BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7144_g1_i1 len=1162 path=[1:0-697 699:698-1161]

Length=1162
                                                                      Score     E

ref|XP_004247365.1|  PREDICTED: uncharacterized protein LOC101255829    421   1e-143   
ref|XP_009778492.1|  PREDICTED: uncharacterized protein LOC104227838    416   7e-142   
ref|XP_006359923.1|  PREDICTED: uncharacterized protein C24B11.05...    416   7e-142   
ref|XP_009591867.1|  PREDICTED: uncharacterized protein LOC104088829    413   1e-140   
ref|XP_011090711.1|  PREDICTED: uncharacterized protein LOC105171337    394   2e-133   
emb|CDO99041.1|  unnamed protein product                                391   9e-132   
gb|KDP40159.1|  hypothetical protein JCGZ_02157                         390   1e-131   
ref|XP_010256007.1|  PREDICTED: uncharacterized protein LOC104596512    389   3e-131   
ref|XP_010277510.1|  PREDICTED: uncharacterized protein LOC104611920    384   3e-129   
ref|XP_004296895.1|  PREDICTED: suppressor of disruption of TFIIS...    384   4e-129   
ref|XP_010024347.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    382   1e-128   
ref|XP_002312525.1|  putative phosphatase family protein                382   3e-128   Populus trichocarpa [western balsam poplar]
gb|ABK94360.1|  unknown                                                 382   3e-128   Populus trichocarpa [western balsam poplar]
ref|XP_011021545.1|  PREDICTED: uncharacterized protein C24B11.05...    381   6e-128   
ref|XP_002281854.1|  PREDICTED: uncharacterized protein LOC100263185    380   8e-128   Vitis vinifera
ref|XP_002314706.1|  putative phosphatase family protein                380   9e-128   Populus trichocarpa [western balsam poplar]
gb|EYU41498.1|  hypothetical protein MIMGU_mgv1a011931mg                379   4e-127   
ref|XP_002516773.1|  Protein SSM1, putative                             378   1e-126   Ricinus communis
ref|XP_011015858.1|  PREDICTED: uncharacterized protein C24B11.05...    377   3e-126   
ref|XP_010108012.1|  hypothetical protein L484_012369                   376   4e-126   
ref|XP_008363460.1|  PREDICTED: uncharacterized protein C24B11.05...    376   7e-126   
ref|XP_011026318.1|  PREDICTED: uncharacterized protein C24B11.05...    375   1e-125   
ref|XP_009344085.1|  PREDICTED: uncharacterized protein LOC103935975    374   5e-125   
ref|XP_008224536.1|  PREDICTED: uncharacterized protein C24B11.05       374   5e-125   
ref|XP_007227483.1|  hypothetical protein PRUPE_ppa009986mg             374   6e-125   
ref|XP_007034726.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    371   3e-124   
ref|XP_009366925.1|  PREDICTED: uncharacterized protein LOC103956624    366   5e-122   
emb|CAN62374.1|  hypothetical protein VITISV_036478                     357   2e-118   Vitis vinifera
ref|XP_006419900.1|  hypothetical protein CICLE_v10005687mg             355   9e-118   
ref|XP_004496742.1|  PREDICTED: uncharacterized protein C24B11.05...    354   2e-117   
gb|KDO74644.1|  hypothetical protein CISIN_1g025190mg                   353   2e-117   
gb|AFK41981.1|  unknown                                                 347   8e-115   
ref|XP_003592405.1|  Phosphate metabolism protein                       345   5e-114   
emb|CAD57681.1|  putative phosphatase                                   345   6e-114   Phaseolus vulgaris [French bean]
gb|KHN15780.1|  Hypothetical protein glysoja_012572                     345   8e-114   
ref|NP_001235869.1|  uncharacterized protein LOC547648                  341   2e-112   
ref|XP_004156075.1|  PREDICTED: uncharacterized protein C24B11.05...    341   2e-112   
ref|XP_008449552.1|  PREDICTED: uncharacterized protein C24B11.05       340   4e-112   
ref|XP_006410349.1|  hypothetical protein EUTSA_v10017107mg             340   6e-112   
gb|AGV54261.1|  phosphatase                                             340   8e-112   
ref|XP_004140145.1|  PREDICTED: uncharacterized protein C24B11.05...    339   1e-111   
ref|XP_007143240.1|  hypothetical protein PHAVU_007G056000g             340   3e-111   
ref|XP_006295927.1|  hypothetical protein CARUB_v10025064mg             337   9e-111   
ref|XP_002879366.1|  predicted protein                                  337   1e-110   
gb|KHN02709.1|  Hypothetical protein glysoja_015951                     336   2e-110   
gb|KFK31156.1|  hypothetical protein AALP_AA6G075700                    336   2e-110   
emb|CAD57680.1|  putative phosphatase                                   336   2e-110   Glycine max [soybeans]
ref|XP_010666929.1|  PREDICTED: phosphate metabolism protein 8          334   1e-109   
ref|NP_565738.1|  haloacid dehalogenase-like hydrolase domain-con...    333   2e-109   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12231.1|  BnaC04g12610D                                          333   3e-109   
ref|XP_010510096.1|  PREDICTED: uncharacterized protein LOC104786383    333   5e-109   
gb|ACU14943.1|  unknown                                                 331   9e-109   Glycine max [soybeans]
ref|XP_010414030.1|  PREDICTED: uncharacterized protein LOC104700243    332   1e-108   
ref|XP_009144008.1|  PREDICTED: uncharacterized protein C24B11.05       330   3e-108   
ref|XP_010469627.1|  PREDICTED: uncharacterized protein LOC104749650    330   4e-108   
ref|XP_010522301.1|  PREDICTED: uncharacterized protein C24B11.05       326   1e-106   
ref|XP_008357036.1|  PREDICTED: uncharacterized protein C24B11.05...    323   6e-106   
gb|KHG28233.1|  putative C24B11.05                                      320   3e-104   
gb|KCW60795.1|  hypothetical protein EUGRSUZ_H03532                     317   7e-104   
ref|XP_003535653.1|  PREDICTED: uncharacterized protein C24B11.05       318   1e-103   
gb|AES62657.2|  haloacid dehalogenase-like hydrolase                    316   9e-103   
ref|XP_007143241.1|  hypothetical protein PHAVU_007G056000g             306   4e-98    
ref|XP_008801711.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    291   1e-92    
gb|EAY91536.1|  hypothetical protein OsI_13169                          287   3e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_009396379.1|  PREDICTED: uncharacterized protein LOC103981...    285   3e-90    
ref|NP_001050999.1|  Os03g0701200                                       280   2e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006650447.1|  PREDICTED: uncharacterized protein C24B11.05...    280   3e-88    
ref|XP_003560896.1|  PREDICTED: suppressor of disruption of TFIIS       277   4e-87    
ref|XP_007143243.1|  hypothetical protein PHAVU_007G056000g             276   5e-87    
gb|KDO74645.1|  hypothetical protein CISIN_1g025190mg                   273   5e-87    
ref|NP_001136893.1|  phosphatase                                        273   8e-86    Zea mays [maize]
gb|ABK22916.1|  unknown                                                 272   1e-85    Picea sitchensis
ref|XP_009395583.1|  PREDICTED: uncharacterized protein LOC103980...    271   4e-85    
ref|XP_009411270.1|  PREDICTED: uncharacterized protein LOC103993065    271   5e-85    
ref|XP_009396378.1|  PREDICTED: uncharacterized protein LOC103981...    271   2e-84    
gb|ABK23515.1|  unknown                                                 269   8e-84    Picea sitchensis
gb|ABR17203.1|  unknown                                                 266   1e-82    Picea sitchensis
ref|XP_004982074.1|  PREDICTED: uncharacterized protein C24B11.05...    265   1e-82    
gb|ABK21362.1|  unknown                                                 261   7e-81    Picea sitchensis
dbj|BAJ97807.1|  predicted protein                                      256   3e-79    
dbj|BAK03247.1|  predicted protein                                      255   7e-79    
gb|EMT22780.1|  hypothetical protein F775_28925                         254   2e-78    
ref|XP_004982073.1|  PREDICTED: uncharacterized protein C24B11.05...    254   2e-77    
ref|XP_009125440.1|  PREDICTED: uncharacterized protein C24B11.05...    251   3e-77    
emb|CDY48102.1|  BnaC02g03590D                                          251   3e-77    
ref|XP_009419743.1|  PREDICTED: phosphate metabolism protein 8-like     249   3e-76    
ref|XP_008667535.1|  PREDICTED: uncharacterized protein LOC100273...    248   7e-76    
gb|ACG34520.1|  catalytic/ hydrolase                                    248   8e-76    Zea mays [maize]
ref|XP_002320927.1|  haloacid dehalogenase-like hydrolase family ...    247   8e-76    Populus trichocarpa [western balsam poplar]
ref|XP_010037824.1|  PREDICTED: uncharacterized protein C24B11.05...    248   2e-75    
gb|KCW49591.1|  hypothetical protein EUGRSUZ_K03116                     248   2e-75    
ref|XP_002866333.1|  hypothetical protein ARALYDRAFT_496082             246   3e-75    
ref|XP_009395584.1|  PREDICTED: uncharacterized protein LOC103980...    245   4e-75    
ref|XP_010047821.1|  PREDICTED: uncharacterized protein LOC104436669    246   5e-75    
ref|XP_002468106.1|  hypothetical protein SORBIDRAFT_01g039680          245   7e-75    Sorghum bicolor [broomcorn]
ref|XP_009416228.1|  PREDICTED: uncharacterized protein C24B11.05...    245   9e-75    
ref|XP_006281623.1|  hypothetical protein CARUB_v10027751mg             244   2e-74    
ref|XP_003558239.1|  PREDICTED: phosphate metabolism protein 8          244   2e-74    
ref|XP_006649838.1|  PREDICTED: uncharacterized protein C24B11.05...    244   3e-74    
ref|XP_010931242.1|  PREDICTED: uncharacterized protein C24B11.05...    244   3e-74    
ref|XP_004137773.1|  PREDICTED: uncharacterized protein C24B11.05...    243   4e-74    
emb|CBI30538.3|  unnamed protein product                                247   6e-74    
ref|XP_003562613.1|  PREDICTED: uncharacterized protein C24B11.05       242   8e-74    
ref|XP_011076255.1|  PREDICTED: uncharacterized protein C24B11.05       243   8e-74    
ref|NP_001150070.1|  catalytic/ hydrolase                               243   1e-73    Zea mays [maize]
ref|XP_004984719.1|  PREDICTED: uncharacterized protein C24B11.05...    242   1e-73    
gb|AFW88835.1|  catalytic/ hydrolase                                    243   1e-73    
ref|XP_008240768.1|  PREDICTED: uncharacterized protein LOC103339270    243   1e-73    
ref|XP_009389528.1|  PREDICTED: uncharacterized protein C24B11.05...    243   1e-73    
ref|XP_004302744.1|  PREDICTED: uncharacterized protein LOC101294...    242   1e-73    
ref|XP_006398686.1|  hypothetical protein EUTSA_v10014335mg             242   2e-73    
ref|XP_006838246.1|  hypothetical protein AMTR_s00103p00040030          238   2e-73    
ref|XP_007134046.1|  hypothetical protein PHAVU_010G014800g             242   3e-73    
ref|XP_010256890.1|  PREDICTED: uncharacterized protein LOC104597165    241   4e-73    
gb|EMT24873.1|  hypothetical protein F775_27766                         241   4e-73    
ref|XP_004229150.1|  PREDICTED: uncharacterized protein C24B11.05       239   6e-73    
emb|CDX91378.1|  BnaC04g07720D                                          240   6e-73    
ref|XP_007205580.1|  hypothetical protein PRUPE_ppa008834mg             241   6e-73    
emb|CBI16105.3|  unnamed protein product                                240   7e-73    
ref|XP_007205579.1|  hypothetical protein PRUPE_ppa008834mg             241   8e-73    
gb|KDP35647.1|  hypothetical protein JCGZ_09085                         240   1e-72    
ref|XP_007205578.1|  hypothetical protein PRUPE_ppa008834mg             241   1e-72    
dbj|BAJ98890.1|  predicted protein                                      239   1e-72    
ref|XP_009387370.1|  PREDICTED: uncharacterized protein C24B11.05...    239   2e-72    
gb|EYU40822.1|  hypothetical protein MIMGU_mgv1a012429mg                238   2e-72    
ref|XP_010483585.1|  PREDICTED: suppressor of disruption of TFIIS...    239   2e-72    
ref|XP_010455085.1|  PREDICTED: suppressor of disruption of TFIIS...    239   2e-72    
ref|XP_010937594.1|  PREDICTED: uncharacterized protein C24B11.05...    239   2e-72    
ref|XP_010483581.1|  PREDICTED: suppressor of disruption of TFIIS...    238   2e-72    
gb|KDP28362.1|  hypothetical protein JCGZ_14133                         239   2e-72    
gb|AFK36449.1|  unknown                                                 239   3e-72    
ref|XP_010035366.1|  PREDICTED: suppressor of disruption of TFIIS       239   3e-72    
ref|NP_001242073.1|  uncharacterized protein LOC100796466               239   3e-72    
ref|NP_001049700.1|  Os03g0273800                                       239   3e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010920551.1|  PREDICTED: uncharacterized protein C24B11.05...    239   4e-72    
ref|NP_001239984.1|  uncharacterized protein LOC100787007               239   4e-72    
ref|XP_011094874.1|  PREDICTED: uncharacterized protein LOC105174...    239   4e-72    
ref|XP_006444646.1|  hypothetical protein CICLE_v10021621mg             238   4e-72    
gb|KEH29061.1|  haloacid dehalogenase-like hydrolase                    239   4e-72    
ref|XP_010443707.1|  PREDICTED: suppressor of disruption of TFIIS...    238   5e-72    
ref|XP_002515158.1|  catalytic, putative                                238   5e-72    Ricinus communis
gb|EYU41734.1|  hypothetical protein MIMGU_mgv1a011006mg                239   5e-72    
ref|XP_006444648.1|  hypothetical protein CICLE_v10021621mg             238   5e-72    
gb|KCW46732.1|  hypothetical protein EUGRSUZ_K00553                     239   5e-72    
ref|XP_011077641.1|  PREDICTED: uncharacterized protein LOC105161601    239   5e-72    
ref|XP_002283297.1|  PREDICTED: uncharacterized protein C24B11.05       238   6e-72    Vitis vinifera
ref|XP_006572870.1|  PREDICTED: uncharacterized protein LOC100796...    239   6e-72    
emb|CDY10459.1|  BnaCnng03600D                                          238   7e-72    
ref|XP_011094872.1|  PREDICTED: uncharacterized protein LOC105174...    239   7e-72    
gb|KHG12961.1|  putative C24B11.05                                      238   9e-72    
gb|KHG16693.1|  putative C24B11.05                                      237   1e-71    
ref|XP_009143463.1|  PREDICTED: uncharacterized protein C24B11.05...    237   1e-71    
ref|XP_010262543.1|  PREDICTED: uncharacterized protein LOC104601051    238   1e-71    
ref|XP_008784612.1|  PREDICTED: uncharacterized protein C24B11.05       237   2e-71    
ref|XP_010909508.1|  PREDICTED: uncharacterized protein C24B11.05       237   2e-71    
ref|XP_009349464.1|  PREDICTED: uncharacterized protein LOC103941004    237   2e-71    
emb|CDX74940.1|  BnaA05g06860D                                          236   2e-71    
ref|XP_009416677.1|  PREDICTED: uncharacterized protein C24B11.05...    237   2e-71    
ref|NP_001268146.1|  ripening-related protein-like                      237   2e-71    
ref|XP_011039981.1|  PREDICTED: uncharacterized protein C24B11.05...    237   2e-71    
ref|XP_007140519.1|  hypothetical protein PHAVU_008G119500g             237   2e-71    
gb|AGV54701.1|  ripening-related protein                                237   2e-71    
ref|XP_010238970.1|  PREDICTED: uncharacterized protein LOC100821...    236   3e-71    
ref|XP_009375913.1|  PREDICTED: uncharacterized protein LOC103964681    236   3e-71    
ref|XP_008387783.1|  PREDICTED: uncharacterized protein LOC103450242    236   3e-71    
ref|XP_002463244.1|  hypothetical protein SORBIDRAFT_02g040450          235   3e-71    Sorghum bicolor [broomcorn]
ref|XP_009122797.1|  PREDICTED: uncharacterized protein C24B11.05       236   3e-71    
ref|XP_004302743.1|  PREDICTED: uncharacterized protein LOC101294...    236   4e-71    
ref|XP_008349600.1|  PREDICTED: uncharacterized protein C24B11.05...    236   4e-71    
ref|XP_010676721.1|  PREDICTED: suppressor of disruption of TFIIS       234   5e-71    
ref|XP_008227762.1|  PREDICTED: uncharacterized protein C24B11.05       235   7e-71    
emb|CDY33043.1|  BnaA10g12490D                                          234   8e-71    
ref|XP_010544915.1|  PREDICTED: uncharacterized protein C24B11.05       234   9e-71    
ref|XP_009600978.1|  PREDICTED: uncharacterized protein C24B11.05       234   1e-70    
ref|NP_191763.3|  haloacid dehalogenase-like hydrolase superfamil...    234   1e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010468992.1|  PREDICTED: uncharacterized protein C24B11.05...    234   1e-70    
ref|XP_007221494.1|  hypothetical protein PRUPE_ppa009851mg             234   1e-70    
ref|XP_010423885.1|  PREDICTED: uncharacterized protein C24B11.05...    234   1e-70    
ref|XP_008222324.1|  PREDICTED: uncharacterized protein C24B11.05...    234   1e-70    
ref|XP_007150342.1|  hypothetical protein PHAVU_005G145500g             234   1e-70    
ref|XP_004514386.1|  PREDICTED: uncharacterized protein LOC101507684    235   1e-70    
ref|XP_002309065.1|  hypothetical protein POPTR_0006s08720g             235   1e-70    Populus trichocarpa [western balsam poplar]
ref|XP_011019847.1|  PREDICTED: uncharacterized protein LOC105122445    235   1e-70    
ref|XP_004288663.1|  PREDICTED: uncharacterized protein C24B11.05...    234   1e-70    
ref|XP_008222317.1|  PREDICTED: uncharacterized protein C24B11.05...    234   2e-70    
ref|XP_003543518.1|  PREDICTED: uncharacterized protein C24B11.05...    234   2e-70    
ref|XP_009779692.1|  PREDICTED: uncharacterized protein LOC104228845    234   2e-70    
ref|NP_001241637.1|  uncharacterized protein LOC100795391               234   2e-70    
ref|XP_009116877.1|  PREDICTED: uncharacterized protein C24B11.05       233   2e-70    
ref|XP_004981147.1|  PREDICTED: uncharacterized protein C24B11.05...    234   2e-70    
ref|XP_004971429.1|  PREDICTED: uncharacterized protein C24B11.05...    233   3e-70    
ref|XP_010452055.1|  PREDICTED: uncharacterized protein C24B11.05...    233   4e-70    
ref|XP_010509295.1|  PREDICTED: uncharacterized protein C24B11.05...    233   5e-70    
ref|XP_009387379.1|  PREDICTED: uncharacterized protein C24B11.05...    233   5e-70    
ref|XP_002302699.2|  haloacid dehalogenase-like hydrolase family ...    234   5e-70    Populus trichocarpa [western balsam poplar]
ref|XP_009587188.1|  PREDICTED: uncharacterized protein LOC104084931    233   5e-70    
gb|EMS45749.1|  Uncharacterized protein C24B11.05                       234   5e-70    
ref|NP_001150461.1|  LOC100284091                                       232   6e-70    Zea mays [maize]
ref|XP_009764836.1|  PREDICTED: uncharacterized protein C24B11.05       232   7e-70    
ref|XP_006288408.1|  hypothetical protein CARUB_v10001663mg             232   8e-70    
ref|XP_003554584.1|  PREDICTED: uncharacterized protein C24B11.05...    232   8e-70    
ref|XP_003521627.1|  PREDICTED: uncharacterized protein C24B11.05...    232   8e-70    
ref|XP_010490640.1|  PREDICTED: uncharacterized protein C24B11.05...    232   9e-70    
ref|XP_010543295.1|  PREDICTED: uncharacterized protein C24B11.05...    233   9e-70    
ref|XP_010682722.1|  PREDICTED: uncharacterized protein C24B11.05...    233   1e-69    
ref|XP_006365453.1|  PREDICTED: suppressor of disruption of TFIIS...    230   1e-69    
ref|XP_002280756.1|  PREDICTED: uncharacterized protein C24B11.05...    232   1e-69    Vitis vinifera
ref|XP_006341015.1|  PREDICTED: uncharacterized protein LOC102599760    233   1e-69    
gb|KHN13997.1|  Hypothetical protein glysoja_025014                     233   1e-69    
ref|XP_002533744.1|  catalytic, putative                                232   1e-69    Ricinus communis
ref|XP_008799742.1|  PREDICTED: uncharacterized protein C24B11.05...    232   1e-69    
ref|XP_010107302.1|  hypothetical protein L484_009436                   233   1e-69    
gb|KDP42242.1|  hypothetical protein JCGZ_02972                         232   1e-69    
gb|EMS52722.1|  Uncharacterized protein C24B11.05                       239   2e-69    
ref|XP_003522172.1|  PREDICTED: suppressor of disruption of TFIIS...    232   2e-69    
ref|XP_010652318.1|  PREDICTED: uncharacterized protein C24B11.05...    232   2e-69    
gb|KHN27240.1|  Hypothetical protein glysoja_046608                     232   2e-69    
ref|XP_008448042.1|  PREDICTED: uncharacterized protein C24B11.05...    232   2e-69    
ref|XP_009759728.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    231   2e-69    
ref|XP_007051329.1|  Haloacid dehalogenase-like hydrolase superfa...    231   3e-69    
ref|XP_008653771.1|  PREDICTED: uncharacterized protein LOC100193...    231   3e-69    
ref|XP_002463591.1|  hypothetical protein SORBIDRAFT_01g002590          231   3e-69    Sorghum bicolor [broomcorn]
ref|XP_004166506.1|  PREDICTED: uncharacterized protein C24B11.05...    231   3e-69    
ref|XP_007205709.1|  hypothetical protein PRUPE_ppa009908mg             231   3e-69    
ref|XP_011025285.1|  PREDICTED: uncharacterized protein C24B11.05       232   3e-69    
ref|XP_006576591.1|  PREDICTED: suppressor of disruption of TFIIS...    232   3e-69    
ref|XP_010512588.1|  PREDICTED: uncharacterized protein C24B11.05...    230   3e-69    
emb|CDP09081.1|  unnamed protein product                                230   3e-69    
ref|XP_010106511.1|  hypothetical protein L484_025271                   231   4e-69    
ref|XP_008442536.1|  PREDICTED: uncharacterized protein LOC103486381    231   4e-69    
ref|XP_010914820.1|  PREDICTED: uncharacterized protein C24B11.05...    231   4e-69    
ref|XP_010505362.1|  PREDICTED: uncharacterized protein C24B11.05...    230   4e-69    
ref|XP_004246419.1|  PREDICTED: uncharacterized protein LOC101251913    231   5e-69    
ref|XP_006488357.1|  PREDICTED: uncharacterized protein C24B11.05...    230   5e-69    
gb|ACF78996.1|  unknown                                                 230   5e-69    Zea mays [maize]
ref|XP_010529825.1|  PREDICTED: uncharacterized protein C24B11.05...    230   5e-69    
ref|XP_010240834.1|  PREDICTED: uncharacterized protein C24B11.05       230   6e-69    
ref|XP_004958439.1|  PREDICTED: uncharacterized protein C24B11.05...    230   6e-69    
ref|XP_004516490.1|  PREDICTED: uncharacterized protein LOC101512518    231   6e-69    
gb|AAM65114.1|  unknown                                                 230   6e-69    Arabidopsis thaliana [mouse-ear cress]
ref|NP_195843.1|  haloacid dehalogenase-like hydrolase superfamil...    230   7e-69    Arabidopsis thaliana [mouse-ear cress]
gb|KCW46735.1|  hypothetical protein EUGRSUZ_K00553                     229   8e-69    
gb|ACG27085.1|  catalytic/ hydrolase                                    229   8e-69    Zea mays [maize]
gb|KHF97741.1|  putative C24B11.05                                      230   8e-69    
ref|XP_004142063.1|  PREDICTED: uncharacterized protein C24B11.05...    230   9e-69    
ref|XP_002870962.1|  hypothetical protein ARALYDRAFT_908087             229   1e-68    
ref|XP_007145081.1|  hypothetical protein PHAVU_007G208000g             229   1e-68    
gb|ACU19510.1|  unknown                                                 230   1e-68    Glycine max [soybeans]
ref|XP_008777166.1|  PREDICTED: uncharacterized protein C24B11.05...    229   1e-68    
ref|XP_010413314.1|  PREDICTED: uncharacterized protein C24B11.05...    228   1e-68    
ref|XP_004981148.1|  PREDICTED: uncharacterized protein C24B11.05...    229   1e-68    
ref|XP_009345398.1|  PREDICTED: uncharacterized protein LOC103937203    230   1e-68    
gb|KEH43165.1|  haloacid dehalogenase-like hydrolase                    228   2e-68    
ref|XP_009341744.1|  PREDICTED: uncharacterized protein LOC103933782    229   2e-68    
ref|XP_010239121.1|  PREDICTED: uncharacterized protein LOC100821...    228   2e-68    
gb|AFK42861.1|  unknown                                                 228   2e-68    
ref|XP_009375914.1|  PREDICTED: uncharacterized protein LOC103964682    229   2e-68    
ref|XP_009414325.1|  PREDICTED: uncharacterized protein C24B11.05...    229   2e-68    
ref|XP_007207960.1|  hypothetical protein PRUPE_ppa016790mg             229   2e-68    
ref|XP_006281852.1|  hypothetical protein CARUB_v10028046mg             228   2e-68    
ref|XP_009606496.1|  PREDICTED: uncharacterized protein C24B11.05...    228   2e-68    
ref|XP_008775417.1|  PREDICTED: uncharacterized protein LOC103695...    229   2e-68    
gb|EYU26599.1|  hypothetical protein MIMGU_mgv1a010834mg                229   2e-68    
ref|NP_001132215.1|  uncharacterized protein LOC100193647               228   3e-68    Zea mays [maize]
ref|XP_004294647.1|  PREDICTED: suppressor of disruption of TFIIS...    228   3e-68    
emb|CBI37037.3|  unnamed protein product                                229   3e-68    
ref|XP_004486990.1|  PREDICTED: uncharacterized protein C24B11.05...    228   4e-68    
gb|EPS62697.1|  hypothetical protein M569_12094                         228   5e-68    
ref|XP_004958437.1|  PREDICTED: uncharacterized protein C24B11.05...    227   5e-68    
ref|XP_010517039.1|  PREDICTED: uncharacterized protein C24B11.05...    228   5e-68    
ref|XP_006350782.1|  PREDICTED: uncharacterized protein C24B11.05...    227   6e-68    
ref|XP_004514131.1|  PREDICTED: uncharacterized protein LOC101497...    228   6e-68    
emb|CDM87099.1|  unnamed protein product                                228   6e-68    
ref|XP_003565160.1|  PREDICTED: suppressor of disruption of TFIIS...    228   7e-68    
ref|XP_010520273.1|  PREDICTED: suppressor of disruption of TFIIS       226   8e-68    
ref|XP_004514130.1|  PREDICTED: uncharacterized protein LOC101497...    228   8e-68    
ref|XP_009387529.1|  PREDICTED: uncharacterized protein C24B11.05...    227   8e-68    
ref|XP_008222342.1|  PREDICTED: uncharacterized protein C24B11.05       227   8e-68    
gb|ACJ85359.1|  unknown                                                 227   9e-68    Medicago truncatula
ref|NP_200757.1|  haloacid dehalogenase-like hydrolase (HAD) supe...    226   9e-68    
ref|XP_010322342.1|  PREDICTED: uncharacterized protein C24B11.05...    226   1e-67    
ref|XP_006650859.1|  PREDICTED: uncharacterized protein C24B11.05...    227   1e-67    
ref|XP_009363053.1|  PREDICTED: uncharacterized protein C24B11.05...    228   1e-67    
ref|XP_006424862.1|  hypothetical protein CICLE_v10028968mg             227   1e-67    
gb|KFK27474.1|  hypothetical protein AALP_AA8G388400                    226   1e-67    
gb|AAR88590.1|  expressed protein                                       227   1e-67    
dbj|BAJ89714.1|  predicted protein                                      226   1e-67    
gb|EEC72257.1|  hypothetical protein OsI_05400                          227   1e-67    
ref|NP_001241392.1|  uncharacterized protein LOC100814291               226   1e-67    
ref|NP_001045544.1|  Os01g0973000                                       226   2e-67    
dbj|BAA97484.1|  ripening-related protein-like; hydrolase-like          226   2e-67    
gb|KHN14182.1|  Hypothetical protein glysoja_028580                     226   2e-67    
ref|XP_004495846.1|  PREDICTED: uncharacterized protein C24B11.05...    226   2e-67    
ref|XP_003520900.1|  PREDICTED: uncharacterized protein LOC100790020    227   2e-67    
ref|XP_002457026.1|  hypothetical protein SORBIDRAFT_03g047380          226   3e-67    
ref|XP_008381633.1|  PREDICTED: uncharacterized protein C24B11.05...    226   3e-67    
gb|EAZ04823.1|  hypothetical protein OsI_27001                          226   3e-67    
ref|XP_007026991.1|  Haloacid dehalogenase-like hydrolase (HAD) s...    226   3e-67    
ref|XP_008356961.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    225   3e-67    
ref|XP_006841524.1|  hypothetical protein AMTR_s00003p00149130          226   4e-67    
ref|NP_001060381.1|  Os07g0634400                                       225   5e-67    
ref|XP_009120460.1|  PREDICTED: suppressor of disruption of TFIIS...    224   5e-67    
gb|KHG26779.1|  putative C24B11.05                                      225   6e-67    
emb|CDX80262.1|  BnaC09g34800D                                          224   6e-67    
gb|KEH29067.1|  haloacid dehalogenase-like hydrolase                    226   7e-67    
gb|ACU24195.1|  unknown                                                 226   7e-67    
emb|CDY53448.1|  BnaA02g07040D                                          224   8e-67    
emb|CDP06600.1|  unnamed protein product                                227   8e-67    
gb|KEH43163.1|  haloacid dehalogenase-like hydrolase                    223   9e-67    
ref|NP_001150242.1|  LOC100283872                                       224   1e-66    
gb|KDP42241.1|  hypothetical protein JCGZ_02971                         224   1e-66    
ref|XP_007163260.1|  hypothetical protein PHAVU_001G219300g             224   1e-66    
ref|XP_006577190.1|  PREDICTED: uncharacterized protein C24B11.05...    223   1e-66    
ref|XP_002533745.1|  catalytic, putative                                224   1e-66    
ref|XP_002313427.1|  hypothetical protein POPTR_0009s03870g             224   2e-66    
ref|XP_003597382.1|  Ripening-related protein-like hydrolase-like...    224   2e-66    
ref|XP_006294778.1|  hypothetical protein CARUB_v10023829mg             223   2e-66    
ref|XP_010558332.1|  PREDICTED: uncharacterized protein LOC104827021    224   2e-66    
ref|XP_010091441.1|  hypothetical protein L484_013896                   223   2e-66    
ref|XP_006348795.1|  PREDICTED: uncharacterized protein LOC102602380    224   2e-66    
ref|XP_007016371.1|  Haloacid dehalogenase-like hydrolase superfa...    232   3e-66    
emb|CDY48684.1|  BnaC02g09960D                                          223   3e-66    
ref|XP_006429115.1|  hypothetical protein CICLE_v10012173mg             223   4e-66    
ref|XP_006480883.1|  PREDICTED: uncharacterized protein LOC102613...    223   4e-66    
ref|XP_009416664.1|  PREDICTED: uncharacterized protein C24B11.05...    224   4e-66    
gb|KHN14243.1|  Hypothetical protein glysoja_040897                     222   5e-66    
ref|XP_004145289.1|  PREDICTED: uncharacterized protein C24B11.05...    223   5e-66    
ref|XP_007134006.1|  hypothetical protein PHAVU_010G011200g             223   6e-66    
ref|XP_009414327.1|  PREDICTED: uncharacterized protein C24B11.05...    222   6e-66    
gb|EMS66233.1|  Uncharacterized protein C24B11.05                       222   8e-66    
gb|EPS65633.1|  hypothetical protein M569_09148                         221   8e-66    
ref|XP_006429113.1|  hypothetical protein CICLE_v10012173mg             223   8e-66    
ref|XP_006429114.1|  hypothetical protein CICLE_v10012173mg             224   8e-66    
ref|XP_011042726.1|  PREDICTED: uncharacterized protein C24B11.05...    222   9e-66    
ref|XP_006480882.1|  PREDICTED: uncharacterized protein LOC102613...    223   9e-66    
gb|KHG18972.1|  putative C24B11.05                                      224   1e-65    
ref|XP_010920549.1|  PREDICTED: uncharacterized protein C24B11.05...    223   1e-65    
ref|XP_010322341.1|  PREDICTED: uncharacterized protein C24B11.05...    221   1e-65    
gb|KDO51172.1|  hypothetical protein CISIN_1g020219mg                   222   1e-65    
ref|XP_009126695.1|  PREDICTED: suppressor of disruption of TFIIS...    221   1e-65    
ref|XP_003606690.1|  Ripening-related protein-like hydrolase-like...    221   1e-65    
ref|XP_009364428.1|  PREDICTED: uncharacterized protein LOC103954336    232   2e-65    
ref|XP_006645398.1|  PREDICTED: uncharacterized protein C24B11.05...    221   2e-65    
ref|XP_011035284.1|  PREDICTED: uncharacterized protein C24B11.05...    221   2e-65    
gb|KDO51171.1|  hypothetical protein CISIN_1g020219mg                   223   2e-65    
ref|XP_002298348.1|  hypothetical protein POPTR_0001s24910g             221   3e-65    
ref|XP_008775418.1|  PREDICTED: uncharacterized protein LOC103695...    220   5e-65    
ref|XP_011089496.1|  PREDICTED: suppressor of disruption of TFIIS...    219   7e-65    
emb|CDO97465.1|  unnamed protein product                                220   7e-65    
ref|XP_010535470.1|  PREDICTED: uncharacterized protein C24B11.05       219   1e-64    
gb|KCW49593.1|  hypothetical protein EUGRSUZ_K03116                     218   1e-64    
ref|XP_002866332.1|  hypothetical protein ARALYDRAFT_919179             219   2e-64    
ref|XP_010455049.1|  PREDICTED: uncharacterized protein C24B11.05...    218   2e-64    
gb|EMS64060.1|  Uncharacterized protein C24B11.05                       224   2e-64    
ref|XP_006400955.1|  hypothetical protein EUTSA_v10014321mg             218   3e-64    
ref|XP_006280925.1|  hypothetical protein CARUB_v10026922mg             218   3e-64    
ref|XP_006846256.1|  hypothetical protein AMTR_s00012p00242140          218   3e-64    
ref|XP_008356946.1|  PREDICTED: uncharacterized protein C24B11.05...    218   3e-64    
gb|KCW46737.1|  hypothetical protein EUGRSUZ_K00553                     216   4e-64    
ref|XP_004163328.1|  PREDICTED: uncharacterized protein C24B11.05...    218   4e-64    
gb|KHN40293.1|  Hypothetical protein glysoja_000791                     218   8e-64    
ref|XP_010443704.1|  PREDICTED: uncharacterized protein C24B11.05...    217   1e-63    
ref|XP_009131994.1|  PREDICTED: uncharacterized protein C24B11.05...    217   1e-63    
ref|NP_851223.1|  Haloacid dehalogenase-like hydrolase (HAD) supe...    217   1e-63    
ref|XP_010483578.1|  PREDICTED: uncharacterized protein C24B11.05...    216   2e-63    
ref|XP_004145287.1|  PREDICTED: uncharacterized protein C24B11.05...    216   2e-63    
ref|XP_003537986.1|  PREDICTED: uncharacterized protein C24B11.05...    216   2e-63    
ref|XP_004507175.1|  PREDICTED: uncharacterized protein C24B11.05...    216   2e-63    
gb|KHG06579.1|  putative C24B11.05                                      217   3e-63    
gb|KHN33369.1|  Hypothetical protein glysoja_005411                     215   3e-63    
ref|XP_002960329.1|  hypothetical protein SELMODRAFT_73861              214   3e-63    
ref|XP_010937595.1|  PREDICTED: uncharacterized protein C24B11.05...    215   4e-63    
ref|XP_004163334.1|  PREDICTED: uncharacterized protein C24B11.05...    215   5e-63    
ref|XP_006658005.1|  PREDICTED: uncharacterized protein C24B11.05...    214   6e-63    
ref|XP_007132052.1|  hypothetical protein PHAVU_011G062900g             215   6e-63    
ref|XP_008457464.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    221   1e-62    
ref|XP_008457462.1|  PREDICTED: uncharacterized protein C24B11.05...    214   1e-62    
ref|XP_002866331.1|  hypothetical protein ARALYDRAFT_496081             214   1e-62    
gb|ABK22648.1|  unknown                                                 214   1e-62    
ref|XP_002967383.1|  hypothetical protein SELMODRAFT_87325              213   2e-62    
emb|CDX88701.1|  BnaA03g09480D                                          213   2e-62    
emb|CDX71109.1|  BnaC03g11930D                                          213   2e-62    
ref|XP_010321177.1|  PREDICTED: uncharacterized protein C24B11.05...    212   5e-62    
ref|NP_001141173.1|  uncharacterized protein LOC100273259               210   8e-62    
ref|XP_009120459.1|  PREDICTED: uncharacterized protein C24B11.05       212   8e-62    
ref|XP_009387527.1|  PREDICTED: uncharacterized protein C24B11.05...    213   9e-62    
emb|CDY33042.1|  BnaA10g12480D                                          211   1e-61    
ref|XP_008437682.1|  PREDICTED: uncharacterized protein C24B11.05       210   1e-61    
ref|XP_004495841.1|  PREDICTED: uncharacterized protein C24B11.05...    211   1e-61    
ref|NP_200756.2|  Haloacid dehalogenase-like hydrolase (HAD) supe...    211   1e-61    
ref|XP_001773601.1|  predicted protein                                  210   2e-61    
ref|XP_003539664.1|  PREDICTED: uncharacterized protein C24B11.05...    211   2e-61    
gb|AAM67205.1|  putative ripening-related protein-like                  210   3e-61    
ref|XP_009403786.1|  PREDICTED: uncharacterized protein C24B11.05...    208   5e-61    
ref|XP_009387526.1|  PREDICTED: uncharacterized protein C24B11.05...    210   8e-61    
gb|KCW88958.1|  hypothetical protein EUGRSUZ_A01281                     209   8e-61    
ref|XP_006444649.1|  hypothetical protein CICLE_v10021621mg             207   8e-61    
ref|XP_009363054.1|  PREDICTED: uncharacterized protein LOC103953...    208   1e-60    
ref|XP_008448051.1|  PREDICTED: uncharacterized protein C24B11.05...    207   2e-60    
ref|XP_010483584.1|  PREDICTED: suppressor of disruption of TFIIS...    206   2e-60    
ref|XP_006293193.1|  hypothetical protein CARUB_v10019512mg             206   3e-60    
gb|KEH29063.1|  haloacid dehalogenase-like hydrolase                    206   3e-60    
ref|XP_010043515.1|  PREDICTED: suppressor of disruption of TFIIS       208   3e-60    
gb|KEH43162.1|  haloacid dehalogenase-like hydrolase                    205   4e-60    
gb|ACF87920.1|  unknown                                                 206   4e-60    
ref|XP_010443710.1|  PREDICTED: suppressor of disruption of TFIIS...    205   4e-60    
emb|CDX76612.1|  BnaC08g31980D                                          205   6e-60    
gb|ABF95237.1|  haloacid dehalogenase-like hydrolase family prote...    205   1e-59    
gb|KCW85529.1|  hypothetical protein EUGRSUZ_B02326                     208   3e-59    
tpg|DAA50850.1|  TPA: hypothetical protein ZEAMMB73_387391              202   4e-59    
gb|EYU40823.1|  hypothetical protein MIMGU_mgv1a012429mg                201   1e-58    
emb|CDY11396.1|  BnaA09g39620D                                          201   2e-58    
ref|XP_008653917.1|  PREDICTED: uncharacterized protein LOC100193...    201   3e-58    
gb|EMT24021.1|  hypothetical protein F775_31588                         200   8e-58    
gb|AFK49599.1|  unknown                                                 199   9e-58    
ref|XP_006402418.1|  hypothetical protein EUTSA_v10006238mg             198   2e-57    
ref|XP_010685725.1|  PREDICTED: suppressor of disruption of TFIIS...    201   2e-57    
ref|XP_008777174.1|  PREDICTED: uncharacterized protein C24B11.05...    198   3e-57    
ref|XP_006429117.1|  hypothetical protein CICLE_v10012173mg             197   2e-56    
ref|XP_009120461.1|  PREDICTED: suppressor of disruption of TFIIS...    195   5e-56    
tpg|DAA44634.1|  TPA: hypothetical protein ZEAMMB73_440935              193   2e-55    
ref|XP_006588491.1|  PREDICTED: uncharacterized protein LOC100814...    194   3e-55    
gb|AFK46890.1|  unknown                                                 192   4e-55    
ref|XP_008800335.1|  PREDICTED: uncharacterized protein LOC103714736    201   6e-55    
ref|XP_009387524.1|  PREDICTED: uncharacterized protein LOC103974...    196   6e-55    
ref|XP_004153930.1|  PREDICTED: uncharacterized protein C24B11.05...    192   8e-55    
gb|ACR34789.1|  unknown                                                 191   2e-54    
emb|CDX80263.1|  BnaC09g34790D                                          191   3e-54    
gb|KCW49592.1|  hypothetical protein EUGRSUZ_K03116                     191   5e-54    
ref|XP_008777183.1|  PREDICTED: uncharacterized protein C24B11.05...    189   8e-54    
ref|XP_008356953.1|  PREDICTED: uncharacterized protein LOC103420...    189   1e-53    
ref|XP_004145333.1|  PREDICTED: uncharacterized protein C24B11.05...    189   1e-53    
gb|EMT08525.1|  hypothetical protein F775_05020                         189   2e-53    
ref|XP_006410957.1|  hypothetical protein EUTSA_v10017180mg             188   2e-53    
ref|XP_009416227.1|  PREDICTED: uncharacterized protein LOC103996...    191   9e-53    
ref|XP_002530988.1|  catalytic, putative                                186   4e-52    
gb|KEH22904.1|  haloacid dehalogenase-like hydrolase                    184   9e-52    
gb|KHN21937.1|  Suppressor of disruption of TFIIS                       184   1e-51    
gb|KEH29062.1|  haloacid dehalogenase-like hydrolase                    182   2e-51    
tpg|DAA63789.1|  TPA: hypothetical protein ZEAMMB73_634027              180   8e-51    
ref|XP_007140518.1|  hypothetical protein PHAVU_008G119500g             181   2e-50    
ref|XP_004958438.1|  PREDICTED: uncharacterized protein C24B11.05...    182   5e-50    
ref|XP_003592406.1|  Phosphate metabolism protein                       175   1e-49    
gb|ABK26470.1|  unknown                                                 181   2e-49    
ref|XP_008350462.1|  PREDICTED: uncharacterized protein C24B11.05...    176   3e-49    
ref|XP_009363055.1|  PREDICTED: uncharacterized protein C24B11.05...    177   3e-49    
ref|XP_010911370.1|  PREDICTED: uncharacterized protein C24B11.05...    176   4e-49    
gb|KHN31046.1|  Hypothetical protein glysoja_020344                     174   2e-48    
ref|XP_008392633.1|  PREDICTED: uncharacterized protein C24B11.05...    174   2e-48    
ref|XP_008381636.1|  PREDICTED: uncharacterized protein LOC103444...    175   3e-48    
ref|XP_008366329.1|  PREDICTED: uncharacterized protein C24B11.05...    171   6e-47    
ref|XP_006429116.1|  hypothetical protein CICLE_v10012173mg             171   1e-46    
gb|ACU17892.1|  unknown                                                 170   1e-46    
ref|XP_010911386.1|  PREDICTED: uncharacterized protein C24B11.05...    169   3e-46    
ref|XP_006294777.1|  hypothetical protein CARUB_v10023829mg             168   5e-46    
gb|KDO72823.1|  hypothetical protein CISIN_1g0355662mg                  166   1e-45    
gb|ABF95238.1|  haloacid dehalogenase-like hydrolase family prote...    168   1e-45    
ref|XP_010255175.1|  PREDICTED: uncharacterized protein LOC104595912    159   2e-43    
ref|XP_010936175.1|  PREDICTED: uncharacterized protein C24B11.05...    160   8e-43    
dbj|BAJ84885.1|  predicted protein                                      155   9e-41    
gb|KGN49790.1|  hypothetical protein Csa_5G128280                       153   1e-40    
ref|XP_005850177.1|  hypothetical protein CHLNCDRAFT_11898              154   2e-40    
ref|XP_004153929.1|  PREDICTED: uncharacterized protein C24B11.05...    151   7e-40    
ref|XP_006424864.1|  hypothetical protein CICLE_v10029907mg             149   5e-39    
ref|XP_007199450.1|  hypothetical protein PRUPE_ppa026833mg             146   7e-39    
gb|KHG06361.1|  Suppressor of disruption of TFIIS                       147   2e-38    
ref|XP_004173466.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    147   2e-38    
gb|ACR34545.1|  unknown                                                 142   6e-37    
ref|XP_002953393.1|  hypothetical protein VOLCADRAFT_82194              146   7e-37    
ref|XP_010265743.1|  PREDICTED: uncharacterized protein LOC104603420    139   4e-36    
gb|ACR38184.1|  unknown                                                 135   2e-34    
ref|XP_001697012.1|  hypothetical protein CHLREDRAFT_150728             139   3e-34    
ref|XP_010272896.1|  PREDICTED: uncharacterized protein LOC104608558    132   8e-34    
ref|XP_010230037.1|  PREDICTED: uncharacterized protein LOC100841294    132   7e-33    
ref|XP_006400954.1|  hypothetical protein EUTSA_v10015826mg             132   1e-32    
gb|KFM25963.1|  Suppressor of disruption of TFIIS                       133   2e-32    
gb|KCW46736.1|  hypothetical protein EUGRSUZ_K00553                     130   2e-32    
ref|WP_029414942.1|  HAD family hydrolase                               127   9e-31    
gb|AFW80969.1|  hypothetical protein ZEAMMB73_536902                    127   1e-29    
gb|EKD88618.1|  hypothetical protein ACD_34C00433G0002                  124   2e-29    
gb|AFW80970.1|  hypothetical protein ZEAMMB73_536902                    128   2e-29    
gb|ACF83231.1|  unknown                                                 120   5e-29    
dbj|BAL56942.1|  HAD family hydrolase                                   122   7e-29    
ref|XP_008385101.1|  PREDICTED: uncharacterized protein LOC103447693    118   5e-28    
ref|WP_035305834.1|  HAD family hydrolase                               119   1e-27    
ref|WP_013270700.1|  5'-nucleotidase                                    118   2e-27    
ref|WP_035244497.1|  hypothetical protein                               118   2e-27    
ref|WP_008260665.1|  5'-nucleotidase                                    118   2e-27    
ref|WP_013008352.1|  5'-nucleotidase                                    116   7e-27    
ref|WP_039244076.1|  HAD family hydrolase                               116   9e-27    
ref|XP_005702416.1|  putative hydrolase of the HAD superfamily          117   1e-26    
dbj|GAM17718.1|  hypothetical protein SAMD00019534_008930               114   6e-26    
gb|AFK46579.1|  unknown                                                 110   7e-26    
ref|NP_001173701.1|  Os03g0834050                                       109   1e-25    
emb|CDH55010.1|  pyrimidine 5-nucleotidase                              112   2e-25    
ref|WP_038294381.1|  HAD family hydrolase                               112   3e-25    
ref|XP_005978438.1|  PREDICTED: uncharacterized protein C24B11.05...    112   3e-25    
ref|XP_010260880.1|  PREDICTED: uncharacterized protein LOC104599839    108   5e-25    
ref|WP_018280775.1|  hypothetical protein                               110   8e-25    
ref|WP_026370068.1|  hypothetical protein                               111   9e-25    



