CNENSAGPPCTGFIEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTRNIG  299

Query  588   IVDSEYLVHLGIQSLGGSS  532
             IVDSEYL+H+G+ +LGGS+
Sbjct  300   IVDSEYLLHMGLPTLGGSA  318



>ref|XP_009139660.1| PREDICTED: uncharacterized protein LOC103863665 isoform X2 [Brassica 
rapa]
Length=399

 Score =   357 bits (916),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 164/276 (59%), Positives = 206/276 (75%), Gaps = 6/276 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDATRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDNKSRVHRRTYKVIGKAR  254

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVD  481
             IVDSEY++HLG+ +LGGS+  +  S Q L K +  D
Sbjct  315   IVDSEYILHLGLPTLGGSAENKIDSEQ-LDKTKTED  349



>emb|CDY60485.1| BnaC04g55870D [Brassica napus]
Length=400

 Score =   357 bits (916),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 161/267 (60%), Positives = 202/267 (76%), Gaps = 5/267 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM VGIKQK++VN+I++KF S
Sbjct  80    SETLPRGIVASTSDLEMRPLWG-----AKRNKNPKQNLLAMAVGIKQKESVNKILKKFSS  134

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  135   SEFVVMLFHYDGTVDEWKEFEWSETAIHVSVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  194

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I++ EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  195   DLGVDHFDAKRYVSIIREEGLEISQPALDPNLSEVHHQLTSRDSKSRVHRRTYKVIGKAR  254

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  255   CNENSTGPPCTGFVEMMAPVFSRAAWRCAWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  314

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             IVDSEY++HLG+ +LGGS+  +  S Q
Sbjct  315   IVDSEYILHLGLPTLGGSAENKIDSEQ  341



>ref|XP_010557742.1| PREDICTED: uncharacterized protein LOC104826643 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557743.1| PREDICTED: uncharacterized protein LOC104826643 isoform X1 [Tarenaya 
hassleriana]
Length=387

 Score =   356 bits (914),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 161/259 (62%), Positives = 201/259 (78%), Gaps = 5/259 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ + SDLE++PL  +  +K         NLLAM  GIKQK+NVN+I++KF S
Sbjct  79    SETLPRGIVANTSDLEMRPLWGIVRNKKP-----KLNLLAMATGIKQKENVNKIVKKFPS  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F +++FHYDG VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+VS Y Y+FLWDE
Sbjct  134   NEFVVMMFHYDGIVDEWKEFDWSETAIHVSAINQTKWWFAKRFLHPDIVSAYSYVFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGVE+F   RYL IVK EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G  K
Sbjct  194   DLGVEHFDARRYLSIVKEEGLEISQPALDPRSSELHHQITARDSKSRVHRRTYKVIGRAK  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GF+E MAPVFS++AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  254   CNENSAGPPCTGFIEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTRNIG  313

Query  588   IVDSEYLVHLGIQSLGGSS  532
             IVDSEYL+H+G+ +LGGS+
Sbjct  314   IVDSEYLLHMGLPTLGGSA  332



>ref|XP_006414995.1| hypothetical protein EUTSA_v10025444mg [Eutrema salsugineum]
 gb|ESQ56448.1| hypothetical protein EUTSA_v10025444mg [Eutrema salsugineum]
Length=385

 Score =   355 bits (912),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 162/265 (61%), Positives = 200/265 (75%), Gaps = 5/265 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S+SDLE++PL       +K N     NLLAM  GIKQK++VN+I+ KF S
Sbjct  65    SETLPRGIVASKSDLEMRPLWG-----AKRNKKPKQNLLAMAAGIKQKESVNKIVNKFSS  119

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG+VD W +  WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   SEFVVMLFHYDGSVDEWKEFEWSETAIHISVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  179

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV+NF   RY+ I+K EGLEISQPALDP    +HH+ T R   ++ HRR YK  G  +
Sbjct  180   DLGVDNFDARRYVSIIKEEGLEISQPALDPHLSEVHHQHTSRENKSRVHRRTYKVIGRAR  239

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CNENSTGPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  299

Query  588   IVDSEYLVHLGIQSLGGSSLKRASS  514
             IVDSEY++HLG+ +LGGS+  +  S
Sbjct  300   IVDSEYILHLGLPTLGGSAENKTDS  324



>ref|XP_009384294.1| PREDICTED: uncharacterized protein LOC103971874 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=338

 Score =   353 bits (906),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 170/282 (60%), Positives = 206/282 (73%), Gaps = 3/282 (1%)
 Frame = -3

Query  1335  EDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNV  1156
             + +C++   S  LP+GI+   SD+E+ PL        K N     +LLAMPVGIKQK+ V
Sbjct  19    QSTCISS-GSEPLPKGIVCQTSDMEMVPL--WGPPNGKENNILQKSLLAMPVGIKQKEIV  75

Query  1155  NEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSI  976
             N+II KF S +FTIILFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ 
Sbjct  76    NQIIIKFASSDFTIILFHYDGVVDEWKDLQWSGSALHISAINQTKWWFAKRFLHPDIVAP  135

Query  975   YDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRR  796
             Y Y+FLWDEDL VENFHP +YL IV+ EGLEISQPAL+P    IHH+ITVRSR    HRR
Sbjct  136   YKYVFLWDEDLEVENFHPEKYLAIVEREGLEISQPALEPAKSRIHHQITVRSRKGDVHRR  195

Query  795   VYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCA  616
             +YK  G +KC   S  PPC+G+VE MAPVFSR+AWRC WH+IQ+DL+H WG+DMKLGYCA
Sbjct  196   MYKFNGGSKCYQNSSAPPCTGWVELMAPVFSRAAWRCAWHMIQSDLIHAWGLDMKLGYCA  255

Query  615   QGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGR  490
             QGDR+ NVG+VDSEY+VH G+ +LG    K  SS +     R
Sbjct  256   QGDRSKNVGVVDSEYIVHKGLPTLGWFDEKTVSSERPAANNR  297



>ref|XP_010527349.1| PREDICTED: uncharacterized protein LOC104804705 isoform X2 [Tarenaya 
hassleriana]
Length=378

 Score =   354 bits (909),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 203/259 (78%), Gaps = 5/259 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ + SDLE++PL   ++ K K  +    NLLAM  GIKQK+NVN+I++KF S
Sbjct  65    SETLPRGIVANTSDLEMRPLWG-TVRKKKPKM----NLLAMATGIKQKENVNKIVKKFPS  119

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS  A+H+ A +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   NEFVVMLFHYDGIVDEWKEFEWSGTALHVSAINQTKWWFAKRFLHPDIVSSYSYIFLWDE  179

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RYL I++ EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G T+
Sbjct  180   DLGVDHFDATRYLSIIREEGLEISQPALDPRSSELHHQITARDNKSRVHRRTYKVIGRTR  239

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFS++AWRC WH+IQNDL HGWG+D +LGYC+QGDRT N+G
Sbjct  240   CNENSTGPPCTGFVEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCSQGDRTKNIG  299

Query  588   IVDSEYLVHLGIQSLGGSS  532
             +VDSEYL+H+G+ +LGGS+
Sbjct  300   VVDSEYLLHMGLPTLGGSA  318



>ref|XP_010527348.1| PREDICTED: uncharacterized protein LOC104804705 isoform X1 [Tarenaya 
hassleriana]
Length=392

 Score =   355 bits (911),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 159/259 (61%), Positives = 203/259 (78%), Gaps = 5/259 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ + SDLE++PL   ++ K K  +    NLLAM  GIKQK+NVN+I++KF S
Sbjct  79    SETLPRGIVANTSDLEMRPLWG-TVRKKKPKM----NLLAMATGIKQKENVNKIVKKFPS  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS  A+H+ A +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   NEFVVMLFHYDGIVDEWKEFEWSGTALHVSAINQTKWWFAKRFLHPDIVSSYSYIFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RYL I++ EGLEISQPALDP+S  +HH+IT R   ++ HRR YK  G T+
Sbjct  194   DLGVDHFDATRYLSIIREEGLEISQPALDPRSSELHHQITARDNKSRVHRRTYKVIGRTR  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFS++AWRC WH+IQNDL HGWG+D +LGYC+QGDRT N+G
Sbjct  254   CNENSTGPPCTGFVEMMAPVFSKAAWRCTWHMIQNDLNHGWGIDFQLGYCSQGDRTKNIG  313

Query  588   IVDSEYLVHLGIQSLGGSS  532
             +VDSEYL+H+G+ +LGGS+
Sbjct  314   VVDSEYLLHMGLPTLGGSA  332



>ref|XP_002527278.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35122.1| conserved hypothetical protein [Ricinus communis]
Length=382

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 165/273 (60%), Positives = 206/273 (75%), Gaps = 6/273 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ + SDLE + L        + N+    N+LAM VGIKQK NV++II+KFLS
Sbjct  72    SETLPRGIVSATSDLERRQL----FGHHEKNLKKPSNILAMAVGIKQKKNVDKIIKKFLS  127

Query  1128  --ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLW  955
                +F ++LFHYDG VD W DL WS  AIHI A +QTKWWFAKRFLHPD+VS YDYIFLW
Sbjct  128   SDNDFVLMLFHYDGVVDEWRDLEWSSRAIHIAAVNQTKWWFAKRFLHPDIVSEYDYIFLW  187

Query  954   DEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGS  775
             DEDLG++NFHP RYL I+K EGLEISQPALDPK   +HH++T R   ++ HRR+ K  G 
Sbjct  188   DEDLGIDNFHPGRYLSIIKEEGLEISQPALDPKKSEVHHQLTKRCNGSRVHRRINKQIGI  247

Query  774   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  595
             ++C     GPPCSGFVE MAPVFS+++WRC W++IQNDLVHGWG+D +LGYCAQGD T N
Sbjct  248   SRCDKNVTGPPCSGFVEMMAPVFSKASWRCTWYMIQNDLVHGWGVDFQLGYCAQGDPTKN  307

Query  594   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPK  496
             VGIVDSEY++H G+ +LGGS+  +A    + P+
Sbjct  308   VGIVDSEYIIHYGLPTLGGSATDKAQLLSKQPQ  340



>ref|XP_002982728.1| hypothetical protein SELMODRAFT_116806 [Selaginella moellendorffii]
 gb|EFJ16481.1| hypothetical protein SELMODRAFT_116806 [Selaginella moellendorffii]
Length=351

 Score =   353 bits (907),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/298 (58%), Positives = 214/298 (72%), Gaps = 22/298 (7%)
 Frame = -3

Query  1404  YRTTIYQYQQAE-----MESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAM  1240
             Y + I+ Y Q+      ++SK  P           R S +LPRGI+E+ SD+ELKPL   
Sbjct  16    YVSNIFLYSQSAVACLTLQSKRCP-----------RGSEALPRGIVEAASDMELKPLWRS  64

Query  1239  SISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWS  1060
             S  K+        +LLA+  GI+QK  V++I +KF   NFTI+LFHYDG VD W DL W 
Sbjct  65    SKKKALQK-----SLLAIAAGIQQKRGVDQIARKFPVTNFTIMLFHYDGVVDRWSDLPWF  119

Query  1059  KEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEI  880
               AIHIVA +QTKWWFAKRF+HPDVVS Y++IF+WDEDLGV++F   RYLEIV+ EGL+I
Sbjct  120   GSAIHIVAINQTKWWFAKRFMHPDVVSAYEFIFVWDEDLGVDHFRADRYLEIVRKEGLQI  179

Query  879   SQPALDPK-SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFS  703
             SQPALDP  S  +HHRITVR++  + HRR+Y ++G   C N S  PPC+G+VE MAPVFS
Sbjct  180   SQPALDPSLSSEVHHRITVRNKKTRVHRRIYMNRGREYCGNNSTQPPCTGWVEMMAPVFS  239

Query  702   RSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSL  529
             RSAWRC WHLIQNDLVHGWGMDMKLGYCA+GD T NVG+VD++YL+H GI SLGG   
Sbjct  240   RSAWRCAWHLIQNDLVHGWGMDMKLGYCAEGDPTRNVGVVDTQYLIHRGIPSLGGGKF  297



>ref|XP_010929765.1| PREDICTED: uncharacterized protein LOC105051150 isoform X5 [Elaeis 
guineensis]
Length=369

 Score =   353 bits (907),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/268 (59%), Positives = 202/268 (75%), Gaps = 1/268 (0%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  35    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  94

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  95    SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  154

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  155   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  214

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  215   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  274

Query  591   GIVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             G+VDSEY+VH+G  +LGG    ++++ Q
Sbjct  275   GVVDSEYIVHMGTPTLGGFDENKSNAEQ  302



>ref|XP_009384293.1| PREDICTED: uncharacterized protein LOC103971874 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=409

 Score =   355 bits (911),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 171/284 (60%), Positives = 207/284 (73%), Gaps = 3/284 (1%)
 Frame = -3

Query  1341  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1162
             S + +C++   S  LP+GI+   SD+E+ PL        K N     +LLAMPVGIKQK+
Sbjct  88    SCKSTCISS-GSEPLPKGIVCQTSDMEMVPL--WGPPNGKENNILQKSLLAMPVGIKQKE  144

Query  1161  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  982
              VN+II KF S +FTIILFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V
Sbjct  145   IVNQIIIKFASSDFTIILFHYDGVVDEWKDLQWSGSALHISAINQTKWWFAKRFLHPDIV  204

Query  981   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  802
             + Y Y+FLWDEDL VENFHP +YL IV+ EGLEISQPAL+P    IHH+ITVRSR    H
Sbjct  205   APYKYVFLWDEDLEVENFHPEKYLAIVEREGLEISQPALEPAKSRIHHQITVRSRKGDVH  264

Query  801   RRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGY  622
             RR+YK  G +KC   S  PPC+G+VE MAPVFSR+AWRC WH+IQ+DL+H WG+DMKLGY
Sbjct  265   RRMYKFNGGSKCYQNSSAPPCTGWVELMAPVFSRAAWRCAWHMIQSDLIHAWGLDMKLGY  324

Query  621   CAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGR  490
             CAQGDR+ NVG+VDSEY+VH G+ +LG    K  SS +     R
Sbjct  325   CAQGDRSKNVGVVDSEYIVHKGLPTLGWFDEKTVSSERPAANNR  368



>gb|KDO75812.1| hypothetical protein CISIN_1g015555mg [Citrus sinensis]
Length=269

 Score =   350 bits (897),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 161/246 (65%), Positives = 193/246 (78%), Gaps = 0/246 (0%)
 Frame = -3

Query  1464  VKMKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             VKMK +QF+ + C  MLF++YRTT YQY+Q EME+K  P   ++ S  +     SLPRGI
Sbjct  23    VKMKQLQFMAIMCTVMLFVVYRTTYYQYKQTEMEAKFSPFDISKGSRFSSGRLKSLPRGI  82

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +++RSDLEL+PL + S S+ K  V    NLLA+P GIKQKDNV+ I++KFL ENFT+ILF
Sbjct  83    VQARSDLELRPLWSTSSSRKKFGVYSNRNLLAIPAGIKQKDNVDAIVRKFLPENFTVILF  142

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDG+V+ W  L WS +AIHI A +QTKWWFAKRFLHPDVVS YDYIFLWDEDLGVENF 
Sbjct  143   HYDGDVNAWRGLDWSNKAIHIAAQNQTKWWFAKRFLHPDVVSNYDYIFLWDEDLGVENFD  202

Query  924   PARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGP  745
             P RYLEIVKSEG EISQPALDP S  IHH+ T+R+RT KFHRRVY  +GS KC+N SEGP
Sbjct  203   PRRYLEIVKSEGFEISQPALDPNSTEIHHKFTIRARTKKFHRRVYDLRGSVKCTNISEGP  262

Query  744   PCSGFV  727
             PC+G+V
Sbjct  263   PCTGYV  268



>ref|XP_009385148.1| PREDICTED: uncharacterized protein LOC103972515 [Musa acuminata 
subsp. malaccensis]
Length=383

 Score =   353 bits (907),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 163/273 (60%), Positives = 204/273 (75%), Gaps = 2/273 (1%)
 Frame = -3

Query  1302  SLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
             +LP+G++   SDLE +PL   SI K K N + + NLLA+ VG+KQK  VNEI++KFL  N
Sbjct  80    ALPKGMVSQTSDLERQPLWG-SIEK-KGNSSSFKNLLAIAVGLKQKQVVNEIVKKFLFSN  137

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FTIILFHYDG VD W DL WS   +HI A +QTKWWFAKRFLHPD+V++Y YIFLWDED+
Sbjct  138   FTIILFHYDGVVDEWSDLEWSDTVLHISAINQTKWWFAKRFLHPDIVALYSYIFLWDEDI  197

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCS  763
             GVENFHP RYLEIV+ EGL++SQP LD +   +H+R T R R    HRR+Y      +C+
Sbjct  198   GVENFHPGRYLEIVEREGLDVSQPGLDTEKSKVHYRFTERQREGDVHRRIYDLAQGLRCN  257

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
               S G PC+GFVE MAPVF+ SAWRC WH+IQNDL+H WG+DMKLGYC+QGDRT  VG+V
Sbjct  258   ENSTGFPCAGFVEMMAPVFTWSAWRCAWHMIQNDLIHAWGLDMKLGYCSQGDRTKKVGVV  317

Query  582   DSEYLVHLGIQSLGGSSLKRASSPQELPKGRAV  484
             DSEY+ H+GI +LGGS++++ S+       RA 
Sbjct  318   DSEYITHMGIPTLGGSNVRKDSNGSSTTNLRAA  350



>gb|KCW57155.1| hypothetical protein EUGRSUZ_I02788 [Eucalyptus grandis]
Length=386

 Score =   353 bits (907),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 221/328 (67%), Gaps = 12/328 (4%)
 Frame = -3

Query  1443  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1270
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  39    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  96

Query  1269  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  1090
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  97    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  154

Query  1089  VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  910
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  155   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  214

Query  909   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  730
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  215   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  274

Query  729   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  550
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  275   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  334

Query  549   SLGGS------SLKRASSPQELPKGRAV  484
             +LG          K   S ++LP   AV
Sbjct  335   TLGAGLKNQVHDHKPVHSAKDLPSAGAV  362



>ref|XP_010929762.1| PREDICTED: uncharacterized protein LOC105051150 isoform X2 [Elaeis 
guineensis]
Length=407

 Score =   354 bits (908),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 159/268 (59%), Positives = 202/268 (75%), Gaps = 1/268 (0%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  74    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  133

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  134   SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  193

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  194   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  253

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  254   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  313

Query  591   GIVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             G+VDSEY+VH+G  +LGG    ++++ Q
Sbjct  314   GVVDSEYIVHMGTPTLGGFDENKSNAEQ  341



>ref|XP_010929761.1| PREDICTED: uncharacterized protein LOC105051150 isoform X1 [Elaeis 
guineensis]
Length=408

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/268 (59%), Positives = 202/268 (75%), Gaps = 1/268 (0%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  74    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  133

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  134   SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  193

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  194   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  253

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  254   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  313

Query  591   GIVDSEYLVHLGIQSLGGSSLKRASSPQ  508
             G+VDSEY+VH+G  +LGG    ++++ Q
Sbjct  314   GVVDSEYIVHMGTPTLGGFDENKSNAEQ  341



>ref|XP_010030218.1| PREDICTED: uncharacterized protein LOC104420022 isoform X2 [Eucalyptus 
grandis]
Length=394

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 221/328 (67%), Gaps = 12/328 (4%)
 Frame = -3

Query  1443  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1270
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  25    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  82

Query  1269  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  1090
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  83    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  140

Query  1089  VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  910
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  141   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  200

Query  909   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  730
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  201   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  260

Query  729   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  550
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  261   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  320

Query  549   SLGGS------SLKRASSPQELPKGRAV  484
             +LG          K   S ++LP   AV
Sbjct  321   TLGAGLKNQVHDHKPVHSAKDLPSAGAV  348



>ref|XP_010030219.1| PREDICTED: uncharacterized protein LOC104420022 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010030220.1| PREDICTED: uncharacterized protein LOC104420022 isoform X3 [Eucalyptus 
grandis]
 gb|KCW57156.1| hypothetical protein EUGRSUZ_I02788 [Eucalyptus grandis]
Length=390

 Score =   353 bits (906),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 221/328 (67%), Gaps = 12/328 (4%)
 Frame = -3

Query  1443  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1270
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  21    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  78

Query  1269  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  1090
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  79    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  136

Query  1089  VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  910
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  137   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  196

Query  909   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  730
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  197   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  256

Query  729   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  550
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  257   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  316

Query  549   SLGGS------SLKRASSPQELPKGRAV  484
             +LG          K   S ++LP   AV
Sbjct  317   TLGAGLKNQVHDHKPVHSAKDLPSAGAV  344



>ref|XP_009404257.1| PREDICTED: uncharacterized protein LOC103987631 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=369

 Score =   352 bits (904),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 201/271 (74%), Gaps = 1/271 (0%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMS-ISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             S  LP GII   S+LE++P+  +S  SK+K       +LLAM VGIKQK+ VN+I++KF 
Sbjct  35    SEPLPEGIIRRTSNLEMRPICGLSQSSKTKETKRASRSLLAMAVGIKQKEVVNQIVEKFS  94

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S  FT++LFHYDG VD W DL WS   IH+ A +QTKWWFAKRFLHPD+V+ YDYIFLWD
Sbjct  95    SSKFTVMLFHYDGVVDEWRDLRWSDSTIHVSAINQTKWWFAKRFLHPDIVAEYDYIFLWD  154

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDLGVE+FHP RY+ I+  EGLE+SQPALD     +HH+IT R R    HRRVYK K S 
Sbjct  155   EDLGVEHFHPQRYISIIDKEGLEVSQPALDTSKSEVHHQITARGRKGDVHRRVYKVKSSG  214

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
              C   S  PPC+G+VE MAPVFSR++W CVW++IQNDL+H WG+DMKLGYC QGDR+ N+
Sbjct  215   GCYENSTAPPCTGWVEMMAPVFSRTSWHCVWNMIQNDLIHAWGLDMKLGYCVQGDRSKNI  274

Query  591   GIVDSEYLVHLGIQSLGGSSLKRASSPQELP  499
             G+VDSEY+VH+GI +LGGS   + ++    P
Sbjct  275   GVVDSEYIVHMGIPTLGGSDENKPNAETSSP  305



>ref|XP_010030213.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030214.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030215.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030216.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010030217.1| PREDICTED: uncharacterized protein LOC104420022 isoform X1 [Eucalyptus 
grandis]
Length=409

 Score =   353 bits (907),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 175/328 (53%), Positives = 221/328 (67%), Gaps = 12/328 (4%)
 Frame = -3

Query  1443  FIGLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1270
             F G + +S   I   Y+  + +   +E     D +   +D   +G  S  LP+GI+   S
Sbjct  40    FCGAYFISSTVIAKEYKDRLIRLGASETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETS  97