>ref|XP_004247365.1| PREDICTED: uncharacterized protein LOC101255829 [Solanum lycopersicum]
Length=256

 Score =   421 bits (1081),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 199/256 (78%), Positives = 231/256 (90%), Gaps = 6/256 (2%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            DSSSPFD+IIFD+DDTLYSS  GIGQ+LKKNIDDFLVEKCGFP ++ASALRVELFK YGS
Sbjct  2    DSSSPFDSIIFDLDDTLYSSATGIGQSLKKNIDDFLVEKCGFPVSKASALRVELFKTYGS  61

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            SLAGLRA+GYDVDAD+YHS+VHGRLPY+LIKPDP+LRS+LRSINQRKIIFTNSDR+HAMK
Sbjct  62   SLAGLRAIGYDVDADDYHSYVHGRLPYDLIKPDPQLRSILRSINQRKIIFTNSDRIHAMK  121

Query  460  VLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLF  639
             LDR+GI DCFEQIICFETMN NLS+++RP+E PV+LKP+MEAMNIA++ A VDP RTLF
Sbjct  122  ALDRLGITDCFEQIICFETMNFNLSKATRPEEIPVILKPSMEAMNIAIEAAQVDPYRTLF  181

Query  640  LDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE-----VRC  804
            LDDN +NIAAG AVGL+T LVG +TKTKE+DYA+E VT++VQV+P IWF+EE     V  
Sbjct  182  LDDNVKNIAAGKAVGLQTVLVGRSTKTKEADYALEIVTDLVQVVPAIWFKEEEKDQKVTR  241

Query  805  SRSEMDSYLATTSVGA  852
            +RSEMD +LATTSVGA
Sbjct  242  TRSEMD-FLATTSVGA  256



>ref|XP_009778492.1| PREDICTED: uncharacterized protein LOC104227838 [Nicotiana sylvestris]
Length=264

 Score =   416 bits (1070),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 203/264 (77%), Positives = 236/264 (89%), Gaps = 4/264 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MDS+  S RDSSSPFD+I+FD+DDTLYSSK GIGQALKKNIDDFLVEKCGFPE++ASALR
Sbjct  1    MDSYSNSSRDSSSPFDSIVFDLDDTLYSSKTGIGQALKKNIDDFLVEKCGFPESKASALR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGYD+DAD+YHS+VHGRLPY LIKPD +LRS+LRSINQRKIIFT
Sbjct  61   VELFKTYGSSLAGLRALGYDIDADDYHSYVHGRLPYELIKPDAQLRSILRSINQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR+HA+K LDR+GIKDCFEQIICFETMN NLS+++RP+E PV+LKP+MEAMNIA++ A
Sbjct  121  NSDRIHAIKALDRLGIKDCFEQIICFETMNCNLSKATRPNEIPVILKPSMEAMNIAIEAA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
             V+P RTLFLDDN RNIAAG AVGLRT LVG  TKTKE+DYA+E VT++ QV+P IWF+E
Sbjct  181  QVEPCRTLFLDDNVRNIAAGKAVGLRTVLVGRTTKTKEADYALETVTDLFQVVPAIWFKE  240

Query  793  E----VRCSRSEMDSYLATTSVGA  852
            E    +R + SE+DS LATT+VGA
Sbjct  241  EEDQKMRRTGSELDSLLATTAVGA  264



>ref|XP_006359923.1| PREDICTED: uncharacterized protein C24B11.05-like [Solanum tuberosum]
Length=256

 Score =   416 bits (1069),  Expect = 7e-142, Method: Compositional matrix adjust.
 Identities = 195/256 (76%), Positives = 230/256 (90%), Gaps = 6/256 (2%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            DSSSPFD+IIFD+DDTLYSSK GIGQ+LKKNIDDFLVEKCGFP ++ASALRVELFK YGS
Sbjct  2    DSSSPFDSIIFDLDDTLYSSKTGIGQSLKKNIDDFLVEKCGFPVSKASALRVELFKTYGS  61

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            SLAGLRA+GYDVDAD+YHS+VHGRLPY+LIKPDP+LRS+LR INQRKIIFTNSDR+HAMK
Sbjct  62   SLAGLRAIGYDVDADDYHSYVHGRLPYDLIKPDPQLRSILRRINQRKIIFTNSDRIHAMK  121

Query  460  VLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLF  639
             LDR+GI DCFEQIICFETMN NLS+++RP+E PV+LKP+MEAMNIA++ A VDP RTLF
Sbjct  122  ALDRLGITDCFEQIICFETMNFNLSKATRPEEIPVILKPSMEAMNIAIEAAQVDPYRTLF  181

Query  640  LDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE-----VRC  804
            LDDN +NIAAG AVGL+T LVG +TKTKE+DYA+E VT++VQV+P IWF+EE     +  
Sbjct  182  LDDNVKNIAAGKAVGLQTVLVGRSTKTKEADYALEIVTDLVQVVPAIWFKEEEKDQKITR  241

Query  805  SRSEMDSYLATTSVGA  852
            +RSEMD ++ TT+VGA
Sbjct  242  TRSEMD-FVTTTAVGA  256



>ref|XP_009591867.1| PREDICTED: uncharacterized protein LOC104088829 [Nicotiana tomentosiformis]
Length=264

 Score =   413 bits (1061),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 201/264 (76%), Positives = 235/264 (89%), Gaps = 4/264 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MDS+  S RDSSSPFD+I+FD+DDTLYSSK GIGQALKKNIDDFLVEKCGFPE++AS LR
Sbjct  1    MDSYSNSSRDSSSPFDSIVFDLDDTLYSSKTGIGQALKKNIDDFLVEKCGFPESKASVLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGYD+DAD+YHS+VHGRLPY LIKPD +LRS+LRSINQRKIIFT
Sbjct  61   VELFKTYGSSLAGLRALGYDIDADDYHSYVHGRLPYELIKPDAQLRSILRSINQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR+HA+K LDR+GIKDCFEQIICFETMN NLSR++RP+E PV+LKP+MEAMNIA++ A
Sbjct  121  NSDRIHAIKALDRLGIKDCFEQIICFETMNCNLSRATRPNEIPVILKPSMEAMNIAIEAA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
             VDP RTLFLDDN RNIAAG AVGLRT LVG A+KTKE+DYA+E VT++ Q +P IWF++
Sbjct  181  QVDPCRTLFLDDNVRNIAAGKAVGLRTVLVGRASKTKEADYALEMVTDLFQGVPAIWFKQ  240

Query  793  E----VRCSRSEMDSYLATTSVGA  852
            E    +R + SE+DS +ATT+VGA
Sbjct  241  EEDQKIRRTGSELDSLVATTAVGA  264



>ref|XP_011090711.1| PREDICTED: uncharacterized protein LOC105171337 [Sesamum indicum]
Length=263

 Score =   394 bits (1013),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 191/267 (72%), Positives = 227/267 (85%), Gaps = 11/267 (4%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MDS C +V   SSPFD ++FD+DDTLYSSK GIG+ALK+N+ DFLVEKCGF E+EA  + 
Sbjct  1    MDS-CSTV---SSPFDCLMFDLDDTLYSSKTGIGKALKQNVQDFLVEKCGFSESEAPDVN  56

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
             ELF+ YGSSLAGLRALGYD++ D+YH FVHGRLPY+LIKPD  LR++L+SI QRKIIFT
Sbjct  57   RELFRTYGSSLAGLRALGYDINPDDYHGFVHGRLPYDLIKPDSRLRNILQSIKQRKIIFT  116

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR+HAMK LDR+GI+DCFE+IICFETMNPNLS+S+RPDEFPVVLKP+MEAM IA+D A
Sbjct  117  NSDRIHAMKALDRLGIRDCFEKIICFETMNPNLSKSTRPDEFPVVLKPSMEAMRIAIDVA  176

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW-FE  789
            ++DPRRTLFLDDN +N+AAG AVGLRT LVG+A K+KE+DYAME VT MVQ IPEIW F 
Sbjct  177  EIDPRRTLFLDDNVKNVAAGKAVGLRTVLVGSAIKSKEADYAMETVTNMVQAIPEIWVFS  236

Query  790  EEV---RCSRS---EMDSYLATTSVGA  852
            EE    R S++   +MDS LATT+VGA
Sbjct  237  EEKGDERISQNRADQMDSALATTTVGA  263



>emb|CDO99041.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   391 bits (1005),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 189/247 (77%), Positives = 215/247 (87%), Gaps = 5/247 (2%)
 Frame = +1

Query  73   MDSFCK-SVRDSSS----PFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETE  237
            MDS  K S RDSS+    PFD IIFD+DDTLYSS+ GIG+ALK+NIDDFLVEKCGF E++
Sbjct  1    MDSCSKLSARDSSTSSSSPFDCIIFDLDDTLYSSETGIGEALKRNIDDFLVEKCGFHESK  60

Query  238  ASALRVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQR  417
            AS+LRVELF+ YGSSLAGLRALGYDVDAD+YHS VHGRLPY+LIKPDP+LR LL +I QR
Sbjct  61   ASSLRVELFQAYGSSLAGLRALGYDVDADDYHSVVHGRLPYDLIKPDPQLRKLLLTIKQR  120

Query  418  KIIFTNSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNI  597
            KIIFTNSDRVHAM  LDR+GI+DCFEQIICFETMNPNLS+S+RPDEFPVVLKP++EAMNI
Sbjct  121  KIIFTNSDRVHAMNALDRLGIRDCFEQIICFETMNPNLSKSTRPDEFPVVLKPSLEAMNI  180

Query  598  AVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPE  777
            A+D A VDPRRTLFLDD+ RN+AAG AVGLRT LVG ATK   +DYA+E VT +VQVIPE
Sbjct  181  AIDVAKVDPRRTLFLDDSVRNVAAGKAVGLRTVLVGKATKIGGADYALETVTNLVQVIPE  240

Query  778  IWFEEEV  798
            IWF   +
Sbjct  241  IWFNNNI  247



>gb|KDP40159.1| hypothetical protein JCGZ_02157 [Jatropha curcas]
Length=262

 Score =   390 bits (1002),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 185/266 (70%), Positives = 223/266 (84%), Gaps = 10/266 (4%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD + K+    SSP D +IFD+DDTLYSSK+GI +AL+KNIDDFLVEKCGFPE +AS LR
Sbjct  1    MDCYGKT----SSPIDCLIFDLDDTLYSSKLGIAEALRKNIDDFLVEKCGFPENKASTLR  56

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGYD+DAD+YHS VHGRLPY+LIKP+ +LR++LRSI QRKIIFT
Sbjct  57   VELFKTYGSSLAGLRALGYDIDADDYHSVVHGRLPYDLIKPNGQLRNILRSITQRKIIFT  116

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDRVHA+KVL R+G++DCF+QIICFETMNPNLS+S+RPDEFPV+LKP+M+AM IA+  A
Sbjct  117  NSDRVHAIKVLKRLGLEDCFDQIICFETMNPNLSKSTRPDEFPVLLKPSMDAMKIALQVA  176

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW---  783
            +VDPRRTLFLDDN RN+AAG A+GLRT LVG   K+KE+DY +E V ++ QVIPEI    
Sbjct  177  NVDPRRTLFLDDNARNVAAGKAMGLRTVLVGKTVKSKEADYVLENVNKLAQVIPEILGSG  236

Query  784  ---FEEEVRCSRSEMDSYLATTSVGA  852
                E+ +  +RSE+DS LAT  VGA
Sbjct  237  KDSGEQRISRTRSEIDSMLATAPVGA  262



>ref|XP_010256007.1| PREDICTED: uncharacterized protein LOC104596512 [Nelumbo nucifera]
Length=266

 Score =   389 bits (1000),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 218/258 (84%), Gaps = 6/258 (2%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R+S+SPFD ++FD+DDTLYSSKVGIG+A K+NI++FLV+KCGFPE +AS+LRVELFK YG
Sbjct  9    RESTSPFDCLLFDLDDTLYSSKVGIGEACKRNIEEFLVKKCGFPEDKASSLRVELFKTYG  68

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            SSLAGLRALGYD+D D+YH FVHGRLPY  IKP+P+LR+LLR+INQRKIIFTNSDR HA+
Sbjct  69   SSLAGLRALGYDIDTDDYHGFVHGRLPYETIKPNPQLRNLLRTINQRKIIFTNSDRNHAI  128

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            KVLDR+G++DCF+QIICFET+NPNLS+SSRPDEFPVVLKP++ AM IA+D A VDP RTL
Sbjct  129  KVLDRLGLQDCFDQIICFETLNPNLSKSSRPDEFPVVLKPSINAMKIAIDVAQVDPCRTL  188

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEV  798
            FLDDN RNIAAG  VGLRT L+G   K+KE+ Y  E V  + QV+PEIWF      ++++
Sbjct  189  FLDDNERNIAAGKVVGLRTVLIGKQVKSKEAGYVAESVVHLPQVVPEIWFSRTDGKDQKI  248

Query  799  RCSRSEMDSYLATTSVGA  852
              S SEMDS L  T+VGA
Sbjct  249  SSSGSEMDSVLKATTVGA  266



>ref|XP_010277510.1| PREDICTED: uncharacterized protein LOC104611920 [Nelumbo nucifera]
Length=266

 Score =   384 bits (986),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 220/266 (83%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            M+   K +++ +SPFD ++FD+DDTLYSSKVGIG+A K+NI++FLV+KCGF E +AS LR
Sbjct  1    MEPCSKPIQEFTSPFDCLLFDLDDTLYSSKVGIGEACKRNIEEFLVKKCGFAEVKASGLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLR LGYD+DAD+YH FVHGRLPY  IKPDP+LR+LLRSINQRKIIFT
Sbjct  61   VELFKTYGSSLAGLRFLGYDIDADDYHGFVHGRLPYEAIKPDPQLRALLRSINQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+KVL+RIG++DCF++IICFET+NPN+S+SSRP+EFPVVLKP+++AM IA+D A
Sbjct  121  NSDRKHAIKVLERIGLQDCFDEIICFETLNPNISKSSRPNEFPVVLKPSIDAMKIAIDAA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
             VDPRRTLFLDDN RNIAAG +VGLRT LVG   K KE DY +E V  + QV+PEIW   
Sbjct  181  QVDPRRTLFLDDNERNIAAGKSVGLRTVLVGKQVKRKEGDYVVESVVHLPQVVPEIWVSP  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                ++ +   RSEMD  L +T+VGA
Sbjct  241  TDSKDQRMSRGRSEMDPVLKSTTVGA  266



>ref|XP_004296895.1| PREDICTED: suppressor of disruption of TFIIS-like [Fragaria vesca 
subsp. vesca]
Length=268

 Score =   384 bits (986),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 185/268 (69%), Positives = 219/268 (82%), Gaps = 8/268 (3%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MDS    +R SSSPFD +IFD+DDTLYSS +G+G+ALKKNIDDFLVEKCGFPE++AS+LR
Sbjct  1    MDSCNSFLRASSSPFDCLIFDLDDTLYSSSIGLGEALKKNIDDFLVEKCGFPESKASSLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFKKYGSSLAGLRALGYD+DAD+YHSFVHGRLPY+ IKPD +LR+L+RSI QRKIIFT
Sbjct  61   VELFKKYGSSLAGLRALGYDIDADDYHSFVHGRLPYDRIKPDHQLRNLIRSIPQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  LDR+G+  CFEQIICFETMNP L+ S+RPDEFPVVLKP+MEAM IA++ A
Sbjct  121  NSDRNHALTCLDRLGLNGCFEQIICFETMNPKLAESTRPDEFPVVLKPSMEAMRIAIEAA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            +VDPRRTLFLDDN RNI AG AVGLRT LVG   K+KE+DY +E V  + Q I E+W   
Sbjct  181  EVDPRRTLFLDDNVRNITAGRAVGLRTVLVGKTVKSKEADYVLENVKNLAQSISEVWVGG  240

Query  787  ----EEEVRCSRS--EMDSYLATTSVGA  852
                 ++V  +RS  E+DS   TT+V A
Sbjct  241  SEGSNQQVNGTRSDIEVDSIRTTTAVVA  268



>ref|XP_010024347.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein C24B11.05 
[Eucalyptus grandis]
Length=267

 Score =   382 bits (982),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 222/269 (83%), Gaps = 11/269 (4%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            M+S  KS R+SSSPFD+++FD+DDTLYSSK GIG++LKKNIDDFLVE+CGF   +AS+LR
Sbjct  1    MESCSKSARESSSPFDSLLFDLDDTLYSSKTGIGESLKKNIDDFLVERCGFALDKASSLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFKKYGSSLAGLRALGYDVDAD+YHS VHGRLPY+LIKPDP+LR+LLRS  QRKIIFT
Sbjct  61   VELFKKYGSSLAGLRALGYDVDADDYHSVVHGRLPYHLIKPDPQLRNLLRSTAQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HAMK L R+G++DCF+QI+CFETMNPNLS ++RPDEFPVVLKP+ EAM IA+   
Sbjct  121  NSDRTHAMKALKRLGVEDCFDQIVCFETMNPNLSEAARPDEFPVVLKPSPEAMQIALRET  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
             VDPRRTLFLDD  RNIAAG AVGLRTALVG   KTKE+DYAM+ V  + +V+PE+W   
Sbjct  181  RVDPRRTLFLDDXVRNIAAGKAVGLRTALVGKTVKTKEADYAMDTVNNLPKVVPEVWVNP  240

Query  787  ------EEEVRCSR-SEMDSYLATTSVGA  852
                  ++ +  +R +E+DS L  T VGA
Sbjct  241  ADGAGGDQIINAARNNEIDSIL--TPVGA  267



>ref|XP_002312525.1| putative phosphatase family protein [Populus trichocarpa]
 gb|EEE89892.1| putative phosphatase family protein [Populus trichocarpa]
Length=266

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 219/266 (82%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   K+  +SSSPFD ++FD+DDTLYSSK+GI +AL+KNIDDFLVE+CGF E +A ++R
Sbjct  1    MDHCSKTSCNSSSPFDCLLFDLDDTLYSSKLGIAEALRKNIDDFLVERCGFSEEKAPSIR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGY +DAD+YHSFVHGRLPY+LIKPD +L +LLRSI QRKIIFT
Sbjct  61   VELFKTYGSSLAGLRALGYGIDADDYHSFVHGRLPYDLIKPDSQLLNLLRSITQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  L R+GI+DCF+QIICFETMNPNLS+SS PDEFPV+LKP+M+AM IA+  A
Sbjct  121  NSDRNHAIMALKRLGIEDCFDQIICFETMNPNLSKSSSPDEFPVLLKPSMDAMKIALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            DVD RRTLFLDDN RN+AAG A+GLRTALVG   K+KE+DY +E +  + QVIPEIW   
Sbjct  181  DVDLRRTLFLDDNVRNVAAGKALGLRTALVGKTVKSKEADYVLEHIHNLAQVIPEIWARG  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                ++ +  +RSEMD+ L  T+VGA
Sbjct  241  TDSGDQRISRTRSEMDAVLTATTVGA  266



>gb|ABK94360.1| unknown [Populus trichocarpa]
Length=266

 Score =   382 bits (980),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 180/266 (68%), Positives = 219/266 (82%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   K+  +SSSPFD ++FD+DDTLYSSK+GI +AL+KNIDDFLVE+CGF E +A ++R
Sbjct  1    MDHCSKTSCNSSSPFDCLLFDLDDTLYSSKLGIAEALRKNIDDFLVERCGFSEDKAPSIR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGY +DAD+YHSFVHGRLPY+LIKPD +L +LLRSI QRKIIFT
Sbjct  61   VELFKTYGSSLAGLRALGYGIDADDYHSFVHGRLPYDLIKPDSQLLNLLRSITQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  L R+GI+DCF+QIICFETMNPNLS+SS PDEFPV+LKP+M+AM IA+  A
Sbjct  121  NSDRNHAIMALKRLGIEDCFDQIICFETMNPNLSKSSSPDEFPVLLKPSMDAMKIALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            DVD RRTLFLDDN RN+AAG A+GLRTALVG   K+KE+DY +E +  + QVIPEIW   
Sbjct  181  DVDLRRTLFLDDNVRNVAAGKALGLRTALVGKTVKSKEADYVLEHIHNLAQVIPEIWARG  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                ++ +  +RSEMD+ L  T+VGA
Sbjct  241  TDSGDQRISRTRSEMDAVLTATTVGA  266



>ref|XP_011021545.1| PREDICTED: uncharacterized protein C24B11.05-like [Populus euphratica]
 ref|XP_011021546.1| PREDICTED: uncharacterized protein C24B11.05-like [Populus euphratica]
Length=266

 Score =   381 bits (978),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 183/266 (69%), Positives = 219/266 (82%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   KS    SSPFD ++FD+DDTLYSSK+GI +AL+KNID+FLVEKCGFPE +A + R
Sbjct  1    MDYCSKSSCTPSSPFDCLLFDLDDTLYSSKLGIAEALRKNIDEFLVEKCGFPENKAPSHR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGYD+DAD+YHSFVHGRLPY+LIKPD +LR+LLRSI QRKIIFT
Sbjct  61   VELFKSYGSSLAGLRALGYDIDADDYHSFVHGRLPYDLIKPDSQLRNLLRSITQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  L R+GI+DCF+QIICFETMNPNLS+S+ PDEFPV+LKP+++AM +A+  A
Sbjct  121  NSDRNHAIMALKRLGIEDCFDQIICFETMNPNLSKSTSPDEFPVLLKPSVDAMKVALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            DVDPRRTLFLDDN RN+AAG A+GL TALVG   K+KE+DY +E +  + QVIPEIW   
Sbjct  181  DVDPRRTLFLDDNVRNVAAGKALGLCTALVGKTVKSKEADYVLEHIHNLAQVIPEIWVGG  240

Query  787  --EEEVRCSR--SEMDSYLATTSVGA  852
                + R SR  SEMD+ LA T+VGA
Sbjct  241  TKSGDQRISRPGSEMDAILAATTVGA  266



>ref|XP_002281854.1| PREDICTED: uncharacterized protein LOC100263185 [Vitis vinifera]
 emb|CBI26231.3| unnamed protein product [Vitis vinifera]
Length=266

 Score =   380 bits (977),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 221/266 (83%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   KS+RDS+SPFD ++FD+DDTLY SK GI +A K+NI++FLV+KCGF ET+AS+LR
Sbjct  1    MDFCGKSLRDSTSPFDCLVFDLDDTLYHSKTGISEACKRNIEEFLVQKCGFGETKASSLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGS+LAGLRALGY++DAD+YHSFVHGRLPY LIKPD +LRSLLRSI  RKII T
Sbjct  61   VELFKNYGSTLAGLRALGYNIDADDYHSFVHGRLPYELIKPDSQLRSLLRSIALRKIILT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+KVLDR+G++DCF+QIICFETMNPNL +S+R DEFPV+LKP+++AM IA+D A
Sbjct  121  NSDRNHAIKVLDRLGLQDCFDQIICFETMNPNLPKSTRLDEFPVILKPSLDAMKIALDAA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            +V+P RTLFLDDN RNIAAG A+GLRT LVG   KTKE+DY +E V  + QVIPEIW   
Sbjct  181  NVNPPRTLFLDDNVRNIAAGKALGLRTVLVGKTMKTKEADYVLETVHNLAQVIPEIWLGG  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                ++ ++ + SE+D+ L TT VGA
Sbjct  241  KDGEDQRIKRTGSELDATLPTTPVGA  266



>ref|XP_002314706.1| putative phosphatase family protein [Populus trichocarpa]
 gb|EEF00877.1| putative phosphatase family protein [Populus trichocarpa]
Length=266

 Score =   380 bits (977),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 179/266 (67%), Positives = 219/266 (82%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   KS  + SSPFD ++FD+DDTLYSSK+GI +AL+KNID+FLVEKCGFPE +A + R
Sbjct  1    MDYCSKSSCNPSSPFDCLLFDLDDTLYSSKLGIAEALRKNIDEFLVEKCGFPENKAPSHR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGSSLAGLRALGYD+DAD+YHSFVHGRLPY+LIKPD +LR+LLRSI QRKIIFT
Sbjct  61   VELFKSYGSSLAGLRALGYDIDADDYHSFVHGRLPYDLIKPDSQLRNLLRSITQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  L R+GI+DCF+QIICFETMNPNLS+S+ PDEFPV+LKP+++AM +A+  A
Sbjct  121  NSDRNHAIMALKRLGIEDCFDQIICFETMNPNLSKSTSPDEFPVLLKPSVDAMKVALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            DVDPRRTLFLDDN RN+AAG A+GLRTALVG    +KE+DY +E +  + +VIPEIW   
Sbjct  181  DVDPRRTLFLDDNVRNVAAGKALGLRTALVGKTVTSKEADYVLEHIHNLAEVIPEIWVGG  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                +  +   RSEMD+ L+ T+VGA
Sbjct  241  TESGDRRISRPRSEMDAILSPTTVGA  266



>gb|EYU41498.1| hypothetical protein MIMGU_mgv1a011931mg [Erythranthe guttata]
Length=266