Query  1269  DLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGN  1090
             +LE++PL      K+  N T   NLLA+ VGIKQK+ VN ++QKF S++F ++LFHYDG 
Sbjct  98    NLEMQPL--WGPIKNYKNTTPAMNLLALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGV  155

Query  1089  VDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYL  910
             VD W +  WS+ AIH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL
Sbjct  156   VDDWKNFTWSERAIHVSAVNQTKWWFAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYL  215

Query  909   EIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGF  730
              IV+ EGLEISQPALDP    +H  IT R + +K HRR+YK KGS +C   S  PPC G+
Sbjct  216   SIVQGEGLEISQPALDPVKSAVHQPITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGW  275

Query  729   VEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQ  550
             VE MAPVFSR AWRCVWH+IQNDL+H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ 
Sbjct  276   VEMMAPVFSRIAWRCVWHMIQNDLIHAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLP  335

Query  549   SLGGS------SLKRASSPQELPKGRAV  484
             +LG          K   S ++LP   AV
Sbjct  336   TLGAGLKNQVHDHKPVHSAKDLPSAGAV  363



>ref|XP_010929763.1| PREDICTED: uncharacterized protein LOC105051150 isoform X3 [Elaeis 
guineensis]
Length=375

 Score =   352 bits (903),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/258 (61%), Positives = 197/258 (76%), Gaps = 1/258 (0%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPL-KAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             S  LP GI+   S+LE++P+  ++   K K       +LLAM VGIKQK  V++I++KF 
Sbjct  74    SEPLPNGIVSRTSNLEMQPMWGSLHTQKEKHVAKASQSLLAMAVGIKQKTVVDQIVEKFF  133

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S NFTI+LFHYDG VD W DL WS  A+H+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  134   SSNFTIMLFHYDGVVDEWRDLQWSDSALHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWD  193

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDLGVE+FHP RY+ I++ EGLEISQPALD     +HH+IT R R    HRR+YK +G  
Sbjct  194   EDLGVEHFHPGRYISIIEREGLEISQPALDVAKSEVHHQITARGRQGDVHRRIYKSRGGG  253

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C   S  PPC+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+DMKLGYC QGDRT NV
Sbjct  254   RCYENSTAPPCTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDMKLGYCCQGDRTKNV  313

Query  591   GIVDSEYLVHLGIQSLGG  538
             G+VDSEY+VH+G  +LGG
Sbjct  314   GVVDSEYIVHMGTPTLGG  331



>ref|XP_010274913.1| PREDICTED: uncharacterized protein LOC104610123 isoform X3 [Nelumbo 
nucifera]
Length=279

 Score =   348 bits (893),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/234 (68%), Positives = 194/234 (83%), Gaps = 6/234 (3%)
 Frame = -3

Query  1149  IIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYD  970
             ++QKFLSEN +I+LFHYDG+VDGW DL WS +A+HI+AH+QTKWWFAKRFLHPDVVS YD
Sbjct  1     MVQKFLSENCSILLFHYDGSVDGWNDLEWSNKAVHILAHNQTKWWFAKRFLHPDVVSPYD  60

Query  969   YIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVY  790
             +IFLWDEDLGVENFHP R+LEI+ SEGLEISQPALDP+   +HHRIT+R++T K HR+VY
Sbjct  61    FIFLWDEDLGVENFHPGRFLEIMISEGLEISQPALDPELSEVHHRITLRNKTVKVHRQVY  120

Query  789   KDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQG  610
               +GS  CS+ S GPPC+G+VEGMAPVFSR+AW CVWHLIQNDL+HGWG+DMKLGYCAQG
Sbjct  121   VSRGSFNCSDNSTGPPCTGWVEGMAPVFSRAAWHCVWHLIQNDLIHGWGLDMKLGYCAQG  180

Query  609   DRTTNVGIVDSEYLVHLGIQSLGGSSLKRA----SSPQELP--KGRAVDLRVEV  466
             D T  VG++DSEY+VH GI +LGG+S  +      SP+  P    R++DLR  +
Sbjct  181   DPTKTVGVIDSEYIVHRGIPTLGGASATKPPPDRKSPEHSPVKSDRSIDLRTHI  234



>ref|XP_007139737.1| hypothetical protein PHAVU_008G055100g [Phaseolus vulgaris]
 gb|ESW11731.1| hypothetical protein PHAVU_008G055100g [Phaseolus vulgaris]
Length=378

 Score =   351 bits (901),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 170/329 (52%), Positives = 232/329 (71%), Gaps = 13/329 (4%)
 Frame = -3

Query  1440  IGLFCVSMLF---ILYRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRS  1270
             + + CV ++F      +    +  +  M + +    + ++ C  G  SS+LP GII + S
Sbjct  27    VSILCVVLIFSSSFFTQRFNEKLLRWRMNTSTLENDTCKNQCRPG-GSSALPEGIISNTS  85

Query  1269  DLELKPLKAMSISKS---KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHY  1099
             DLE++PL ++S++K+   + N++   NL AM VGI QKD VN++++KFL+ NF ++LFHY
Sbjct  86    DLEMRPLWSISMTKTIEKEQNLST--NLFAMAVGITQKDLVNKMVKKFLASNFVVMLFHY  143

Query  1098  DGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPA  919
             DG VD W +  WS   IH+   +Q+KWWFAKRFLHPD+V+ Y YIFLWDEDLGVE+FHP 
Sbjct  144   DGIVDEWNEFEWSNHVIHVAVANQSKWWFAKRFLHPDIVAEYGYIFLWDEDLGVEHFHPD  203

Query  918   RYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK-CSNESEGPP  742
             +Y+ I+KSEGLEISQPALD +   +HH+IT R R +  HRR+YK  G  K C   S GPP
Sbjct  204   KYVSIIKSEGLEISQPALDTEKSEVHHQITSRGRRSNVHRRIYKTGGRGKSCDENSSGPP  263

Query  741   CSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVH  562
             C+G+VE MAPVFSR+AWRCVW++IQNDL+H WG+D++LGYCAQGDRT NVG+VD+EY++H
Sbjct  264   CTGWVEMMAPVFSRAAWRCVWYMIQNDLIHAWGLDIQLGYCAQGDRTKNVGVVDAEYIIH  323

Query  561   LGIQSLGGSSLKRASSPQELPKGRAVDLR  475
              G  +LGG  L + SS     K   VD+R
Sbjct  324   YGHPTLGGLDLHKVSSG---AKDHRVDVR  349



>ref|XP_007222756.1| hypothetical protein PRUPE_ppa006529mg [Prunus persica]
 gb|EMJ23955.1| hypothetical protein PRUPE_ppa006529mg [Prunus persica]
Length=407

 Score =   352 bits (903),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 162/263 (62%), Positives = 202/263 (77%), Gaps = 2/263 (1%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGIKQK+ V+ I++KFLS
Sbjct  75    SEALPEGIVAKTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGIKQKEIVDRIVKKFLS  132

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  133   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  192

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K HRR YK KGS +
Sbjct  193   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVHRRFYKFKGSGR  252

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C N S  PPC+G+VE MAPVFS++AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  253   CDNHSSAPPCAGWVEMMAPVFSKAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  312

Query  588   IVDSEYLVHLGIQSLGGSSLKRA  520
             +VDSEY+VHLG+ +LG S   +A
Sbjct  313   VVDSEYIVHLGLPTLGVSDGNKA  335



>ref|XP_009404256.1| PREDICTED: uncharacterized protein LOC103987631 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=410

 Score =   352 bits (903),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 201/271 (74%), Gaps = 1/271 (0%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMS-ISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             S  LP GII   S+LE++P+  +S  SK+K       +LLAM VGIKQK+ VN+I++KF 
Sbjct  76    SEPLPEGIIRRTSNLEMRPICGLSQSSKTKETKRASRSLLAMAVGIKQKEVVNQIVEKFS  135

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S  FT++LFHYDG VD W DL WS   IH+ A +QTKWWFAKRFLHPD+V+ YDYIFLWD
Sbjct  136   SSKFTVMLFHYDGVVDEWRDLRWSDSTIHVSAINQTKWWFAKRFLHPDIVAEYDYIFLWD  195

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             EDLGVE+FHP RY+ I+  EGLE+SQPALD     +HH+IT R R    HRRVYK K S 
Sbjct  196   EDLGVEHFHPQRYISIIDKEGLEVSQPALDTSKSEVHHQITARGRKGDVHRRVYKVKSSG  255

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
              C   S  PPC+G+VE MAPVFSR++W CVW++IQNDL+H WG+DMKLGYC QGDR+ N+
Sbjct  256   GCYENSTAPPCTGWVEMMAPVFSRTSWHCVWNMIQNDLIHAWGLDMKLGYCVQGDRSKNI  315

Query  591   GIVDSEYLVHLGIQSLGGSSLKRASSPQELP  499
             G+VDSEY+VH+GI +LGGS   + ++    P
Sbjct  316   GVVDSEYIVHMGIPTLGGSDENKPNAETSSP  346



>ref|XP_002463031.1| hypothetical protein SORBIDRAFT_02g036520 [Sorghum bicolor]
 gb|EER99552.1| hypothetical protein SORBIDRAFT_02g036520 [Sorghum bicolor]
Length=319

 Score =   348 bits (894),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 163/248 (66%), Positives = 199/248 (80%), Gaps = 5/248 (2%)
 Frame = -3

Query  1266  LELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNV  1087
             +ELKPL  ++ ++SK +      L+A+  GI QK +V+ I++KFL ENFT ILFHYDGNV
Sbjct  1     MELKPL-WLTSAQSKKSKQSDKFLIAIAAGINQKKSVDAIMKKFLPENFTAILFHYDGNV  59

Query  1086  DGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLE  907
             +GW DL WSK  IHI A +QTKWWFAKRFLHP VVS+Y YIFLWDEDL V+NF+P RYL 
Sbjct  60    NGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPSVVSMYQYIFLWDEDLEVDNFNPRRYLN  119

Query  906   IVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFV  727
             IV+SEGLEISQP LD K   IHHRITVR +T  FHRRV   + + +CS   EGPPCSG+V
Sbjct  120   IVRSEGLEISQPGLDSKLSEIHHRITVRKKTGTFHRRV--SRANKQCSR--EGPPCSGWV  175

Query  726   EGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQS  547
             EGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT N+G+VDSE++VH G+Q+
Sbjct  176   EGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTKNIGVVDSEFIVHRGVQT  235

Query  546   LGGSSLKR  523
             LGGS++ +
Sbjct  236   LGGSTITK  243



>ref|XP_008218669.1| PREDICTED: uncharacterized protein LOC103318970 isoform X3 [Prunus 
mume]
Length=398

 Score =   351 bits (901),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 205/271 (76%), Gaps = 5/271 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGI QK+ V+ I++KFLS
Sbjct  75    SEALPEGIVAQTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGINQKEIVDRIVKKFLS  132

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  133   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  192

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K HRR YK KGS +
Sbjct  193   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVHRRFYKFKGSGR  252

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  253   CDDHSSAPPCAGWVEMMAPVFSRAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  312

Query  588   IVDSEYLVHLGIQSLG---GSSLKRASSPQE  505
             +VDSEY+VHLG+ +LG   G+ +  A +P +
Sbjct  313   VVDSEYIVHLGLPTLGVSDGNKVTNAPAPPQ  343



>ref|XP_008218666.1| PREDICTED: uncharacterized protein LOC103318970 isoform X1 [Prunus 
mume]
Length=402