 Score =   379 bits (973),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 179/260 (69%), Positives = 215/260 (83%), Gaps = 11/260 (4%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            SSPFD++IFD+DDTLYSSK GIGQALK+N+ DFLVEKCGF E+EA  +  ELF+ YGSSL
Sbjct  7    SSPFDSLIFDLDDTLYSSKSGIGQALKQNVQDFLVEKCGFAESEAPNVNRELFRTYGSSL  66

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGLRALGY+++ D+YHSFVHGRLPY+LI+PDP LR LL+SINQRKIIFTNSDR+HA K L
Sbjct  67   AGLRALGYNINPDDYHSFVHGRLPYDLIRPDPRLRRLLQSINQRKIIFTNSDRIHADKAL  126

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
            DR+GI+DCFE+IICFETMNPNL +S+RPDEFPVVLKP++EAM I VD A+VDPRRTLF D
Sbjct  127  DRLGIRDCFEKIICFETMNPNLWKSNRPDEFPVVLKPSIEAMKIGVDVAEVDPRRTLFFD  186

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW-FEEEVRCSRS---  813
            DN +N+AAG   GLRT LVG+A K+KE+DYA+E +T M QVIPEIW   EE+  + S   
Sbjct  187  DNVKNVAAGKIFGLRTVLVGSAIKSKEADYALEILTNMAQVIPEIWVINEEINANDSDKK  246

Query  814  -------EMDSYLATTSVGA  852
                   E+DS ++ TSVGA
Sbjct  247  RISHALTEIDSLISATSVGA  266



>ref|XP_002516773.1| Protein SSM1, putative [Ricinus communis]
 gb|EEF45387.1| Protein SSM1, putative [Ricinus communis]
Length=264

 Score =   378 bits (970),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 216/258 (84%), Gaps = 8/258 (3%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + SPFD +IFD+DDTLYSSK+GI +AL+KNIDDFLVEKCGF + +AS+LRVELFK YGSS
Sbjct  7    TKSPFDCLIFDLDDTLYSSKLGIAEALRKNIDDFLVEKCGFAQDKASSLRVELFKTYGSS  66

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            LAGLRALGYD+DAD+YHSFVHGRLPY+LIKPD +LR++L SI QRK+IFTNSDR HAMK 
Sbjct  67   LAGLRALGYDIDADDYHSFVHGRLPYDLIKPDGQLRNILLSIPQRKLIFTNSDRNHAMKS  126

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFL  642
            L+R+GI+DCF+QIICFETMNPNLSRS+RPDEFPV+LKP+++AM IA+  AD++P RTLFL
Sbjct  127  LERLGIEDCFDQIICFETMNPNLSRSTRPDEFPVLLKPSIDAMKIALHVADINPSRTLFL  186

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE--------V  798
            DDN RN+AAG A+GL T LVG   K+KE+DY +E V ++ QVIPEIW   E        +
Sbjct  187  DDNVRNVAAGKAMGLSTVLVGKTVKSKEADYLLEYVIKLPQVIPEIWMSGEDSGGDGRRI  246

Query  799  RCSRSEMDSYLATTSVGA  852
              +RSEMDS LA T VGA
Sbjct  247  SRTRSEMDSILAPTPVGA  264



>ref|XP_011015858.1| PREDICTED: uncharacterized protein C24B11.05-like [Populus euphratica]
Length=266

 Score =   377 bits (967),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/266 (67%), Positives = 217/266 (82%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   K+  +SSSPFD I+FD+DDTLYSSK+GI +AL+KNIDDFLVE+CGF E +A ++R
Sbjct  1    MDHCSKTSCNSSSPFDCILFDLDDTLYSSKLGIAEALRKNIDDFLVERCGFSEDKAPSIR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            V+LFK +GSSLAGLRALGY +DAD+YHSFVHGRLPY+LIKPD  L +LLRSI QRKIIFT
Sbjct  61   VKLFKTHGSSLAGLRALGYGIDADDYHSFVHGRLPYDLIKPDSHLLNLLRSITQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  L R+GI+DCF+QIICFETMNPNLS+S+ PDE PV+LKP+M+AM IA+  A
Sbjct  121  NSDRNHAITALKRLGIEDCFDQIICFETMNPNLSKSTSPDEIPVLLKPSMDAMKIALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            DVD RRTLFLDDN RN+AAG A+GLRTALVG   K+KE+DYA+E +  + Q+IPEIW   
Sbjct  181  DVDIRRTLFLDDNVRNVAAGKALGLRTALVGKTVKSKEADYALEHIHNLAQIIPEIWARG  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                 + +  +RSEMD+ L  T+VGA
Sbjct  241  TDSGNQRISRTRSEMDAVLTATTVGA  266



>ref|XP_010108012.1| hypothetical protein L484_012369 [Morus notabilis]
 gb|EXC17577.1| hypothetical protein L484_012369 [Morus notabilis]
Length=262

 Score =   376 bits (966),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 178/257 (69%), Positives = 214/257 (83%), Gaps = 7/257 (3%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            SSS FD+I+FD+DDTLY +  GI  A KKNI+DFLVEKCGFPE++AS LRVELFK YGS+
Sbjct  6    SSSSFDSILFDLDDTLYPANTGIASACKKNIEDFLVEKCGFPESQASTLRVELFKTYGST  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            LAGLR LGYD+DAD+YHSFVHGRLPY LIKPDP+LR+LLRSI+QRKIIFTNSDR HA+K 
Sbjct  66   LAGLRILGYDIDADDYHSFVHGRLPYELIKPDPQLRALLRSISQRKIIFTNSDRNHAIKA  125

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFL  642
            L+R+G+ +CF+QIICFETMNPNL+++S+PDE PVVLKP+M+A  IA+  A VDPRRTLFL
Sbjct  126  LERLGLSECFDQIICFETMNPNLAKASKPDEIPVVLKPSMDAFKIALAVARVDPRRTLFL  185

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEVRC  804
            DDN +NIAAG AVGL TALVG   KTKE+DY +E V  + QVIPEIW       ++ +  
Sbjct  186  DDNVKNIAAGKAVGLWTALVGKTVKTKEADYVLETVNNLEQVIPEIWISKADGGDQRISR  245

Query  805  SRSEM-DSYLATTSVGA  852
            S+SE+ DS LATT+VGA
Sbjct  246  SKSEINDSILATTAVGA  262



>ref|XP_008363460.1| PREDICTED: uncharacterized protein C24B11.05-like [Malus domestica]
Length=266

 Score =   376 bits (965),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 178/258 (69%), Positives = 212/258 (82%), Gaps = 11/258 (4%)
 Frame = +1

Query  112  PFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAG  291
            PFD+IIFD+DDTLYSS +G+G+A KKNIDDFLVEKCGFPE++AS+LRVELFKKYGSSLAG
Sbjct  9    PFDSIIFDLDDTLYSSNLGLGEACKKNIDDFLVEKCGFPESKASSLRVELFKKYGSSLAG  68

Query  292  LRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDR  471
            LRALGYD+DA++YH  VHGRLPY+ IKPDP+LR LLRSI QRKIIFTNSDR HAMKVL+R
Sbjct  69   LRALGYDIDAEDYHDVVHGRLPYDRIKPDPQLRDLLRSIAQRKIIFTNSDRKHAMKVLER  128

Query  472  IGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDN  651
            +G+++CF++IICFETMNPNL  S++PDEFPVVLKP++EAM IA+  A+VDPRRTLFLDDN
Sbjct  129  LGVEECFDRIICFETMNPNLXSSTQPDEFPVVLKPSIEAMEIALRAAEVDPRRTLFLDDN  188

Query  652  TRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF-------EEEVRCSR  810
             RN+AAG AVGLRT LVG   K+KE+DY +E V  M Q I E+W            R SR
Sbjct  189  VRNVAAGKAVGLRTVLVGKTVKSKEADYVLENVNNMAQAISEVWVGGSGAKDGSNQRISR  248

Query  811  S----EMDSYLATTSVGA  852
            +    E+DS L  T+VGA
Sbjct  249  TRSDXELDSVLTATAVGA  266



>ref|XP_011026318.1| PREDICTED: uncharacterized protein C24B11.05-like [Populus euphratica]
Length=266

 Score =   375 bits (963),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 177/266 (67%), Positives = 216/266 (81%), Gaps = 6/266 (2%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   K+  +SSSPFD I+FD+DDTLYSSK+GI +AL+KNIDDFLVE+CGF E +A ++R
Sbjct  1    MDHCSKTSCNSSSPFDCILFDLDDTLYSSKLGIAEALRKNIDDFLVERCGFSEDKAPSIR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            V+LFK +GSSLAGLRALGY +DAD+YHSFVHGRLPY+LIKPD  L +LLRSI QRKIIFT
Sbjct  61   VKLFKTHGSSLAGLRALGYGIDADDYHSFVHGRLPYDLIKPDSHLLNLLRSITQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+  L R+GI+DCF+QIICFETMNPNLS+S+ PDE PV+LKP+M+AM IA+  A
Sbjct  121  NSDRNHAITALKRLGIEDCFDQIICFETMNPNLSKSTSPDEIPVLLKPSMDAMKIALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            DVD RRTLFLDDN RN+AAG A+GLRTALVG   K+K +DYA+E +  + QVIPEIW   
Sbjct  181  DVDIRRTLFLDDNVRNVAAGKALGLRTALVGKTVKSKAADYALEHIHNLAQVIPEIWARG  240

Query  787  ----EEEVRCSRSEMDSYLATTSVGA  852
                 + +  +RSEMD+ L  T+VGA
Sbjct  241  TDSGNQRISRTRSEMDAVLTATTVGA  266



>ref|XP_009344085.1| PREDICTED: uncharacterized protein LOC103935975 [Pyrus x bretschneideri]
Length=266

 Score =   374 bits (959),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 180/258 (70%), Positives = 210/258 (81%), Gaps = 11/258 (4%)
 Frame = +1

Query  112  PFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAG  291
            PFD+IIFD+DDTLYSS +G+G+A KKNIDDFLVEKCGFP T+AS+LRVELFKKYGSSLAG
Sbjct  9    PFDSIIFDLDDTLYSSNLGLGEACKKNIDDFLVEKCGFPVTKASSLRVELFKKYGSSLAG  68

Query  292  LRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDR  471
            LRALGYD+DAD+YH  VHGRLPY+ IKPDP+LR+LLRSI QRKIIFTNSDR HA+KVL+R
Sbjct  69   LRALGYDIDADDYHGVVHGRLPYDRIKPDPQLRNLLRSIAQRKIIFTNSDRKHAVKVLER  128

Query  472  IGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDN  651
            +G+ +CF+QIICFETMNPN   S+RPDEFPVVLKP++EAM IA+  ADVDPRRTLFLDDN
Sbjct  129  LGVVECFDQIICFETMNPNPPSSTRPDEFPVVLKPSIEAMEIALRAADVDPRRTLFLDDN  188

Query  652  TRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE-------EVRCSR  810
             RN+AAG  VGLRT LVG   K+KE+DY +E V  M QVI E+W  E         R SR
Sbjct  189  VRNVAAGKTVGLRTVLVGKTVKSKEADYLLENVNNMAQVITEVWVGEGGGKDGSNQRISR  248

Query  811  S----EMDSYLATTSVGA  852
            +    + DS L  T+VGA
Sbjct  249  TRSDIDRDSVLTATAVGA  266



>ref|XP_008224536.1| PREDICTED: uncharacterized protein C24B11.05 [Prunus mume]
Length=269

 Score =   374 bits (959),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 217/269 (81%), Gaps = 9/269 (3%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MDS   SVRDSSSPFD +IFD+DDTLY S  G+G+A K NIDDFLVEKCGFPE++AS+LR
Sbjct  1    MDSCSSSVRDSSSPFDCLIFDLDDTLYPSNTGLGEACKTNIDDFLVEKCGFPESKASSLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGS+LAGLRALGYD+DAD+YHS VHGRLPY+ IKPDP+LR+LLRSI QRKIIFT
Sbjct  61   VELFKSYGSTLAGLRALGYDIDADDYHSVVHGRLPYDRIKPDPQLRNLLRSIAQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+K LDR+G++DCFEQIICFETMNPNL  S+RPDEFPVVLKP+MEAM IA+  A
Sbjct  121  NSDRKHAVKALDRLGVRDCFEQIICFETMNPNLQSSTRPDEFPVVLKPSMEAMEIALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            +VDP RTLFLDDN RN+AAG AVGL T LVG   K+KE+DY +E V  + Q + E+W   
Sbjct  181  EVDPSRTLFLDDNVRNVAAGKAVGLHTVLVGKTVKSKEADYVLENVNNLAQAVSEVWVGG  240

Query  787  ---EEEVRCSRS----EMDSYLATTSVGA  852
                   R SR+    E+DS L TT+VGA
Sbjct  241  KDGGSNKRISRTRSDIEVDSILTTTAVGA  269



>ref|XP_007227483.1| hypothetical protein PRUPE_ppa009986mg [Prunus persica]
 gb|EMJ28682.1| hypothetical protein PRUPE_ppa009986mg [Prunus persica]
Length=269

 Score =   374 bits (959),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 186/269 (69%), Positives = 218/269 (81%), Gaps = 9/269 (3%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MDS   SVRDSSSPFD +IFD+DDTLY S  G+G+A K NIDDFLVEKCGFPE++AS+LR
Sbjct  1    MDSCSSSVRDSSSPFDCLIFDLDDTLYPSNTGLGEACKTNIDDFLVEKCGFPESKASSLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFK YGS+LAGLRALGYD+DAD+YHS VHGRLPY+ IKPDP+LR+LLRSI QRKIIFT
Sbjct  61   VELFKSYGSTLAGLRALGYDIDADDYHSVVHGRLPYDRIKPDPQLRNLLRSIAQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HA+K LDR+G++DCFEQIICFETMNPNL  S+RP+EFPVVLKP+MEAM IA+  A
Sbjct  121  NSDRKHAVKALDRLGVRDCFEQIICFETMNPNLPSSTRPNEFPVVLKPSMEAMEIALRVA  180

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--  786
            +VDPRRTLFLDDN RN+AAG AVGLRT LVG   K+ E+DY +E V  + Q + E+W   
Sbjct  181  EVDPRRTLFLDDNIRNVAAGKAVGLRTVLVGKTVKSNEADYVLENVNNLAQAVSEVWVGG  240

Query  787  ---EEEVRCSRS----EMDSYLATTSVGA  852
                   R SR+    E+DS L TT+VGA
Sbjct  241  KDGGSNKRISRTRSDIEVDSILTTTAVGA  269



>ref|XP_007034726.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Theobroma cacao]
 gb|EOY05652.1| Haloacid dehalogenase-like hydrolase (HAD) superfamily protein 
[Theobroma cacao]
Length=257

 Score =   371 bits (953),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 178/256 (70%), Positives = 212/256 (83%), Gaps = 7/256 (3%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            +SPFD ++FD+DDTLY S  G+ Q LKKNIDDFL+EK G  ET+AS+LRVELFK YGS+L
Sbjct  2    ASPFDCLLFDLDDTLYPSTTGLAQGLKKNIDDFLIEKFGLSETKASSLRVELFKTYGSTL  61

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGLRALGYD+DAD+YH FVHGRLPY +IKPDP+LR+LLRSI QRKIIFTNSDRVHA+KVL
Sbjct  62   AGLRALGYDIDADDYHGFVHGRLPYAMIKPDPQLRNLLRSITQRKIIFTNSDRVHAIKVL  121

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
             R+G++DCF+QIICFET+NPNL +S+RPDEFPVVLKP+M+AM IA+D + VDP RTLF D
Sbjct  122  KRLGLEDCFDQIICFETLNPNLPKSTRPDEFPVVLKPSMDAMKIALDVSHVDPGRTLFFD  181

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE----EVRCSR-  810
            DN RNIAAG A+GL T LVG   KTKE+DYA+E V  + QVIPE+W  E    + R SR 
Sbjct  182  DNVRNIAAGKALGLWTCLVGKTVKTKEADYAIETVNNLEQVIPEMWVNETDGGDERISRT  241

Query  811  -SEMDSYL-ATTSVGA  852
             SE+D+ L ATT VGA
Sbjct  242  SSELDAILAATTPVGA  257



>ref|XP_009366925.1| PREDICTED: uncharacterized protein LOC103956624 [Pyrus x bretschneideri]
Length=266

 Score =   366 bits (939),  Expect = 5e-122, Method: Compositional matrix adjust.
 Identities = 174/258 (67%), Positives = 210/258 (81%), Gaps = 11/258 (4%)
 Frame = +1

Query  112  PFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAG  291
            PFD+IIFD+DDTLYSS +G+G+A KKNIDDFLVEKCGFPE++AS LRVELFKKYGSSLAG
Sbjct  9    PFDSIIFDLDDTLYSSNLGLGEACKKNIDDFLVEKCGFPESKASGLRVELFKKYGSSLAG  68

Query  292  LRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDR  471
            LRALGYD+DA +YH  VHGRLPY+ IKPDP+LR LLRSI+QRKIIFTNSDR HA+KVL+R
Sbjct  69   LRALGYDIDAKDYHDVVHGRLPYDRIKPDPQLRDLLRSISQRKIIFTNSDRKHAVKVLER  128

Query  472  IGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDN  651
            +G+++ F++IICFET+NPNL  S++PDEFPVVLKP+++AM IA+  A+VDPRRTLFLDDN
Sbjct  129  LGVEEYFDRIICFETLNPNLPSSTQPDEFPVVLKPSIKAMEIALRAAEVDPRRTLFLDDN  188

Query  652  TRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF-------EEEVRCSR  810
             RN+AAG AVGLRT LVG   K+KE+DY +E V  M Q I E+W            R SR
Sbjct  189  VRNVAAGKAVGLRTVLVGKTVKSKEADYVLENVNNMAQAISEVWVGGSGAKDGSNQRISR  248

Query  811  S----EMDSYLATTSVGA  852
            +    E+DS L  T+VGA
Sbjct  249  TRSDIELDSVLTATAVGA  266



>emb|CAN62374.1| hypothetical protein VITISV_036478 [Vitis vinifera]
Length=257

 Score =   357 bits (915),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/246 (68%), Positives = 205/246 (83%), Gaps = 6/246 (2%)
 Frame = +1

Query  133  DMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRALGYD  312
            D+DDTLY SK GI +A K+NI++FLV+KCGF ET+AS+LRVELFK YGS+LAGLRALGY+
Sbjct  12   DLDDTLYHSKTGIAEACKRNIEEFLVQKCGFGETKASSLRVELFKNYGSTLAGLRALGYN  71

Query  313  VDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIKDCF  492
            +DAD+YHSFVHGRLPY LIKPD +LRSLLRSI  RKII TNSDR HA+KVLDR+G++DCF
Sbjct  72   IDADDYHSFVHGRLPYELIKPDSQLRSLLRSIALRKIILTNSDRNHAIKVLDRLGLQDCF  131

Query  493  EQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAG  672
            +QIICFETMNPNL +S+R DEFPV+LKP+++AM IA+D A+V+P RTLFLDDN RNIAAG
Sbjct  132  DQIICFETMNPNLPKSTRLDEFPVILKPSLDAMKIALDAANVNPPRTLFLDDNVRNIAAG  191

Query  673  NAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEVRCSRSEMDSYLA  834
             A+GLRT LVG   KTKE+DY +E V  + QVIPEIW       ++ ++ + SE+D+ L 
Sbjct  192  KALGLRTVLVGKTMKTKEADYVLETVHNLAQVIPEIWLGGKDGEDQRIKRTGSELDATLP  251

Query  835  TTSVGA  852
            TT VGA
Sbjct  252  TTPVGA  257



>ref|XP_006419900.1| hypothetical protein CICLE_v10005687mg [Citrus clementina]
 ref|XP_006489367.1| PREDICTED: suppressor of disruption of TFIIS-like [Citrus sinensis]
 gb|ESR33140.1| hypothetical protein CICLE_v10005687mg [Citrus clementina]
Length=256

 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 162/254 (64%), Positives = 205/254 (81%), Gaps = 6/254 (2%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPF+ ++FD+DDTLY S+ GI +A+K+NI+ FL+EKCGF ET+AS+LRVELFK YGS+LA
Sbjct  3    SPFNCLVFDLDDTLYPSETGIAEAVKRNIEGFLIEKCGFSETKASSLRVELFKAYGSTLA  62

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ AD+YH FVHGRLPY+LIKPDP+LR+LL SI QRKIIFTNSDR HA+  L 
Sbjct  63   GLRALGYDIGADDYHGFVHGRLPYDLIKPDPQLRNLLCSITQRKIIFTNSDRNHAITCLK  122

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+ I DCF+QIICFETMNPNLS+++RPDEFPV+LKP+M+AM +A+  A+VDPR  LFLDD
Sbjct  123  RLEIADCFDQIICFETMNPNLSKATRPDEFPVLLKPSMDAMKLALHVANVDPRHALFLDD  182

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEVRCSR  810
            N +N+ AG A+GLRT LVG      E+DYA+E V  + QV+PEIW       ++ +  +R
Sbjct  183  NIKNVTAGKALGLRTVLVGKTVNVGEADYALENVNNLPQVVPEIWVSQSDDGDQRISRTR  242

Query  811  SEMDSYLATTSVGA  852
            SE++S L TT VGA
Sbjct  243  SELESILTTTPVGA  256



>ref|XP_004496742.1| PREDICTED: uncharacterized protein C24B11.05-like [Cicer arietinum]
Length=266

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/259 (66%), Positives = 212/259 (82%), Gaps = 11/259 (4%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPFD IIFD+DDTLY   +GIG ++KKNID FL+EKCGF +T+AS LRVELFK +GS+LA
Sbjct  8    SPFDCIIFDLDDTLYPETIGIGASVKKNIDLFLIEKCGFSQTKASTLRVELFKSHGSTLA  67

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ A++YHSFVHGRLPY+LIKPD +LR+LLR+INQRKIIFTNSDR+HA++VLD
Sbjct  68   GLRALGYDITAEDYHSFVHGRLPYDLIKPDIQLRNLLRTINQRKIIFTNSDRIHALRVLD  127

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+GIKDCFEQIICFET+NPNL  S+RPDEFPVVLKP++EA  IA+  A VDPRRTLFLDD
Sbjct  128  RLGIKDCFEQIICFETINPNLPNSTRPDEFPVVLKPSLEAFKIAIHAASVDPRRTLFLDD  187

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKV--TEMVQVIPEIWF------EEEVRC  804
            + RN+AAG  +GL T LVG   K+K  +Y +E V   E+ QVIPEIW       +++++ 
Sbjct  188  SVRNVAAGKEMGLHTVLVGKKGKSKVGEYVVECVNSVELAQVIPEIWGMRMDDDDQKLKL  247

Query  805  SR--SEMDSYL-ATTSVGA  852
            +R  SE+D+ L A T+VGA
Sbjct  248  ARTNSELDAMLSAFTAVGA  266



>gb|KDO74644.1| hypothetical protein CISIN_1g025190mg [Citrus sinensis]
Length=256

 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/254 (64%), Positives = 204/254 (80%), Gaps = 6/254 (2%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPF+ ++FD+DDTLY S+ GI  A+K+NI+ FL+EKCGF ET+AS+LRVELFK YGS+LA
Sbjct  3    SPFNCLVFDLDDTLYPSETGIAAAVKRNIEGFLIEKCGFSETKASSLRVELFKAYGSTLA  62

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ AD+YH FVHGRLPY+LIKPDP+LR+LL SI QRKIIFTNSDR HA+  L 
Sbjct  63   GLRALGYDIGADDYHGFVHGRLPYDLIKPDPQLRNLLCSITQRKIIFTNSDRNHAITCLK  122

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+ I DCF+QIICFETMNPNLS+++RPDEFPV+LKP+M+AM +A+  A+VDPR  LFLDD
Sbjct  123  RLEIADCFDQIICFETMNPNLSKATRPDEFPVLLKPSMDAMKLALHVANVDPRHALFLDD  182

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEVRCSR  810
            N +N+ AG A+GLRT LVG      E+DYA+E V  + QV+PEIW       ++ +  +R
Sbjct  183  NIKNVTAGKALGLRTVLVGKTVNVGEADYALENVNNLPQVVPEIWVSQSDDGDQRISRTR  242

Query  811  SEMDSYLATTSVGA  852
            SE++S L TT VGA
Sbjct  243  SELESILTTTPVGA  256



>gb|AFK41981.1| unknown [Medicago truncatula]
Length=264

 Score =   347 bits (891),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 167/263 (63%), Positives = 206/263 (78%), Gaps = 9/263 (3%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            +VR+  SPFD IIFD+DDTLY S  GIG A+KKNID FL+EKCGF +++AS LRVELFK 
Sbjct  2    AVRNKPSPFDCIIFDLDDTLYPSNTGIGAAVKKNIDLFLMEKCGFSQSKASTLRVELFKS  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            +GS+LAGLRALGYD+ A+EYH FVHGRLPY LIKPD +LR+LLRSINQRKIIFTNSDR+H
Sbjct  62   HGSTLAGLRALGYDITAEEYHGFVHGRLPYELIKPDIQLRNLLRSINQRKIIFTNSDRIH  121

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            A++ LDR+GI DCFEQIICFET+NPNL  S+RPDEFPV+LKP+ +A  IA+  A+VDPR 
Sbjct  122  ALRALDRLGITDCFEQIICFETLNPNLPNSTRPDEFPVLLKPSPDAFKIAIQAANVDPRH  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE--MVQVIPEIW------F  786
            TLFLDD+ RNI AG  +GL T LVG   K    DY +E V    + +VIPEIW      +
Sbjct  182  TLFLDDSVRNIIAGKEMGLHTVLVGETVKNNVGDYVVECVNSVTLAEVIPEIWGSRVDDY  241

Query  787  EEEVRCSRSEMDSYL-ATTSVGA  852
            ++++  + SE+D+ L A T+VGA
Sbjct  242  DQKLSRTNSELDALLSAYTAVGA  264



>ref|XP_003592405.1| Phosphate metabolism protein [Medicago truncatula]
 gb|ACJ85293.1| unknown [Medicago truncatula]
 gb|AES62656.1| haloacid dehalogenase-like hydrolase [Medicago truncatula]
 gb|AFK47833.1| unknown [Medicago truncatula]
Length=264

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 166/263 (63%), Positives = 205/263 (78%), Gaps = 9/263 (3%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            + R+  SPFD IIFD+DDTLY S  GIG A+KKNID FL+EKCGF +++AS LRVELFK 
Sbjct  2    AFRNKPSPFDCIIFDLDDTLYPSNTGIGAAVKKNIDLFLMEKCGFSQSKASTLRVELFKS  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            +GS+LAGLRALGYD+ A+EYH FVHGRLPY LIKPD +LR+LLRSINQRKIIFTNSDR+H
Sbjct  62   HGSTLAGLRALGYDITAEEYHGFVHGRLPYELIKPDIQLRNLLRSINQRKIIFTNSDRIH  121

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            A++ LDR+GI DCFEQIICFET+NPNL  S+RPDEFPV+LKP+ +A  IA+  A+VDPR 
Sbjct  122  ALRALDRLGITDCFEQIICFETLNPNLPNSTRPDEFPVLLKPSPDAFKIAIQAANVDPRH  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE--MVQVIPEIW------F  786
            TLFLDD+ RNI AG  +GL T LVG   K    DY +E V    + +VIPEIW      +
Sbjct  182  TLFLDDSVRNIIAGKEMGLHTVLVGETVKNNVGDYVVECVNSVTLAEVIPEIWGSRVDDY  241

Query  787  EEEVRCSRSEMDSYL-ATTSVGA  852
            ++++  + SE+D+ L A T+VGA
Sbjct  242  DQKLSRTNSELDALLSAYTAVGA  264



>emb|CAD57681.1| putative phosphatase [Phaseolus vulgaris]
Length=262

 Score =   345 bits (885),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/255 (64%), Positives = 206/255 (81%), Gaps = 7/255 (3%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPFDAIIFD+DDTLY S  GI + +K+NI+ FL+EKCGF E++A+ LRVELFK YGS+LA
Sbjct  8    SPFDAIIFDLDDTLYPSTTGIDRCVKRNIELFLIEKCGFSESKAAHLRVELFKTYGSTLA  67

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ A+EYHSFVHGRLPY+ IKPD +LR+LL +I QRKI+FTNSDR+HAM+ LD
Sbjct  68   GLRALGYDITAEEYHSFVHGRLPYDSIKPDVQLRNLLCTIKQRKIVFTNSDRIHAMRALD  127

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+GI DCFEQIICFET+NPNL  S+RPDEFPV+LKP+++A  IA+D A+V+PRRTLFLDD
Sbjct  128  RLGISDCFEQIICFETINPNLPNSTRPDEFPVLLKPSLDAFRIALDAANVEPRRTLFLDD  187

Query  649  NTRNIAAGN-AVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEVRCS  807
            + RNIAAG    GL+T LVG   K+KE++YA+E V  + Q IPEIW       +E +  +
Sbjct  188  SVRNIAAGKRKWGLQTVLVGKTVKSKEANYAVEFVNNVAQAIPEIWANKMEYKDETITRT  247

Query  808  RSEMDSYLATTSVGA  852
            +SE++S LA   VGA
Sbjct  248  KSELESALAIALVGA  262



>gb|KHN15780.1| Hypothetical protein glysoja_012572 [Glycine soja]
Length=261

 Score =   345 bits (884),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 161/260 (62%), Positives = 206/260 (79%), Gaps = 6/260 (2%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            ++  ++SPFD+IIFD+DDTLY S  GI + +KKNI  FL++KCGF E+EA  LRV+LFK 
Sbjct  2    AISSNASPFDSIIFDLDDTLYPSSTGIDKCVKKNIQLFLIQKCGFSESEAFTLRVDLFKT  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YGS+LAGLRALG+D+ A+EYH FVHGRLPY+ I PD  LR+LL +I QRKI+FTNSDR+H
Sbjct  62   YGSTLAGLRALGHDITAEEYHGFVHGRLPYDSINPDHHLRNLLCTIKQRKIVFTNSDRIH  121

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            AM+ LDR+GIKDCFEQIICFET+NPNL  S+RPDEFP++LKP+++A  IA+D A+VDPRR
Sbjct  122  AMRSLDRLGIKDCFEQIICFETINPNLPYSTRPDEFPILLKPSLDAFKIALDAANVDPRR  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE------  792
            TLFLDD+ RNIAAG  +GL T LVG   K+K +DYA+E V ++ QVIPEIW  E      
Sbjct  182  TLFLDDSVRNIAAGKEMGLHTVLVGKTEKSKGADYAVECVNDLAQVIPEIWANEMDGEDQ  241

Query  793  EVRCSRSEMDSYLATTSVGA  852
             +  ++SE+++ LA   VGA
Sbjct  242  TMTRTKSELEAVLACAVVGA  261



>ref|NP_001235869.1| uncharacterized protein LOC547648 [Glycine max]
 gb|AAM94615.1| putative hydrolase [Glycine max]
Length=261

 Score =   341 bits (875),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 205/260 (79%), Gaps = 6/260 (2%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            ++  ++SPFD+IIFD+DDTLY S  GI + +KKNI  FL++KCGF E+EA  LRV+LFK 
Sbjct  2    AISSNASPFDSIIFDLDDTLYPSSTGIDKCVKKNIQLFLIQKCGFSESEAFTLRVDLFKT  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YGS+LAGLRALG+D+ A+EYH FVHGRLPY+ I PD  LR+LL +I QRKI+FTNSDR+H
Sbjct  62   YGSTLAGLRALGHDITAEEYHGFVHGRLPYDSINPDHHLRNLLCTIKQRKIVFTNSDRIH  121

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            AM+ LDR+GIKDCFEQIICFET+NPNL  S+RPDEF ++LKP+++A  IA+D A+VDPRR
Sbjct  122  AMRSLDRLGIKDCFEQIICFETINPNLPYSTRPDEFLILLKPSLDAFKIALDAANVDPRR  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE------  792
            TLFLDD+ RNIAAG  +GL T LVG   K+K +DYA+E V ++ QVIPEIW  E      
Sbjct  182  TLFLDDSVRNIAAGKEMGLHTVLVGKTEKSKGADYAVECVNDLAQVIPEIWANEMDGEDQ  241

Query  793  EVRCSRSEMDSYLATTSVGA  852
             +  ++SE+++ LA   VGA
Sbjct  242  TMTRTKSELEAVLACAVVGA  261



>ref|XP_004156075.1| PREDICTED: uncharacterized protein C24B11.05-like [Cucumis sativus]
Length=257

 Score =   341 bits (874),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 160/253 (63%), Positives = 198/253 (78%), Gaps = 7/253 (3%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            FD +IFD+DDTLY    GI  A KKNI+DFL+EKCGFP+T+A  LR ELFK YGS+LAGL
Sbjct  5    FDCLIFDLDDTLYPFNTGIATACKKNIEDFLIEKCGFPKTQAPILRTELFKTYGSTLAGL  64

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RALGYD+ AD+YH FVHGRLPY+ IK D +LR LL SI QRKIIFTNSD +HA K L R+
Sbjct  65   RALGYDIKADDYHGFVHGRLPYDRIKQDFQLRRLLLSIPQRKIIFTNSDMIHATKALSRL  124

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNT  654
            G++ CFE+IICFETMNPNL +++RP+EFP++LKP+++AM IA+D ADVDPRRTLFLDDN 
Sbjct  125  GLEGCFEKIICFETMNPNLPKATRPNEFPILLKPSLDAMRIALDVADVDPRRTLFLDDNI  184

Query  655  RNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF-------EEEVRCSRS  813
            RNIAAG ++GLRT LVG   K+KE+DY +E V  +VQ IPEIW        +E +  SR+
Sbjct  185  RNIAAGKSLGLRTVLVGKTVKSKEADYVVETVHNLVQAIPEIWMNTDLDGDDEMMNRSRN  244

Query  814  EMDSYLATTSVGA  852
            ++DS     +VGA
Sbjct  245  DVDSIHMAATVGA  257



>ref|XP_008449552.1| PREDICTED: uncharacterized protein C24B11.05 [Cucumis melo]
Length=260

 Score =   340 bits (872),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 163/259 (63%), Positives = 200/259 (77%), Gaps = 10/259 (4%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            +S F  +IFD+DDTLY    GI  A KKNI+DFL+EKCGFP+T+A  LR ELFK YGS+L
Sbjct  2    ASSFHCLIFDLDDTLYPFNTGIATACKKNIEDFLIEKCGFPKTQAPILRTELFKTYGSTL  61

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGLRALGYD+ AD+YH FVHGRLPY+ IK D +LR LL SI QRKIIFTNSD +HA K L
Sbjct  62   AGLRALGYDIKADDYHGFVHGRLPYDRIKQDFQLRRLLLSIPQRKIIFTNSDMIHATKAL  121

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
             R+G++ CFE+IICFETMNPNL +++RP+EFP++LKP+M+AM IA+D ADVDPR TLFLD
Sbjct  122  SRLGLEGCFEKIICFETMNPNLPKAARPNEFPILLKPSMDAMRIALDVADVDPRHTLFLD  181

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--------EEEVR  801
            DN RNIAAG ++GLRT LVG   K+KE+DY +E V  +VQVIPEIW         +E + 
Sbjct  182  DNIRNIAAGKSLGLRTVLVGKTVKSKEADYVVESVHNLVQVIPEIWMNTADSDGDDEMMN  241

Query  802  CSRSEMDS--YLATTSVGA  852
             SR+E+DS    A  +VGA
Sbjct  242  RSRNEVDSIHMTAAAAVGA  260



>ref|XP_006410349.1| hypothetical protein EUTSA_v10017107mg [Eutrema salsugineum]
 gb|ESQ51802.1| hypothetical protein EUTSA_v10017107mg [Eutrema salsugineum]
Length=262

 Score =   340 bits (872),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 162/259 (63%), Positives = 205/259 (79%), Gaps = 11/259 (4%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K GI  A+KKNIDDFLVEK GFPE++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGIAPAVKKNIDDFLVEKFGFPESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HAMKVL+
Sbjct  64   GLRALGHDVHPDEYHSFVHGRLPYGSIQPNSKLRNLLNKIKQRKIIFTNSDRDHAMKVLE  123

Query  469  RIGIKDCFEQIICFETMNPNL--SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFL  642
            ++G++DCFE++ICFETMNPNL  S+++RPDE PVVLKP++ AM+I +  A++DPRRT+F 
Sbjct  124  KLGLEDCFEEMICFETMNPNLFGSKTTRPDEHPVVLKPSLTAMDICIRVANIDPRRTIFS  183

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE---------EE  795
            DDN  NI AG +VGLRT LVG + KTKE+D+A+E V E+   +PEIW           E 
Sbjct  184  DDNIHNITAGKSVGLRTILVGRSEKTKEADFAVETVAEIATAVPEIWTTTTTGFDVGGES  243

Query  796  VRCSRSEMDSYLATTSVGA  852
            VR S+SE+++  + T+VGA
Sbjct  244  VRRSKSELEAMASITAVGA  262



>gb|AGV54261.1| phosphatase [Phaseolus vulgaris]
Length=262

 Score =   340 bits (871),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 162/255 (64%), Positives = 205/255 (80%), Gaps = 7/255 (3%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPFDAIIFD+DDTLY S  GI + +K+NI+ FL+EKCGF E++A+ LRVELFK YGS+LA
Sbjct  8    SPFDAIIFDLDDTLYPSTTGIDRCVKRNIELFLIEKCGFSESKAAHLRVELFKTYGSTLA  67

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ A+EYHSFVHGRLPY+ IKPD +LR+LL +I QRKI+FTNSDR+HAM+ LD
Sbjct  68   GLRALGYDITAEEYHSFVHGRLPYDSIKPDVQLRNLLCTIKQRKIVFTNSDRIHAMRALD  127

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+GI DCFEQIICFET+NPNL  S+RPDEFPV+LKP+++A  IA+D A+V+PRRTLFLDD
Sbjct  128  RLGISDCFEQIICFETINPNLPNSTRPDEFPVLLKPSLDAFRIALDAANVEPRRTLFLDD  187

Query  649  NTRNIAAGN-AVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF------EEEVRCS  807
            + RNIAAG   +GL+T LVG   + KE++ A+E V  + Q IPEIW       +E +  +
Sbjct  188  SVRNIAAGKRKMGLQTVLVGKTVENKEANMAVEFVNNVPQAIPEIWANKMEYKDETITRT  247

Query  808  RSEMDSYLATTSVGA  852
            +SE++S LA   VGA
Sbjct  248  KSELESALAIALVGA  262



>ref|XP_004140145.1| PREDICTED: uncharacterized protein C24B11.05-like [Cucumis sativus]
 gb|KGN48008.1| hypothetical protein Csa_6G423990 [Cucumis sativus]
Length=257

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 159/253 (63%), Positives = 197/253 (78%), Gaps = 7/253 (3%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            FD +IFD+DDTLY    GI  A KKNI+DFL+EKCGFP+T+A  LR ELFK YGS+LAGL
Sbjct  5    FDCLIFDLDDTLYPFNTGIATACKKNIEDFLIEKCGFPKTQAPILRTELFKTYGSTLAGL  64

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RALGYD+ AD+YH FVHGRLPY+ IK D +LR LL SI QRKIIFTNSD +HA K L R+
Sbjct  65   RALGYDIKADDYHGFVHGRLPYDRIKQDFQLRRLLLSIPQRKIIFTNSDMIHATKALSRL  124

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNT  654
            G++ CFE+IICFETMNPNL +++RP+EFP++LKP+++AM IA+D ADVDPRRTLFLDDN 
Sbjct  125  GLEGCFEKIICFETMNPNLPKATRPNEFPILLKPSLDAMRIALDVADVDPRRTLFLDDNI  184

Query  655  RNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF-------EEEVRCSRS  813
            RNIAAG ++ LRT LVG   K+KE+DY +E V  +VQ IPEIW        +E +  SR+
Sbjct  185  RNIAAGKSLALRTVLVGKTVKSKEADYVVETVHNLVQAIPEIWMNTDLDGDDEMMNRSRN  244

Query  814  EMDSYLATTSVGA  852
            ++DS     +VGA
Sbjct  245  DVDSIHMAATVGA  257



>ref|XP_007143240.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
 ref|XP_007143242.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
 gb|ESW15234.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
 gb|ESW15236.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
Length=321

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/225 (68%), Positives = 192/225 (85%), Gaps = 0/225 (0%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPFDAIIFD+DDTLY S  GI + +K+NI+ FL+EKCGF E++A+ LRVELFK YGS+LA
Sbjct  80   SPFDAIIFDLDDTLYPSTTGIDRCVKRNIELFLIEKCGFSESKAAHLRVELFKTYGSTLA  139

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ A+EYHSFVHGRLPY+ IKPD +LR+LL +I QRKI+FTNSDR+HAM+ LD
Sbjct  140  GLRALGYDITAEEYHSFVHGRLPYDSIKPDVQLRNLLCTIKQRKIVFTNSDRIHAMRALD  199

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+GI DCFEQ+ICFET+NPNL  S+RPDEFPV+LKP+++A  IA+D A+V+PRRTLFLDD
Sbjct  200  RLGISDCFEQVICFETINPNLPNSTRPDEFPVLLKPSLDAFRIALDAANVEPRRTLFLDD  259

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            + RNIAAG  +GL+T LVG   K+KE++YA+E V  + Q IPEIW
Sbjct  260  SVRNIAAGREMGLQTVLVGKTVKSKEANYAVEFVNNVAQAIPEIW  304



>ref|XP_006295927.1| hypothetical protein CARUB_v10025064mg [Capsella rubella]
 gb|EOA28825.1| hypothetical protein CARUB_v10025064mg [Capsella rubella]
Length=260

 Score =   337 bits (864),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 161/257 (63%), Positives = 203/257 (79%), Gaps = 9/257 (4%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K G+  A+KKNIDDFLVEK GFPE++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGLAPAVKKNIDDFLVEKFGFPESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HA+ VL 
Sbjct  64   GLRALGHDVHPDEYHSFVHGRLPYGSIEPNNKLRNLLNKIKQRKIIFTNSDRNHAVTVLK  123

Query  469  RIGIKDCFEQIICFETMNPNL---SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLF  639
            ++G++DCFE++ICFETMNPNL   + ++RPDE PVVLKP++ AM+I +  A+VDPRRT+F
Sbjct  124  KLGLEDCFEEMICFETMNPNLFGSTTTTRPDEHPVVLKPSLAAMDICIRVANVDPRRTVF  183

Query  640  LDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE------EEVR  801
            LDDN  NI AG +VGLRT LVG A KT E+DYA+E VTE+   +PEIW        E +R
Sbjct  184  LDDNIHNITAGKSVGLRTILVGRAEKTNEADYAVETVTEIATEVPEIWTTATATGGERIR  243

Query  802  CSRSEMDSYLATTSVGA  852
             S+SE++  ++ T+VGA
Sbjct  244  RSKSELEGMVSITAVGA  260



>ref|XP_002879366.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH55625.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=264

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 164/263 (62%), Positives = 205/263 (78%), Gaps = 12/263 (5%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            D SSP + +IFD+DDTLY  K GI  A+KKNIDDFLVEK GF E++AS+LRVELFK YGS
Sbjct  2    DFSSPINCLIFDLDDTLYPLKTGIAPAVKKNIDDFLVEKYGFSESKASSLRVELFKTYGS  61

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            +L GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HA+K
Sbjct  62   TLVGLRALGHDVHPDEYHSFVHGRLPYGSIEPNNKLRNLLNKIKQRKIIFTNSDRNHAVK  121

Query  460  VLDRIGIKDCFEQIICFETMNPNL-SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            VL ++G++DCFE++ICFETMNPNL   ++RPDE PVVLKP++ AM+I +  A+VDPRRT+
Sbjct  122  VLKKLGLEDCFEEMICFETMNPNLFGSTTRPDEHPVVLKPSLTAMDICIRVANVDPRRTI  181

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW--------FE-  789
            FLDDN  NI AG +VGLRT LVG A KTK++DYA+E VTE+   +PEIW        F+ 
Sbjct  182  FLDDNIHNITAGKSVGLRTILVGRAEKTKDADYAVETVTEIATAVPEIWKTATATGGFDV  241

Query  790  --EEVRCSRSEMDSYLATTSVGA  852
              E +R S+SE++   + T+VGA
Sbjct  242  GGERIRRSKSELEGMASITAVGA  264



>gb|KHN02709.1| Hypothetical protein glysoja_015951 [Glycine soja]
Length=261

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 159/255 (62%), Positives = 199/255 (78%), Gaps = 6/255 (2%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            +SPFD+IIFD+DDTLY S  GI + +KKNI  FL++KCGF E++A   RVELFK YGS+L
Sbjct  7    ASPFDSIIFDLDDTLYPSSTGIDKCVKKNIQLFLIQKCGFSESKALTQRVELFKTYGSTL  66

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGLRA G D+ A++YH FVHGRLPY+ I  D +LR+LL SI QRKI+FTNSDR+HAM+ L
Sbjct  67   AGLRAQGLDITAEDYHGFVHGRLPYDSIDTDHQLRNLLLSIKQRKIVFTNSDRIHAMRAL  126

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
            DR+GIKDCFEQIICFET+NPNL  S+RPDEFP++LKP+++A  IA+D A+VDPRRTLFLD
Sbjct  127  DRLGIKDCFEQIICFETINPNLPYSTRPDEFPILLKPSLDAFKIALDAANVDPRRTLFLD  186

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE------EVRCS  807
            D+ RNIAAG  +GL T LVG   K+K +DYA+E V  + QVIPEIW  E       +  S
Sbjct  187  DSVRNIAAGKEMGLHTVLVGKTMKSKGADYAVESVHNLAQVIPEIWANEMDGGDPTMTRS  246

Query  808  RSEMDSYLATTSVGA  852
            +SE+++ LA   VGA
Sbjct  247  KSELEAVLACALVGA  261



>gb|KFK31156.1| hypothetical protein AALP_AA6G075700 [Arabis alpina]
Length=258

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/255 (63%), Positives = 202/255 (79%), Gaps = 7/255 (3%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K GI  A+K+NIDDFLVEK GF E++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGIAPAVKRNIDDFLVEKFGFSESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHS VHGRLPY  I+ + +LR+LL  I QRKIIFTNSDR HAMKVL+
Sbjct  64   GLRALGHDVHPDEYHSIVHGRLPYGSIESNTKLRNLLNKIKQRKIIFTNSDRNHAMKVLE  123

Query  469  RIGIKDCFEQIICFETMNPNL--SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFL  642
            ++G++DCFE++ICFETMNPNL  S S+RPDE+PVVLKP++ AM I +  A+VDPRRT+FL
Sbjct  124  KLGLEDCFEEMICFETMNPNLFGSTSTRPDEYPVVLKPSLSAMEICIRVANVDPRRTVFL  183

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF-----EEEVRCS  807
            DDN  NI AG +VGLRT LVG + KTKE+DYA+E VTE+   +P+IW       E +R S
Sbjct  184  DDNVHNITAGKSVGLRTILVGRSEKTKEADYAVENVTEIATALPDIWTMAKNGGERIRRS  243

Query  808  RSEMDSYLATTSVGA  852
            +SE++   + T+VGA
Sbjct  244  KSELEGMASITAVGA  258



>emb|CAD57680.1| putative phosphatase [Glycine max]
Length=261

 Score =   336 bits (861),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/255 (62%), Positives = 199/255 (78%), Gaps = 6/255 (2%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            +SPFD+IIFD+DDTLY S  GI + +KKNI  FL++KCGF E++A   RVELFK YGS+L
Sbjct  7    ASPFDSIIFDLDDTLYPSSTGIDKCVKKNIQLFLIQKCGFSESKALTQRVELFKTYGSTL  66

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGLRA G D+ A++YH FVHGRLPY+ I  D +LR+LL SI QRKI+FTNSDR+HAM+ L
Sbjct  67   AGLRAQGLDITAEDYHGFVHGRLPYDSIDTDHQLRNLLLSIKQRKIVFTNSDRIHAMRAL  126

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
            DR+G+KDCFEQIICFET+NPNL  S+RPDEFP++LKP+++A  IA+D A+VDPRRTLFLD
Sbjct  127  DRLGVKDCFEQIICFETINPNLPYSTRPDEFPILLKPSLDAFKIALDAANVDPRRTLFLD  186

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE------EVRCS  807
            D+ RNIAAG  +GL T LVG   K+K +DYA+E V  + QVIPEIW  E       +  S
Sbjct  187  DSVRNIAAGKEMGLHTVLVGKTMKSKGADYAVESVHNLAQVIPEIWANEMDGGDPTMTRS  246

Query  808  RSEMDSYLATTSVGA  852
            +SE+++ LA   VGA
Sbjct  247  KSELEAVLACALVGA  261



>ref|XP_010666929.1| PREDICTED: phosphate metabolism protein 8 [Beta vulgaris subsp. 
vulgaris]
Length=264

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 165/265 (62%), Positives = 210/265 (79%), Gaps = 11/265 (4%)
 Frame = +1

Query  82   FCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVEL  261
            F K  R S+SPFD ++FD+DDTLYSS  GI QALKKNI+DFLVE+CGF   +A++LRVEL
Sbjct  3    FGKLSRASTSPFDCLMFDLDDTLYSSHTGIHQALKKNIEDFLVERCGFSTDQAASLRVEL  62

Query  262  FKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSD  441
            FK YGS+LAGLRALGYD+DAD+YHSFVHGRLPY  IKP+P+LR+LL  I QRKIIFTNSD
Sbjct  63   FKTYGSTLAGLRALGYDIDADDYHSFVHGRLPYAQIKPNPQLRNLLCRITQRKIIFTNSD  122

Query  442  RVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVD  621
            RVHA K L R+G++DCFEQIICFET+NPNLS ++RPDE PV+LKP+++A+ IA+  A++ 
Sbjct  123  RVHATKALSRLGLEDCFEQIICFETLNPNLSIATRPDEIPVLLKPSLDAIAIAISAANIT  182

Query  622  PRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF-----  786
            P RTLFLDDN RN+AAG A+GL+TALVG ATK   +DYA+E V  + Q IP+I       
Sbjct  183  PHRTLFLDDNVRNVAAGKALGLKTALVGRATKCVGADYALETVNNLAQAIPDIVMINGSE  242

Query  787  ---EEEVRCSRSEMDSYLATTSVGA  852
               ++ +  S S+++++L   +VGA
Sbjct  243  EDDQQAMGRSMSDLETFL---TVGA  264



>ref|NP_565738.1| haloacid dehalogenase-like hydrolase domain-containing protein 
[Arabidopsis thaliana]
 gb|AAK43917.1|AF370598_1 putative hydrolase [Arabidopsis thaliana]
 gb|AAL09775.1| At2g32150/F22D22.10 [Arabidopsis thaliana]
 gb|AAD15390.2| putative hydrolase [Arabidopsis thaliana]
 gb|AAM16239.1| At2g32150/F22D22.10 [Arabidopsis thaliana]
 gb|AEC08640.1| haloacid dehalogenase-like hydrolase domain-containing protein 
[Arabidopsis thaliana]
Length=263

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 160/260 (62%), Positives = 202/260 (78%), Gaps = 12/260 (5%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K GI  A+KKNIDDFLVEK GF E++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGIAPAVKKNIDDFLVEKFGFSESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSD+ HA+KVL 
Sbjct  64   GLRALGHDVHPDEYHSFVHGRLPYGSIEPNNKLRNLLNKIKQRKIIFTNSDKNHAVKVLK  123

Query  469  RIGIKDCFEQIICFETMNPNL-SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
            ++G++DCFE++ICFETMNPNL   ++RPDE+PVVLKP++ AM+I +  A+VDPRRT+FLD
Sbjct  124  KLGLEDCFEEMICFETMNPNLFGSTTRPDEYPVVLKPSLTAMDICIRVANVDPRRTVFLD  183

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE-----------E  792
            DN  NI AG +VGLRT LVG A KTK++DYA+E VTE+   +PEIW             E
Sbjct  184  DNIHNITAGKSVGLRTILVGRAEKTKDADYAVETVTEIATAVPEIWATATATGGFDVGGE  243

Query  793  EVRCSRSEMDSYLATTSVGA  852
             +R S+SE++   +  +VGA
Sbjct  244  RIRRSKSELEGMASIAAVGA  263



>emb|CDY12231.1| BnaC04g12610D [Brassica napus]
Length=261

 Score =   333 bits (853),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 159/258 (62%), Positives = 202/258 (78%), Gaps = 10/258 (4%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K GI  A+KKNIDDFL+EK GF E++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGIAPAVKKNIDDFLMEKFGFSESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHS VHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HAMKVL+
Sbjct  64   GLRALGHDVHPDEYHSVVHGRLPYGSIQPNSKLRNLLNKIKQRKIIFTNSDRNHAMKVLE  123

Query  469  RIGIKDCFEQIICFETMNPNL-SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
            R+G++DCFE+IICFETMNPNL   ++RPDE PVVLKP++ AM++ +  A+VDPRR +FLD
Sbjct  124  RLGLEDCFEEIICFETMNPNLFGSTTRPDEHPVVLKPSLTAMDVCIRAANVDPRRAVFLD  183

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE---------EEV  798
            DN  NI+AG +VGLRT LVG + KTK++DYA+E VTE+   +P+IW           E +
Sbjct  184  DNVHNISAGKSVGLRTILVGRSEKTKDADYAVESVTEIATAVPDIWATATAGCDDGGERI  243

Query  799  RCSRSEMDSYLATTSVGA  852
            R S+SE++   + T+VGA
Sbjct  244  RRSKSELEGMASITAVGA  261



>ref|XP_010510096.1| PREDICTED: uncharacterized protein LOC104786383 [Camelina sativa]
Length=267

 Score =   333 bits (853),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 203/264 (77%), Gaps = 16/264 (6%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K G+  A+KKNIDDFLVEK GFPE++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGLAPAVKKNIDDFLVEKFGFPESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HA+ VL 
Sbjct  64   GLRALGHDVHPDEYHSFVHGRLPYGSIEPNSKLRNLLNKIKQRKIIFTNSDRNHAVTVLK  123

Query  469  RIGIKDCFEQIICFETMNPNL----SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            ++G++DCFE +ICFETMNPNL    S ++RPDE PVVLKP++ AM+I +  A+VDPRRT+
Sbjct  124  KLGLEDCFEDMICFETMNPNLFGSGSTTTRPDEHPVVLKPSLAAMDICIRVANVDPRRTV  183

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW---------FE  789
            FLDDN  NI AG +VGLRT LVG   KTK++DYA+E VTE+   +PEIW         +E
Sbjct  184  FLDDNIHNITAGKSVGLRTILVGRTEKTKDADYAVETVTEIATEVPEIWTTAKASTGGYE  243

Query  790  ---EEVRCSRSEMDSYLATTSVGA  852
               E +R S+SE++   + T+VGA
Sbjct  244  AGGERIRRSKSELEGMTSITAVGA  267



>gb|ACU14943.1| unknown [Glycine max]
Length=242

 Score =   331 bits (849),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 152/234 (65%), Positives = 191/234 (82%), Gaps = 0/234 (0%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            ++  ++SPFD+IIFD+DDTLY S  GI + +KKNI  FL++KCGF E+EA  LRV+LFK 
Sbjct  2    AISSNASPFDSIIFDLDDTLYPSSTGIDKCVKKNIQLFLIQKCGFSESEAFTLRVDLFKT  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YGS+LAGLRALG+D+ A+EYH FVHGRLPY+ I PD  LR+LL +I QRKI+FTNSDR+H
Sbjct  62   YGSTLAGLRALGHDITAEEYHGFVHGRLPYDSINPDHHLRNLLCTIKQRKIVFTNSDRIH  121

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            AM+ LDR+GIKDCFEQIICFET+NPNL  S+RPDEF ++LKP+++A  IA+D A+VDPRR
Sbjct  122  AMRSLDRLGIKDCFEQIICFETINPNLPYSTRPDEFLILLKPSLDAFKIALDAANVDPRR  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
            TLFLDD+ RNIAAG  +GL T  VG   K+K +DYA+E V ++ QVIPEIW  E
Sbjct  182  TLFLDDSVRNIAAGKEMGLHTVHVGKTEKSKGADYAVECVNDLAQVIPEIWANE  235



>ref|XP_010414030.1| PREDICTED: uncharacterized protein LOC104700243 [Camelina sativa]
Length=267

 Score =   332 bits (851),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/264 (61%), Positives = 202/264 (77%), Gaps = 16/264 (6%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K G+  A+KKNIDDFLVEK GFPE++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGLAPAVKKNIDDFLVEKFGFPESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HA+ VL 
Sbjct  64   GLRALGHDVHPDEYHSFVHGRLPYGSIEPNSKLRNLLNKIKQRKIIFTNSDRNHAVTVLK  123

Query  469  RIGIKDCFEQIICFETMNPNL----SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            ++G++DCFE++ICFETMNPNL    S ++R DE PVVLKP++ AM+I +  A+VDPRRT+
Sbjct  124  KLGLEDCFEEMICFETMNPNLFGSGSTTARSDEHPVVLKPSLAAMDICIRVANVDPRRTV  183

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE---------  789
            FLDDN  NI AG +VGLRT LVG A KTK++DYA+E VTE+   +PEIW           
Sbjct  184  FLDDNIHNITAGKSVGLRTILVGRAEKTKDADYAVETVTEIATEVPEIWTTAKASKGGYD  243

Query  790  ---EEVRCSRSEMDSYLATTSVGA  852
               E +R S+SE++   + T+VGA
Sbjct  244  AGGERIRRSKSELEGMASITAVGA  267



>ref|XP_009144008.1| PREDICTED: uncharacterized protein C24B11.05 [Brassica rapa]
 emb|CDY61401.1| BnaA05g35130D [Brassica napus]
Length=261

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 157/258 (61%), Positives = 199/258 (77%), Gaps = 10/258 (4%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K GI  A+KKNIDDFL+EK GF E++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGIAPAVKKNIDDFLMEKFGFSESKASSLRVELFKSYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHS VHGRLPY  I+P+ +LR+LL  I Q+KIIFTNSDR HAMKVL+
Sbjct  64   GLRALGHDVHPDEYHSVVHGRLPYGSIQPNSKLRNLLNKIKQKKIIFTNSDRNHAMKVLE  123

Query  469  RIGIKDCFEQIICFETMNPNL-SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLD  645
            R+G++DCFE+IICFETMNPNL   ++RPDE PVVLKP++ AM++ +  A+VDPRR +FLD
Sbjct  124  RLGLEDCFEEIICFETMNPNLFGATTRPDEHPVVLKPSLTAMDVCIRAANVDPRRAVFLD  183

Query  646  DNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRC-------  804
            DN  NI AG +VGLRT LVG + KTK++DYA+E VTE+   +P+IW      C       
Sbjct  184  DNVHNITAGKSVGLRTVLVGRSEKTKDADYAVETVTEIATAVPDIWATATAGCDDGGERI  243

Query  805  --SRSEMDSYLATTSVGA  852
              S+SE++   + T+VGA
Sbjct  244  SRSKSELEGMASITAVGA  261



>ref|XP_010469627.1| PREDICTED: uncharacterized protein LOC104749650 [Camelina sativa]
Length=267

 Score =   330 bits (847),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 162/264 (61%), Positives = 204/264 (77%), Gaps = 16/264 (6%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SP + +IFD+DDTLY  K G+  A+KKNIDDFLVEK GFPE++AS+LRVELFK YGS+LA
Sbjct  4    SPINCLIFDLDDTLYPLKTGLAPAVKKNIDDFLVEKFGFPESKASSLRVELFKTYGSTLA  63

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALG+DV  DEYHSFVHGRLPY  I+P+ +LR+LL  I QRKIIFTNSDR HA+ VL 
Sbjct  64   GLRALGHDVHPDEYHSFVHGRLPYGSIEPNSKLRNLLNKIKQRKIIFTNSDRNHAVTVLK  123

Query  469  RIGIKDCFEQIICFETMNPNL----SRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            ++G++DCFE++ICFETMNPNL    S ++RPDE PVVLKP++ AM+I +  A+VDPRRT+
Sbjct  124  KLGLEDCFEEMICFETMNPNLFGSGSATTRPDEHPVVLKPSLAAMDICIRVANVDPRRTV  183

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW---------FE  789
            FLDDN  NI AG +VGLRT LVG A KTK++DYA+E VTE+   +PEI          +E
Sbjct  184  FLDDNIHNITAGKSVGLRTILVGRAEKTKDADYAVETVTEIATEVPEILTTAKASTGGYE  243

Query  790  ---EEVRCSRSEMDSYLATTSVGA  852
               E +R S+SE++   + T+VGA
Sbjct  244  AGGERIRRSKSELEGMASITAVGA  267



>ref|XP_010522301.1| PREDICTED: uncharacterized protein C24B11.05 [Tarenaya hassleriana]
 ref|XP_010522302.1| PREDICTED: uncharacterized protein C24B11.05 [Tarenaya hassleriana]
Length=259

 Score =   326 bits (836),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/251 (63%), Positives = 203/251 (81%), Gaps = 8/251 (3%)
 Frame = +1

Query  124  IIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRAL  303
            +IFD+DDTLY  K G+  A+KKNIDDFLVE+ GF E++AS++RVELFK +GS+LAGLRAL
Sbjct  9    LIFDLDDTLYPLKTGLAAAVKKNIDDFLVERFGFSESKASSVRVELFKTHGSTLAGLRAL  68

Query  304  GYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIK  483
            G+DV  D+YHSFVHGRLPY+ I+P+ +LR+LL  I QRKIIFTNSDR HA KVL+R+G++
Sbjct  69   GHDVSPDDYHSFVHGRLPYDAIEPNSKLRNLLHRIKQRKIIFTNSDRNHATKVLERLGLE  128

Query  484  DCFEQIICFETMNPNLSRSSRPDE-FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRN  660
            DCFE+IICFETMNP+L  S+RPD+  PVVLKP++ A++IA+  ++VDPRRTLFLDDN  N
Sbjct  129  DCFEEIICFETMNPSLFGSTRPDQRRPVVLKPSLAAIDIALRLSNVDPRRTLFLDDNVHN  188

Query  661  IAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE------EVRCSRSEMD  822
            +AAG +VGLRT LVG + KTKE+DYA+E VTE+   +PEIW  E       +R S+SE+D
Sbjct  189  VAAGKSVGLRTVLVGRSEKTKEADYAVEIVTEIATAVPEIWSAEMDGRDQRIRRSKSELD  248

Query  823  SY-LATTSVGA  852
            +   A T+VGA
Sbjct  249  AMSTAITAVGA  259



>ref|XP_008357036.1| PREDICTED: uncharacterized protein C24B11.05-like [Malus domestica]
Length=207

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = +1

Query  124  IIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRAL  303
            IIFD+DDTLY S +G+G+A KKNIDDFLVEKCGFP ++AS+LRVELFKKYGSSLAGLRAL
Sbjct  13   IIFDLDDTLYPSNLGLGEACKKNIDDFLVEKCGFPVSKASSLRVELFKKYGSSLAGLRAL  72

Query  304  GYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIK  483
            GYD+DAD+YH  VHGRLPY+ IKPDP+LR+LLRSI QRKIIFTNSDR HA+KVL+R+G+ 
Sbjct  73   GYDIDADDYHGVVHGRLPYDRIKPDPQLRNLLRSIAQRKIIFTNSDRKHAVKVLERLGVV  132

Query  484  DCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNI  663
            +CF+QIICFETMNPNL  S+RPDEFPVVLKP++EAM IA+  ADVDPRRTLFLDDN RN+
Sbjct  133  ECFDQIICFETMNPNLPSSTRPDEFPVVLKPSIEAMEIALRAADVDPRRTLFLDDNVRNV  192

Query  664  AAGNAVGLRTALV  702
            AAG AVG RT LV
Sbjct  193  AAGKAVGFRTVLV  205



>gb|KHG28233.1| putative C24B11.05 [Gossypium arboreum]
Length=262

 Score =   320 bits (821),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 155/244 (64%), Positives = 191/244 (78%), Gaps = 9/244 (4%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPF+ ++FD+DDTLY S  GI Q +KKNIDDFL+EKCG   T+AS LRVELFK YGS+LA
Sbjct  3    SPFNCLLFDLDDTLYPSSTGIAQGIKKNIDDFLIEKCGMSVTKASNLRVELFKTYGSTLA  62

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+DAD+YH FVHGRL Y++IKPDP+L SLLRSI QRKIIFTNSDRVHA+KV+ 
Sbjct  63   GLRALGYDIDADDYHDFVHGRLSYDVIKPDPQLCSLLRSITQRKIIFTNSDRVHAVKVMK  122

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+GI+DCF+QIICFET+NPNLS S       VVLKP+ +A+ IA+  A VDP RTLFLDD
Sbjct  123  RLGIEDCFDQIICFETLNPNLSESK-----CVVLKPSTDAIKIALHVARVDPPRTLFLDD  177

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRS----E  816
            N +NI+AG  +GL T LVG + + KE+DYA+E+V  +  VIPEIW  ++    RS    E
Sbjct  178  NVQNISAGKTLGLWTCLVGKSGEGKEADYAIEEVKNLGDVIPEIWVNKQDGGDRSRSELE  237

Query  817  MDSY  828
            +D +
Sbjct  238  LDQF  241



>gb|KCW60795.1| hypothetical protein EUGRSUZ_H03532 [Eucalyptus grandis]
Length=196

 Score =   317 bits (812),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            M+S  KS R+SSSPFD+++FD+DDTLYSSK GIG++LKKNIDDFLVE+CGF   +AS+LR
Sbjct  1    MESCSKSARESSSPFDSLLFDLDDTLYSSKTGIGESLKKNIDDFLVERCGFALDKASSLR  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            VELFKKYGSSLAGLRALGYDVDAD+YHS VHGRLPY+LIKPDP+LR+LLRS  QRKIIFT
Sbjct  61   VELFKKYGSSLAGLRALGYDVDADDYHSVVHGRLPYHLIKPDPQLRNLLRSTAQRKIIFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            NSDR HAMK L R+G++DCF+QI+CFETMNPNLS ++RPDEFPVVLKP+ EAM IA+   
Sbjct  121  NSDRTHAMKALKRLGVEDCFDQIVCFETMNPNLSEAARPDEFPVVLKPSPEAMQIALRET  180

Query  613  DVDPRRTLFLDD  648
             VDPRRTLFLDD
Sbjct  181  RVDPRRTLFLDD  192



>ref|XP_003535653.1| PREDICTED: uncharacterized protein C24B11.05, partial [Glycine 
max]
Length=245

 Score =   318 bits (815),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/245 (61%), Positives = 189/245 (77%), Gaps = 6/245 (2%)
 Frame = +1

Query  136  MDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRALGYDV  315
            +DDTLY S  GI + +KKNI  FL++KCGF E++A   RVELFK YGS+LAGLRA G D+
Sbjct  1    LDDTLYPSSTGIDKCVKKNIQLFLIQKCGFSESKALTQRVELFKTYGSTLAGLRAQGLDI  60

Query  316  DADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIKDCFE  495
             A++YH FVHGRLPY+ I  D +LR+LL SI QRKI+FTNSDR+HAM+ LDR+G+KDCFE
Sbjct  61   TAEDYHGFVHGRLPYDSIDTDHQLRNLLLSIKQRKIVFTNSDRIHAMRALDRLGVKDCFE  120

Query  496  QIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGN  675
            QIICFET+NPNL  S+RPDEFP++LKP+++A  IA+D A+VDPRRTLFLDD+ RNIAAG 
Sbjct  121  QIICFETINPNLPYSTRPDEFPILLKPSLDAFKIALDAANVDPRRTLFLDDSVRNIAAGK  180

Query  676  AVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE------EVRCSRSEMDSYLAT  837
             +GL T LVG   K+K +DYA+E V  + QVIPEIW  E       +  S+SE+++ LA 
Sbjct  181  EMGLHTVLVGKTMKSKGADYAVESVHNLAQVIPEIWANEMDGGDPTMTRSKSELEAVLAC  240

Query  838  TSVGA  852
              VGA
Sbjct  241  ALVGA  245



>gb|AES62657.2| haloacid dehalogenase-like hydrolase [Medicago truncatula]
Length=241

 Score =   316 bits (809),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 174/210 (83%), Gaps = 0/210 (0%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            + R+  SPFD IIFD+DDTLY S  GIG A+KKNID FL+EKCGF +++AS LRVELFK 
Sbjct  2    AFRNKPSPFDCIIFDLDDTLYPSNTGIGAAVKKNIDLFLMEKCGFSQSKASTLRVELFKS  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            +GS+LAGLRALGYD+ A+EYH FVHGRLPY LIKPD +LR+LLRSINQRKIIFTNSDR+H
Sbjct  62   HGSTLAGLRALGYDITAEEYHGFVHGRLPYELIKPDIQLRNLLRSINQRKIIFTNSDRIH  121

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            A++ LDR+GI DCFEQIICFET+NPNL  S+RPDEFPV+LKP+ +A  IA+  A+VDPR 
Sbjct  122  ALRALDRLGITDCFEQIICFETLNPNLPNSTRPDEFPVLLKPSPDAFKIAIQAANVDPRH  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKT  720
            TLFLDD+ RNI AG  +GL T LV   TK 
Sbjct  182  TLFLDDSVRNIIAGKEMGLHTVLVILLTKV  211



>ref|XP_007143241.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
 gb|ESW15235.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
Length=301

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 172/197 (87%), Gaps = 0/197 (0%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPFDAIIFD+DDTLY S  GI + +K+NI+ FL+EKCGF E++A+ LRVELFK YGS+LA
Sbjct  80   SPFDAIIFDLDDTLYPSTTGIDRCVKRNIELFLIEKCGFSESKAAHLRVELFKTYGSTLA  139

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ A+EYHSFVHGRLPY+ IKPD +LR+LL +I QRKI+FTNSDR+HAM+ LD
Sbjct  140  GLRALGYDITAEEYHSFVHGRLPYDSIKPDVQLRNLLCTIKQRKIVFTNSDRIHAMRALD  199

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            R+GI DCFEQ+ICFET+NPNL  S+RPDEFPV+LKP+++A  IA+D A+V+PRRTLFLDD
Sbjct  200  RLGISDCFEQVICFETINPNLPNSTRPDEFPVLLKPSLDAFRIALDAANVEPRRTLFLDD  259

Query  649  NTRNIAAGNAVGLRTAL  699
            + RNIAAG  +GL+T L
Sbjct  260  SVRNIAAGREMGLQTVL  276



>ref|XP_008801711.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103715749 
[Phoenix dactylifera]
Length=273

 Score =   291 bits (744),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 186/265 (70%), Gaps = 17/265 (6%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            S FD ++ D+DDTLYSS +GI QA K+NI++FL  KCG    +A +LRVELF+ YGSSLA
Sbjct  9    SSFDCLLIDLDDTLYSSSLGIAQACKRNIEEFLAAKCGVSAEKACSLRVELFRSYGSSLA  68

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GL ALGYDV  DEYHSFVHG LPY  I PDP+LR LL SI Q KI+FTNSDR H  +VL+
Sbjct  69   GLIALGYDVHPDEYHSFVHGLLPYERISPDPQLRELLLSIPQAKIMFTNSDRKHVKRVLE  128

Query  469  RIGI-KDCFEQIICFETMNPNL-------SRSSRPDEFP-VVLKPAMEAMNIAVDFADVD  621
             +GI ++CF++I+CFET+NP+L       S   RP   P V+LKP++ A+  AV  A  D
Sbjct  129  GLGIEEECFDRIVCFETLNPHLFDTKEESSTLPRPPATPEVILKPSITAVETAVRLAGFD  188

Query  622  PRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVR  801
            PRR LFLDD+ RNIAAG AVGLRTALVG   KTK +DY++E +  + Q IPEIW E+E +
Sbjct  189  PRRALFLDDSERNIAAGKAVGLRTALVGKRVKTKAADYSLESIMNLSQAIPEIWGEKEKK  248

Query  802  --------CSRSEMDSYLATTSVGA  852
                      RSE+DS  +TT + A
Sbjct  249  KGTLDDGLAVRSELDSVRSTTPIEA  273



>gb|EAY91536.1| hypothetical protein OsI_13169 [Oryza sativa Indica Group]
Length=276

 Score =   287 bits (735),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/272 (53%), Positives = 188/272 (69%), Gaps = 20/272 (7%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            S   +SSPFD ++FD+DDTLY    GIG A K+NID+FL+ +CG     A+ALRVELF+ 
Sbjct  3    STAAASSPFDCVLFDLDDTLYPGSAGIGLATKRNIDEFLMARCGVTAERAAALRVELFRS  62

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YGSSLAGL ALGYDV  DEYHS+VHGRLPY+ I  DP+L  LLRSI QRKI+FTNSDR H
Sbjct  63   YGSSLAGLIALGYDVHPDEYHSYVHGRLPYDRIAADPQLAGLLRSIPQRKILFTNSDRAH  122

Query  451  AMKVLDRIGI-KDCFEQIICFETMNPNL---SRSSRPDEFP-VVLKPAMEAMNIAVDFAD  615
              K L R+G+ + CF+ ++CFETMNP+L   +  +  D+ P V+LKP+ +A+  A+  A 
Sbjct  123  MRKALQRLGVDEGCFDAVVCFETMNPHLFGEAPCASGDDRPGVILKPSPDAIVAALRIAG  182