 Score =   351 bits (901),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 205/271 (76%), Gaps = 5/271 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LP GI+   SDLE++PL   S++    N     +LLA+ VGI QK+ V+ I++KFLS
Sbjct  79    SEALPEGIVAQTSDLEVRPLWGSSVNNE--NSKPSMSLLAIAVGINQKEIVDRIVKKFLS  136

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y+YIFLWDE
Sbjct  137   SDFVVMLFHYDGAVDKWRDLNWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYEYIFLWDE  196

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGVENF P RYL IV+ EGLEISQPALDP    ++H IT R +  K HRR YK KGS +
Sbjct  197   DLGVENFDPKRYLSIVREEGLEISQPALDPDKSDVYHPITARVKKLKVHRRFYKFKGSGR  256

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDL+H WG+D++LGYCAQGDRT NVG
Sbjct  257   CDDHSSAPPCAGWVEMMAPVFSRAAWQCVWYMIQNDLIHAWGLDVQLGYCAQGDRTKNVG  316

Query  588   IVDSEYLVHLGIQSLG---GSSLKRASSPQE  505
             +VDSEY+VHLG+ +LG   G+ +  A +P +
Sbjct  317   VVDSEYIVHLGLPTLGVSDGNKVTNAPAPPQ  347



>ref|XP_008368197.1| PREDICTED: uncharacterized protein LOC103431805 [Malus domestica]
Length=451

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/291 (57%), Positives = 214/291 (74%), Gaps = 4/291 (1%)
 Frame = -3

Query  1362  SKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMP  1183
             +++  L++ ++ C     S +LP+GI+   SDLE  PL   S+     N     +LLA+ 
Sbjct  72    TQNTTLHTCKNXC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNE--NSKPSKSLLAIA  128

Query  1182  VGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKR  1003
             VGIKQK+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKR
Sbjct  129   VGIKQKEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKR  188

Query  1002  FLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVR  823
             FLHPD+VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R
Sbjct  189   FLHPDIVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITAR  248

Query  822   SRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWG  643
              + +K HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG
Sbjct  249   VKNSKVHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWG  308

Query  642   MDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKG  493
             +D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG
Sbjct  309   LDVQLGYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKG  359



>ref|XP_009341364.1| PREDICTED: uncharacterized protein LOC103933395 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009341365.1| PREDICTED: uncharacterized protein LOC103933395 isoform X3 [Pyrus 
x bretschneideri]
Length=341

 Score =   348 bits (893),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 211/286 (74%), Gaps = 4/286 (1%)
 Frame = -3

Query  1347  LYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQ  1168
             L++ ++ C     S +LP+GI+   SDLE  PL   S+  +  N     +L+A+ VGIKQ
Sbjct  6     LHTCKNHC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNA--NSKPSKSLMAIAVGIKQ  62

Query  1167  KDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPD  988
             K+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHP 
Sbjct  63    KEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKRFLHPA  122

Query  987   VVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNK  808
             +VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R + +K
Sbjct  123   IVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITARVKNSK  182

Query  807   FHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKL  628
              HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG+D++L
Sbjct  183   VHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWGLDVQL  242

Query  627   GYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKG  493
             GYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG
Sbjct  243   GYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKG  288



>gb|KCW57157.1| hypothetical protein EUGRSUZ_I02788 [Eucalyptus grandis]
Length=354

 Score =   348 bits (894),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 170/303 (56%), Positives = 211/303 (70%), Gaps = 10/303 (3%)
 Frame = -3

Query  1374  AEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNL  1195
             +E     D +   +D   +G  S  LP+GI+   S+LE++PL      K+  N T   NL
Sbjct  10    SETMRNKDSMRCKDDCRPSG--SEHLPKGIVVETSNLEMQPL--WGPIKNYKNTTPAMNL  65

Query  1194  LAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWW  1015
             LA+ VGIKQK+ VN ++QKF S++F ++LFHYDG VD W +  WS+ AIH+ A +QTKWW
Sbjct  66    LALAVGIKQKEIVNRLVQKFPSKDFVVMLFHYDGVVDDWKNFTWSERAIHVSAVNQTKWW  125

Query  1014  FAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHR  835
             FAKRFLHPD+V+ Y YIFLWDEDLGVENF P RYL IV+ EGLEISQPALDP    +H  
Sbjct  126   FAKRFLHPDIVAEYGYIFLWDEDLGVENFDPNRYLSIVQGEGLEISQPALDPVKSAVHQP  185

Query  834   ITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLV  655
             IT R + +K HRR+YK KGS +C   S  PPC G+VE MAPVFSR AWRCVWH+IQNDL+
Sbjct  186   ITARRKRSKLHRRMYKFKGSGRCDENSTAPPCVGWVEMMAPVFSRIAWRCVWHMIQNDLI  245

Query  654   HGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGS------SLKRASSPQELPKG  493
             H WG+DM LGYCAQGDRT  VG+VD+EY+VHLG+ +LG          K   S ++LP  
Sbjct  246   HAWGLDMLLGYCAQGDRTQKVGVVDAEYIVHLGLPTLGAGLKNQVHDHKPVHSAKDLPSA  305

Query  492   RAV  484
              AV
Sbjct  306   GAV  308



>ref|XP_007049550.1| Uncharacterized protein TCM_002621 [Theobroma cacao]
 gb|EOX93707.1| Uncharacterized protein TCM_002621 [Theobroma cacao]
Length=385

 Score =   349 bits (896),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 162/274 (59%), Positives = 208/274 (76%), Gaps = 3/274 (1%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LP+GII   SDLE++PL  +  +K K  ++   NLLA+ VGIKQK++VN+I++KF +
Sbjct  77    SEALPKGIISETSDLEMRPLWGLQ-NKKKPKLS--MNLLAIAVGIKQKESVNKIVKKFPA  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
              +F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   SDFVVMLFHYDGIVDQWKDLEWNDLAIHVSAVNQTKWWFAKRFLHPDIVSEYSYIFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F+ ARYL I+K EGLEISQPALD +   +HH IT R + +  HRR Y+  G T+
Sbjct  194   DLGVDHFNAARYLSIIKKEGLEISQPALDVEKSELHHPITARDKKSTVHRRTYEVIGRTR  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR++WRC WH+IQ+DLV+GWG+D +LGYCAQGDRT  +G
Sbjct  254   CNENSTGPPCTGFVEMMAPVFSRASWRCAWHMIQSDLVYGWGVDFQLGYCAQGDRTQKIG  313

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA  487
             IVDSEYLVH  + +LGG +     SP   P GR+
Sbjct  314   IVDSEYLVHNALPTLGGVAANEVPSPSSEPGGRS  347



>ref|XP_002972149.1| hypothetical protein SELMODRAFT_96555, partial [Selaginella moellendorffii]
 gb|EFJ27066.1| hypothetical protein SELMODRAFT_96555, partial [Selaginella moellendorffii]
Length=299

 Score =   346 bits (887),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 165/267 (62%), Positives = 203/267 (76%), Gaps = 6/267 (2%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LPRGI++  S+ E++PL    +S+ KV   G   LLA+  GIKQK  V+ I+QKFL+ NF
Sbjct  6     LPRGIVQQTSNFEVQPLG--RVSRKKVVPNG---LLAVAAGIKQKRYVDRIVQKFLAHNF  60

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             TI+LFHYDG VD W +L WS  AIH+VA +QTKWWFAKRFLHPD+V  Y+YIF+WDEDLG
Sbjct  61    TIMLFHYDGVVDKWNELPWSSRAIHVVAINQTKWWFAKRFLHPDIVDPYEYIFVWDEDLG  120

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGS-TKCS  763
             VENFH  RYL I+K E LEISQPAL+P +  +HHRIT+RS+  + HRR  K KG+ T C 
Sbjct  121   VENFHVDRYLAIMKYERLEISQPALEPNASEVHHRITIRSKRYRVHRRSLKPKGTGTLCF  180

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
               S  PPC+G+VEGMAPVF+R AW+CVWHLIQNDLVHGWGMD KLGYC +GDR+ +VG++
Sbjct  181   ENSTDPPCTGWVEGMAPVFTRDAWKCVWHLIQNDLVHGWGMDFKLGYCVKGDRSKSVGVI  240

Query  582   DSEYLVHLGIQSLGGSSLKRASSPQEL  502
             DSEY+VH GI SLGG +  + S    L
Sbjct  241   DSEYIVHRGIPSLGGPAKSKVSKSNVL  267



>ref|XP_010039032.1| PREDICTED: uncharacterized protein LOC104427672 [Eucalyptus grandis]
Length=507

 Score =   353 bits (906),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/259 (63%), Positives = 200/259 (77%), Gaps = 5/259 (2%)
 Frame = -3

Query  1314  RSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKF  1135
             R S +LPRGI+ S SDL+L+PL     +KS    +   NLLA+PVGI+QKDNV++I++KF
Sbjct  194   RGSETLPRGIVSSTSDLKLRPLWDSHNTKS----SNSTNLLAIPVGIRQKDNVDKIVKKF  249

Query  1134  LSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLW  955
             LS +F ++LFHYDGNVDGW D  WS   IH+ A +QTKWWFAKRFLHPD+VS Y YIFLW
Sbjct  250   LSSDFLVMLFHYDGNVDGWRDTEWSDHVIHVSAINQTKWWFAKRFLHPDIVSEYAYIFLW  309

Query  954   DEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGS  775
             DEDLGVENFH  RYL IVK EGLEISQPALDP    IHH+IT R R +K HRR++++ G 
Sbjct  310   DEDLGVENFHVGRYLSIVKEEGLEISQPALDPNKSEIHHQITERDRKSKVHRRIFREMGG  369

Query  774   T-KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  598
                C+  S  PPC+G+VE MAPVFSR++WRCVWH+IQNDL H WG+D +LGYCAQGDR  
Sbjct  370   GFTCNENSTSPPCTGWVEIMAPVFSRASWRCVWHMIQNDLTHAWGLDYQLGYCAQGDRMK  429

Query  597   NVGIVDSEYLVHLGIQSLG  541
              +G+VDSEY+VH G  +LG
Sbjct  430   KIGVVDSEYIVHSGSVTLG  448



>gb|ABR17377.1| unknown [Picea sitchensis]
Length=336

 Score =   347 bits (891),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 163/293 (56%), Positives = 210/293 (72%), Gaps = 2/293 (1%)
 Frame = -3

Query  1392  IYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNV  1213
             ++Q     M+S  D     +      R S +LP+G+++  SDLE++ L    I + +   
Sbjct  1     MHQPTPVSMQSSVDNESKDKHGEPCPRGSGALPKGLVQRSSDLEMRSLWGNPIQEGQRKT  60

Query  1212  TGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAH  1033
                HNLLA+PVGIKQKDNVN+++QKF ++NFT++LFHY G VD W +  W++ AIH+ A 
Sbjct  61    P--HNLLAIPVGIKQKDNVNKMVQKFPADNFTVMLFHYYGVVDKWSEFKWTETAIHVAAI  118

Query  1032  SQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKS  853
             +QTKWWFAKRFLHPD++ +Y+YIF+WDEDLGV NFH  RYL I++ EGLEISQPALD   
Sbjct  119   NQTKWWFAKRFLHPDIIDLYNYIFIWDEDLGVNNFHADRYLAIMEEEGLEISQPALDTSH  178

Query  852   IGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHL  673
               +H+ IT R+   + HRR+YK+ G   C   S  PPC+G+VE MAPVFSR+AWRC W +
Sbjct  179   ADVHYGITKRNPRTRVHRRMYKNGGGHPCLANSIAPPCTGWVEMMAPVFSRAAWRCSWGM  238