Query  616  VDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW----  783
             +P RTLFLDD+ RNIAAG A+GLRTALVG   ++KE+DYA+E +  + + IPEIW    
Sbjct  183  TNPHRTLFLDDSERNIAAGKALGLRTALVGKRVRSKEADYALESIGSLRRAIPEIWGGVA  242

Query  784  -----------FEEEVRCSRSEMDSYLATTSV  846
                         E+ +  RS++DS +  TSV
Sbjct  243  VAAAGEQLDHGAAEKTKGMRSDLDSIIQPTSV  274



>ref|XP_009396379.1| PREDICTED: uncharacterized protein LOC103981383 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=288

 Score =   285 bits (730),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 188/272 (69%), Gaps = 20/272 (7%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R S SPFD ++ D+DDTLYSS +GI QA KKNI+DFL  KCG  E  ASALRVE F+ +G
Sbjct  17   RGSKSPFDCLLLDLDDTLYSSTIGIRQACKKNIEDFLASKCGVSEGRASALRVEHFRSHG  76

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            SSLAGL ALGYDV  DEYHSFVHGRLPY LI+PD  LR LL SI Q KI+FTNSDR HA 
Sbjct  77   SSLAGLLALGYDVHPDEYHSFVHGRLPYELIRPDAGLRELLLSIPQPKILFTNSDRQHAR  136

Query  457  KVLDRIGI-KDCFEQIICFETMNPNLSRSSR----PDEFP------VVLKPAMEAMNIAV  603
            + L R+G+ +DCF +IICFETMNP+L +  R        P      V+LKP+  AM +AV
Sbjct  137  RTLRRLGVEEDCFHRIICFETMNPHLFKDEREAGSSGPLPATRNVEVILKPSAAAMKMAV  196

Query  604  DFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
              A   P RTLF+DDN RNIAAG A+GLRTALVG   +TKE DY ++ ++E+ QVIPEIW
Sbjct  197  WLAGFAPHRTLFVDDNERNIAAGKAIGLRTALVGKRERTKEDDYLLDSISELRQVIPEIW  256

Query  784  FEEE---------VRCSRSEMDSYLATTSVGA  852
             E+E         V   R ++DS   TT +GA
Sbjct  257  GEQEKKGGGEHGAVTTMRRDLDSIRETTPIGA  288



>ref|NP_001050999.1| Os03g0701200 [Oryza sativa Japonica Group]
 gb|AAX95646.1| HAD-superfamily hydrolase, subfamily IA, variant 3, putative 
[Oryza sativa Japonica Group]
 gb|ABF98404.1| Phosphatase, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12913.1| Os03g0701200 [Oryza sativa Japonica Group]
 gb|EAZ28273.1| hypothetical protein OsJ_12245 [Oryza sativa Japonica Group]
 dbj|BAG87985.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94196.1| unnamed protein product [Oryza sativa Japonica Group]
Length=276

 Score =   280 bits (716),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/272 (52%), Positives = 185/272 (68%), Gaps = 20/272 (7%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            S   +SSPFD ++FD+DDTLY    GIG A K+NID+FL+ +CG     A+ALRVELF+ 
Sbjct  3    STAAASSPFDCVLFDLDDTLYPGSAGIGLATKRNIDEFLMARCGVTAERAAALRVELFRS  62

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YGSSLAGL ALGYDV  DEYHS+VHGRLPY+ I  DP+L  LLRSI QRKI+FTNSDR H
Sbjct  63   YGSSLAGLIALGYDVHPDEYHSYVHGRLPYDRIAADPQLAGLLRSIPQRKILFTNSDRAH  122

Query  451  AMKVLDRIGI-KDCFEQIICFETMNPNL---SRSSRPDEFP-VVLKPAMEAMNIAVDFAD  615
              K L R+ + + CF+ ++CFETMNP+L   +  +  D+ P V+LKP+ +A+  A+  A 
Sbjct  123  MRKALQRLSVDEGCFDAVVCFETMNPHLFGEAPCASGDDRPGVILKPSPDAIVAALRIAG  182

Query  616  VDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW----  783
             +P RTLFLDD+ RNIAAG A+ LRT LVG   ++KE+DYA+E +  + + IPEIW    
Sbjct  183  TNPHRTLFLDDSERNIAAGKALSLRTVLVGKRVRSKEADYALESIGSLRRAIPEIWGGVA  242

Query  784  -----------FEEEVRCSRSEMDSYLATTSV  846
                         E+ +  RS++DS +  TSV
Sbjct  243  VAVAGEQLDHGAAEKTKGMRSDLDSIIQPTSV  274



>ref|XP_006650447.1| PREDICTED: uncharacterized protein C24B11.05-like [Oryza brachyantha]
Length=273

 Score =   280 bits (715),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/234 (56%), Positives = 170/234 (73%), Gaps = 7/234 (3%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +SSPFD ++ D+DDTLY    GIG A K+NID+FL+ +CG     A+ALRVELF+ YGSS
Sbjct  7    TSSPFDCVLLDLDDTLYPGSAGIGLATKRNIDEFLMARCGATAERAAALRVELFRSYGSS  66

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            LAGL ALGYDV  DEYHS+VHGRLPY+ I  DP+L  LLRSI QRK++FTNSDR H  + 
Sbjct  67   LAGLIALGYDVHPDEYHSYVHGRLPYDRIAEDPQLAGLLRSIPQRKVLFTNSDRAHMRRA  126

Query  463  LDRIGI-KDCFEQIICFETMNPNLSRSSRP------DEFPVVLKPAMEAMNIAVDFADVD  621
            L R+G+ + CF+ ++CFETMNP+L     P      D   V+LKP+ +A+  A+  A  +
Sbjct  127  LQRLGVDEGCFDAVVCFETMNPHLFGEQAPCDCSGVDRSAVILKPSPDAIVAALRVAGTN  186

Query  622  PRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            P RTLFLDD+ RNIAAG A+GLRTALVG   ++KE+DYA+E +  + + IPEIW
Sbjct  187  PHRTLFLDDSERNIAAGKALGLRTALVGKRVRSKEADYALESIGSLRRAIPEIW  240



>ref|XP_003560896.1| PREDICTED: suppressor of disruption of TFIIS [Brachypodium distachyon]
Length=273

 Score =   277 bits (708),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 182/263 (69%), Gaps = 16/263 (6%)
 Frame = +1

Query  112  PFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAG  291
            PFD ++ D+DDTLY    GIG ALK+NID+FL+ + G     A+ALRVELF+ +GS+LAG
Sbjct  11   PFDCLLIDLDDTLYPGGTGIGPALKRNIDEFLMARYGLAADTAAALRVELFRTHGSTLAG  70

Query  292  LRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDR  471
            L ALGYDV  DEYHS+VHGRLPY+ I  DP L  LL+SI QRKI+FTNSDR H  + L+R
Sbjct  71   LIALGYDVHPDEYHSYVHGRLPYDRIAADPRLALLLQSIPQRKILFTNSDRAHMERALER  130

Query  472  IGIKD-CFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            +G+ + CF+ ++CFETMNP+L      D   VVLKP+++A+ + +  A  +PRRTLFLDD
Sbjct  131  LGVDEACFDDVVCFETMNPHLFGGDGQDRTDVVLKPSVDAILVGLRVAGTNPRRTLFLDD  190

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWF--------------  786
            + RNIAAG A+GLRTALVG   ++KE+DYA+E +  + + IPEIW               
Sbjct  191  SERNIAAGKALGLRTALVGKRVRSKEADYALETIGSLQRAIPEIWGVAAGAVDGELQPDH  250

Query  787  -EEEVRCSRSEMDSYLATTSVGA  852
              E+ +  R+E+DS +  TS+ A
Sbjct  251  NVEKNKSMRAELDSVIQPTSIQA  273



>ref|XP_007143243.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
 gb|ESW15237.1| hypothetical protein PHAVU_007G056000g [Phaseolus vulgaris]
Length=258

 Score =   276 bits (706),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 155/176 (88%), Gaps = 0/176 (0%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPFDAIIFD+DDTLY S  GI + +K+NI+ FL+EKCGF E++A+ LRVELFK YGS+LA
Sbjct  80   SPFDAIIFDLDDTLYPSTTGIDRCVKRNIELFLIEKCGFSESKAAHLRVELFKTYGSTLA  139

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ A+EYHSFVHGRLPY+ IKPD +LR+LL +I QRKI+FTNSDR+HAM+ LD
Sbjct  140  GLRALGYDITAEEYHSFVHGRLPYDSIKPDVQLRNLLCTIKQRKIVFTNSDRIHAMRALD  199

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            R+GI DCFEQ+ICFET+NPNL  S+RPDEFPV+LKP+++A  IA+D A+V+PRRT+
Sbjct  200  RLGISDCFEQVICFETINPNLPNSTRPDEFPVLLKPSLDAFRIALDAANVEPRRTV  255



>gb|KDO74645.1| hypothetical protein CISIN_1g025190mg [Citrus sinensis]
Length=191

 Score =   273 bits (699),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 153/176 (87%), Gaps = 0/176 (0%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            SPF+ ++FD+DDTLY S+ GI  A+K+NI+ FL+EKCGF ET+AS+LRVELFK YGS+LA
Sbjct  3    SPFNCLVFDLDDTLYPSETGIAAAVKRNIEGFLIEKCGFSETKASSLRVELFKAYGSTLA  62

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRALGYD+ AD+YH FVHGRLPY+LIKPDP+LR+LL SI QRKIIFTNSDR HA+  L 
Sbjct  63   GLRALGYDIGADDYHGFVHGRLPYDLIKPDPQLRNLLCSITQRKIIFTNSDRNHAITCLK  122

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            R+ I DCF+QIICFETMNPNLS+++RPDEFPV+LKP+M+AM +A+  A+VDPR  +
Sbjct  123  RLEIADCFDQIICFETMNPNLSKATRPDEFPVLLKPSMDAMKLALHVANVDPRHAV  178



>ref|NP_001136893.1| phosphatase [Zea mays]
 gb|ACF82831.1| unknown [Zea mays]
 gb|ACG36562.1| phosphatase [Zea mays]
 gb|ACL52915.1| unknown [Zea mays]
 tpg|DAA50849.1| TPA: phosphatase [Zea mays]
Length=269

 Score =   273 bits (699),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/237 (56%), Positives = 172/237 (73%), Gaps = 2/237 (1%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++SPFD ++ D+DDTLY    GIG AL++NID+FL  K G    EA+A R ELF+ +GSS
Sbjct  3    ATSPFDCVLLDLDDTLYPGDTGIGAALRRNIDEFLQAKLGVSADEAAATRAELFRAHGSS  62

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            LAGL ALGYDV  DEYHS+VHGRLPY+ I  DP+L  LL+SI QRK++FTNSDR H  + 
Sbjct  63   LAGLIALGYDVHPDEYHSYVHGRLPYDRIARDPQLARLLQSIPQRKVLFTNSDRAHMERA  122

Query  463  LDRIGIKD-CFEQIICFETMNPNLSRSSRPDEFP-VVLKPAMEAMNIAVDFADVDPRRTL  636
            L+R+G+ +  F+ ++CFETMNP+L      D  P VVLKPA++A+   +  A  +PRRTL
Sbjct  123  LERLGVDEAAFDAVVCFETMNPHLFGDDGGDRRPAVVLKPAVDAIVAGLRAAGSNPRRTL  182

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCS  807
            FLDD+ RNIAAG A+GLRTALVG   ++KE+DYA+E +  + + IPEIW E   R S
Sbjct  183  FLDDSERNIAAGKALGLRTALVGKRARSKEADYAVESIGALRRAIPEIWGEAAERSS  239



>gb|ABK22916.1| unknown [Picea sitchensis]
Length=264

 Score =   272 bits (696),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 134/263 (51%), Positives = 178/263 (68%), Gaps = 12/263 (5%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            +  S+  FD ++FD+DDTLY S  GI  A +KNID+FL +  GF      +LR + +K  
Sbjct  1    MEQSTPQFDCLLFDLDDTLYPSSTGIATACRKNIDEFLAQVFGFSREVVPSLRTQFYKTN  60

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            GS+LAGLR LGY+VDADEYHSFVHG LPY  IK DP LRS+L S+ QRK+IFTNSD+ HA
Sbjct  61   GSTLAGLRKLGYEVDADEYHSFVHGNLPYEAIKKDPALRSILMSMPQRKLIFTNSDKTHA  120

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEF-----PVVLKPAMEAMNIAVDFADV  618
             KVL R+G++DCFE +ICFE++N     + + DE      PV +KP++EAM  A+  A+V
Sbjct  121  CKVLTRLGLEDCFEDVICFESLNMAYPFNQQTDECNPSTSPVFIKPSIEAMKRAITIANV  180

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE--E  792
            DP+RTLF DDN RNIA     GL T LVG++ K + +DYA+E +  M Q IPEIW E  +
Sbjct  181  DPQRTLFFDDNVRNIAGAKEAGLNTILVGSSVKNEGADYALESIHNMRQAIPEIWIETTK  240

Query  793  EVRCSR-----SEMDSYLATTSV  846
             + C +     +E++S  AT +V
Sbjct  241  YIGCDKFGGSITEVNSIEATPTV  263



>ref|XP_009395583.1| PREDICTED: uncharacterized protein LOC103980802 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=270

 Score =   271 bits (694),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 149/265 (56%), Positives = 184/265 (69%), Gaps = 15/265 (6%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            S SPFD ++ D+DDTLYS  +GIGQA K+NI++FL  KCG     A  LRVE F+ +GSS
Sbjct  6    SRSPFDCLLLDLDDTLYSPTIGIGQACKRNIEEFLAGKCGVSAERACTLRVEHFRNHGSS  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            LAGL  LG+DV  DEYHSFVHGRLPY LI+P+ ELR LL SI Q KI+FTNSDR HA + 
Sbjct  66   LAGLLDLGHDVHPDEYHSFVHGRLPYELIQPEAELRELLGSITQPKILFTNSDRQHAKRA  125

Query  463  LDRIGI-KDCFEQIICFETMNPNLSRSSRP-DEFP-VVLKPAMEAMNIAVDFADVDPRRT  633
            L R+GI ++CF +IICFETMNP+L    R   + P VVLKP+ +AM  AV  A   P RT
Sbjct  126  LQRLGIEEECFHRIICFETMNPHLFGDEREVSKTPEVVLKPSAKAMETAVRLAGFPPHRT  185

Query  634  LFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE------  795
            LF+DD+ RNIAAG A+GLRTALVG   KTKE+DY ++ +  + Q+IPEIW E+E      
Sbjct  186  LFVDDSERNIAAGKAIGLRTALVGKREKTKEADYLLDNICALRQLIPEIWGEQEKVEAGG  245

Query  796  ------VRCSRSEMDSYLATTSVGA  852
                     +R E+DS  ATT +GA
Sbjct  246  EHGVTTTTTTRPELDSIRATTIIGA  270



>ref|XP_009411270.1| PREDICTED: uncharacterized protein LOC103993065 [Musa acuminata 
subsp. malaccensis]
Length=274

 Score =   271 bits (694),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 188/275 (68%), Gaps = 23/275 (8%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            ++R  +SPFD ++ D+DDTLYSS +GI QA +KNI++FL  KCG     A +LRVELF+ 
Sbjct  2    ALRGLNSPFDCLLLDLDDTLYSSTIGIAQACRKNIEEFLAFKCGISAERAFSLRVELFRS  61

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YGSSLAGL ALGYDV  DEYHS+VHGRLPY LIKPD ELR LL  I Q KI+FTNSDR H
Sbjct  62   YGSSLAGLIALGYDVHPDEYHSYVHGRLPYELIKPDAELRELLLGIPQTKILFTNSDRQH  121

Query  451  AMKVLDRIGIKD-CFEQIICFETMNPNL------SRSSRPDEFP------VVLKPAMEAM  591
            A + L R+GI++ CF +IICFETMNP+L      + SS P   P      V+LKP+  AM
Sbjct  122  ARRALQRLGIEEGCFRRIICFETMNPHLFGDEIGANSSPP--LPAVATPEVILKPSAPAM  179

Query  592  NIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVI  771
             +AV  A   P RTLF+DD+ RNIAAG A GLRTALVG   KTKE+DY ++ ++ + QV+
Sbjct  180  EMAVRLAGFGPHRTLFVDDSERNIAAGKAAGLRTALVGKRVKTKEADYLLDSISRLKQVV  239

Query  772  PEIWFEEEVR--------CSRSEMDSYLATTSVGA  852
            PEIW   E+           RS++DS   T  VGA
Sbjct  240  PEIWRGLEMERGGDHGATAMRSDLDSIRPTYPVGA  274



>ref|XP_009396378.1| PREDICTED: uncharacterized protein LOC103981383 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=314

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 157/298 (53%), Positives = 188/298 (63%), Gaps = 46/298 (15%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R S SPFD ++ D+DDTLYSS +GI QA KKNI+DFL  KCG  E  ASALRVE F+ +G
Sbjct  17   RGSKSPFDCLLLDLDDTLYSSTIGIRQACKKNIEDFLASKCGVSEGRASALRVEHFRSHG  76

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            SSLAGL ALGYDV  DEYHSFVHGRLPY LI+PD  LR LL SI Q KI+FTNSDR HA 
Sbjct  77   SSLAGLLALGYDVHPDEYHSFVHGRLPYELIRPDAGLRELLLSIPQPKILFTNSDRQHAR  136

Query  457  KVLDRIGI-KDCFEQIICFETMNPNLSRSSR----PDEFP------VVLKPAMEAMNIAV  603
            + L R+G+ +DCF +IICFETMNP+L +  R        P      V+LKP+  AM +AV
Sbjct  137  RTLRRLGVEEDCFHRIICFETMNPHLFKDEREAGSSGPLPATRNVEVILKPSAAAMKMAV  196

Query  604  DFADVDPRRTLFLDDNTRNIAAGNAVGLRTAL--------------------------VG  705
              A   P RTLF+DDN RNIAAG A+GLRTAL                          VG
Sbjct  197  WLAGFAPHRTLFVDDNERNIAAGKAIGLRTALVIPPPSPSPAFLGDSYIEQSHVLFLKVG  256

Query  706  TATKTKESDYAMEKVTEMVQVIPEIWFEEE---------VRCSRSEMDSYLATTSVGA  852
               +TKE DY ++ ++E+ QVIPEIW E+E         V   R ++DS   TT +GA
Sbjct  257  KRERTKEDDYLLDSISELRQVIPEIWGEQEKKGGGEHGAVTTMRRDLDSIRETTPIGA  314



>gb|ABK23515.1| unknown [Picea sitchensis]
Length=296

 Score =   269 bits (688),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 130/265 (49%), Positives = 176/265 (66%), Gaps = 12/265 (5%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            +  S+  FD ++FD+DDTLY S  GI  A +KNID+FL +  GF      +LR + +K  
Sbjct  1    MEQSTLQFDCLLFDLDDTLYPSSTGIATACRKNIDEFLAQVFGFSREVVPSLRTQFYKTN  60

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            GS+LAGLR LGY+VDADEYHSFVHG LPY +I+ DP LRS+L S+ QRK++FTNSD++HA
Sbjct  61   GSTLAGLRKLGYEVDADEYHSFVHGNLPYEVIEADPALRSILMSMPQRKLVFTNSDKIHA  120

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEF-----PVVLKPAMEAMNIAVDFADV  618
             K L R+G++DCFE IICFE++N     + + DE      PV +KP++EAM  A+  A+V
Sbjct  121  CKALKRLGLEDCFEDIICFESLNMAYPFNQQIDECKPSTSPVFIKPSIEAMKRAITIANV  180

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEV  798
            DP+RTLF DDN RNIA     GL T LVG++ K + +DYA+E +  + +VIPEIW E   
Sbjct  181  DPQRTLFFDDNVRNIAGAKEAGLNTVLVGSSVKNEGADYALESIHNVREVIPEIWIETTK  240

Query  799  RCSRSEMDSYLATTSVGA*SIHSLQ  873
                 E  S +A        +HS++
Sbjct  241  YVGCDEFGSSIA-------EVHSIE  258



>gb|ABR17203.1| unknown [Picea sitchensis]
Length=296

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/265 (49%), Positives = 175/265 (66%), Gaps = 12/265 (5%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            +  S+  FD ++FD+DDTLY S  GI  A +KNID+FL +  GF      +LR + +K  
Sbjct  1    MEQSTLQFDCLLFDLDDTLYPSSTGIATACRKNIDEFLAQVFGFSREVVPSLRTQFYKTN  60

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            GS+LAGLR LGY+VDADEYHSFVHG LPY +I+ DP LRS+L S+ QRK++FTNSD++HA
Sbjct  61   GSTLAGLRKLGYEVDADEYHSFVHGNLPYEVIEADPALRSILMSMPQRKLVFTNSDKIHA  120

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEF-----PVVLKPAMEAMNIAVDFADV  618
             K L R+G++DCFE IICFE++N     + + DE      PV +KP++EAM  A+  A+V
Sbjct  121  CKALKRLGLEDCFEDIICFESLNMAYPFNQQIDECKPSTSPVFIKPSIEAMKRAITIANV  180

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEV  798
            DP+RTLF DDN RNIA     GL T LVG++ K + +DYA+  +  + +VIPEIW E   
Sbjct  181  DPQRTLFFDDNVRNIAGAKEAGLNTVLVGSSVKNEGADYALGSIHNVREVIPEIWIETTK  240

Query  799  RCSRSEMDSYLATTSVGA*SIHSLQ  873
                 E  S +A        +HS++
Sbjct  241  YIGCDEFGSSIA-------EVHSIE  258



>ref|XP_004982074.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X4 
[Setaria italica]
Length=274

 Score =   265 bits (677),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/235 (53%), Positives = 171/235 (73%), Gaps = 8/235 (3%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++SPFD ++ D+DDTLY    G+G AL++NID+FL  K G     A+A+RVELF+ +GSS
Sbjct  3    ANSPFDCVLLDLDDTLYPGDTGLGPALRRNIDEFLQAKLGVSAERAAAMRVELFRTHGSS  62

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            LAGL ALGYDV  DEYHS+VHG LPY++I  DP+L   L+SI QRK++FTNSDR H  + 
Sbjct  63   LAGLIALGYDVHPDEYHSYVHGMLPYDMIAADPQLARTLQSIPQRKVLFTNSDRAHMKRA  122

Query  463  LDRIGIKDC-FEQIICFETMNPNLSRSSRPDEFP-------VVLKPAMEAMNIAVDFADV  618
            L+R+G+ +  F+ ++CFETMNP+L   +R +E         VVLKP+++A+   +  A  
Sbjct  123  LERLGVDEAVFDDVVCFETMNPHLFGEAREEERAAGGDPPVVVLKPSVDAIVAGLRVAGT  182

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            +PRRTLFLDD+ RNIAAG A+GLRTALVG   ++KE+DYA+E +  + + IPEIW
Sbjct  183  NPRRTLFLDDSERNIAAGKALGLRTALVGKRVRSKEADYALESIGALRRAIPEIW  237



>gb|ABK21362.1| unknown [Picea sitchensis]
 gb|ABK23523.1| unknown [Picea sitchensis]
Length=276

 Score =   261 bits (666),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/264 (47%), Positives = 180/264 (68%), Gaps = 11/264 (4%)
 Frame = +1

Query  88   KSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFK  267
            + V D    +D ++FD+DDTLY    G+  A   NI D++ +K G  ++    L  EL+K
Sbjct  7    RRVTDQRPRYDCLLFDLDDTLYPLSSGLAAACTNNIGDYVNQKLGVEKSRVPDLSRELYK  66

Query  268  KYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRV  447
             YG+++AGLRA+GY+ D D+YHSFVHGRLPY  +KPDP L++LL S+ QRKIIFTNSD+V
Sbjct  67   TYGTTMAGLRAIGYEFDYDDYHSFVHGRLPYENLKPDPVLKNLLLSMPQRKIIFTNSDKV  126

Query  448  HAMKVLDRIGIKDCFEQIICFETMN-PNLSRS----------SRPDEFPVVLKPAMEAMN  594
            HA KVL+R+G++DCFE IICFET+N PN++ S          S   + P++ KPA EAM 
Sbjct  127  HAAKVLNRLGLEDCFEGIICFETLNPPNITESNNEWGMPTVNSTVPKTPIICKPAKEAME  186

Query  595  IAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIP  774
             A+  A+ DP+RT+F DD+ RNIAAG   GL T LVGT+ +T+ +D+A+E +  + + +P
Sbjct  187  QALRLANADPQRTIFFDDSPRNIAAGKCAGLHTVLVGTSVRTEGADFALESIHNIREALP  246

Query  775  EIWFEEEVRCSRSEMDSYLATTSV  846
            EIW EE+   +++ + S  A  ++
Sbjct  247  EIWEEEDTESAKNVVRSRGAGATI  270



>dbj|BAJ97807.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=274

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 184/270 (68%), Gaps = 24/270 (9%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            +SPFD ++ D+DDTLY    GIG AL++NID+FLV + G    +A+ALR +LF+ +GS+L
Sbjct  8    TSPFDCLLIDLDDTLYPGNTGIGPALRRNIDEFLVARFGLAADKAAALRADLFRSHGSTL  67

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL ALG+DV  DEYHS+VHGRLPY++I  DP+L + L+S+ QRKI+FTNSDR H  + L
Sbjct  68   AGLIALGHDVHPDEYHSYVHGRLPYDVIAADPQLAAALQSMPQRKILFTNSDRAHMRRSL  127

Query  466  DRIGIKDC-FEQIICFETMNPNL--------SRSSRPDEFPVVLKPAMEAMNIAVDFADV  618
            +R+G+ +  F+ ++CFETMNPNL            RP    VVLKP++ A   A+  A  
Sbjct  128  ERLGLDEALFDGVVCFETMNPNLFGEDAKDDDDVDRP---AVVLKPSVHAFATALRVAGT  184

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE---  789
            +PRRTLFLDDN RNIA+G A+GLRTALVG   ++KE+DYA+E +  + + IPEIW     
Sbjct  185  NPRRTLFLDDNERNIASGKALGLRTALVGKRARSKEADYALETIGGLRRAIPEIWGGAAD  244

Query  790  ---------EEVRCSRSEMDSYLATTSVGA  852
                     E+ +  R+E+D+ +  TS+ A
Sbjct  245  GELQLDHNVEKNKSMRAELDAVIQPTSIQA  274



>dbj|BAK03247.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99569.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96839.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=270

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 133/270 (49%), Positives = 183/270 (68%), Gaps = 24/270 (9%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            +SPFD ++ D+DDTLY    GIG AL++NID+FLV + G    +A+ALR +LF+ +GS+L
Sbjct  4    NSPFDCLLIDLDDTLYPGNTGIGPALRRNIDEFLVARFGLAADKAAALRADLFRSHGSTL  63

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL ALG+DV  DEYHS+VHGRLPY++I  DP+L + L+S+ QRKI+FTNSDR H  + L
Sbjct  64   AGLIALGHDVHPDEYHSYVHGRLPYDVIAADPQLAAALQSMPQRKILFTNSDRAHMRRSL  123

Query  466  DRIGIKDC-FEQIICFETMNPNL--------SRSSRPDEFPVVLKPAMEAMNIAVDFADV  618
            +R+G+ +  F+ ++CFETMNPNL            RP    VVLKP++ A   A+  A  
Sbjct  124  ERLGLDEALFDGVVCFETMNPNLFGEDAKDDDDVDRP---AVVLKPSVHAFATALRVAGT  180

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE---  789
            +PRRTLFLDDN RNIA+G A+GLRTALVG   ++KE+DYA+E +  + + IPEIW     
Sbjct  181  NPRRTLFLDDNERNIASGKALGLRTALVGKRARSKEADYALETIGGLRRAIPEIWGGAAD  240

Query  790  ---------EEVRCSRSEMDSYLATTSVGA  852
                     E  +  R+E+D+ +  TS+ A
Sbjct  241  GELQPDHNVERNKSMRAELDAVIQPTSIQA  270



>gb|EMT22780.1| hypothetical protein F775_28925 [Aegilops tauschii]
Length=280

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 184/273 (67%), Gaps = 24/273 (9%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            SSPFD ++ D+DDTLY    GIG AL++NID+FLV + G    +A+ALR +LF+ +GS+L
Sbjct  8    SSPFDCLLIDLDDTLYPGNTGIGPALRRNIDEFLVARFGLAADKAAALRADLFRSHGSTL  67

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL ALG+DV  DEYHS+VHGRLPY++I  DP+L + L+S+ QRKI+FTNSDR H  + L
Sbjct  68   AGLIALGHDVHPDEYHSYVHGRLPYDVIAADPQLAAALQSMPQRKILFTNSDRAHMKRAL  127

Query  466  DRIGIKD-CFEQIICFETMNPNL----------SRSSRPDEFPVVLKPAMEAMNIAVDFA  612
            +R+G+ + CF+ ++CFETMNP+L            +   D   VVLKP++ A   A+  A
Sbjct  128  ERLGVDEACFDGVVCFETMNPHLFGEEAEEDEGEAADDVDRPAVVLKPSVHAFVTALRVA  187

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFE-  789
              +PRRTLFLDD+ RNIAAG A+GLRTALVG   ++KE+DYA+E V  + + +PEIW   
Sbjct  188  GTNPRRTLFLDDSERNIAAGKALGLRTALVGKRARSKEADYALETVGGLRRALPEIWGGA  247

Query  790  ------------EEVRCSRSEMDSYLATTSVGA  852
                        E+ +  R+E+D+ +  T + A
Sbjct  248  AADGELQPDHNVEKNKSMRAELDAVIQPTPIQA  280



>ref|XP_004982073.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X3 
[Setaria italica]
Length=320

 Score =   254 bits (648),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 121/225 (54%), Positives = 163/225 (72%), Gaps = 8/225 (4%)
 Frame = +1

Query  133  DMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRALGYD  312
            D+DDTLY    G+G AL++NID+FL  K G     A+A+RVELF+ +GSSLAGL ALGYD
Sbjct  59   DLDDTLYPGDTGLGPALRRNIDEFLQAKLGVSAERAAAMRVELFRTHGSSLAGLIALGYD  118

Query  313  VDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIKDC-  489
            V  DEYHS+VHG LPY++I  DP+L   L+SI QRK++FTNSDR H  + L+R+G+ +  
Sbjct  119  VHPDEYHSYVHGMLPYDMIAADPQLARTLQSIPQRKVLFTNSDRAHMKRALERLGVDEAV  178

Query  490  FEQIICFETMNPNLSRSSRPDEFP-------VVLKPAMEAMNIAVDFADVDPRRTLFLDD  648
            F+ ++CFETMNP+L   +R +E         VVLKP+++A+   +  A  +PRRTLFLDD
Sbjct  179  FDDVVCFETMNPHLFGEAREEERAAGGDPPVVVLKPSVDAIVAGLRVAGTNPRRTLFLDD  238

Query  649  NTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            + RNIAAG A+GLRTALVG   ++KE+DYA+E +  + + IPEIW
Sbjct  239  SERNIAAGKALGLRTALVGKRVRSKEADYALESIGALRRAIPEIW  283



>ref|XP_009125440.1| PREDICTED: uncharacterized protein C24B11.05-like [Brassica rapa]
 emb|CDY04846.1| BnaAnng00280D [Brassica napus]
Length=280

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 116/247 (47%), Positives = 165/247 (67%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++  +D ++FD+DDTLY    G+ +   KNI D++VEK G P+ +   L   L+K YG++
Sbjct  11   ATQKYDCLLFDLDDTLYPLSTGLARECGKNIKDYMVEKLGIPKDKIVELSNLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D DEYHSFVHGRLPY+ IKPDP LRS+L S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYDFDYDEYHSFVHGRLPYDNIKPDPVLRSILLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPD--------------------EFPVVLKPAM  582
            L ++G++DCFE IICFET+NP  + ++  +                    + P+V KP+ 
Sbjct  131  LKKLGLEDCFEGIICFETLNPTHTNAASENSEIFDIVGHFDLSEPVGSLPKTPIVCKPSE  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG+  K K +DYA+E +  M 
Sbjct  191  SAIEKALEIANIDPNRTLFFEDSVRNVQAGKRVGLHTVLVGSPNKVKGADYALENIHNMK  250

Query  763  QVIPEIW  783
            + +PE+W
Sbjct  251  EALPELW  257



>emb|CDY48102.1| BnaC02g03590D [Brassica napus]
Length=277

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/244 (48%), Positives = 164/244 (67%), Gaps = 17/244 (7%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++  +D ++FD+DDTLY    G+ +   KNI D++VEK G P+ +   L   L+K YG++
Sbjct  11   ATQKYDCLLFDLDDTLYPLSTGLARECGKNIKDYMVEKLGIPKDKIVELSNLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D DEYHSFVHGRLPY+ IKPDP LRS+L S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYDFDYDEYHSFVHGRLPYDNIKPDPVLRSILLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSRS-------------SRP----DEFPVVLKPAMEAM  591
            L ++G++DCFE IICFET+NP  + +             S P     + P+V KP   A+
Sbjct  131  LKKLGLEDCFEGIICFETLNPTHTNAASEIFDIVGHFDLSEPVGSLPKTPIVCKPCESAI  190

Query  592  NIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVI  771
              A++ A++DP RTLF +D+ RN+ AG  VGL T LVG+  K K +DYA+E +  M + +
Sbjct  191  EKALEIANIDPNRTLFFEDSVRNVQAGKRVGLHTVLVGSPNKVKGADYALENIHNMKEAL  250

Query  772  PEIW  783
            PE+W
Sbjct  251  PELW  254



>ref|XP_009419743.1| PREDICTED: phosphate metabolism protein 8-like [Musa acuminata 
subsp. malaccensis]
Length=282

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 173/268 (65%), Gaps = 22/268 (8%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI    +KNI D++ EK G  E++ S L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGIATECRKNIGDYMHEKLGIEESKISELCDVLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D D+YHSFVHGRLPYN +KPDP LR LL S+  RK++FTN D VHA +VL R+
Sbjct  75   RAVGYDFDYDDYHSFVHGRLPYNKLKPDPVLRQLLLSLPMRKVVFTNGDEVHAAEVLKRL  134

Query  475  GIKDCFEQIICFETMNPNLSRS---------------SRPD-------EFPVVLKPAMEA  588
            G++DCFE +ICFET+NP  S                 S+PD       + PV+ KP++EA
Sbjct  135  GLEDCFEGVICFETLNPPSSSCGTQTPSEIFDIVDHFSKPDTSGIELPKTPVLCKPSVEA  194

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
            M  A+  A++DP+R++F DD+ RNI +G  +GL+T LVGT+ + K +D+A+E +  + + 
Sbjct  195  MEHALRLANIDPQRSVFFDDSARNIRSGKRIGLQTVLVGTSHRVKGADHALESIHNIREA  254

Query  769  IPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            +PE+W + E   S          TSV A
Sbjct  255  LPELWEKAEKSGSIRHSGKVAMETSVTA  282



>ref|XP_008667535.1| PREDICTED: uncharacterized protein LOC100273259 isoform X1 [Zea 
mays]
 gb|ACF87875.1| unknown [Zea mays]
 gb|ACN27779.1| unknown [Zea mays]
 tpg|DAA44633.1| TPA: catalytic/ hydrolase [Zea mays]
Length=280

 Score =   248 bits (633),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 171/262 (65%), Gaps = 22/262 (8%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +KKNI+D++VEK G  ET+   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSAGIAGHVKKNIEDYMVEKLGIDETKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYH+FVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHAFVHGRLPYDNIKPDPILKHILKNLRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF  558
            TN D VHA++ L R+G++DCFE IICFET+NP                 + +RS   DE 
Sbjct  120  TNGDMVHAVRALKRLGLEDCFEGIICFETLNPPCPPQGDQEPEIFDIAGHFARSGTADEL  179

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVG + + K +
Sbjct  180  PKTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKQIGLHTVLVGKSQRVKGA  239

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +PE+W E E
Sbjct  240  DHALESIHNIREALPELWEEAE  261



>gb|ACG34520.1| catalytic/ hydrolase [Zea mays]
Length=280

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/262 (45%), Positives = 171/262 (65%), Gaps = 22/262 (8%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +KKNI+D++VEK G  ET+   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSAGIAGHVKKNIEDYMVEKLGIDETKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYH+FVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHAFVHGRLPYDNIKPDPILKHILKNLRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF  558
            TN D VHA++ L R+G++DCFE IICFET+NP                 + +RS   DE 
Sbjct  120  TNGDMVHAVRALKRLGLEDCFEGIICFETLNPPCPPQGDQEPEIFDIADHFARSGTADEL  179

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVG + + K +
Sbjct  180  PKTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKQIGLHTVLVGKSQRVKGA  239

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +PE+W E E
Sbjct  240  DHALESIHNIREALPELWEEAE  261



>ref|XP_002320927.1| haloacid dehalogenase-like hydrolase family protein [Populus 
trichocarpa]
 gb|EEE99242.1| haloacid dehalogenase-like hydrolase family protein [Populus 
trichocarpa]
Length=261

 Score =   247 bits (631),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 113/257 (44%), Positives = 176/257 (68%), Gaps = 6/257 (2%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +   ++ ++FDMDDTLY   +G+  A +KNI++F++ K    E+E   + +EL++++G
Sbjct  6    RANGPKYECLLFDMDDTLYPMSLGLNLACRKNIEEFMLHKLHIEESEVPRMCLELYREHG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ LGY+ D DE+H+FVHGRLPY  +KPDP LR+LL S+ QRKIIFTN+D+ HA 
Sbjct  66   TTMAGLKDLGYEFDDDEFHAFVHGRLPYETLKPDPVLRNLLLSLPQRKIIFTNADKAHAA  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFP-----VVLKPAMEAMNIAVDFADVD  621
            +VL R+G++DCFE +IC+ET+NP L  ++  D        ++ KP++EA+  A+  A+VD
Sbjct  126  EVLKRMGLEDCFEGVICYETLNPPLENANNMDALDNDASRILCKPSLEAIEAAIQIANVD  185

Query  622  PRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVR  801
            P++T+F DD+ RNIA+G A GLRT +VG++     +D+ +  +  + + IPEIW E+E  
Sbjct  186  PKKTIFFDDSARNIASGKAAGLRTVIVGSSVLVPGADHGLRNIHNIKEAIPEIW-EDEGE  244

Query  802  CSRSEMDSYLATTSVGA  852
             S   + S    T V A
Sbjct  245  QSEQVIQSTAVETVVHA  261



>ref|XP_010037824.1| PREDICTED: uncharacterized protein C24B11.05-like [Eucalyptus 
grandis]
Length=296

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/296 (44%), Positives = 180/296 (61%), Gaps = 41/296 (14%)
 Frame = +1

Query  76   DSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRV  255
            D FC S    S  +D ++FD+DDTLY    GI +   KNI D++VEK G  E++  AL  
Sbjct  5    DLFCAS---QSPKYDCLLFDLDDTLYPISSGIAKECLKNIQDYMVEKLGIDESKLDALSN  61

Query  256  ELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTN  435
             L+K YG+++AGLR +GYD D D+YHSFVHGRLPY  +KPDP LRSLL S+  RKIIFTN
Sbjct  62   LLYKNYGTTMAGLRGIGYDFDYDQYHSFVHGRLPYESLKPDPVLRSLLLSLPYRKIIFTN  121

Query  436  SDRVHAMKVLDRIGIKDCFEQIICFETMN-------------------PN----------  528
            +D++HA KVL R+G++DCFE IICFET+N                   P+          
Sbjct  122  ADKIHAAKVLSRLGLEDCFEGIICFETLNTICGSVASGNEDNAEFVESPSTAYGGSSKIF  181

Query  529  --LSRSSRPD------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVG  684
              +   S PD      + P+V KP+ EA+  A+  A+++P RT+F DD+ RNI AG  VG
Sbjct  182  DIIGHFSGPDLGLGLPKTPIVCKPSEEAIEQALRIANINPHRTIFFDDSVRNIQAGKRVG  241

Query  685  LRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            L T LVG + + K +DYA+E +  + + +PE+W E++++   S   +    TSV A
Sbjct  242  LHTVLVGKSQRCKGADYALESIHNLREALPELW-EDDLKSEVSYSGAVAVETSVTA  296



>gb|KCW49591.1| hypothetical protein EUGRSUZ_K03116 [Eucalyptus grandis]
Length=314

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/296 (44%), Positives = 180/296 (61%), Gaps = 41/296 (14%)
 Frame = +1

Query  76   DSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRV  255
            D FC S    S  +D ++FD+DDTLY    GI +   KNI D++VEK G  E++  AL  
Sbjct  23   DLFCAS---QSPKYDCLLFDLDDTLYPISSGIAKECLKNIQDYMVEKLGIDESKLDALSN  79

Query  256  ELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTN  435
             L+K YG+++AGLR +GYD D D+YHSFVHGRLPY  +KPDP LRSLL S+  RKIIFTN
Sbjct  80   LLYKNYGTTMAGLRGIGYDFDYDQYHSFVHGRLPYESLKPDPVLRSLLLSLPYRKIIFTN  139

Query  436  SDRVHAMKVLDRIGIKDCFEQIICFETMN-------------------PN----------  528
            +D++HA KVL R+G++DCFE IICFET+N                   P+          
Sbjct  140  ADKIHAAKVLSRLGLEDCFEGIICFETLNTICGSVASGNEDNAEFVESPSTAYGGSSKIF  199

Query  529  --LSRSSRPD------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVG  684
              +   S PD      + P+V KP+ EA+  A+  A+++P RT+F DD+ RNI AG  VG
Sbjct  200  DIIGHFSGPDLGLGLPKTPIVCKPSEEAIEQALRIANINPHRTIFFDDSVRNIQAGKRVG  259

Query  685  LRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            L T LVG + + K +DYA+E +  + + +PE+W E++++   S   +    TSV A
Sbjct  260  LHTVLVGKSQRCKGADYALESIHNLREALPELW-EDDLKSEVSYSGAVAVETSVTA  314



>ref|XP_002866333.1| hypothetical protein ARALYDRAFT_496082 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42592.1| hypothetical protein ARALYDRAFT_496082 [Arabidopsis lyrata subsp. 
lyrata]
Length=266

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/256 (46%), Positives = 164/256 (64%), Gaps = 7/256 (3%)
 Frame = +1

Query  100  DSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            +SSSP ++ ++FD+DDTLY    G+  A   NI +++VEK G  E     L   L+KKYG
Sbjct  5    NSSSPRYECLLFDLDDTLYPLSSGLSDACTNNIIEYMVEKLGIDEDGVVELNQILYKKYG  64

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +S+AGL+ +GY+ D DEYHS+VHGRLPY  +KPDP LRSLL ++  RK++F+N D VH M
Sbjct  65   TSMAGLKEVGYEFDNDEYHSYVHGRLPYENLKPDPVLRSLLLTLPCRKLVFSNGDEVHVM  124

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSR------SSRPDEFPVVLKPAMEAMNIAVDFADV  618
            K L R+GI+DCFE+II FET+NP ++       +    E PV+ KP   A   A + A +
Sbjct  125  KALKRLGIEDCFERIISFETLNPEINEAEVSCITGHLPENPVICKPTEIAFEKAFNIAQL  184

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEV  798
            +P +TLF DD+ RNI  G AVGL T LVG + K   SDYA+E +  M +  PE+W E ++
Sbjct  185  NPHKTLFFDDSIRNIQTGKAVGLHTVLVGKSEKVDGSDYALESIHNMKEAFPELWLESKI  244

Query  799  RCSRSEMDSYLATTSV  846
                +E   Y A  S+
Sbjct  245  NNKETERIDYAAQVSI  260



>ref|XP_009395584.1| PREDICTED: uncharacterized protein LOC103980802 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=239

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/233 (55%), Positives = 158/233 (68%), Gaps = 15/233 (6%)
 Frame = +1

Query  199  DFLVEKCGFPETEASALRVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPD  378
            +FL  KCG     A  LRVE F+ +GSSLAGL  LG+DV  DEYHSFVHGRLPY LI+P+
Sbjct  7    EFLAGKCGVSAERACTLRVEHFRNHGSSLAGLLDLGHDVHPDEYHSFVHGRLPYELIQPE  66

Query  379  PELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGI-KDCFEQIICFETMNPNLSRSSRP-D  552
             ELR LL SI Q KI+FTNSDR HA + L R+GI ++CF +IICFETMNP+L    R   
Sbjct  67   AELRELLGSITQPKILFTNSDRQHAKRALQRLGIEEECFHRIICFETMNPHLFGDEREVS  126

Query  553  EFP-VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
            + P VVLKP+ +AM  AV  A   P RTLF+DD+ RNIAAG A+GLRTALVG   KTKE+
Sbjct  127  KTPEVVLKPSAKAMETAVRLAGFPPHRTLFVDDSERNIAAGKAIGLRTALVGKREKTKEA  186

Query  730  DYAMEKVTEMVQVIPEIWFEEE------------VRCSRSEMDSYLATTSVGA  852
            DY ++ +  + Q+IPEIW E+E               +R E+DS  ATT +GA
Sbjct  187  DYLLDNICALRQLIPEIWGEQEKVEAGGEHGVTTTTTTRPELDSIRATTIIGA  239



>ref|XP_010047821.1| PREDICTED: uncharacterized protein LOC104436669 [Eucalyptus grandis]
 gb|KCW88959.1| hypothetical protein EUGRSUZ_A01281 [Eucalyptus grandis]
 gb|KCW88960.1| hypothetical protein EUGRSUZ_A01281 [Eucalyptus grandis]
 gb|KCW88961.1| hypothetical protein EUGRSUZ_A01281 [Eucalyptus grandis]
Length=298

 Score =   246 bits (629),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 127/285 (45%), Positives = 180/285 (63%), Gaps = 40/285 (14%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D+++FD+DDTLY    G+  + +KNI D++VEK G  E +   L   L+K YG+++AGL
Sbjct  15   YDSLLFDLDDTLYPVSSGLATSCRKNIGDYMVEKLGIDEDKIDTLCNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D D+YHSFVHGRLPY+ +KPDP LRSLL S+  RKIIFTN+D++HA+K L R+
Sbjct  75   RAIGYDFDYDDYHSFVHGRLPYDNLKPDPVLRSLLLSLPYRKIIFTNADQIHAVKALSRL  134

Query  475  GIKDCFEQIICFETMNP-------------------NLSRS--SRPDEF-----------  558
            G++DCFE IICFET+NP                   N +RS  SR + F           
Sbjct  135  GLEDCFEGIICFETLNPVHKNAASDDEDDIEFVGLQNTTRSSDSRSEIFDIIGHFSRHGD  194

Query  559  -------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATK  717
                   PVV KP+ +A+  A+  A+++P+RT+F +D+ RNI AG  VGL+T +VGT+ +
Sbjct  195  GSGLPKTPVVCKPSEDAIEQALRVANINPQRTIFFEDSVRNIQAGKHVGLQTVMVGTSNR  254

Query  718  TKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
             K +DYA+E +  + + IPE+W E EV+      D     T+V A
Sbjct  255  PKGADYALENIHNLREAIPELW-EFEVKSEVGYSDKVAVETTVTA  298



>ref|XP_002468106.1| hypothetical protein SORBIDRAFT_01g039680 [Sorghum bicolor]
 gb|EER95104.1| hypothetical protein SORBIDRAFT_01g039680 [Sorghum bicolor]
Length=281

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 171/262 (65%), Gaps = 22/262 (8%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +K NI+D++VEK G  E++   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSSGIAGHVKNNIEDYMVEKLGIDESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYH+FVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHAFVHGRLPYDNIKPDPVLKHILKNLRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF  558
            TN D VHA++ L+R+G++DCFE IICFET+NP                 + +RS   DE 
Sbjct  120  TNGDMVHAVRALERLGLEDCFEGIICFETLNPPCPPQGDEEPEIFDIAGHFARSGTADEL  179

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVG + + K +
Sbjct  180  PKTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKQIGLHTVLVGKSQRVKGA  239

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +PE+W E E
Sbjct  240  DHALESIHNIREALPELWEEAE  261



>ref|XP_009416228.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009416229.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=282

 Score =   245 bits (626),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 165/249 (66%), Gaps = 22/249 (9%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI    + NI D+LVEK G  E + SAL   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGIAIQCRNNIGDYLVEKLGIEENKVSALCNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +A+GYD D D+YHSFVHGRLP+  +KPDP LR LL S+  RK++FTN+D VHA KVL ++
Sbjct  75   KAIGYDFDYDDYHSFVHGRLPHENLKPDPVLRQLLLSLPIRKVVFTNADEVHAAKVLKKL  134

Query  475  GIKDCFEQIICFETMNPN---------------LSRSSRPD-------EFPVVLKPAMEA  588
             ++DCFE IICFET+NP                +   +RPD       + P++ KP++EA
Sbjct  135  RLEDCFEGIICFETLNPPSSSSVTETSSQIFDIVEHFARPDTGGIELPKTPILCKPSLEA  194

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
            M  A+  A++DP+RT+F DD+ RN+ +G  +GL T LVGTA K K +DYA+E +  + + 
Sbjct  195  MEYALRIANIDPQRTVFFDDSVRNVQSGKRIGLHTVLVGTAHKVKGADYALESIHNIREA  254

Query  769  IPEIWFEEE  795
            +P +W E E
Sbjct  255  LPGLWEEAE  263



>ref|XP_006281623.1| hypothetical protein CARUB_v10027751mg [Capsella rubella]
 gb|EOA14521.1| hypothetical protein CARUB_v10027751mg [Capsella rubella]
Length=267

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/260 (45%), Positives = 168/260 (65%), Gaps = 7/260 (3%)
 Frame = +1

Query  94   VRDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            V +SS+P ++ ++FD+DDTLY    G+ +A   NI +F+V+K G  E     L   L+KK
Sbjct  4    VTNSSTPRYECLVFDLDDTLYPLSSGLSEACANNIIEFMVQKLGIEEDRVVELNQLLYKK  63

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YG+S+AGL+A+GY+ D DEYHS+VHGRLPY  +KPDP LR+LL ++  RK++F+N D  H
Sbjct  64   YGTSMAGLKAIGYEFDNDEYHSYVHGRLPYENLKPDPVLRNLLLTLPFRKLVFSNGDDAH  123

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSR------SSRPDEFPVVLKPAMEAMNIAVDFA  612
              K L R+GI+DCFE+II FET+NP  +       +    E PV+ KP   A   A D A
Sbjct  124  VKKALKRLGIEDCFEKIISFETLNPKTNDAEVSCVAGHLPENPVICKPTEIAFEKAFDIA  183

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
             ++P +TLF DD+ RNI  G  +GLRT LVG + K + SDYA+E +  M + +PE+W E 
Sbjct  184  QLNPHKTLFFDDSIRNIQTGKLMGLRTILVGKSEKVEGSDYALESIHNMKEALPELWSES  243

Query  793  EVRCSRSEMDSYLATTSVGA  852
                ++SE  +Y+A  S+  
Sbjct  244  NNNNTKSERINYVAQISIAT  263



>ref|XP_003558239.1| PREDICTED: phosphate metabolism protein 8 [Brachypodium distachyon]
Length=280

 Score =   244 bits (623),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/262 (45%), Positives = 171/262 (65%), Gaps = 22/262 (8%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +K NI+D++VEK G  E++   L
Sbjct  2    EYEERCLMVQEPK--FDCLLFDLDDTLYPMSSGISSHVKTNIEDYMVEKLGIEESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY+ D DEYHSFVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYNFDYDEYHSFVHGRLPYDNIKPDPVLKHILKNMRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF  558
            TN D VHA++ L R+G++DCFE IICFET+NP                 + + S   DE 
Sbjct  120  TNGDMVHAVRALKRLGLEDCFEGIICFETLNPPCLLPGDQALEIFDIAGHFAGSGSTDEL  179

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT+ + K +
Sbjct  180  PRTPVLCKPNVDAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLVGTSHRVKGA  239

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +PE+W E E
Sbjct  240  DHALESIHNIREALPELWEEAE  261



>ref|XP_006649838.1| PREDICTED: uncharacterized protein C24B11.05-like [Oryza brachyantha]
Length=282

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 119/263 (45%), Positives = 168/263 (64%), Gaps = 23/263 (9%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +KKNI D++VEK G  E++   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSSGIASHVKKNIGDYMVEKLGIEESKIETL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYHSFVHGRLPY  IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHSFVHGRLPYENIKPDPVLKHILKNLRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP------------------NLSRSSRPDE  555
            TN D+ HA++ L R+G++DCFE IICFET+N                   + SRS   DE
Sbjct  120  TNGDKDHAVRALKRLGLEDCFEGIICFETLNQPCPSAPCDGEANAFDIAGHFSRSGAADE  179

Query  556  F---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKE  726
                PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT  + K 
Sbjct  180  LPRTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKRIGLHTVLVGTPQRVKG  239

Query  727  SDYAMEKVTEMVQVIPEIWFEEE  795
            +D+A+E +  + + +PE+W E E
Sbjct  240  ADHALESIHNIREALPELWEEAE  262



>ref|XP_010931242.1| PREDICTED: uncharacterized protein C24B11.05-like [Elaeis guineensis]
Length=277

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/251 (48%), Positives = 163/251 (65%), Gaps = 17/251 (7%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            + D     D ++FD+DDTLY    G+   + KNI D+LV+K G  E++   +   L+K Y
Sbjct  8    LNDQRPKIDCLLFDLDDTLYPLSSGLSTEILKNIGDYLVQKLGIEESKIPDMCNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GY  D +EYHSFVHGRLPY  IKPDP LR LL S+  RKIIFTN+DR H 
Sbjct  68   GTTMAGLRAIGYTFDYEEYHSFVHGRLPYEKIKPDPVLRHLLLSLPIRKIIFTNADRTHT  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPNL-----------SRSSRP------DEFPVVLKPAM  582
             KVL+R+G++DCFE IICFET+NP +             S RP       E PV+ KP+ 
Sbjct  128  AKVLNRLGLEDCFEGIICFETLNPPMEATRTNIFDIIEYSLRPVAGMELPETPVLCKPSE  187

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A D A +DP++T+F DD+ RNI AG  +GL T LVGT+ K K +D+A+E +  + 
Sbjct  188  YAIKQAFDIAGIDPQKTIFFDDSARNIQAGKRIGLHTVLVGTSHKVKGADHALESIHNIR  247

Query  763  QVIPEIWFEEE  795
            + +PE+W E E
Sbjct  248  EALPELWEEGE  258



>ref|XP_004137773.1| PREDICTED: uncharacterized protein C24B11.05-like [Cucumis sativus]
Length=254

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/230 (48%), Positives = 164/230 (71%), Gaps = 6/230 (3%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P +D ++FD+DDTLY    GI  +  +NI D++VEK G  +++   L   L+K Y
Sbjct  8    RQAQRPKYDCLLFDLDDTLYPLSSGIAASCLQNIKDYMVEKLGIEQSKIPDLCNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GYD D DEYH FVHGRLPY+ +KPDP LR+LL ++  RK+IFTN+D++HA
Sbjct  68   GTTMAGLRAIGYDFDYDEYHKFVHGRLPYDNLKPDPVLRNLLLNLPYRKVIFTNADKIHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRT  633
            +KVL ++G++DCF+ IICFET+NP     +   + P++ KP+  A+  A+  A ++P+RT
Sbjct  128  VKVLKKLGLEDCFQGIICFETLNP-----TNKTKTPIICKPSEAAIERALKIAGLNPQRT  182

Query  634  LFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            LF +D+ RNI AG  VGL T L+GT+ + K +DYA+E +  + + IPE+W
Sbjct  183  LFFEDSVRNIQAGKRVGLDTVLIGTSQRVKGADYALESIHNLREGIPELW  232



>emb|CBI30538.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   247 bits (631),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/241 (47%), Positives = 167/241 (69%), Gaps = 18/241 (7%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +A + NI+D++VEK G  + + + L   L+K YG+++AGL
Sbjct  143  YDCLLFDLDDTLYPLSSGLAKACRNNIEDYMVEKLGIEKNKIADLGNLLYKNYGTTMAGL  202

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LRSLL S+  RK+IFTN+D+VHA K L R+
Sbjct  203  RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRSLLLSLPIRKVIFTNADKVHAAKALSRL  262

Query  475  GIKDCFEQIICFETMNPN------------LSRSSRPD------EFPVVLKPAMEAMNIA  600
            G++DCFE +ICFET+NP+            +   S+P+      + P+V KP+  A+  A
Sbjct  263  GLEDCFEGVICFETLNPSHKSTVSTEIFDIIGHFSQPNAGTALPKTPIVCKPSEAAIERA  322

Query  601  VDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEI  780
            +  A+++P+RTLF +D+ RNI +G  VGL T LVGT+ + K +D+A+E +  M + +PE+
Sbjct  323  LRIANINPQRTLFFEDSARNIQSGKRVGLHTVLVGTSQRIKGADFALESIHNMREALPEL  382

Query  781  W  783
            W
Sbjct  383  W  383



>ref|XP_003562613.1| PREDICTED: uncharacterized protein C24B11.05 [Brachypodium distachyon]
Length=254

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 108/229 (47%), Positives = 163/229 (71%), Gaps = 1/229 (0%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            +S + FD ++FDMDDTLY   +GI  A +KNI D++V K G  E+    + ++L+K+YG+
Sbjct  5    NSEAKFDCLLFDMDDTLYPLSLGINLACRKNIQDYMVNKLGIEESLVPKMCLDLYKEYGT  64

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            ++AGL+ LGY  D DE+H+ VHG LPY  +KPDP LR+LL S+ QRK+IFTNSDR HA +
Sbjct  65   TMAGLKLLGYGFDYDEFHACVHGTLPYEKLKPDPVLRNLLLSLPQRKLIFTNSDRAHAAR  124

Query  460  VLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVL-KPAMEAMNIAVDFADVDPRRTL  636
            VL+++G++ CFE IICFET+NP+ +  +  DE   VL KP++E+M   V+ A +DP++T+
Sbjct  125  VLEKMGLEGCFEGIICFETLNPSAAGPAACDEAARVLCKPSLESMEAVVEIAKLDPKKTV  184

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            F DD+ RNIA+G A G  T +VG++     +D A+E +  + + +P++W
Sbjct  185  FFDDSARNIASGKAAGFHTVIVGSSALVAGADVALESIHNIREALPDLW  233



>ref|XP_011076255.1| PREDICTED: uncharacterized protein C24B11.05 [Sesamum indicum]
 ref|XP_011076264.1| PREDICTED: uncharacterized protein C24B11.05 [Sesamum indicum]
Length=276

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 110/256 (43%), Positives = 172/256 (67%), Gaps = 21/256 (8%)
 Frame = +1

Query  88   KSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFK  267
            ++V DS + ++ ++FDMDDTLY   +GI  A +KNI+++++      ETE   + +EL+K
Sbjct  2    EAVGDSGAKYECLLFDMDDTLYPLSLGINLACRKNIEEYMLHHLQIEETEVPRMCLELYK  61

Query  268  KYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRV  447
            +YG+++AGL+ALGY+ D DE+H++VHGRLPY L+KPDP LR+LL S+ Q+KIIFTN+D  
Sbjct  62   EYGTTMAGLKALGYEFDNDEFHAYVHGRLPYELLKPDPLLRNLLLSMPQQKIIFTNADEA  121

Query  448  HAMKVLDRIGIKDCFEQIICFETMNPNL-------------------SRSSRPDEF--PV  564
            HA +VL R+G++DCF+ +ICFET+NP +                   +R +    F   +
Sbjct  122  HAAQVLSRLGLEDCFQDVICFETLNPPMEPVKCINGTYEEEPQDATETRKNEESSFKTKI  181

Query  565  VLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAME  744
            + KP++EA+  A+   +VDP++T+F DD+ RNIA G A GL T +VG +T    +D+A+ 
Sbjct  182  LCKPSLEAIEAAIRITNVDPKKTIFFDDSVRNIANGKAAGLHTVIVGRSTLVPGADHALN  241

Query  745  KVTEMVQVIPEIWFEE  792
             +  + + +PEIW +E
Sbjct  242  SIHNIREALPEIWEDE  257



>ref|NP_001150070.1| catalytic/ hydrolase [Zea mays]
 gb|ACG37696.1| catalytic/ hydrolase [Zea mays]
Length=280

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 171/262 (65%), Gaps = 22/262 (8%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +KKNI+D++VEK G  E++   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSSGIAGHVKKNIEDYMVEKLGIDESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYH+FVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHAFVHGRLPYDNIKPDPVLKHILKNLPIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF  558
            TN D+VHA++ L+R+G++DCFE IICFET+NP                 + +RS    E 
Sbjct  120  TNGDKVHAVRALERLGLEDCFEGIICFETLNPPCPPQGDREAEIFDIAGHFARSGAAAEL  179

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVG + + K +
Sbjct  180  PKTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKQIGLHTVLVGKSQRVKGA  239

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +P +W E E
Sbjct  240  DHALESIHNVREALPGLWEEAE  261



>ref|XP_004984719.1| PREDICTED: uncharacterized protein C24B11.05-like [Setaria italica]
Length=275

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/252 (45%), Positives = 165/252 (65%), Gaps = 20/252 (8%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            D    FD ++FD+DDTLY    GI   +KKNI+D++VEK G  E++   L   L++ YG+
Sbjct  5    DRCHKFDCLLFDLDDTLYPLSSGIAGHVKKNIEDYMVEKLGIDESKIENLGNLLYRNYGT  64

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            ++AGLRA+GY  D DEYH+FVHGRLPY+ IKPDP L+ +L+++  RK+IFTN D+VHA++
Sbjct  65   TMAGLRAIGYSFDYDEYHAFVHGRLPYDNIKPDPVLKHILKNLRIRKLIFTNGDKVHALR  124

Query  460  VLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF---PVVLKPA  579
             L R+G++DCFE IICFET+NP                 + +RS    E    PV+ KP 
Sbjct  125  ALKRLGLEDCFEGIICFETLNPPCPPQGEQKPEIFDIAGHFARSGTAGELPKTPVLCKPN  184

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
            ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVG + + K +D+A+E +  +
Sbjct  185  VDAMEEALRIANVNPHKAIFFDDSVRNIQAGKQIGLHTVLVGKSQRVKGADHALESIHNI  244

Query  760  VQVIPEIWFEEE  795
             + +P +W E E
Sbjct  245  REALPGLWEEAE  256



>gb|AFW88835.1| catalytic/ hydrolase [Zea mays]
Length=280

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/262 (44%), Positives = 171/262 (65%), Gaps = 22/262 (8%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +KKNI+D++VEK G  E++   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSSGIADHVKKNIEDYMVEKLGIDESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYH+FVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHAFVHGRLPYDNIKPDPVLKHILKNLPIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF  558
            TN D+VHA++ L+R+G++DCFE IICFET+NP                 + +RS    E 
Sbjct  120  TNGDKVHAVRALERLGLEDCFEGIICFETLNPPCPPQGDREAEIFDIAGHFARSGAAAEL  179

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVG + + K +
Sbjct  180  PKTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKQIGLHTVLVGKSQRVKGA  239

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +P +W E E
Sbjct  240  DHALESIHNVREALPGLWEEAE  261



>ref|XP_008240768.1| PREDICTED: uncharacterized protein LOC103339270 [Prunus mume]
Length=299

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 169/276 (61%), Gaps = 43/276 (16%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            + +D ++FD+DDTLY    GI  A + NI+D++VEK G   +    L   L+K YG+++A
Sbjct  13   TKYDCLLFDLDDTLYPYSTGIATACRNNIEDYMVEKLGIERSIIPELGNLLYKNYGTTMA  72

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GYD D DEYHSFVHGRLPY  IKPDP LR+LL S+  RKIIFTN+D+VHA K L 
Sbjct  73   GLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRNLLLSLPYRKIIFTNADKVHAAKALS  132

Query  469  RIGIKDCFEQIICFETMNP----------------------------------------N  528
            R+G++DCFE IICFET+NP                                         
Sbjct  133  RLGLEDCFEGIICFETLNPTHKSIVSDDEDDIEFVGSAAEVPATTTSSSQIFDIIGHFAQ  192

Query  529  LSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
             + +S+  + P+V KP+  A+  A+  A++DP+RTLF +D+ RNI AG  VGL+T L+GT
Sbjct  193  QNPTSKLPKTPIVCKPSEAAIERALKIANIDPQRTLFFEDSVRNIQAGKRVGLQTVLIGT  252

Query  709  ATKTKESDYAMEKVTEMVQVIPEIW---FEEEVRCS  807
            + + K +DYA+E +  + + +PE+W    + EVR S
Sbjct  253  SQRVKGADYALESIHNLREALPELWEVEMKSEVRYS  288



>ref|XP_009389528.1| PREDICTED: uncharacterized protein C24B11.05-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389529.1| PREDICTED: uncharacterized protein C24B11.05-like [Musa acuminata 
subsp. malaccensis]
Length=289

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/286 (42%), Positives = 176/286 (62%), Gaps = 42/286 (15%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            S + ++ ++FDMDDTLY    GI  A +KNI+D+++      E++   + +EL+K+YG++
Sbjct  6    SEAKYECLLFDMDDTLYPLSCGINLACRKNIEDYMLHHLQIEESQIPKMCLELYKEYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ALG+  D DE+H++VHGRLPY  +KPDP LR++L S+ QRKIIFTN+D+ HA KV
Sbjct  66   MAGLKALGFVFDNDEFHAYVHGRLPYETLKPDPLLRNMLLSMPQRKIIFTNADQAHAAKV  125

Query  463  LDRIGIKDCFEQIICFETMNP------------------------------------NLS  534
            L R+G++DCFE +ICFET+NP                                    N  
Sbjct  126  LSRLGLEDCFEGVICFETLNPPPKKTELDDKLTATPAYNLPDDLNNHGFYSETDSITNTE  185

Query  535  RSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTAT  714
             ++ P E  ++ KP++EAM  A+  A++DPRRT+F DD+ RNIAAG A GL T LVG++ 
Sbjct  186  SNTTPHER-ILCKPSVEAMQTAIRIANIDPRRTVFFDDSARNIAAGKAAGLHTVLVGSSV  244

Query  715  KTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
                +D A+E +  + + +PEIW +E       E+   L TTSV A
Sbjct  245  VVPGADNALESIHNIREALPEIWHDE-----GDELKPVLETTSVEA  285



>ref|XP_004302744.1| PREDICTED: uncharacterized protein LOC101294772 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=285

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/248 (46%), Positives = 162/248 (65%), Gaps = 25/248 (10%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A + NI+D++VEK G   +    L   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLSTGVATACRINIEDYMVEKLGIERSIIPELGNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  IKPDP LRSLL ++  RKIIFTN+D+VHA K L R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNADKVHAAKALSRL  135

Query  475  GIKDCFEQIICFETMNP-------------------------NLSRSSRPDEFPVVLKPA  579
            G++DCFE I+CFET+NP                           + SS+  + P+V KP+
Sbjct  136  GLEDCFEGILCFETLNPIHKSTVSDDEDDIDSEIFDIIAHFAQANPSSKLPKTPIVCKPS  195

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
              A+  A+  A+++P+RTLF +D+ RNI AG  VGL T LVGT+ + K +D+A+E +  +
Sbjct  196  EAAIEKALKIANINPQRTLFFEDSVRNIQAGKRVGLHTVLVGTSQRVKGADFALESIHNL  255

Query  760  VQVIPEIW  783
             + +PE+W
Sbjct  256  REALPELW  263



>ref|XP_006398686.1| hypothetical protein EUTSA_v10014335mg [Eutrema salsugineum]
 ref|XP_006398687.1| hypothetical protein EUTSA_v10014335mg [Eutrema salsugineum]
 gb|ESQ40139.1| hypothetical protein EUTSA_v10014335mg [Eutrema salsugineum]
 gb|ESQ40140.1| hypothetical protein EUTSA_v10014335mg [Eutrema salsugineum]
Length=280

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/247 (50%), Positives = 165/247 (67%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++  +D ++FD+DDTLY    GI +A  KNI D+++EK G PE +   L   L+K YG++
Sbjct  11   TTQKYDCLLFDLDDTLYPLSTGIARACGKNIKDYMIEKLGIPEDKIVELSNLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D DEYHSFVHGRLPY  IKPDP LRSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNP-----------------NLSRSSRPDEF---PVVLKPAM  582
            L ++G++DCFE IICFET+NP                 + +RS   D     P+V KP+ 
Sbjct  131  LKKLGLEDCFEGIICFETLNPTHKNAAFENFEIFDIVEHFNRSEPVDSLPKTPIVCKPSD  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A +DP RTLF +D+ RN+ AG  VGL T LVGT+ K K +DYA+E +  M 
Sbjct  191  SAIVKALEIAAIDPNRTLFFEDSVRNVQAGKRVGLHTVLVGTSNKVKGADYALESIHNMK  250

Query  763  QVIPEIW  783
            + +PE+W
Sbjct  251  EALPELW  257



>ref|XP_006838246.1| hypothetical protein AMTR_s00103p00040030 [Amborella trichopoda]
 gb|ERN00815.1| hypothetical protein AMTR_s00103p00040030 [Amborella trichopoda]
Length=193

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = +1

Query  88   KSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFK  267
            KS   + S +D ++FD+DDTLYS  +GI +  +KNID+FL++KCG    +A+ LR ELF 
Sbjct  5    KSKFQTVSSYDCLLFDLDDTLYSPALGIAEDCRKNIDEFLMKKCGLVREKATKLRAELFL  64

Query  268  KYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRV  447
             YGSSLAGLR LGYDVDAD+YHS VHG LPY +IKPDP+LR++L+SI QRK++FTNSDR 
Sbjct  65   TYGSSLAGLRTLGYDVDADDYHSNVHGPLPYQVIKPDPKLRAVLQSITQRKLVFTNSDRA  124

Query  448  HAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPR  627
            HAMKVL R+ ++DCFEQIICFE++NP++S S    E PVVLKP+ EAM IA+  A  DP 
Sbjct  125  HAMKVLMRLNLEDCFEQIICFESLNPHISMSR---EVPVVLKPSKEAMQIAIKLAQADPH  181

Query  628  RT  633
            +T
Sbjct  182  KT  183



>ref|XP_007134046.1| hypothetical protein PHAVU_010G014800g [Phaseolus vulgaris]
 gb|ESW06040.1| hypothetical protein PHAVU_010G014800g [Phaseolus vulgaris]
Length=303

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 119/267 (45%), Positives = 168/267 (63%), Gaps = 45/267 (17%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY  K GI +A  KNI D++VEK G   ++   L   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLKSGIAEACLKNIKDYMVEKLGIHPSKIDDLSNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK+IFTN+D+VHA K L+R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRNLLLSLPYRKLIFTNADKVHAAKALNRL  135

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE IICFET+NP + +S+  D     EF                           
Sbjct  136  GLEDCFEGIICFETLNP-IHKSTVSDDEDDIEFVGSRTTTPTTTSNGPATSQIFNIIEHF  194

Query  559  ------------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALV  702
                        P++ KP+  A+ +A+  AD+ P+RTLF +D+TRNI AG  VGL T L+
Sbjct  195  AKPNPSTILPKTPIICKPSENAIELALKIADLKPQRTLFFEDSTRNILAGKRVGLHTVLI  254

Query  703  GTATKTKESDYAMEKVTEMVQVIPEIW  783
            GT+ + K +DYA+E +  + + +P++W
Sbjct  255  GTSQRCKGADYALESIHNLKEAVPQLW  281



>ref|XP_010256890.1| PREDICTED: uncharacterized protein LOC104597165 [Nelumbo nucifera]
 ref|XP_010256891.1| PREDICTED: uncharacterized protein LOC104597165 [Nelumbo nucifera]
Length=296

 Score =   241 bits (616),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 168/270 (62%), Gaps = 37/270 (14%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P +D ++FD+DDTLY    G+    + NI D++V+K G  E++AS +   L+K Y
Sbjct  8    RQAQRPKYDCLLFDLDDTLYPLSSGLAIECRNNIQDYMVQKLGIEESKASDMCNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GYD D D+YHSFVHGRLPY  +KPDP LRSLL S+  RK+IFTN+D++HA
Sbjct  68   GTTMAGLRAIGYDFDYDDYHSFVHGRLPYEKLKPDPVLRSLLLSLPIRKVIFTNADKIHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDE--------------------------  555
             KVL R+G++DCFE IICFET+NP    +   DE                          
Sbjct  128  AKVLSRLGLEDCFEGIICFETLNPTHKNAVSDDEDDSGFGGSKPTTTGSDQYFDIIGHFS  187

Query  556  ----------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVG  705
                       PVV KP+  A+  A+   +++P+RT+F DD+ RNI +G  VGL T LVG
Sbjct  188  QPSAGLELPNTPVVCKPSEIAIERALKIGNINPQRTMFFDDSVRNIQSGKRVGLHTVLVG  247

Query  706  TATKTKESDYAMEKVTEMVQVIPEIWFEEE  795
            T+ +TK SD+A+E +  + + +PE+W  EE
Sbjct  248  TSYRTKGSDFALESIHNIREALPELWEAEE  277