Query  672   IQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS  514
             IQNDLVHGWGMDMKLGYCAQGDRT  VGI+DSEY++H GI SLGG   +  SS
Sbjct  239   IQNDLVHGWGMDMKLGYCAQGDRTKKVGIIDSEYILHEGIPSLGGMHDQNVSS  291



>gb|KDO42574.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
Length=372

 Score =   348 bits (894),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 204/260 (78%), Gaps = 4/260 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             + +LP GI+   S+LE++PL +   S SK+N      NLLA+  GIKQK  V++I++KF 
Sbjct  76    TEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAIAAGIKQKKIVDQIVRKFP  132

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  133   SKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAKRFLHPDIVAEYNYIFLWD  192

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             ED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT R R +K HRR+YK KGS 
Sbjct  193   EDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITARRRNSKAHRRMYKYKGSG  252

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG+D++LGYCAQGDRT NV
Sbjct  253   RCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAWGLDIQLGYCAQGDRTKNV  312

Query  591   GIVDSEYLVHLGIQSLGGSS  532
             G+VDSEY+VHLG+ +LG ++
Sbjct  313   GVVDSEYIVHLGLPTLGVTT  332



>ref|XP_008650834.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
Length=369

 Score =   348 bits (893),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 176/325 (54%), Positives = 218/325 (67%), Gaps = 45/325 (14%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILYRTTIYQYQQAEMESKSDPL----YSAEDSCVTGRSSSS---  1300
             MK    + + CV ++F++Y    +Q++Q  +E+KS P      S  D+    + + +   
Sbjct  1     MKLRLHLFVLCVIIIFLVYNMANFQHKQTTLEAKSHPFDTVTVSDRDAVKVPQKAEARIG  60

Query  1299  -LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSEN  1123
              LP GI+ES SD++LKPL   + ++SK                            FL EN
Sbjct  61    YLPHGIVESNSDMDLKPLWLTTSARSK----------------------------FLPEN  92

Query  1122  FTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDL  943
             FT ILFHYDGNV+GW DL WSK  IHI A +QTKWWFAKRFLHP VVSIY YIFLWDEDL
Sbjct  93    FTAILFHYDGNVNGWNDLPWSKSVIHIAASNQTKWWFAKRFLHPAVVSIYQYIFLWDEDL  152

Query  942   GVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH-----RRVYKDKG  778
              V+NF P RYL IV+SEGLEISQP LD K   IHHRITVR +   FH     RRV   + 
Sbjct  153   EVDNFSPRRYLNIVRSEGLEISQPGLDSKLSEIHHRITVRKKAGTFHSVYFDRRV--SRA  210

Query  777   STKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTT  598
             + KCS   EGPPCSG+VEGMAPVFS+SAW+CVWHLIQNDL+HGWG+D K GYCAQGDRT 
Sbjct  211   NKKCSR--EGPPCSGWVEGMAPVFSKSAWQCVWHLIQNDLIHGWGIDYKFGYCAQGDRTK  268

Query  597   NVGIVDSEYLVHLGIQSLGGSSLKR  523
             N+G+VDSE++VH G+Q+LGGS++ +
Sbjct  269   NIGVVDSEFIVHRGVQTLGGSTITK  293



>ref|XP_010450248.1| PREDICTED: uncharacterized protein LOC104732403 isoform X1 [Camelina 
sativa]
Length=388

 Score =   348 bits (894),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 198/268 (74%), Gaps = 5/268 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM  GIKQK++VN+I++KF S
Sbjct  79    SETLPRGIVASTSDLEMRPLWG-----AKRNKKPKPNLLAMAAGIKQKESVNKIVKKFSS  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W    WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   SEFVVMLFHYDGAVDEWKKFEWSETAIHISVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  194   DLGVDHFDARRYVSIIKEEGLEISQPALDPNFSEVHHQLTSRDSKSRVHRRTYKVIGRAR  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C   S  PPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  254   CDENSTAPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  313

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQE  505
             IVDSEY++H+G+ +LGGS+  +  +  +
Sbjct  314   IVDSEYILHMGLPTLGGSAENKTKTQHD  341



>ref|XP_008794583.1| PREDICTED: uncharacterized protein LOC103710580 isoform X3 [Phoenix 
dactylifera]
Length=412

 Score =   350 bits (897),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 206/294 (70%), Gaps = 5/294 (2%)
 Frame = -3

Query  1386  QYQQAEMESKSDPLYSAEDSCVTG---RSSSSLPRGIIESRSDLELKPLKAMSISKSKVN  1216
             Q  Q  +E+K +   +    C +      S  LP+GII   S+ E++PL      + KV 
Sbjct  60    QNSQTNLETKRNLETTKSSLCESQWKPAGSEPLPKGIISQTSNFEMQPL--WGSPERKVK  117

Query  1215  VTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVA  1036
                  +LLA+PVGIKQK  V++I++KF S NFT++LFHYDG VD W D+ WS  A+HI A
Sbjct  118   TKHSKSLLAIPVGIKQKGAVSQIVEKFPSNNFTVMLFHYDGVVDEWSDVRWSDSALHISA  177

Query  1035  HSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK  856
              +QTKWWFAKRFLHPDVV+ Y+YIFLWDEDL VENFHP RYL I+K EGLEISQPALD  
Sbjct  178   INQTKWWFAKRFLHPDVVAEYNYIFLWDEDLEVENFHPLRYLSIIKREGLEISQPALDTA  237

Query  855   SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWH  676
                +HH IT R R    HRR+YK  G  +C   S  PPC+G+VE MAPVFSR AWRC WH
Sbjct  238   RSAVHHGITARWRKGDVHRRIYKLGGGGRCYENSTTPPCTGWVEMMAPVFSRDAWRCTWH  297

Query  675   LIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS  514
             +IQNDLVH WG+D KLGYCAQGDR+ NVG+VDSEY+VH GI +LGG   K+ ++
Sbjct  298   MIQNDLVHAWGLDTKLGYCAQGDRSKNVGVVDSEYIVHRGIPTLGGLDEKKRNA  351



>ref|XP_010450249.1| PREDICTED: uncharacterized protein LOC104732403 isoform X2 [Camelina 
sativa]
Length=382

 Score =   348 bits (894),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 198/268 (74%), Gaps = 5/268 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM  GIKQK++VN+I++KF S
Sbjct  73    SETLPRGIVASTSDLEMRPLWG-----AKRNKKPKPNLLAMAAGIKQKESVNKIVKKFSS  127

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W    WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  128   SEFVVMLFHYDGAVDEWKKFEWSETAIHISVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  187

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  188   DLGVDHFDARRYVSIIKEEGLEISQPALDPNFSEVHHQLTSRDSKSRVHRRTYKVIGRAR  247

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C   S  PPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  248   CDENSTAPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  307

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQE  505
             IVDSEY++H+G+ +LGGS+  +  +  +
Sbjct  308   IVDSEYILHMGLPTLGGSAENKTKTQHD  335



>ref|XP_008794581.1| PREDICTED: uncharacterized protein LOC103710580 isoform X1 [Phoenix 
dactylifera]
Length=424

 Score =   350 bits (898),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 206/294 (70%), Gaps = 5/294 (2%)
 Frame = -3

Query  1386  QYQQAEMESKSDPLYSAEDSCVTG---RSSSSLPRGIIESRSDLELKPLKAMSISKSKVN  1216
             Q  Q  +E+K +   +    C +      S  LP+GII   S+ E++PL      + KV 
Sbjct  72    QNSQTNLETKRNLETTKSSLCESQWKPAGSEPLPKGIISQTSNFEMQPL--WGSPERKVK  129

Query  1215  VTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVA  1036
                  +LLA+PVGIKQK  V++I++KF S NFT++LFHYDG VD W D+ WS  A+HI A
Sbjct  130   TKHSKSLLAIPVGIKQKGAVSQIVEKFPSNNFTVMLFHYDGVVDEWSDVRWSDSALHISA  189

Query  1035  HSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK  856
              +QTKWWFAKRFLHPDVV+ Y+YIFLWDEDL VENFHP RYL I+K EGLEISQPALD  
Sbjct  190   INQTKWWFAKRFLHPDVVAEYNYIFLWDEDLEVENFHPLRYLSIIKREGLEISQPALDTA  249

Query  855   SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWH  676
                +HH IT R R    HRR+YK  G  +C   S  PPC+G+VE MAPVFSR AWRC WH
Sbjct  250   RSAVHHGITARWRKGDVHRRIYKLGGGGRCYENSTTPPCTGWVEMMAPVFSRDAWRCTWH  309

Query  675   LIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS  514
             +IQNDLVH WG+D KLGYCAQGDR+ NVG+VDSEY+VH GI +LGG   K+ ++
Sbjct  310   MIQNDLVHAWGLDTKLGYCAQGDRSKNVGVVDSEYIVHRGIPTLGGLDEKKRNA  363



>ref|XP_010450250.1| PREDICTED: uncharacterized protein LOC104732403 isoform X3 [Camelina 
sativa]
Length=374

 Score =   348 bits (893),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 198/268 (74%), Gaps = 5/268 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM  GIKQK++VN+I++KF S
Sbjct  65    SETLPRGIVASTSDLEMRPLWG-----AKRNKKPKPNLLAMAAGIKQKESVNKIVKKFSS  119

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W    WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  120   SEFVVMLFHYDGAVDEWKKFEWSETAIHISVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  179

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  180   DLGVDHFDARRYVSIIKEEGLEISQPALDPNFSEVHHQLTSRDSKSRVHRRTYKVIGRAR  239

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C   S  PPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  240   CDENSTAPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  299

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQE  505
             IVDSEY++H+G+ +LGGS+  +  +  +
Sbjct  300   IVDSEYILHMGLPTLGGSAENKTKTQHD  327



>ref|XP_009341362.1| PREDICTED: uncharacterized protein LOC103933395 isoform X2 [Pyrus 
x bretschneideri]
Length=395

 Score =   349 bits (895),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 211/286 (74%), Gaps = 4/286 (1%)
 Frame = -3

Query  1347  LYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQ  1168
             L++ ++ C     S +LP+GI+   SDLE  PL   S+  +  N     +L+A+ VGIKQ
Sbjct  60    LHTCKNHC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNA--NSKPSKSLMAIAVGIKQ  116

Query  1167  KDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPD  988
             K+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHP 
Sbjct  117   KEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKRFLHPA  176

Query  987   VVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNK  808
             +VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R + +K
Sbjct  177   IVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITARVKNSK  236

Query  807   FHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKL  628
              HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG+D++L
Sbjct  237   VHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWGLDVQL  296

Query  627   GYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKG  493
             GYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG
Sbjct  297   GYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKG  342



>ref|XP_008794582.1| PREDICTED: uncharacterized protein LOC103710580 isoform X2 [Phoenix 
dactylifera]
Length=423

 Score =   350 bits (897),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 168/294 (57%), Positives = 206/294 (70%), Gaps = 5/294 (2%)
 Frame = -3

Query  1386  QYQQAEMESKSDPLYSAEDSCVTG---RSSSSLPRGIIESRSDLELKPLKAMSISKSKVN  1216
             Q  Q  +E+K +   +    C +      S  LP+GII   S+ E++PL      + KV 
Sbjct  72    QNSQTNLETKRNLETTKSSLCESQWKPAGSEPLPKGIISQTSNFEMQPL--WGSPERKVK  129

Query  1215  VTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVA  1036
                  +LLA+PVGIKQK  V++I++KF S NFT++LFHYDG VD W D+ WS  A+HI A
Sbjct  130   TKHSKSLLAIPVGIKQKGAVSQIVEKFPSNNFTVMLFHYDGVVDEWSDVRWSDSALHISA  189

Query  1035  HSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPK  856
              +QTKWWFAKRFLHPDVV+ Y+YIFLWDEDL VENFHP RYL I+K EGLEISQPALD  
Sbjct  190   INQTKWWFAKRFLHPDVVAEYNYIFLWDEDLEVENFHPLRYLSIIKREGLEISQPALDTA  249

Query  855   SIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWH  676
                +HH IT R R    HRR+YK  G  +C   S  PPC+G+VE MAPVFSR AWRC WH
Sbjct  250   RSAVHHGITARWRKGDVHRRIYKLGGGGRCYENSTTPPCTGWVEMMAPVFSRDAWRCTWH  309

Query  675   LIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASS  514
             +IQNDLVH WG+D KLGYCAQGDR+ NVG+VDSEY+VH GI +LGG   K+ ++
Sbjct  310   MIQNDLVHAWGLDTKLGYCAQGDRSKNVGVVDSEYIVHRGIPTLGGLDEKKRNA  363



>ref|XP_010682054.1| PREDICTED: uncharacterized protein LOC104896958 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=399

 Score =   349 bits (895),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 207/288 (72%), Gaps = 2/288 (1%)
 Frame = -3

Query  1404  YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKS  1225
             YR  I ++    M +   P  +   +    R S +LP GI+   S+ E++PL    ++K 
Sbjct  56    YREKISRWPMEMMGTAHQPKPNFCKNQCRPRGSEALPEGIVVQTSNFEMRPLWDSDLAKE  115

Query  1224  KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIH  1045
             K+  +   NLLAM VG+KQK+ V+++++KFLS  F ++LFHYDGNVD W  L W+   IH
Sbjct  116   KLKPS--LNLLAMAVGMKQKEIVDKMVEKFLSNGFVVMLFHYDGNVDEWSALEWNDRVIH  173

Query  1044  IVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPAL  865
             + A +QTKWWFAKRFLHPDVV+ YDYIFLWDEDLGVENF P RY+ I+KSEGLEISQPAL
Sbjct  174   VSAKNQTKWWFAKRFLHPDVVADYDYIFLWDEDLGVENFSPQRYISIIKSEGLEISQPAL  233

Query  864   DPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRC  685
             DP    +H  IT R +  + HRR YK KGS +C   S  PPC+G+VE MAP FS++AW+C
Sbjct  234   DPIKSVVHQPITARQKYARVHRRYYKSKGSGRCDENSRAPPCTGWVEMMAPAFSKAAWQC  293

Query  684   VWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLG  541
             VW++IQNDL+H WG+D +LGYCAQGDR  NVG+VDSEY+VHLG+ +LG
Sbjct  294   VWYMIQNDLIHAWGLDRQLGYCAQGDRVKNVGVVDSEYIVHLGLPTLG  341



>ref|XP_009341361.1| PREDICTED: uncharacterized protein LOC103933395 isoform X1 [Pyrus 
x bretschneideri]
Length=400

 Score =   348 bits (894),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/286 (58%), Positives = 211/286 (74%), Gaps = 4/286 (1%)
 Frame = -3

Query  1347  LYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQ  1168
             L++ ++ C     S +LP+GI+   SDLE  PL   S+  +  N     +L+A+ VGIKQ
Sbjct  65    LHTCKNHC-QPSGSEALPKGIVVKTSDLEALPLWGSSVKNA--NSKPSKSLMAIAVGIKQ  121

Query  1167  KDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPD  988
             K+ V++I++KFLS +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHP 
Sbjct  122   KEIVDKIVKKFLSSDFVVMLFHYDGAVDKWRDLPWSDHAIHVSVMNQTKWWFAKRFLHPA  181

Query  987   VVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNK  808
             +VS Y YIFLWDEDLGVENF P RYL I++ EGLEISQPALDP    ++H IT R + +K
Sbjct  182   IVSEYKYIFLWDEDLGVENFDPMRYLSIIQEEGLEISQPALDPDKSEVYHPITARVKNSK  241

Query  807   FHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKL  628
              HRR YK KGS +C + S  PPC+G+VE MAPVFSR+AW+CVW++IQNDLVH WG+D++L
Sbjct  242   VHRRFYKYKGSGRCDDHSSAPPCAGWVEMMAPVFSRTAWQCVWYMIQNDLVHAWGLDVQL  301

Query  627   GYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRAS-SPQELPKG  493
             GYCAQGDRT NVG+VDSEY+VHLG+ +LG S   + + SP    KG
Sbjct  302   GYCAQGDRTQNVGVVDSEYIVHLGLPTLGVSDGNKVTNSPDPSQKG  347



>gb|KDO42569.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
 gb|KDO42570.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
Length=358

 Score =   347 bits (890),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 213/278 (77%), Gaps = 9/278 (3%)
 Frame = -3

Query  1347  LYSAE-DSCVTGR----SSSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAM  1186
             +YSA+ ++C   +     + +LP GI+   S+LE++PL +   S SK+N      NLLA+
Sbjct  9     MYSAKPETCKNQQCRLPGTEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAI  65

Query  1185  PVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAK  1006
               GIKQK  V++I++KF S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAK
Sbjct  66    AAGIKQKKIVDQIVRKFPSKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAK  125

Query  1005  RFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITV  826
             RFLHPD+V+ Y+YIFLWDED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT 
Sbjct  126   RFLHPDIVAEYNYIFLWDEDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITA  185

Query  825   RSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGW  646
             R R +K HRR+YK KGS +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H W
Sbjct  186   RRRNSKAHRRMYKYKGSGRCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAW  245

Query  645   GMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  532
             G+D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG ++
Sbjct  246   GLDIQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVTT  283



>ref|XP_010440627.1| PREDICTED: uncharacterized protein LOC104723886 [Camelina sativa]
Length=388

 Score =   348 bits (893),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 157/268 (59%), Positives = 200/268 (75%), Gaps = 5/268 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K N     NLLAM  GIKQK++VN+I++KF S
Sbjct  79    SETLPRGIVASTSDLEMRPLWG-----AKRNKKPKPNLLAMAAGIKQKESVNKIVKKFSS  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   SEFVVMLFHYDGAVDEWKEFEWSETAIHISVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  194   DLGVDHFDARRYVSIIKEEGLEISQPALDPNFSEVHHQLTSRDSKSRVHRRTYKVIGRAR  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S  PPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  254   CNENSTSPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  313

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQE  505
             IVDS+Y++H+G+ +LGGS+  +  +  +
Sbjct  314   IVDSDYILHMGLPTLGGSAENKTKTQHD  341



>ref|XP_010682053.1| PREDICTED: uncharacterized protein LOC104896958 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=401

 Score =   348 bits (894),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 160/288 (56%), Positives = 207/288 (72%), Gaps = 2/288 (1%)
 Frame = -3

Query  1404  YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKS  1225
             YR  I ++    M +   P  +   +    R S +LP GI+   S+ E++PL    ++K 
Sbjct  58    YREKISRWPMEMMGTAHQPKPNFCKNQCRPRGSEALPEGIVVQTSNFEMRPLWDSDLAKE  117

Query  1224  KVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIH  1045
             K+  +   NLLAM VG+KQK+ V+++++KFLS  F ++LFHYDGNVD W  L W+   IH
Sbjct  118   KLKPS--LNLLAMAVGMKQKEIVDKMVEKFLSNGFVVMLFHYDGNVDEWSALEWNDRVIH  175

Query  1044  IVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPAL  865
             + A +QTKWWFAKRFLHPDVV+ YDYIFLWDEDLGVENF P RY+ I+KSEGLEISQPAL
Sbjct  176   VSAKNQTKWWFAKRFLHPDVVADYDYIFLWDEDLGVENFSPQRYISIIKSEGLEISQPAL  235

Query  864   DPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRC  685
             DP    +H  IT R +  + HRR YK KGS +C   S  PPC+G+VE MAP FS++AW+C
Sbjct  236   DPIKSVVHQPITARQKYARVHRRYYKSKGSGRCDENSRAPPCTGWVEMMAPAFSKAAWQC  295

Query  684   VWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLG  541
             VW++IQNDL+H WG+D +LGYCAQGDR  NVG+VDSEY+VHLG+ +LG
Sbjct  296   VWYMIQNDLIHAWGLDRQLGYCAQGDRVKNVGVVDSEYIVHLGLPTLG  343



>ref|XP_011009620.1| PREDICTED: uncharacterized protein LOC105114685 isoform X3 [Populus 
euphratica]
Length=353

 Score =   347 bits (889),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/275 (57%), Positives = 206/275 (75%), Gaps = 4/275 (1%)
 Frame = -3

Query  1314  RSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKF  1135
             + + +LP+GI+   SD+E++ L        K       ++LAM VGIKQK +V +I+QKF
Sbjct  74    KGTETLPKGIVSPMSDMEMRSLWG----DDKKKTKKPKHVLAMAVGIKQKLSVKKIVQKF  129

Query  1134  LSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLW  955
              S +F ++LFHYDG +D W D+ W   AIH+ A +QTKWWFAKRFLHPD+VS YDYIFLW
Sbjct  130   PSTDFVLMLFHYDGIIDEWRDMEWHHRAIHVSAINQTKWWFAKRFLHPDIVSEYDYIFLW  189

Query  954   DEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGS  775
             DEDLGV+NFH  RYL I+K EGL+ISQPALDP+S  +HH +T R R ++ HR+V++  G 
Sbjct  190   DEDLGVDNFHAGRYLSIIKEEGLDISQPALDPESSEVHHHLTTRKRGSRIHRKVFRIIGQ  249

Query  774   TKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTN  595
             T+C   S  PPC+GFVE MAPVFS+++WRC WH+IQNDLVHGWG+D +LGYCAQGD+T +
Sbjct  250   TRCDENSTRPPCTGFVEMMAPVFSKASWRCTWHMIQNDLVHGWGLDFQLGYCAQGDQTKS  309

Query  594   VGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGR  490
             +GIVDSEY+VH G+ +LGGS+ ++A S  +   GR
Sbjct  310   IGIVDSEYIVHYGLPTLGGSASEKAQSSSDQSAGR  344



>ref|XP_008802242.1| PREDICTED: uncharacterized protein LOC103716141 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008802244.1| PREDICTED: uncharacterized protein LOC103716141 isoform X1 [Phoenix 
dactylifera]
Length=394

 Score =   348 bits (893),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 161/262 (61%), Positives = 196/262 (75%), Gaps = 2/262 (1%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S  LP+GII   S+ E++PL      K K   +   +LLA+PVG+ QK  VN+I++KF  
Sbjct  83    SEPLPKGIISQTSNFEMQPLWGSPKGKGKTKSS--KSLLAIPVGVMQKKAVNQIVKKFPP  140

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
              +F ++LFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ Y+YIFLWDE
Sbjct  141   SDFMVVLFHYDGVVDEWRDLQWSDSALHISAINQTKWWFAKRFLHPDIVAEYNYIFLWDE  200

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DL VENFHP RYL ++K EGLEISQPALD     IHHRIT RSR    HRR+YK  G  +
Sbjct  201   DLQVENFHPLRYLSLIKREGLEISQPALDTSKSEIHHRITARSRKGDVHRRIYKFTGGGR  260

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C   S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL+H WG+DMKLGYCAQGDR+ NVG
Sbjct  261   CYENSTAPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIHAWGLDMKLGYCAQGDRSKNVG  320