>gb|EMT24873.1| hypothetical protein F775_27766 [Aegilops tauschii]
Length=281

 Score =   241 bits (615),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 166/263 (63%), Gaps = 23/263 (9%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E D  C  V+D    FD ++FD+DDTLY    GI   +K NI+ ++VEK G  E++   L
Sbjct  2    EFDERCLKVQDPK--FDCLLFDLDDTLYPLSSGISSHVKTNIEAYMVEKLGIEESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY+ D DEYHSFVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYNFDYDEYHSFVHGRLPYDNIKPDPVLKQILKNMRMRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP---------------------NLSRSSR  546
            TN D +HA++ L R+G++DCFE IICFET+NP                      L  +  
Sbjct  120  TNGDMIHAVRALKRLGLEDCFEGIICFETLNPPCLLTPCDQAPEIFDIAGHFAGLGSADD  179

Query  547  PDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKE  726
                PV+ KP + AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT+ + K 
Sbjct  180  LPRTPVLCKPNVGAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLVGTSQRVKG  239

Query  727  SDYAMEKVTEMVQVIPEIWFEEE  795
            +D+A+E +  + + +PE+W E E
Sbjct  240  ADHALESIHNIREALPELWEEAE  262



>ref|XP_004229150.1| PREDICTED: uncharacterized protein C24B11.05 [Solanum lycopersicum]
Length=252

 Score =   239 bits (611),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 102/232 (44%), Positives = 164/232 (71%), Gaps = 5/232 (2%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R ++  ++ ++FDMDDTLY    G+  A +KNI+++++      E+E   + ++L+++YG
Sbjct  6    RSNNLKYECLLFDMDDTLYPLSSGVNLACRKNIEEYMLHHLNIEESEVPKMCLDLYREYG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ LGY+ D D++H +VHGRLPY ++KPDP LR+LL S+ QRKIIFTN D+ HA+
Sbjct  66   TTMAGLKELGYEFDNDKFHEYVHGRLPYEVLKPDPLLRNLLLSMPQRKIIFTNGDKAHAI  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTL  636
            +VL ++G+ DCFE IICFET+NP+L      D   ++ KP+++AM  A+  A++DP +T+
Sbjct  126  RVLSKLGLGDCFEGIICFETLNPSLE-----DNATILCKPSLKAMEAAIQIANLDPNKTI  180

Query  637  FLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
            F DD+ RNIA+G   GL T +VG++T    +D+A+  +  + + +P IW EE
Sbjct  181  FFDDSARNIASGKQAGLHTVVVGSSTLVGGADHALRSIHNIREALPHIWEEE  232



>emb|CDX91378.1| BnaC04g07720D [Brassica napus]
Length=275

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/265 (44%), Positives = 171/265 (65%), Gaps = 23/265 (9%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +   +NI D++VEK G  +++   L   L+K YG+++AGL
Sbjct  8    YDTLLFDLDDTLYPLSSGIARECGQNIKDYMVEKLGIDKSKILELSNSLYKNYGTTMAGL  67

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHS+VHGRLPY+ IKPDP LR+LL S+  RKIIFTN+D++HA + L+R+
Sbjct  68   RAIGYDFDYDEYHSYVHGRLPYDNIKPDPILRTLLLSVPLRKIIFTNADKLHAARALERL  127

Query  475  GIKDCFEQIICFETMNP-NLSRSSRPDEF---------------------PVVLKPAMEA  588
            G++DCFE I+CFE++N  N       DE                      P+V KP+  A
Sbjct  128  GLEDCFEGIVCFESLNSTNRDNIHGNDEIFDIITYLSSDHEHPLSGLPKTPIVCKPSQTA  187

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
            +  A++ A++DP+RTLF +D+ RNI AG  VGL T LVGT+ + K +DYA+E +  + + 
Sbjct  188  IVKAIEIANIDPKRTLFFEDSVRNIQAGKRVGLSTVLVGTSQRVKFADYAVENIHNLKEA  247

Query  769  IPEIWFEEEVRCSRSEMDSYLATTS  843
            +PE+W E E + ++      LA  +
Sbjct  248  LPELW-ESEAKPNKVRYSGKLAVET  271



>ref|XP_007205580.1| hypothetical protein PRUPE_ppa008834mg [Prunus persica]
 gb|EMJ06779.1| hypothetical protein PRUPE_ppa008834mg [Prunus persica]
Length=299

 Score =   241 bits (615),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 169/276 (61%), Gaps = 43/276 (16%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            + +D ++FD+DDTLY    GI  A + NI+D++VEK G   +    L   L+K YG+++A
Sbjct  13   TKYDCLLFDLDDTLYPYSTGIATACRNNIEDYMVEKLGIERSIIPELGNLLYKNYGTTMA  72

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GYD D DEYHSFVHGRLPY  IKPDP LR+LL ++  RKIIFTN+D+VHA K L 
Sbjct  73   GLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRNLLLNLPYRKIIFTNADKVHAAKALS  132

Query  469  RIGIKDCFEQIICFETMNP----------------------------------------N  528
            R+G++DCFE IICFET+NP                                         
Sbjct  133  RLGLEDCFEGIICFETLNPTHKSIVSDDEDDIEFVGPAAEVPATTTSSSQIFDIIGHFAQ  192

Query  529  LSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
             + +S+  + P+V KP+  A+  A+  A++DP+RTLF +D+ RNI AG  VGL+T L+GT
Sbjct  193  QNPTSKLPKTPIVCKPSEAAIERALKIANIDPQRTLFFEDSVRNIQAGKRVGLQTVLIGT  252

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEE---EVRCS  807
            + + K +DYA+E +  + + +PE+W  E   EVR S
Sbjct  253  SQRVKGADYALESIHNLREALPELWEVEMISEVRYS  288



>emb|CBI16105.3| unnamed protein product [Vitis vinifera]
Length=281

 Score =   240 bits (613),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 163/249 (65%), Gaps = 21/249 (8%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            D +S +D ++FD+DDTLY    G+   + KNI +++++K G  E +   +   L+K YG+
Sbjct  10   DQTSKYDCLLFDIDDTLYPLSSGLSAQITKNIQEYMLQKLGIEEDKVPEMCALLYKHYGT  69

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            ++AGLRA+GY+ D D++HSFVHGRLPY L+KPDP LRSLL S+  RK++FTN+D+ HA +
Sbjct  70   TMAGLRAIGYNFDYDDFHSFVHGRLPYELLKPDPVLRSLLLSLPIRKVVFTNADKGHAAR  129

Query  460  VLDRIGIKDCFEQIICFETMNPN---------------------LSRSSRPDEFPVVLKP  576
            VL+R+G++DCFE +ICFET+NP                      LS  S     P+V KP
Sbjct  130  VLNRLGLEDCFEGVICFETLNPINKSSLGGSGTGSAGICDINHLLSVGSVLPRTPIVCKP  189

Query  577  AMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE  756
              +A   A   A +DPR+TLF DD+ RN+  G +VGL T LVG++ KTK +DYA+E +  
Sbjct  190  FTDAFEEASKIAKIDPRKTLFFDDSFRNLQGGKSVGLHTVLVGSSHKTKGADYALESIHN  249

Query  757  MVQVIPEIW  783
            + + +PE+W
Sbjct  250  IREALPELW  258



>ref|XP_007205579.1| hypothetical protein PRUPE_ppa008834mg [Prunus persica]
 gb|EMJ06778.1| hypothetical protein PRUPE_ppa008834mg [Prunus persica]
Length=307

 Score =   241 bits (615),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 169/276 (61%), Gaps = 43/276 (16%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            + +D ++FD+DDTLY    GI  A + NI+D++VEK G   +    L   L+K YG+++A
Sbjct  21   TKYDCLLFDLDDTLYPYSTGIATACRNNIEDYMVEKLGIERSIIPELGNLLYKNYGTTMA  80

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GYD D DEYHSFVHGRLPY  IKPDP LR+LL ++  RKIIFTN+D+VHA K L 
Sbjct  81   GLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRNLLLNLPYRKIIFTNADKVHAAKALS  140

Query  469  RIGIKDCFEQIICFETMNP----------------------------------------N  528
            R+G++DCFE IICFET+NP                                         
Sbjct  141  RLGLEDCFEGIICFETLNPTHKSIVSDDEDDIEFVGPAAEVPATTTSSSQIFDIIGHFAQ  200

Query  529  LSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
             + +S+  + P+V KP+  A+  A+  A++DP+RTLF +D+ RNI AG  VGL+T L+GT
Sbjct  201  QNPTSKLPKTPIVCKPSEAAIERALKIANIDPQRTLFFEDSVRNIQAGKRVGLQTVLIGT  260

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEE---EVRCS  807
            + + K +DYA+E +  + + +PE+W  E   EVR S
Sbjct  261  SQRVKGADYALESIHNLREALPELWEVEMISEVRYS  296



>gb|KDP35647.1| hypothetical protein JCGZ_09085 [Jatropha curcas]
Length=299

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/286 (42%), Positives = 173/286 (60%), Gaps = 41/286 (14%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A  KNI D++VE+ G  +++ + L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGLAAACGKNIKDYMVERLGIDKSKITELGNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHS+VHGRLPY  +KPDP LR+LL SI  RK+IFTN+D+VHA+KVL ++
Sbjct  75   RAIGYDFDYDEYHSYVHGRLPYENLKPDPVLRTLLHSIPIRKVIFTNADKVHALKVLSKL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    ++  DE                                 
Sbjct  135  GLEDCFEGIICFETLNPTHKSTTSDDEDDIEFMGSTASTTSTTANGPKIFDIISHFAQPN  194

Query  556  -------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTAT  714
                    P+V KP+  A+  A+  A+++P+RTLF +D+ RNI AG  VGL T LVGT+ 
Sbjct  195  PNYVLPKTPIVCKPSEIAIERALRIANINPQRTLFFEDSVRNIQAGKRVGLDTVLVGTSQ  254

Query  715  KTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            + K +DYA+E +  + + +PE+W E E++      +     T V A
Sbjct  255  RVKGADYALESIHNLREAVPELW-EVEIKSEVGYQEKLARETPVTA  299



>ref|XP_007205578.1| hypothetical protein PRUPE_ppa008834mg [Prunus persica]
 gb|EMJ06777.1| hypothetical protein PRUPE_ppa008834mg [Prunus persica]
Length=317

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/276 (44%), Positives = 169/276 (61%), Gaps = 43/276 (16%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            + +D ++FD+DDTLY    GI  A + NI+D++VEK G   +    L   L+K YG+++A
Sbjct  31   TKYDCLLFDLDDTLYPYSTGIATACRNNIEDYMVEKLGIERSIIPELGNLLYKNYGTTMA  90

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GYD D DEYHSFVHGRLPY  IKPDP LR+LL ++  RKIIFTN+D+VHA K L 
Sbjct  91   GLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRNLLLNLPYRKIIFTNADKVHAAKALS  150

Query  469  RIGIKDCFEQIICFETMNP----------------------------------------N  528
            R+G++DCFE IICFET+NP                                         
Sbjct  151  RLGLEDCFEGIICFETLNPTHKSIVSDDEDDIEFVGPAAEVPATTTSSSQIFDIIGHFAQ  210

Query  529  LSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
             + +S+  + P+V KP+  A+  A+  A++DP+RTLF +D+ RNI AG  VGL+T L+GT
Sbjct  211  QNPTSKLPKTPIVCKPSEAAIERALKIANIDPQRTLFFEDSVRNIQAGKRVGLQTVLIGT  270

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEE---EVRCS  807
            + + K +DYA+E +  + + +PE+W  E   EVR S
Sbjct  271  SQRVKGADYALESIHNLREALPELWEVEMISEVRYS  306



>dbj|BAJ98890.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87481.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=281

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/263 (44%), Positives = 166/263 (63%), Gaps = 23/263 (9%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E D  C  V+D    FD ++FD+DDTLY    GI   +K NI+ ++VEK G  E++   L
Sbjct  2    EFDERCLKVQDPK--FDCLLFDLDDTLYPLSSGISSHVKTNIEAYMVEKLGIEESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY+ D DEYHSFVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYNFDYDEYHSFVHGRLPYDNIKPDPVLKHILKNMRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP---------------------NLSRSSR  546
            TN D +HA++ L R+G++DCFE IICFET+NP                      L  +  
Sbjct  120  TNGDMIHAVRALKRLGLEDCFEGIICFETLNPPCLLPQCDQAPKIFDIAGHFAGLGSADD  179

Query  547  PDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKE  726
                PV+ KP + AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT+ + K 
Sbjct  180  LPRTPVLCKPNVGAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLVGTSHRVKG  239

Query  727  SDYAMEKVTEMVQVIPEIWFEEE  795
            +D+A+E +  + + +PE+W E E
Sbjct  240  ADHALESIHNIREALPELWEEAE  262



>ref|XP_009387370.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=282

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 163/249 (65%), Gaps = 22/249 (9%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+     KNI D++VE+ G  E + S L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGVASECLKNIGDYMVERLGIEERKISDLCNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GY+ D ++YHSFVHGRLPY  +KPDP LR LL S+  RK+IFTN+D VHA KVL R+
Sbjct  75   RAIGYEFDYNDYHSFVHGRLPYGKLKPDPVLRHLLLSLPIRKVIFTNADEVHAAKVLRRL  134

Query  475  GIKDCFEQIICFETMNPNLSRSS---RPDEF-------------------PVVLKPAMEA  588
            G++DCF+ IICFET+NP  + SS   R  E                    PV+ KP+++A
Sbjct  135  GLEDCFQGIICFETLNPLPASSSDQERKTEVFDIVGHFSHPTDGVELPKTPVLCKPSVDA  194

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
            M  A+  A +DP+RT+F DD+ RNI +G  +GL T LVGT+ + K +D+A+E +  M + 
Sbjct  195  MEHALRVAGIDPQRTMFFDDSVRNIQSGKHIGLHTILVGTSRRIKGADHALESIHNMKEA  254

Query  769  IPEIWFEEE  795
             PE+W E E
Sbjct  255  FPELWEEGE  263



>gb|EYU40822.1| hypothetical protein MIMGU_mgv1a012429mg [Erythranthe guttata]
Length=251

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/235 (45%), Positives = 166/235 (71%), Gaps = 4/235 (2%)
 Frame = +1

Query  88   KSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFK  267
            ++ R S + ++ ++FDMDDTLY   +GI  A +KNI+++++      E+E   + +EL+K
Sbjct  2    EAARSSRTVYECLLFDMDDTLYPLSLGINMACRKNIEEYMLNHLHIEESEVPRMCLELYK  61

Query  268  KYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRV  447
            ++G+++AGL+ LGY+ D D++H+ VHG LPY L+KPDP LR+LL S+ Q+KIIFTN+D  
Sbjct  62   EHGTTMAGLKTLGYEFDDDQFHAEVHGALPYELLKPDPVLRNLLLSMPQQKIIFTNADEA  121

Query  448  HAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPR  627
            H  +VL R+G++DCF+ +ICFET+NP     S      V+ KP++EAM  A+  A+VDP+
Sbjct  122  HVAQVLSRMGLEDCFQGVICFETLNP----PSETKRTTVLCKPSVEAMEAAIRIANVDPK  177

Query  628  RTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
            +T+F DD+ RNIA+G A GL+T +VG +T    +D+A+  +  + + +PEIW +E
Sbjct  178  KTIFFDDSIRNIASGKAAGLQTVIVGRSTLVPGADHALNSIHNIREALPEIWEDE  232



>ref|XP_010483585.1| PREDICTED: suppressor of disruption of TFIIS-like [Camelina sativa]
 ref|XP_010483586.1| PREDICTED: suppressor of disruption of TFIIS-like [Camelina sativa]
 ref|XP_010483587.1| PREDICTED: suppressor of disruption of TFIIS-like [Camelina sativa]
 ref|XP_010483588.1| PREDICTED: suppressor of disruption of TFIIS-like [Camelina sativa]
Length=267

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 161/258 (62%), Gaps = 7/258 (3%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            V+ S   ++ ++FD+DDTLY    G+  A   NI +F+VEK G  E     L   L+KK+
Sbjct  4    VKTSPPIYECLLFDLDDTLYPFSSGLSDACTNNIIEFMVEKLGIDEEGVVELNDILYKKH  63

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGL+A+GY+ D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK++F+N D  H 
Sbjct  64   GTTMAGLKAVGYEFDNDEYHSFVHGRLPYENLKPDPVLRNLLTSLPFRKLVFSNGDDGHV  123

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPD-------EFPVVLKPAMEAMNIAVDFA  612
            M+ L R+GI+DCFE+II FET+NP ++ ++          E PV+ KP   A   A + A
Sbjct  124  MRALKRLGIEDCFERIISFETLNPVINEAAEVSCETGHLPENPVICKPTEIAFEKAFEIA  183

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
             +DP +TLF DD+ RNI  G AVGL T LVG + K   SDYA+E +  M +  PE+W E 
Sbjct  184  QLDPHKTLFFDDSVRNIQTGKAVGLHTVLVGKSEKVDGSDYALESIHNMKEAFPELWLES  243

Query  793  EVRCSRSEMDSYLATTSV  846
             +    SE   Y    S+
Sbjct  244  NINDKESERIVYATQISI  261



>ref|XP_010455085.1| PREDICTED: suppressor of disruption of TFIIS-like [Camelina sativa]
Length=267

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/258 (45%), Positives = 159/258 (62%), Gaps = 7/258 (3%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            V  S   ++ ++FD+DDTLY    G+  A   NI +F+VEK G  E     L   L+KK+
Sbjct  4    VNTSPPIYECLLFDLDDTLYPFSSGLSDACTNNIIEFMVEKLGIDEEGVVELNDILYKKH  63

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGL+A+GY+ D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK++F+N D  H 
Sbjct  64   GTTMAGLKAVGYEFDNDEYHSFVHGRLPYENLKPDPVLRNLLTSLPFRKLVFSNGDDAHV  123

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLS-------RSSRPDEFPVVLKPAMEAMNIAVDFA  612
            M+ L R+GI+DCFE+II FET+NP ++        +    E PV+ KP   A   A + A
Sbjct  124  MRALKRLGIEDCFERIISFETLNPVINEADEVSCETGHLPENPVICKPTEIAFEKAFEIA  183

Query  613  DVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
             +DP +TLF DD+ RNI  G AVGL T LVG + K   SDYA+E +  M +  PE+W E 
Sbjct  184  QIDPHKTLFFDDSVRNIQTGKAVGLHTVLVGKSEKVDGSDYALESIHNMKEAFPELWLES  243

Query  793  EVRCSRSEMDSYLATTSV  846
             +    SE   Y    S+
Sbjct  244  NINDKESERIVYATQISI  261



>ref|XP_010937594.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Elaeis guineensis]
Length=284

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/258 (44%), Positives = 171/258 (66%), Gaps = 25/258 (10%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R + +P +D ++FD+DDTLY    GI    +KNI D+++EK G  E++ S +   L+K Y
Sbjct  8    RPAQTPNYDCLLFDLDDTLYPYGSGIATECRKNIGDYMIEKLGIEESKISDMCNILYKHY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GY  D D+YHSFVHGRLPY+ +KPDP LR LL S+  RK+IFTN+D+VHA
Sbjct  68   GTTMAGLRAIGYTFDYDDYHSFVHGRLPYDKLKPDPILRHLLLSLPIRKVIFTNADKVHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPN------------------LSRSSRPD------EFP  561
             KVL ++G++DCFE IICFET+NP                   L   S+PD      + P
Sbjct  128  AKVLSKLGLEDCFEGIICFETLNPPTDPSSPSDAPATADVFDILKHFSQPDAGSDLPKTP  187

Query  562  VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAM  741
            +  KP+ ++M  A+  A+++P+RT+F DD+ RNI +G  +GL T LVGT+ + K +D+++
Sbjct  188  IRCKPSTDSMEHALRIANINPQRTIFFDDSVRNIQSGKRIGLHTVLVGTSHRVKGADHSL  247

Query  742  EKVTEMVQVIPEIWFEEE  795
            E +  + + +PE+W + E
Sbjct  248  ENIHNIREALPELWEDAE  265



>ref|XP_010483581.1| PREDICTED: suppressor of disruption of TFIIS-like isoform X1 
[Camelina sativa]
 ref|XP_010483582.1| PREDICTED: suppressor of disruption of TFIIS-like isoform X1 
[Camelina sativa]
Length=267

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/260 (45%), Positives = 165/260 (63%), Gaps = 7/260 (3%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            V +S+  ++ ++FD+DDTLY    G+ +A   NI +F+V+K G  E     L   L++ Y
Sbjct  4    VTNSTPRYECLVFDLDDTLYPLSSGLSEACANNIIEFMVQKLGVEEDRVVELNQLLYRTY  63

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+S+AGL+A+GY+ D DEYHS+VHGRLPY  +KPDP LR+LL S+  RK++F+N D VH 
Sbjct  64   GTSMAGLKAIGYEFDNDEYHSYVHGRLPYENLKPDPVLRNLLLSLPFRKLVFSNGDDVHV  123

Query  454  MKVLDRIGIKDCFEQIICFETMNP------NLSRSSRPDEFPVVLKPAMEAMNIAVDFAD  615
            M+ L R+GI+DCFE+II FET+ P      N   +    E PV+ KPA  A   A + A 
Sbjct  124  MRALKRLGIEDCFERIISFETLKPKTNDAENSCVTGHLPENPVICKPAKIAFEKAFEIAQ  183

Query  616  VDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE  795
            ++P + LF DD+ RNI  G  +GLRT LVG + K   SDYA+E +  M + +PE+W E  
Sbjct  184  LNPHKALFFDDSIRNIQTGKVMGLRTVLVGKSEKVDGSDYALESIHNMKKALPELWSESN  243

Query  796  VRCS-RSEMDSYLATTSVGA  852
               + +SE  SYLA  S+  
Sbjct  244  SNNNKKSERMSYLAQISIAT  263



>gb|KDP28362.1| hypothetical protein JCGZ_14133 [Jatropha curcas]
Length=292

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 163/236 (69%), Gaps = 9/236 (4%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FDMDDTLY    G+  A +KNI++F++      E+E   + +EL+++YG+++AGL
Sbjct  39   YDCLLFDMDDTLYPMSCGLNLACRKNIEEFMLHHLHIEESEVPRMCLELYREYGTTMAGL  98

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            + LGY+ D DE+H+  HGRLPY  +KPDP LR+LL SI QRKIIFTN+D+ HA +VL R+
Sbjct  99   KVLGYEFDDDEFHAIAHGRLPYEKLKPDPVLRNLLLSIPQRKIIFTNADKGHAAEVLKRL  158

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDEFP---------VVLKPAMEAMNIAVDFADVDPR  627
            G++DCFE IICFET+NP +  ++  D            ++ KP++EAM  A++ A+VDP+
Sbjct  159  GLEDCFEGIICFETLNPPVKTANYTDASDDKNCHSKPRILCKPSLEAMEAAIEIANVDPK  218

Query  628  RTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE  795
            +T+F DD+ RNIA+G A GL T +V ++     +D+A+  +  + + IPEIW  EE
Sbjct  219  KTIFFDDSARNIASGKAAGLHTVIVRSSVLVPGADHALSSIHNIKEAIPEIWEGEE  274



>gb|AFK36449.1| unknown [Medicago truncatula]
 gb|KEH22903.1| haloacid dehalogenase-like hydrolase [Medicago truncatula]
Length=301

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 170/288 (59%), Gaps = 43/288 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +A  +NI D++VEK G   +    L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSCGIAKACGQNIKDYMVEKLGIDRSIIDDLSNHLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK+IFTN+D+VHA+K L R+
Sbjct  75   RAIGYDFDYDEYHSFVHGRLPYENLKPDPILRNLLLSLPYRKLIFTNADKVHAIKALSRL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE +ICFET+NP    S   DE                                 
Sbjct  135  GLEDCFEGVICFETLNPIHKNSVSDDEDDIEFVGSSIANHTTNTSASNFQIFDIIGHFAQ  194

Query  556  ---------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
                      P++ KP+  A+ +A+  A++DP+RTLF +D+ RNI AG  VGL T LVG 
Sbjct  195  SNPSQVLPKTPIICKPSEYAIELALKIANLDPQRTLFFEDSARNIQAGKRVGLDTVLVGK  254

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            + + K +DYA+E +  + + +PE+W E E++      +     TSV A
Sbjct  255  SQRIKGADYALESIHNLREAVPELW-ESELKSEVGYPNKLAVETSVTA  301



>ref|XP_010035366.1| PREDICTED: suppressor of disruption of TFIIS [Eucalyptus grandis]
 ref|XP_010035367.1| PREDICTED: suppressor of disruption of TFIIS [Eucalyptus grandis]
 gb|KCW46733.1| hypothetical protein EUGRSUZ_K00553 [Eucalyptus grandis]
 gb|KCW46734.1| hypothetical protein EUGRSUZ_K00553 [Eucalyptus grandis]
Length=280

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 166/257 (65%), Gaps = 24/257 (9%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R   + ++ ++FDMDDTLY    G+  A +KNI++F++ K    E+E   + +EL++++G
Sbjct  6    RSGEAKYECLLFDMDDTLYPMSSGLNLACRKNIEEFMLHKLHIEESEVPRMCLELYREHG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+H++ HGRLPY  +KPDP LR+LL S+ QRKIIFTN D+ H  
Sbjct  66   TTMAGLQALGYEFDNDEFHAYAHGRLPYEALKPDPVLRNLLLSMPQRKIIFTNGDKAHVA  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRP---DEFP---------------------V  564
            +VL R+G++DCFE IICFET+NP L     P   D  P                     +
Sbjct  126  QVLSRLGLEDCFEGIICFETLNPALETVMDPLDSDSVPEDGDIEVDGQIDSDGVSSKMRI  185

Query  565  VLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAME  744
            + KP++EA+  A+  ADVDP +T+F DD+ RNIA+G A GL T +VG++     +D+A+E
Sbjct  186  LCKPSVEAIEAAIKIADVDPSKTIFFDDSARNIASGKAAGLHTVIVGSSALVPGADHALE  245

Query  745  KVTEMVQVIPEIWFEEE  795
             +  + + +PEIW  +E
Sbjct  246  SIHNIREALPEIWEGQE  262



>ref|NP_001242073.1| uncharacterized protein LOC100796466 [Glycine max]
 gb|ACU22970.1| unknown [Glycine max]
Length=302

 Score =   239 bits (611),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 176/288 (61%), Gaps = 43/288 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY  K G+ ++  +NI  ++VEK G   ++   L   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLKSGLAKSCLQNIKHYMVEKLGIDPSKIDDLSNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK+IFTN+D+VHA K L R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRNLLLSLPYRKLIFTNADKVHAAKALSRL  135

Query  475  GIKDCFEQIICFETMNPNL---------------SRSSRPD-------------------  552
            G++DCFE IICFET+NP                 SR++ P                    
Sbjct  136  GLEDCFEGIICFETLNPIHKSTVSDDEDDIEFVGSRTTNPTTCNGSGTSQIFDIIGHFAQ  195

Query  553  --------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
                    + P+V KP+  A+ +A++ A+++P+RTLF +D+TRNI AG  VGL T LVGT
Sbjct  196  PNPGAVLPKTPIVCKPSENAIELAIEIANLNPQRTLFFEDSTRNIQAGKRVGLHTVLVGT  255

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            + + K +DYA+E +  + + +PE+W E +++   +        TSV A
Sbjct  256  SQRCKGADYALESIHNLREAVPELW-EADIKSEVAYPGKLAVETSVTA  302



>ref|NP_001049700.1| Os03g0273800 [Oryza sativa Japonica Group]
 gb|ABF95236.1| haloacid dehalogenase-like hydrolase family protein, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF11614.1| Os03g0273800 [Oryza sativa Japonica Group]
 gb|EAY89431.1| hypothetical protein OsI_10939 [Oryza sativa Indica Group]
 gb|EAZ26429.1| hypothetical protein OsJ_10314 [Oryza sativa Japonica Group]
 dbj|BAG94475.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG86923.1| unnamed protein product [Oryza sativa Japonica Group]
Length=283

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/264 (44%), Positives = 166/264 (63%), Gaps = 24/264 (9%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E +  C  V++    FD ++FD+DDTLY    GI   +KKNI D++VEK G  E++   L
Sbjct  2    EFEDRCHKVQEPK--FDCLLFDLDDTLYPLSSGIASHVKKNIGDYMVEKLGIEESKIENL  59

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY  D DEYHSFVHGRLPY  IKPDP L+ +L+++  RK+IF
Sbjct  60   GNLLYKNYGTTMAGLRAIGYSFDYDEYHSFVHGRLPYENIKPDPVLKHILKNLRIRKLIF  119

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSR-------------------SSRPD  552
            TN D+ HA++ L R+G++DCFE IICFET+NP                        +  D
Sbjct  120  TNGDKDHAVRALKRLGLEDCFEGIICFETLNPPCPSPPCDGEASIFDIAGHFSMPGAAAD  179

Query  553  EF---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTK  723
            E    PV+ KP ++AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT  + K
Sbjct  180  ELPRTPVLCKPNVDAMEEALRIANVNPHKAIFFDDSVRNIQAGKRIGLHTVLVGTPQRVK  239

Query  724  ESDYAMEKVTEMVQVIPEIWFEEE  795
             +D+A+E +  + + +PE+W E E
Sbjct  240  GADHALESIHNIREALPELWEEAE  263



>ref|XP_010920551.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Elaeis guineensis]
Length=284

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/262 (42%), Positives = 170/262 (65%), Gaps = 27/262 (10%)
 Frame = +1

Query  82   FCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVEL  261
            +C++ R     ++ ++FD+DDTLY    G+  A +KNI+D++VEK G  ET+   +   L
Sbjct  7    YCQAQRPK---YECLLFDLDDTLYPYSSGMATACRKNIEDYMVEKLGIQETKIPDMCNLL  63

Query  262  FKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSD  441
            +K YG+++AGLRA+GY+ + D+YH FVHGRLPY+ +KPDP LR LL  +  RK+IFTN+D
Sbjct  64   YKHYGTTMAGLRAIGYNFNYDDYHGFVHGRLPYDKLKPDPVLRHLLLGLPIRKVIFTNAD  123

Query  442  RVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPD-----------------------  552
            ++HA K L+++G++DCFE IICFET+NP    SS  D                       
Sbjct  124  KIHAAKALNKLGLEDCFEGIICFETLNPPSDSSSPCDTTATTNIFDIVEHFSQPAADSEL  183

Query  553  -EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
             + P+  KP+++AM  A+  A+++P+RT+F DD+ RNI +G  VGL T LVG + + K +
Sbjct  184  PKTPIQCKPSIDAMEHALRIANINPQRTIFFDDSVRNIQSGKGVGLHTVLVGKSHRVKGA  243

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + + +PE+W E E
Sbjct  244  DHALESIHNIREALPELWEEAE  265



>ref|NP_001239984.1| uncharacterized protein LOC100787007 [Glycine max]
 gb|ACU22766.1| unknown [Glycine max]
 gb|KHN19787.1| Hypothetical protein glysoja_043254 [Glycine soja]
Length=303

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 121/289 (42%), Positives = 177/289 (61%), Gaps = 44/289 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY  K G+ ++  +NI D++VEK G   ++   L   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLKSGLAKSCLQNIKDYMVEKLGIHPSKIDDLSNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPD  LR+LL S+  RK+IFTN+D+VHA K L+R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENLKPDQVLRNLLLSLPYRKLIFTNADKVHAAKALNRL  135

Query  475  GIKDCFEQIICFETMNPNL---------------SRSSRPD-------------------  552
            G++DCFE IICFET+NP                 SR++ P                    
Sbjct  136  GLEDCFEGIICFETLNPIHKSIVSDDEDDIEFVGSRTTNPTTTCNGSGTSQIFDIIGHFA  195

Query  553  ---------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVG  705
                     + P+V KP+  A+ +A++ A+++P+RTLF +D+TRNI AG  VGL T LVG
Sbjct  196  QLNPSAVLPKTPIVCKPSENAIELALNIANLNPQRTLFFEDSTRNIQAGKRVGLHTVLVG  255

Query  706  TATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            T+ + K +DYA+E +  + + +PE+W E +++   +        TSV A
Sbjct  256  TSQRCKGADYALESIHNLREAVPELW-EADIKSEAAYPGKLAVETSVTA  303



>ref|XP_011094874.1| PREDICTED: uncharacterized protein LOC105174459 isoform X2 [Sesamum 
indicum]
Length=298

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 164/263 (62%), Gaps = 40/263 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A+ KNI D+++EK G  E++   L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGLAAAVLKNIQDYMIEKLGIEESKIPDLCNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP L+SLL S+  RK+IFTN+D+VHA++ L R+
Sbjct  75   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLKSLLSSLPIRKVIFTNADKVHAIEALSRL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    ++  DE                                 
Sbjct  135  GLEDCFEGIICFETLNPTHKSTASDDEDDIEFLGSKQSPNAENGTPEIFDIIGYFSQPDA  194

Query  556  -------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTAT  714
                    P+V KP++ A++ A+  A++DP RTLF +D+ RNI +G  +GL T LVG + 
Sbjct  195  GSSGLPKTPIVCKPSVSAIDRALKIANIDPHRTLFFEDSVRNIQSGKLLGLNTVLVGKSQ  254

Query  715  KTKESDYAMEKVTEMVQVIPEIW  783
            + K +DYA+E +  + + IP++W
Sbjct  255  RVKGADYALESIHNLREAIPQLW  277



>ref|XP_006444646.1| hypothetical protein CICLE_v10021621mg [Citrus clementina]
 ref|XP_006444647.1| hypothetical protein CICLE_v10021621mg [Citrus clementina]
 ref|XP_006492445.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Citrus sinensis]
 ref|XP_006492446.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X3 
[Citrus sinensis]
 gb|ESR57886.1| hypothetical protein CICLE_v10021621mg [Citrus clementina]
 gb|ESR57887.1| hypothetical protein CICLE_v10021621mg [Citrus clementina]
 gb|KDO86747.1| hypothetical protein CISIN_1g024023mg [Citrus sinensis]
 gb|KDO86748.1| hypothetical protein CISIN_1g024023mg [Citrus sinensis]
 gb|KDO86749.1| hypothetical protein CISIN_1g024023mg [Citrus sinensis]
Length=265

 Score =   238 bits (607),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 166/238 (70%), Gaps = 9/238 (4%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +++ ++ ++FD+DDTLY    G   A ++NI++F+ +     E+E   + +EL++++G
Sbjct  6    RTTAANYECLLFDLDDTLYPLSTGFNLACRRNIEEFMSQHLHIDESEVPRMCLELYREHG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+A+GY+ D DE+H+FVHG+LPY  +KPDP LR+LL S+ QRKIIFTN+D+ HAM
Sbjct  66   TTMAGLKAVGYEFDNDEFHAFVHGKLPYEKLKPDPVLRNLLLSMPQRKIIFTNADQKHAM  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFP---------VVLKPAMEAMNIAVDF  609
            +VL R+G++DCFE IICFET+NP L  +   D            ++ KP++EA+  A+  
Sbjct  126  EVLGRLGLEDCFEGIICFETINPRLQPADNTDGIENNSFSSNQRILCKPSLEAIETAIRI  185

Query  610  ADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            A+VDP++T+F DD+ RNIA+  A GL T +VG++     +D+A+  +  + + IPEIW
Sbjct  186  ANVDPKKTIFFDDSARNIASAKAAGLHTVIVGSSVPVPPADHALNSIHNIKEAIPEIW  243



>gb|KEH29061.1| haloacid dehalogenase-like hydrolase [Medicago truncatula]
Length=296

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/264 (43%), Positives = 166/264 (63%), Gaps = 39/264 (15%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            S +D ++FD+DDTLY  + G+ +++ +NI D++VEK G   ++   L   L+K YG++++
Sbjct  14   SKYDCLLFDLDDTLYPLRAGLAKSVLQNIKDYMVEKLGIDSSKIDDLSNLLYKNYGTTMS  73

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK+IFTN+D+VHA+K L 
Sbjct  74   GLRAIGYDFDYDEYHSFVHGRLPYENLKPDPILRNLLLSLPYRKLIFTNADKVHAVKALS  133

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDE-------------------------------  555
            R+G++DCFE IICFET+NP    S   DE                               
Sbjct  134  RLGLEDCFEGIICFETLNPIHKNSVSDDEDDIEFVGSTSTSNSASNTQIFDIINHFAQPN  193

Query  556  --------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTA  711
                     P++ KP+  A+ +A+  A+++P+RTLF +D+ RNI AG  VGL T LVGT+
Sbjct  194  PSLVVLPKTPIICKPSEFAIELALKIANINPQRTLFFEDSVRNIQAGKRVGLDTVLVGTS  253

Query  712  TKTKESDYAMEKVTEMVQVIPEIW  783
             + K +DYA+E +  + + +PE+W
Sbjct  254  QRVKGADYALESIHNLREAVPELW  277



>ref|XP_010443707.1| PREDICTED: suppressor of disruption of TFIIS-like [Camelina sativa]
Length=266