Query  588   IVDSEYLVHLGIQSLGGSSLKR  523
             +VDSEY+VH+GI +LGG   K+
Sbjct  321   VVDSEYIVHMGIPTLGGFDEKK  342



>ref|XP_009381324.1| PREDICTED: uncharacterized protein LOC103969504 [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   349 bits (896),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/285 (58%), Positives = 205/285 (72%), Gaps = 2/285 (1%)
 Frame = -3

Query  1329  SCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNE  1150
             S  T   S +LP+GI+  +SDLE+ PL      K  V++    +LLA+PVGI QK  VN+
Sbjct  114   SPCTSLGSEALPKGIVSPKSDLEMVPLWGSRRGKDGVSLQ--KSLLAIPVGINQKAMVNQ  171

Query  1149  IIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYD  970
             I+ KF+S +FT++LFHYDG VD W DL WS  A+HI A +QTKWWFAKRFLHPD+V+ Y 
Sbjct  172   IVMKFVSSDFTVMLFHYDGVVDEWKDLQWSDSALHISAINQTKWWFAKRFLHPDIVAPYK  231

Query  969   YIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVY  790
             YIFLWDED+ VENFHP RYL IV+ EGLEISQPALD     IHH+IT R      HRR+Y
Sbjct  232   YIFLWDEDIEVENFHPKRYLMIVEREGLEISQPALDLVKSRIHHQITARLSKRVVHRRMY  291

Query  789   KDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQG  610
             K  G  KC + S  PPC+G+VE MAPVFSR+AWRC WH+IQNDL+H WG+DMKLGYCAQG
Sbjct  292   KFSGDKKCDDNSSQPPCTGWVEMMAPVFSRAAWRCAWHMIQNDLIHAWGLDMKLGYCAQG  351

Query  609   DRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLR  475
             D++ N+G+VDSEY+VH G+ +LGG   K  S+     K R+   R
Sbjct  352   DQSKNIGVVDSEYIVHKGLPTLGGFDEKMGSTGSPAAKDRSAVRR  396



>gb|KDO42568.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
Length=407

 Score =   348 bits (894),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 213/278 (77%), Gaps = 9/278 (3%)
 Frame = -3

Query  1347  LYSAE-DSCVTGR----SSSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAM  1186
             +YSA+ ++C   +     + +LP GI+   S+LE++PL +   S SK+N      NLLA+
Sbjct  58    MYSAKPETCKNQQCRLPGTEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAI  114

Query  1185  PVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAK  1006
               GIKQK  V++I++KF S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAK
Sbjct  115   AAGIKQKKIVDQIVRKFPSKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAK  174

Query  1005  RFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITV  826
             RFLHPD+V+ Y+YIFLWDED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT 
Sbjct  175   RFLHPDIVAEYNYIFLWDEDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITA  234

Query  825   RSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGW  646
             R R +K HRR+YK KGS +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H W
Sbjct  235   RRRNSKAHRRMYKYKGSGRCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAW  294

Query  645   GMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  532
             G+D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG ++
Sbjct  295   GLDIQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVTT  332



>ref|XP_008778204.1| PREDICTED: uncharacterized protein LOC103698025 isoform X2 [Phoenix 
dactylifera]
Length=338

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 181/334 (54%), Positives = 220/334 (66%), Gaps = 36/334 (11%)
 Frame = -3

Query  1458  MKHMQFIGLFCVSMLFILY--RTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGI  1285
             MK     GL  + M  +++   T   QY+   M+       S +           LPRG+
Sbjct  1     MKTQASFGLVFLLMTLVIFVAMTMKIQYENLTMDMGQQSFESTKRQWRN--RIDGLPRGV  58

Query  1284  IESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILF  1105
             +ES +D+ LKPL     S  K     Y  LLAM VGI QK NV+ +++KFL +N +IILF
Sbjct  59    VESTTDMALKPL--WERSSRKDGSGNYAALLAMAVGISQKQNVDILVRKFLIDNCSIILF  116

Query  1104  HYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFH  925
             HYDGNVDGW DL WS +AIHI+A++QTKWWFAKRFLHP+ VS YDYIFLWDEDLGVENFH
Sbjct  117   HYDGNVDGWHDLEWSGKAIHILAYNQTKWWFAKRFLHPNAVSAYDYIFLWDEDLGVENFH  176

Query  924   PARYLEIVKSEGLEISQPALDP-KSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEG  748
               RYL+I+ SEGLEISQPALDP +S  IHHRITVR R  K HR                 
Sbjct  177   LGRYLQIMASEGLEISQPALDPDQSSDIHHRITVRDRKAKVHR-----------------  219

Query  747   PPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYL  568
                  +VEGMAPVFSR+AW+CVWHLIQNDL+HGWG+DMKLGYCAQGDRT  VG++D EY+
Sbjct  220   -----WVEGMAPVFSRAAWKCVWHLIQNDLIHGWGLDMKLGYCAQGDRTKKVGVIDVEYI  274

Query  567   VHLGIQSLGGSSLKRASSPQELPKGRAVDLRVEV  466
             VH GI SLGG S+ +A S       +++DLR  +
Sbjct  275   VHQGIPSLGGGSVNKAPS-------KSLDLRAHI  301



>ref|XP_006848445.1| hypothetical protein AMTR_s00013p00243430 [Amborella trichopoda]
 gb|ERN10026.1| hypothetical protein AMTR_s00013p00243430 [Amborella trichopoda]
Length=517

 Score =   352 bits (903),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 167/292 (57%), Positives = 206/292 (71%), Gaps = 7/292 (2%)
 Frame = -3

Query  1398  TTIYQYQQAEMESKSDPLYSAEDSCVTGR----SSSSLPRGIIESRSDLELKPLKAMSIS  1231
             T+ Y     + E  S    S  D C  GR     +  LPR I++  SDLE++PL      
Sbjct  45    TSDYTKTTLQWEVVSSSPTSQSDRC-KGRCIPHGTEPLPRSIVKETSDLEMRPLWGHP--  101

Query  1230  KSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEA  1051
             K KV      NLLA+ VGIKQ + VN++++KFL  NFT++LFHYD NVD W DL W   A
Sbjct  102   KQKVKRNAMKNLLAIAVGIKQMELVNKLVKKFLPYNFTVMLFHYDANVDQWRDLEWCNSA  161

Query  1050  IHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQP  871
             IH+ A +QTKWWFAKRFLHPD+V+ Y YIFLWDEDLGVENF+P RYL I++ EGLEISQP
Sbjct  162   IHVSAVNQTKWWFAKRFLHPDIVAEYKYIFLWDEDLGVENFNPGRYLSIIQKEGLEISQP  221

Query  870   ALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAW  691
             ALDP    +HHRIT R R +  HRR YK +G  +C   S  PPC+G+VE MAPVFSR+AW
Sbjct  222   ALDPIKSEVHHRITSRIRNSIVHRRTYKPQGGGRCFENSTAPPCTGWVEMMAPVFSRAAW  281

Query  690   RCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGS  535
             RC W+++QNDL+H WG+D KLGYCAQGDR+ NVG+VD EY+VH G+ +LGGS
Sbjct  282   RCSWYMVQNDLIHAWGLDKKLGYCAQGDRSKNVGVVDIEYIVHKGLPTLGGS  333



>ref|XP_006592650.1| PREDICTED: uncharacterized protein LOC100526994 isoform X2 [Glycine 
max]
Length=345

 Score =   346 bits (887),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 166/280 (59%), Positives = 206/280 (74%), Gaps = 4/280 (1%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LP GII   S+LE++PL      K    +    NLLAM VG+KQK+ VN+I++KFLS
Sbjct  36    SEALPEGIIARTSNLEMRPL--WDSGKDNRILKRPLNLLAMAVGLKQKEIVNKIVEKFLS  93

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VDGW  LAWS  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWDE
Sbjct  94    SGFVVMLFHYDGFVDGWKSLAWSSCAIHVSAINQTKWWFAKRFLHPDIVAEYNYIFLWDE  153

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DL V+NF P RYL IVK EGLEISQPALDP    +HH +TV    +K HRR YK KGS +
Sbjct  154   DLLVDNFDPKRYLSIVKEEGLEISQPALDPTKSEVHHPLTVHKAVSKVHRRYYKLKGSGR  213

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C ++S  PPC G+VE MAPVFS+ +W+CVWHLIQNDL+H WG+D +LGYCAQGDR  NVG
Sbjct  214   CDDKSTAPPCIGWVEMMAPVFSKKSWQCVWHLIQNDLIHAWGLDRQLGYCAQGDRMRNVG  273

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDLRVE  469
             +VDSEY+VHLG+ +LGGS+   A  P + P      +R++
Sbjct  274   VVDSEYIVHLGLPTLGGSNGNEA--PSDSPGDNRAKVRMQ  311



>ref|XP_006470988.1| PREDICTED: uncharacterized protein LOC102624954 [Citrus sinensis]
Length=407

 Score =   348 bits (893),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 164/278 (59%), Positives = 213/278 (77%), Gaps = 9/278 (3%)
 Frame = -3

Query  1347  LYSAE-DSCVTGR----SSSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAM  1186
             +YSA+ ++C   +     + +LP GI+   S+LE++PL +   S SK+N      NLLA+
Sbjct  58    MYSAKPETCKNQQCRLPGTEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAI  114

Query  1185  PVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAK  1006
               GIKQK  V++I++KF S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAK
Sbjct  115   AAGIKQKKIVDQIVRKFPSKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAK  174

Query  1005  RFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITV  826
             RFLHPD+V+ Y+YIFLWDED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT 
Sbjct  175   RFLHPDIVAEYNYIFLWDEDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITA  234

Query  825   RSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGW  646
             R R +K HRR+YK KGS +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H W
Sbjct  235   RRRNSKAHRRMYKYKGSGRCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAW  294

Query  645   GMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSLGGSS  532
             G+D++LGYCAQGDRT NVG+VDSEY+VHLG+ +LG ++
Sbjct  295   GLDIQLGYCAQGDRTKNVGVVDSEYIVHLGLPTLGVTT  332



>gb|KHG18284.1| GTPase Der [Gossypium arboreum]
Length=394

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 228/320 (71%), Gaps = 7/320 (2%)
 Frame = -3

Query  1437  GLFCVSMLFIL--YRTTIYQYQQAEMESKSDPLYSAEDSCVTGRSSSSLPRGIIESRSDL  1264
             G + +S  FI   Y+    +++   M   S  + + ++ C     S +LP+GI+   S+L
Sbjct  31    GAYFISNAFITNEYKDRFSRWEVINMLRNSKSV-TCKNQC-RPPGSEALPQGIVVKTSNL  88

Query  1263  ELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENFTIILFHYDGNVD  1084
             +++PL + S+    VN     NLLA+ VGIKQK+ V++I++KF   ++ ++LFHYDG VD
Sbjct  89    QMQPLWSDSVKN--VNPETSSNLLAIAVGIKQKEIVDQIVKKFPVSDYVVMLFHYDGIVD  146

Query  1083  GWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLGVENFHPARYLEI  904
              W D  WS  AIH+ A +QTKWWFAKRFLHPD+VS Y YIFLWDEDLGV+NF P +YL I
Sbjct  147   EWKDFEWSDRAIHVSAVNQTKWWFAKRFLHPDIVSKYKYIFLWDEDLGVDNFDPKQYLSI  206

Query  903   VKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTKCSNESEGPPCSGFVE  724
             V+ EGLEISQPALDP    +HH IT R + +KFHRR+YK KG  +C ++S  PPC G+VE
Sbjct  207   VEGEGLEISQPALDPVKSEVHHPITARRKNSKFHRRMYKFKGHGRCDSQSTAPPCIGWVE  266

Query  723   GMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIVDSEYLVHLGIQSL  544
              MAPVFSR+AWRCVW++IQNDL+H WG+DM+LGYCAQGDR  NVG+VD++Y+VH G+ +L
Sbjct  267   MMAPVFSRAAWRCVWYMIQNDLIHAWGLDMQLGYCAQGDRMKNVGVVDAQYVVHFGLPTL  326

Query  543   GGSSLK-RASSPQELPKGRA  487
             G +S + + +  Q+LPK  +
Sbjct  327   GLNSTEVKITQRQQLPKSES  346



>ref|XP_009355359.1| PREDICTED: uncharacterized protein LOC103946389 isoform X3 [Pyrus 
x bretschneideri]
 ref|XP_009355360.1| PREDICTED: uncharacterized protein LOC103946389 isoform X3 [Pyrus 
x bretschneideri]
Length=395

 Score =   348 bits (892),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/278 (58%), Positives = 206/278 (74%), Gaps = 5/278 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LP GII   SDLE  PL   S+     N     +LLA+ VGI+QK+ V++I++KFLS
Sbjct  72    SEALPEGIIAKTSDLEPLPLWGSSVKNE--NSKPSKSLLAIAVGIRQKEIVDKIVKKFLS  129

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
              +F ++LFHYDG VD W DL WS  AIH+   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  130   SDFVVMLFHYDGAVDKWRDLPWSDRAIHVSVMNQTKWWFAKRFLHPDIVSEYKYIFLWDE  189

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGVENF+P RY+ I++ EGLEISQPALDP    ++H IT R + +K HRR +K KGS +
Sbjct  190   DLGVENFNPKRYVSIIQEEGLEISQPALDPDKSEVYHPITARVKKSKVHRRFHKYKGSAR  249

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C + S  PPC+G+VE MAPVFSRSAW+CVW++IQNDLVH WG+D++LGYCAQGDRT NVG
Sbjct  250   CDDHSSAPPCAGWVEMMAPVFSRSAWQCVWYMIQNDLVHAWGLDVQLGYCAQGDRTQNVG  309

Query  588   IVDSEYLVHLGIQSLG---GSSLKRASSPQELPKGRAV  484
             +VDSEY+VHLG+ +LG   G+ +     P +    +A+
Sbjct  310   VVDSEYIVHLGLPTLGVSDGNKVTNGPDPSQKGDSKAL  347



>gb|KDO42573.1| hypothetical protein CISIN_1g014004mg [Citrus sinensis]
Length=432

 Score =   349 bits (895),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 204/260 (78%), Gaps = 4/260 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVN-VTGYHNLLAMPVGIKQKDNVNEIIQKFL  1132
             + +LP GI+   S+LE++PL +   S SK+N      NLLA+  GIKQK  V++I++KF 
Sbjct  76    TEALPEGIVSKTSNLEMRPLWS---SPSKLNNQRPPMNLLAIAAGIKQKKIVDQIVRKFP  132

Query  1131  SENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWD  952
             S++F ++LFHYDG VD W DL W+  AIH+ A +QTKWWFAKRFLHPD+V+ Y+YIFLWD
Sbjct  133   SKDFVVMLFHYDGVVDEWKDLVWADRAIHVSAANQTKWWFAKRFLHPDIVAEYNYIFLWD  192

Query  951   EDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGST  772
             ED+GVENF+P RYL IVK EGLEISQPALDP    +HH IT R R +K HRR+YK KGS 
Sbjct  193   EDIGVENFNPRRYLSIVKDEGLEISQPALDPVKSEVHHPITARRRNSKAHRRMYKYKGSG  252

Query  771   KCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNV  592
             +C + S  PPC G+VE MAPVFSR+AWRC W++IQNDL+H WG+D++LGYCAQGDRT NV
Sbjct  253   RCDDYSTAPPCIGWVEMMAPVFSRAAWRCAWYMIQNDLIHAWGLDIQLGYCAQGDRTKNV  312

Query  591   GIVDSEYLVHLGIQSLGGSS  532
             G+VDSEY+VHLG+ +LG ++
Sbjct  313   GVVDSEYIVHLGLPTLGVTT  332



>ref|XP_010435350.1| PREDICTED: uncharacterized protein LOC104719183 isoform X4 [Camelina 
sativa]
Length=361

 Score =   346 bits (888),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/259 (61%), Positives = 194/259 (75%), Gaps = 5/259 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE +PL       +K N     NLLAM  GIKQK +VN+I++KF S
Sbjct  79    SETLPRGIVASTSDLETRPLWG-----AKRNKKPKPNLLAMAAGIKQKRSVNKIVKKFSS  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS+ AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   SEFVVMLFHYDGVVDEWKEFEWSETAIHISVVNQTKWWFAKRFLHPDIVSTYSYIFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K EGLEISQPALDP    +HH++T R   ++ HRR YK  G  +
Sbjct  194   DLGVDHFDSTRYVSIIKEEGLEISQPALDPYFSEVHHQLTSRDSKSRVHRRTYKVIGQAR  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C   S  PPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  254   CDKNSTAPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  313

Query  588   IVDSEYLVHLGIQSLGGSS  532
             IVDSEY++H+G+ +LGGS+
Sbjct  314   IVDSEYILHMGLPTLGGSA  332



>ref|NP_001154227.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE83192.1| uncharacterized protein AT4G12840 [Arabidopsis thaliana]
Length=395

 Score =   347 bits (891),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 203/274 (74%), Gaps = 5/274 (2%)
 Frame = -3

Query  1308  SSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLS  1129
             S +LPRGI+ S SDLE++PL       +K +     +LLAM VGI+QK++VN+I++KF S
Sbjct  79    SETLPRGIVASTSDLEMRPLWG-----AKRDKKPKPSLLAMAVGIRQKESVNKIVKKFPS  133

Query  1128  ENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDE  949
               F ++LFHYDG VD W +  WS  AIHI   +QTKWWFAKRFLHPD+VS Y YIFLWDE
Sbjct  134   SEFVVMLFHYDGAVDEWKEFEWSDTAIHISVVNQTKWWFAKRFLHPDIVSAYSYIFLWDE  193

Query  948   DLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGSTK  769
             DLGV++F   RY+ I+K E LEISQPALDP    +HH++T R + ++ HRR YK  G  +
Sbjct  194   DLGVDHFDARRYVSIIKEEKLEISQPALDPNFSEVHHQLTSRDKKSRVHRRTYKVIGRAR  253

Query  768   CSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVG  589
             C+  S GPPC+GFVE MAPVFSR+AWRC WH+IQNDL HGWG+D +LGYCAQGDRT N+G
Sbjct  254   CNENSTGPPCTGFVEMMAPVFSRAAWRCTWHMIQNDLNHGWGIDFQLGYCAQGDRTKNIG  313

Query  588   IVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRA  487
             IVDSEY++H+G+ +LGG S +  +   +L K + 
Sbjct  314   IVDSEYILHMGLPTLGGGSAENKTDSGKLDKTKT  347



>ref|XP_002977469.1| hypothetical protein SELMODRAFT_14072, partial [Selaginella moellendorffii]
 gb|EFJ21473.1| hypothetical protein SELMODRAFT_14072, partial [Selaginella moellendorffii]
Length=258

 Score =   342 bits (877),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 198/255 (78%), Gaps = 2/255 (1%)
 Frame = -3

Query  1299  LPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKDNVNEIIQKFLSENF  1120
             LPRGI++  S+ E++PL  +S  K    V   + LLA+  GIKQK  V+ I+QKFL+ NF
Sbjct  5     LPRGIVQQTSNFEVQPLGRVSRKKVVCAVVP-NGLLAVAAGIKQKRYVDRIVQKFLAHNF  63

Query  1119  TIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVVSIYDYIFLWDEDLG  940
             TI+LFHYDG VD W +L WS  AIH+VA +QTKWWFAKRFLHPD+V  Y+YIF+WDEDLG
Sbjct  64    TIMLFHYDGVVDKWNELPWSSRAIHVVAINQTKWWFAKRFLHPDIVDPYEYIFVWDEDLG  123

Query  939   VENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFHRRVYKDKGS-TKCS  763
             VENFH  RYL I+K E LEISQPAL+P +  +HHRIT+RS+  + HRR  K KG+ T C 
Sbjct  124   VENFHVDRYLAIMKYERLEISQPALEPNASEVHHRITIRSKRYRVHRRSLKPKGTGTLCF  183

Query  762   NESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLGYCAQGDRTTNVGIV  583
               S  PPC+G+VEGMAPVF+R AW+CVWHLIQNDLVHGWGMD KLGYC +GDR+ +VG++
Sbjct  184   ENSTDPPCTGWVEGMAPVFTRDAWKCVWHLIQNDLVHGWGMDFKLGYCVKGDRSKSVGVI  243

Query  582   DSEYLVHLGIQSLGG  538
             DSEY+VH GI SLGG
Sbjct  244   DSEYIVHRGIPSLGG  258



>ref|XP_008382541.1| PREDICTED: uncharacterized protein LOC103445326 isoform X1 [Malus 
domestica]
Length=400

 Score =   347 bits (891),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 156/289 (54%), Positives = 212/289 (73%), Gaps = 5/289 (2%)
 Frame = -3

Query  1341  SAEDSCVTGRSSSSLPRGIIESRSDLELKPLKAMSISKSKVNVTGYHNLLAMPVGIKQKD  1162
             S E  C     + +LP+GI+   SDL ++PL      ++K N     NLLAM VG+KQK+
Sbjct  66    SCETQC-RPEGTEALPKGIVSKTSDLLMQPLWG---PRNKKNTKSSTNLLAMAVGLKQKE  121

Query  1161  NVNEIIQKFLSENFTIILFHYDGNVDGWWDLAWSKEAIHIVAHSQTKWWFAKRFLHPDVV  982
             +VN+I++KF+S +F  +LFHYDG+V+ W DL WS +AIH+ A +QTKWW+AKRFLHPD+V
Sbjct  122   SVNKIVKKFISSDFVFMLFHYDGHVNEWRDLEWSGKAIHVSAMNQTKWWYAKRFLHPDIV  181

Query  981   SIYDYIFLWDEDLGVENFHPARYLEIVKSEGLEISQPALDPKSIGIHHRITVRSRTNKFH  802
             S Y++IFLWDEDLG+ENF+  RYL I++ EGL+ISQPALDP +  +HH +T R    + H
Sbjct  182   SEYEFIFLWDEDLGIENFNAGRYLSIIRKEGLQISQPALDPDNSEVHHLLTARDNRTEVH  241

Query  801   RRVYKD-KGSTKCSNESEGPPCSGFVEGMAPVFSRSAWRCVWHLIQNDLVHGWGMDMKLG  625
             R++ K  +G  KC   S  PPC+GFVE MAPVFS+++WRC+WH+IQNDLVH WG+D +LG
Sbjct  242   RKINKTLRGGRKCDENSTDPPCTGFVEMMAPVFSQASWRCIWHMIQNDLVHAWGLDFQLG  301

Query  624   YCAQGDRTTNVGIVDSEYLVHLGIQSLGGSSLKRASSPQELPKGRAVDL  478
             YCAQGDRT N+GIVDSEY++H GI SLGGS+  + ++       + ++L
Sbjct  302   YCAQGDRTKNIGIVDSEYIIHYGIPSLGGSAANKTNAEANDQPAQNINL  350



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4874061219876