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 118/257 (46%), Positives = 159/257 (62%), Gaps = 6/257 (2%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            V  S   ++ ++FD+DDTLY    G+  A   NI +F+VEK G  E     L   L+KK+
Sbjct  4    VNTSPPRYECLLFDLDDTLYPFSSGLSDACTNNIIEFMVEKLGIDEEGVVELNDILYKKH  63

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGL+A+GY+ D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK+IF+N D  H 
Sbjct  64   GTTMAGLKAVGYEFDNDEYHSFVHGRLPYENLKPDPVLRNLLTSLPFRKLIFSNGDDGHV  123

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLS------RSSRPDEFPVVLKPAMEAMNIAVDFAD  615
            M+ L R+GI+DCFE+II FET+NP ++       +    E PV+ KP   A   A + A 
Sbjct  124  MRALKRLGIEDCFERIISFETLNPVINEAEVSCETGHLPENPVICKPTEIAFEKAFEIAQ  183

Query  616  VDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEE  795
            +DP +TLF DD+ RNI  G AVGL T LVG + K   SDYA+E +  M +  PE+W E  
Sbjct  184  LDPHKTLFFDDSVRNIQTGKAVGLHTILVGKSEKVDGSDYALESIHNMKEAFPELWLESN  243

Query  796  VRCSRSEMDSYLATTSV  846
            +    SE   Y    S+
Sbjct  244  INDKESERIVYATQISI  260



>ref|XP_002515158.1| catalytic, putative [Ricinus communis]
 gb|EEF47142.1| catalytic, putative [Ricinus communis]
Length=283

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/254 (43%), Positives = 164/254 (65%), Gaps = 25/254 (10%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +   ++ ++FDMDDTLY    G+  A +KNI++F++      E+E   + +EL+++YG
Sbjct  6    RANELKYECLLFDMDDTLYPMSSGLNLACRKNIEEFMLHHLNIEESEVPRMCLELYREYG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+A+GY+ D DE+H+F HGRLPY  +KPDP LR+LL S+ QRKIIFTN+D+ HA 
Sbjct  66   TTMAGLKAIGYEFDDDEFHAFAHGRLPYEKLKPDPVLRNLLLSMPQRKIIFTNADKAHAA  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFP-------------------------  561
            +VL R+G++DCFE IICFET+NP L  ++  D                            
Sbjct  126  EVLQRLGLEDCFEGIICFETLNPPLGTANYMDALDDDEVLASGEPQHSDLDDADTNSKPR  185

Query  562  VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAM  741
            ++ KP++EAM  A+  ADVDP+RT+F DD+ RNIA+G A GL T +VG++     +D+ +
Sbjct  186  ILCKPSLEAMEAAIRIADVDPKRTIFFDDSVRNIASGKAAGLHTVIVGSSVLVPGADHVL  245

Query  742  EKVTEMVQVIPEIW  783
              +  + + IPEIW
Sbjct  246  SSIHNIKEAIPEIW  259



>gb|EYU41734.1| hypothetical protein MIMGU_mgv1a011006mg [Erythranthe guttata]
 gb|EYU41735.1| hypothetical protein MIMGU_mgv1a011006mg [Erythranthe guttata]
 gb|EYU41736.1| hypothetical protein MIMGU_mgv1a011006mg [Erythranthe guttata]
Length=295

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/267 (43%), Positives = 164/267 (61%), Gaps = 39/267 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A+  NI  +++EK G  E++   L   L+K YG+++AGL
Sbjct  11   YDCLLFDLDDTLYPLSTGLQAAVLTNIQAYMIEKLGVEESKIPDLCDLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LRSLL S+  RK+IFTN+DRVHA+K L ++
Sbjct  71   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRSLLLSLPIRKVIFTNADRVHAVKALTKL  130

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE I+CFET+NP    ++  DE                                 
Sbjct  131  GLEDCFEGILCFETLNPTHKNTASDDEDDLEFLGSTEPSRKCSNAEIFDIIGHFLKPDAG  190

Query  556  ------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATK  717
                   P++ KP+  A+ +A+  A++DP RTLF +D+ RNI +G  VGL T LVG A +
Sbjct  191  SATLPKTPIICKPSESAIEMALKIANIDPHRTLFFEDSVRNIQSGKRVGLDTVLVGKAQR  250

Query  718  TKESDYAMEKVTEMVQVIPEIWFEEEV  798
             K SDYA+E +  + + IPE+W  ++V
Sbjct  251  VKGSDYALESIHNLREAIPELWEGDKV  277



>ref|XP_006444648.1| hypothetical protein CICLE_v10021621mg [Citrus clementina]
 ref|XP_006492444.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Citrus sinensis]
 gb|ESR57888.1| hypothetical protein CICLE_v10021621mg [Citrus clementina]
 gb|KDO86746.1| hypothetical protein CISIN_1g024023mg [Citrus sinensis]
Length=274

 Score =   238 bits (607),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/238 (44%), Positives = 166/238 (70%), Gaps = 9/238 (4%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +++ ++ ++FD+DDTLY    G   A ++NI++F+ +     E+E   + +EL++++G
Sbjct  15   RTTAANYECLLFDLDDTLYPLSTGFNLACRRNIEEFMSQHLHIDESEVPRMCLELYREHG  74

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+A+GY+ D DE+H+FVHG+LPY  +KPDP LR+LL S+ QRKIIFTN+D+ HAM
Sbjct  75   TTMAGLKAVGYEFDNDEFHAFVHGKLPYEKLKPDPVLRNLLLSMPQRKIIFTNADQKHAM  134

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFP---------VVLKPAMEAMNIAVDF  609
            +VL R+G++DCFE IICFET+NP L  +   D            ++ KP++EA+  A+  
Sbjct  135  EVLGRLGLEDCFEGIICFETINPRLQPADNTDGIENNSFSSNQRILCKPSLEAIETAIRI  194

Query  610  ADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            A+VDP++T+F DD+ RNIA+  A GL T +VG++     +D+A+  +  + + IPEIW
Sbjct  195  ANVDPKKTIFFDDSARNIASAKAAGLHTVIVGSSVPVPPADHALNSIHNIKEAIPEIW  252



>gb|KCW46732.1| hypothetical protein EUGRSUZ_K00553 [Eucalyptus grandis]
Length=300

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/257 (43%), Positives = 166/257 (65%), Gaps = 24/257 (9%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R   + ++ ++FDMDDTLY    G+  A +KNI++F++ K    E+E   + +EL++++G
Sbjct  26   RSGEAKYECLLFDMDDTLYPMSSGLNLACRKNIEEFMLHKLHIEESEVPRMCLELYREHG  85

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+H++ HGRLPY  +KPDP LR+LL S+ QRKIIFTN D+ H  
Sbjct  86   TTMAGLQALGYEFDNDEFHAYAHGRLPYEALKPDPVLRNLLLSMPQRKIIFTNGDKAHVA  145

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRP---DEFP---------------------V  564
            +VL R+G++DCFE IICFET+NP L     P   D  P                     +
Sbjct  146  QVLSRLGLEDCFEGIICFETLNPALETVMDPLDSDSVPEDGDIEVDGQIDSDGVSSKMRI  205

Query  565  VLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAME  744
            + KP++EA+  A+  ADVDP +T+F DD+ RNIA+G A GL T +VG++     +D+A+E
Sbjct  206  LCKPSVEAIEAAIKIADVDPSKTIFFDDSARNIASGKAAGLHTVIVGSSALVPGADHALE  265

Query  745  KVTEMVQVIPEIWFEEE  795
             +  + + +PEIW  +E
Sbjct  266  SIHNIREALPEIWEGQE  282



>ref|XP_011077641.1| PREDICTED: uncharacterized protein LOC105161601 [Sesamum indicum]
Length=297

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/261 (44%), Positives = 163/261 (62%), Gaps = 38/261 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  ++ KNI D++VEK G  +++  AL   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLSSGLATSVLKNIQDYMVEKLGIEQSKIPALCDLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LRSLL S+  RK+IFTN+D+VHA+KVL R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRSLLLSLPIRKVIFTNADKVHAVKVLRRL  135

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    ++  DE                                 
Sbjct  136  GLEDCFEGIICFETLNPTHKSTASDDEDDVEFLGLKQSSCASNPEIFDIIGHFAQSNAES  195

Query  556  -----FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKT  720
                  P+V KP+  A+  A+  A+++P RTLF +D+ RNI +G  VGL T LVG + + 
Sbjct  196  SGLPKTPIVCKPSESAIERALKIANINPHRTLFFEDSVRNIQSGKHVGLDTVLVGKSQRV  255

Query  721  KESDYAMEKVTEMVQVIPEIW  783
            K +DYA+E +  + + I E+W
Sbjct  256  KGADYALESIHNLREAIAELW  276



>ref|XP_002283297.1| PREDICTED: uncharacterized protein C24B11.05 [Vitis vinifera]
Length=290

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 165/258 (64%), Gaps = 30/258 (12%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            D +S +D ++FD+DDTLY    G+   + KNI +++++K G  E +   +   L+K YG+
Sbjct  10   DQTSKYDCLLFDIDDTLYPLSSGLSAQITKNIQEYMLQKLGIEEDKVPEMCALLYKHYGT  69

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            ++AGLRA+GY+ D D++HSFVHGRLPY L+KPDP LRSLL S+  RK++FTN+D+ HA +
Sbjct  70   TMAGLRAIGYNFDYDDFHSFVHGRLPYELLKPDPVLRSLLLSLPIRKVVFTNADKGHAAR  129

Query  460  VLDRIGIKDCFEQIICFETMNP----NLSRSSRPDEF-----------------------  558
            VL+R+G++DCFE +ICFET+NP    ++S +    E                        
Sbjct  130  VLNRLGLEDCFEGVICFETLNPINKSSVSEAEHGSELGGSGTGSAGICDINHLLSVGSVL  189

Query  559  ---PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
               P+V KP  +A   A   A +DPR+TLF DD+ RN+  G +VGL T LVG++ KTK +
Sbjct  190  PRTPIVCKPFTDAFEEASKIAKIDPRKTLFFDDSFRNLQGGKSVGLHTVLVGSSHKTKGA  249

Query  730  DYAMEKVTEMVQVIPEIW  783
            DYA+E +  + + +PE+W
Sbjct  250  DYALESIHNIREALPELW  267



>ref|XP_006572870.1| PREDICTED: uncharacterized protein LOC100796466 isoform X1 [Glycine 
max]
 gb|KHN48352.1| Hypothetical protein glysoja_042304 [Glycine soja]
Length=302

 Score =   239 bits (609),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 121/288 (42%), Positives = 175/288 (61%), Gaps = 43/288 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY  K G+ ++  +NI  ++VEK G   ++   L   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLKSGLAKSCLQNIKHYMVEKLGIDPSKIDDLSNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  RK+IFTN+D+VHA K L R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRNLLLSLPYRKLIFTNADKVHAAKALSRL  135

Query  475  GIKDCFEQIICFETMNPNL---------------SRSSRPD-------------------  552
            G++DCFE IICFET+NP                 SR++ P                    
Sbjct  136  GLEDCFEGIICFETLNPIHKSTVSDDEDDIEFVGSRTTNPTTCNGSGTSQIFDIIGHFAQ  195

Query  553  --------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
                    + P+V KP+  A+ +A+  A+++P+RTLF +D+TRNI AG  VGL T LVGT
Sbjct  196  PNPGAVLPKTPIVCKPSENAIELAIKIANLNPQRTLFFEDSTRNIQAGKRVGLHTVLVGT  255

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            + + K +DYA+E +  + + +PE+W E +++   +        TSV A
Sbjct  256  SQRCKGADYALESIHNLREAVPELW-EADIKSEVAYPGKLAVETSVTA  302



>emb|CDY10459.1| BnaCnng03600D [Brassica napus]
Length=280

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 165/247 (67%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++  +D ++FD+DDTLY    GI +   +NI D++VE+ G P+ +   L   L+K YG++
Sbjct  11   TTQKYDCLLFDLDDTLYPLSTGIARECGQNIKDYMVEELGIPKDKIVELSNLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D DEYHSFVHGRLPY+ IKPDP LRSLL S+  RK+IFTN+DRVHA+K 
Sbjct  71   MAGLRAIGYDFDYDEYHSFVHGRLPYDNIKPDPVLRSLLLSLPLRKVIFTNADRVHAVKA  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPD--------------------EFPVVLKPAM  582
            L R+G++DCFE IICFET+NP  + ++  D                    + P+V KP+ 
Sbjct  131  LKRLGLEDCFEGIICFETLNPTHTNAASGDTEIFDIVGHFDRSEPVSLLPKTPIVCKPSE  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG + K K +DY +E +  M 
Sbjct  191  AAIEKALEIANIDPNRTLFFEDSVRNVQAGKRVGLDTVLVGASNKVKGADYVLENIHNMK  250

Query  763  QVIPEIW  783
            + IPE+W
Sbjct  251  EAIPELW  257



>ref|XP_011094872.1| PREDICTED: uncharacterized protein LOC105174459 isoform X1 [Sesamum 
indicum]
Length=309

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/263 (43%), Positives = 164/263 (62%), Gaps = 40/263 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A+ KNI D+++EK G  E++   L   L+K YG+++AGL
Sbjct  26   YDCLLFDLDDTLYPLSSGLAAAVLKNIQDYMIEKLGIEESKIPDLCNLLYKNYGTTMAGL  85

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP L+SLL S+  RK+IFTN+D+VHA++ L R+
Sbjct  86   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLKSLLSSLPIRKVIFTNADKVHAIEALSRL  145

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    ++  DE                                 
Sbjct  146  GLEDCFEGIICFETLNPTHKSTASDDEDDIEFLGSKQSPNAENGTPEIFDIIGYFSQPDA  205

Query  556  -------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTAT  714
                    P+V KP++ A++ A+  A++DP RTLF +D+ RNI +G  +GL T LVG + 
Sbjct  206  GSSGLPKTPIVCKPSVSAIDRALKIANIDPHRTLFFEDSVRNIQSGKLLGLNTVLVGKSQ  265

Query  715  KTKESDYAMEKVTEMVQVIPEIW  783
            + K +DYA+E +  + + IP++W
Sbjct  266  RVKGADYALESIHNLREAIPQLW  288



>gb|KHG12961.1| putative C24B11.05 [Gossypium arboreum]
Length=298

 Score =   238 bits (607),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/285 (42%), Positives = 168/285 (59%), Gaps = 40/285 (14%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +A   NI D++VEK G  + +   L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGLAKACGNNIKDYMVEKLGIGKEKIVELSNYLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D D+YHS+VHG LPY  +K DP+LRSLL ++  RKIIFTN+DRVHA+K L ++
Sbjct  75   RAVGYDFDYDDYHSYVHGGLPYENLKADPQLRSLLLTLPIRKIIFTNADRVHAIKALSKL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    +   DE                                 
Sbjct  135  GLEDCFEGIICFETLNPTHKNTVSDDEDDVEFLGSVSATTGVANNPEIFDIIGHFADPKP  194

Query  556  ------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATK  717
                   P+V KP   A+ +A+  A ++P+RTLF DD+ RNI AG  VGL T LVGT+ +
Sbjct  195  GATLPKTPIVCKPQDSAIELALKIAKINPQRTLFFDDSVRNIQAGKRVGLHTVLVGTSQR  254

Query  718  TKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
             K +DYA+E +  + Q +PE+W E +V+   S        TSV A
Sbjct  255  PKGADYALESIHNIKQALPELW-ETDVKSDVSYAGQVAVETSVTA  298



>gb|KHG16693.1| putative C24B11.05 [Gossypium arboreum]
Length=271

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/230 (45%), Positives = 163/230 (71%), Gaps = 3/230 (1%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R + + ++ ++FDMDDTLY    G   A +KNI++F+++     E+E   + +EL+++YG
Sbjct  22   RAAGAKYECLLFDMDDTLYPLSTGFNLACRKNIEEFMLKYLNIEESEVPRMCLELYREYG  81

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ LGY+ D DE+H++ HGRLPY  ++PDP LR+LL ++ QRKIIFTN+D+ HA+
Sbjct  82   TTMAGLKVLGYEFDNDEFHAYAHGRLPYETLRPDPVLRNLLLAMPQRKIIFTNADKAHAL  141

Query  457  KVLDRIGIKDCFEQIICFETMN-PNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRT  633
            +VL R+ ++DCFE IICFET+N P L   +     P++ KP++EA   A+  A++DP++T
Sbjct  142  QVLKRLALEDCFEGIICFETLNHPPLQPPALKS--PILCKPSLEAFEAAIRVANLDPKKT  199

Query  634  LFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            +F DD+ RNIA+G A GL T +VG +T    +D+A+  +  + + IPEIW
Sbjct  200  IFFDDSARNIASGKAAGLHTVIVGNSTLVPGADHALRSIHNIKEAIPEIW  249



>ref|XP_009143463.1| PREDICTED: uncharacterized protein C24B11.05-like [Brassica rapa]
 ref|XP_009143464.1| PREDICTED: uncharacterized protein C24B11.05-like [Brassica rapa]
Length=275

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 166/249 (67%), Gaps = 24/249 (10%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +   +NI D++VEK G  +++   L   L+K YG+++AGL
Sbjct  8    YDTLLFDLDDTLYPLSSGIARECGQNIKDYMVEKLGIDKSKILELSNSLYKNYGTTMAGL  67

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHS+VHGRLPY+ IKPDP LR++L S+  RKIIFTN+D++HA++ L+R+
Sbjct  68   RAIGYDFDYDEYHSYVHGRLPYDNIKPDPILRTILLSLPLRKIIFTNADKLHAVRALERL  127

Query  475  GIKDCFEQIICFETMNPN-----------------------LSRSSRPDEFPVVLKPAME  585
            G++DCFE I+CFE++N                          S S  P + P++ KP+  
Sbjct  128  GLEDCFEGIVCFESLNSTNRDNIHDNNEIFDIITYLSSDHEHSFSGLP-KTPIICKPSET  186

Query  586  AMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQ  765
            A+  A++ A++DP+RTLF +D+ RNI AG  VGL T LVGT+ + K +DYA+E +  + +
Sbjct  187  AIVKAIEIANIDPKRTLFFEDSVRNIQAGKRVGLSTVLVGTSQRVKCADYAVENIHNLKE  246

Query  766  VIPEIWFEE  792
             +PE+W  E
Sbjct  247  ALPELWESE  255



>ref|XP_010262543.1| PREDICTED: uncharacterized protein LOC104601051 [Nelumbo nucifera]
Length=296

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 165/263 (63%), Gaps = 36/263 (14%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+    +KNI+D++V+K G  +++   +   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGLAMECRKNIEDYMVQKLGIEQSKIPDMCNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D D+YH FVHGRLPY  +KPDP LR+LL S+  RK+IFTN+DR+HA KVL ++
Sbjct  75   RAIGYDFDYDDYHGFVHGRLPYENLKPDPVLRNLLLSLPIRKVIFTNADRIHAAKVLRKL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    S   DE                                 
Sbjct  135  GLEDCFEGIICFETLNPTHKHSVSDDEDASEFGDSKPTTTACTEYFDIIGHFSQAHAGSE  194

Query  556  ---FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKE  726
                P+V KP+  A+  A+  A+++P+RT+F +D+ RNI +G  VGL T LVGT+ +TK 
Sbjct  195  LPKTPIVCKPSESAIERALKIANINPQRTMFFEDSVRNIQSGKRVGLHTVLVGTSHRTKG  254

Query  727  SDYAMEKVTEMVQVIPEIWFEEE  795
            +D+A+E +  + + +PE+W  EE
Sbjct  255  ADFALESIHNIREALPELWEAEE  277



>ref|XP_008784612.1| PREDICTED: uncharacterized protein C24B11.05 [Phoenix dactylifera]
Length=284

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/258 (43%), Positives = 170/258 (66%), Gaps = 25/258 (10%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P ++ ++FD+DDTLY    GI    +KNI+D++VEK G  E++   +   L+K Y
Sbjct  8    RQAQRPKYECLLFDLDDTLYPYNSGIASQCRKNIEDYMVEKLGIEESKIPDMCNLLYKYY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GY+ + D+YHSFVHGRLPY+ +KPDP LR LL ++  RK+IFTN+D++HA
Sbjct  68   GTTMAGLRAIGYNFNYDDYHSFVHGRLPYDKLKPDPVLRHLLLNLPIRKVIFTNADKIHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRPD------------------------EFP  561
             KVL+++G++DCFE IICFET+N   + SS  D                        + P
Sbjct  128  AKVLNKLGLEDCFEGIICFETLNAQSNSSSPCDPTAATNIFNILEHFSQPAAGSELPKTP  187

Query  562  VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAM  741
            +  KP+M+AM  A+  A++ P+R++F DD+ RNI +G ++GL T LVG + + K +D+A+
Sbjct  188  IQCKPSMDAMEHALRIANISPQRSIFFDDSVRNIQSGKSIGLHTVLVGNSHRVKGADHAL  247

Query  742  EKVTEMVQVIPEIWFEEE  795
            E +  + + +PE+W E E
Sbjct  248  ESIHNIKEALPELWEEAE  265



>ref|XP_010909508.1| PREDICTED: uncharacterized protein C24B11.05 [Elaeis guineensis]
 ref|XP_010909515.1| PREDICTED: uncharacterized protein C24B11.05 [Elaeis guineensis]
 ref|XP_010909524.1| PREDICTED: uncharacterized protein C24B11.05 [Elaeis guineensis]
Length=295

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/269 (40%), Positives = 165/269 (61%), Gaps = 42/269 (16%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + + ++ ++FDMDDTLY    G+  A +KNI D+++      E++   + +EL+K+YG++
Sbjct  6    TGAKYECLLFDMDDTLYPLSFGLNLACRKNIQDYMLHHLQIEESQVPKMCMELYKEYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ALG+  D DE+HS+VHGRLPY +++PDP L++LL SI QRKIIFTN+D  H  KV
Sbjct  66   MAGLKALGFKFDNDEFHSYVHGRLPYEILRPDPMLKNLLLSIPQRKIIFTNADEAHVEKV  125

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPDE-----------------------------  555
            L ++G++DCFE +ICFET+NP L  +   DE                             
Sbjct  126  LSKLGLEDCFEGVICFETLNPPLKPTDHHDEKDITVPSTVIQSMGQNGDGCFSETNSETD  185

Query  556  -------------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTA  696
                          P++ KP+MEA+  A+  AD++PR+T+F DD+TRNIAAG A GL T 
Sbjct  186  TIYCADPSNANSNMPILCKPSMEAIKAAIKLADINPRKTIFFDDSTRNIAAGKAAGLHTV  245

Query  697  LVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            +VG++     +D+A+  +  + + +PEIW
Sbjct  246  IVGSSVLVPGADHALRSIHNIKEALPEIW  274



>ref|XP_009349464.1| PREDICTED: uncharacterized protein LOC103941004 [Pyrus x bretschneideri]
Length=297

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/263 (45%), Positives = 162/263 (62%), Gaps = 38/263 (14%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            + FD ++FD+DDTLY    GI  A + NI+D++VEK G   +    L   L+K YG+++A
Sbjct  13   TKFDCLLFDLDDTLYPYSSGIATACRINIEDYMVEKLGIDRSIIPELGNLLYKNYGTTMA  72

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GYD D DEYHSFVHGRLPY  IKPDP LRSLL ++  RKIIFTN+D++HA K L 
Sbjct  73   GLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNADKIHAAKALS  132

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPDE-------------------------------  555
            R+G++D FE IICFET+NP    +   DE                               
Sbjct  133  RLGLEDIFEGIICFETLNPIHKNTVSDDEDDIEFVGLSSTTTTTSSSQIFDIIGHFATAN  192

Query  556  -------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTAT  714
                    P+V KP+ +A+  A+  A+++P+RTLF +D+ RNI AG  VGL+T LVGT+ 
Sbjct  193  PTSKLPKTPIVCKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKRVGLQTVLVGTSQ  252

Query  715  KTKESDYAMEKVTEMVQVIPEIW  783
            + K +DYA+E +  + + IPE+W
Sbjct  253  RVKGADYALESIHNLREAIPELW  275



>emb|CDX74940.1| BnaA05g06860D [Brassica napus]
Length=275

 Score =   236 bits (603),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/248 (45%), Positives = 164/248 (66%), Gaps = 22/248 (9%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +   +NI D++VEK G  +++   L   L+K YG+++AGL
Sbjct  8    YDTLLFDLDDTLYPLSSGIARECGQNIKDYMVEKLGIDKSKILELSNSLYKNYGTTMAGL  67

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHS+ HGRLPY+ IKPDP LR++L S+  RKIIFTN+D++HA + L+R+
Sbjct  68   RAIGYDFDYDEYHSYAHGRLPYDNIKPDPILRTILLSLPLRKIIFTNADKLHAARALERL  127

Query  475  GIKDCFEQIICFETMNP-NLSRSSRPDEF---------------------PVVLKPAMEA  588
            G++DCFE I+CFE++N  N  +    DE                      P+V KP+  A
Sbjct  128  GLEDCFEGIVCFESLNSTNREQIHDNDEIFDIITYLSSDHEHPLSGLPKTPIVCKPSETA  187

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
            +  A++ A++DP+RTLF +D+ RNI AG  VGL T LVGT+ + K +DYA+E +  + + 
Sbjct  188  IVKAIEIANIDPKRTLFFEDSVRNIQAGKRVGLSTVLVGTSQRVKCADYAVENIHNLKEA  247

Query  769  IPEIWFEE  792
            +PE+W  E
Sbjct  248  LPELWESE  255



>ref|XP_009416677.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=286

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/277 (40%), Positives = 173/277 (62%), Gaps = 39/277 (14%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FDMDDTLY    G+  A +KNI+D+++      E++   + +EL+K+YG+++AGL
Sbjct  10   YECLLFDMDDTLYPLSSGLNLACRKNIEDYMLHHLQIEESQVPKMCLELYKEYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H++VHGRLPY ++KPDP LR+LL S+ QRKII TN+D+ HA +VL R+
Sbjct  70   KALGYEFDDDEFHAYVHGRLPYEILKPDPLLRNLLLSMPQRKIILTNADKAHAARVLSRL  129

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDEFP-------------------------------  561
            G++DCFE + CFET+NP   ++   D                                  
Sbjct  130  GLEDCFEGVTCFETLNPPRQQNGSADGHGNFGETDSNTDGESDSSADTAGCVGGRKSNSK  189

Query  562  --VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDY  735
              ++ KP++EA+  A+  A++DP+RT+FLDD+ RNIAAG A GL T LVG+ T    +D 
Sbjct  190  GRILCKPSLEAIEAAIKIANIDPKRTIFLDDSARNIAAGKAAGLHTVLVGSPTLVPGADV  249

Query  736  AMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            A+E +  M + +PEIW + +      +++  LA T+V
Sbjct  250  ALESIHNMREALPEIWKDGD------KLEPVLAATAV  280



>ref|NP_001268146.1| ripening-related protein-like [Vitis vinifera]
 emb|CAB85628.1| putative ripening-related protein [Vitis vinifera]
Length=301

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/265 (43%), Positives = 167/265 (63%), Gaps = 42/265 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +A + NI+D++VEK G  + + + L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGLAKACRNNIEDYMVEKLGIEKNKIADLGNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LRSLL S+  RK+IFTN+D+VHA K L R+
Sbjct  75   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRSLLLSLPIRKVIFTNADKVHAAKALSRL  134

Query  475  GIKDCFEQIICFETMNPN------------------------------------LSRSSR  546
            G++DCFE +ICFET+NP+                                    +   S+
Sbjct  135  GLEDCFEGVICFETLNPSHKSTVSDDEDDIAFVRLTANTATATTTTSSTEIFDIIGHFSQ  194

Query  547  PD------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
            P+      + P+V KP+  A+  A+  A+++P+RTLF +D+ RNI +G  VGL T LVGT
Sbjct  195  PNAGTALPKTPIVCKPSEAAIERALRIANINPQRTLFFEDSARNIQSGKRVGLHTVLVGT  254

Query  709  ATKTKESDYAMEKVTEMVQVIPEIW  783
            + + K +D+A+E +  M + +PE+W
Sbjct  255  SQRIKGADFALESIHNMREALPELW  279



>ref|XP_011039981.1| PREDICTED: uncharacterized protein C24B11.05-like [Populus euphratica]
Length=296

 Score =   237 bits (604),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/272 (41%), Positives = 172/272 (63%), Gaps = 40/272 (15%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +   ++ ++FDMDDTLYS  +G+  A +KNI++F+++K    E+E   + +EL++++G
Sbjct  6    RANGPKYECLLFDMDDTLYSLSLGLNLACRKNIEEFMLQKLHIEESEVPRMCLELYREHG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+H+FVHGRLPY  +KPDP LR+LL S+ QRKIIFTN+D+ HA 
Sbjct  66   TTMAGLKALGYEFDDDEFHAFVHGRLPYETLKPDPVLRNLLLSLPQRKIIFTNADKAHAA  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSR----------------SSRPDEFP---------  561
            +VL R+G++DCFE +IC+ET+NP L                   S P +F          
Sbjct  126  EVLKRMGLEDCFEGVICYETLNPPLENENNKDALDNDAVIAGGESEPSDFDGNAATGSKK  185

Query  562  ---------------VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTA  696
                           ++ KP++EA+  A+  A+VDP++T+F DD+ RNIA+G A GLRT 
Sbjct  186  ILKNALDNGISSKSRILCKPSLEAIEAAIQIANVDPKKTIFFDDSARNIASGKAAGLRTV  245

Query  697  LVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
            +VG++     +D  +  +  + + IPEIW +E
Sbjct  246  IVGSSVLVPGADQCLMNIHNIKEAIPEIWEDE  277



>ref|XP_007140519.1| hypothetical protein PHAVU_008G119500g [Phaseolus vulgaris]
 gb|ESW12513.1| hypothetical protein PHAVU_008G119500g [Phaseolus vulgaris]
Length=302

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 180/296 (61%), Gaps = 45/296 (15%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P +D ++FD+DDTLY    GI  A  +NI D++VEK G  +++   L   L+K Y
Sbjct  8    RQNQRPKYDCLLFDLDDTLYPLSTGIANACGQNIKDYMVEKLGIEKSKIDDLSNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GYD D DEYHSFVHGRLPY  +KPD  LR+LL S+  RK+IFTNSD+VHA
Sbjct  68   GTTMAGLRAIGYDFDYDEYHSFVHGRLPYENLKPDQVLRNLLLSLPYRKLIFTNSDKVHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNP----------------------------NLSRS---  540
            +K L R+G++DCFE IICFET+NP                            N S S   
Sbjct  128  VKALSRLGLEDCFEGIICFETLNPIHKSTVSDDEDDIEFMGVSSTTNPTTKKNASGSQIF  187

Query  541  ------SRPD------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVG  684
                  S+P+      + P++ KP+  A+ +++  A+++P+RTLF +D+ RNI AG  VG
Sbjct  188  DIIAHFSQPNPNTVLPKTPIICKPSENAIELSLKIANLNPQRTLFFEDSVRNIQAGKRVG  247

Query  685  LRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            L T LVG + + K +DYA+E +  + + +PE+W E++++   +   +    TSV A
Sbjct  248  LHTVLVGKSQRIKGADYALESIHNLREAVPELW-EDDIKSEVAYPGNLAVETSVTA  302



>gb|AGV54701.1| ripening-related protein [Phaseolus vulgaris]
Length=302

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/296 (42%), Positives = 180/296 (61%), Gaps = 45/296 (15%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P +D ++FD+DDTLY    GI  A  +NI D++VEK G  +++   L   L+K Y
Sbjct  8    RQNQRPKYDCLLFDLDDTLYPLSTGIANACGQNIKDYMVEKLGIEKSKIDDLSNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GYD D DEYHSFVHGRLPY  +KPD  LR+LL S+  RK+IFTNSD+VHA
Sbjct  68   GTTMAGLRAIGYDFDYDEYHSFVHGRLPYENLKPDQVLRNLLLSLPYRKLIFTNSDKVHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNP----------------------------NLSRS---  540
            +K L R+G++DCFE IICFET+NP                            N S S   
Sbjct  128  VKALSRLGLEDCFEGIICFETLNPIHKSTVFDDEDDIEFMGVSSTTNPTTKKNASGSQIF  187

Query  541  ------SRPD------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVG  684
                  S+P+      + P++ KP+  A+ +++  A+++P+RTLF +D+ RNI AG  VG
Sbjct  188  DIIAHFSQPNPNTVLPKTPIICKPSENAIELSLKIANLNPQRTLFFEDSVRNIQAGKRVG  247

Query  685  LRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            L T LVG + + K +DYA+E +  + + +PE+W E++++   +   +    TSV A
Sbjct  248  LHTVLVGKSQRIKGADYALESIHNLREAVPELW-EDDIKSEVAYPGNLAVETSVTA  302



>ref|XP_010238970.1| PREDICTED: uncharacterized protein LOC100821281 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010239011.1| PREDICTED: uncharacterized protein LOC100821281 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010239047.1| PREDICTED: uncharacterized protein LOC100821281 isoform X1 [Brachypodium 
distachyon]
 ref|XP_010239081.1| PREDICTED: uncharacterized protein LOC100821281 isoform X1 [Brachypodium 
distachyon]
Length=281

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/270 (41%), Positives = 176/270 (65%), Gaps = 30/270 (11%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FDMDDTLY    GI  A +KNI D++ +     E++ + + + L+++YG+++AGL
Sbjct  10   YECLLFDMDDTLYPLSAGINLACRKNIQDYMRDHLQIEESQIAEMCLGLYREYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H+ VHG LPY+ ++PDP LR+LL SI QRKIIFTNSD+VHA ++L R+
Sbjct  70   KALGYEFDNDEFHANVHGTLPYDNLRPDPVLRTLLLSIPQRKIIFTNSDKVHAEEILCRL  129

Query  475  GIKDCFEQIICFETMNP--------------------------NLSRSSRPDEFPVVLKP  576
            G++DCFE +ICFET+NP                          +L+RS    + P++ KP
Sbjct  130  GLEDCFEGVICFETLNPPAAPSNGLSKSQDCMLFSGEPSSDLNDLNRSDLRPKSPILCKP  189

Query  577  AMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE  756
             +E+M  A+   +VDP++T+F DD+ RNIA+G A G  T +VG ++  + +D+A+E +  
Sbjct  190  TIESMEAAIRITNVDPKKTIFFDDSIRNIASGKAAGFHTVIVGRSSVVRGADHALESIHN  249

Query  757  MVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            + + +PE+W   +    RSE D+ LA+ +V
Sbjct  250  IKEALPELWEGHD----RSESDAVLASAAV  275



>ref|XP_009375913.1| PREDICTED: uncharacterized protein LOC103964681 [Pyrus x bretschneideri]
Length=273

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/251 (46%), Positives = 159/251 (63%), Gaps = 20/251 (8%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY    GI   + KNI +++++K G  E+E   L + L+K YG+++AGL
Sbjct  10   YECLLFDLDDTLYPLSSGISVQITKNIKEYMIQKLGMDESEVPELCISLYKDYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +A GY+ D D++HSFVHGRLPY L  PDP LR LL S+  RK+IFTNSD+ HA  VL R+
Sbjct  70   KAQGYNFDYDDFHSFVHGRLPYELFTPDPVLRGLLLSLPIRKVIFTNSDKKHADTVLKRL  129

Query  475  GIKDCFEQIICFETMNP--NLSRSSRPDE---------------FPVVLKPAMEAMNIAV  603
            GI+DCFE ++CFET+NP  N   S   +E                PVV KP   A   A 
Sbjct  130  GIEDCFESVVCFETLNPTNNADDSVGAEETEHIEQPNTGAVVPKTPVVCKPFKLAYEEAF  189

Query  604  DFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
             FA++DP+RTLF DD+ RNI      GL T LVGT+ +TK  DYA+E +  M + +PE+W
Sbjct  190  KFANIDPQRTLFFDDSIRNIKTAKQCGLHTVLVGTSHRTKGVDYALESIHNMKEALPELW  249

Query  784  FEEEVRCSRSE  816
               E+   +SE
Sbjct  250  ---EITTEQSE  257



>ref|XP_008387783.1| PREDICTED: uncharacterized protein LOC103450242 [Malus domestica]
Length=297

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 121/274 (44%), Positives = 166/274 (61%), Gaps = 41/274 (15%)
 Frame = +1

Query  76   DSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRV  255
            D F ++ R   + FD + FD+DDTLY    GI  A + NI+D++VEK G   +    L  
Sbjct  5    DRFMQAQR---TKFDCLXFDLDDTLYPYXSGIATACRINIEDYMVEKLGIDRSIIPELGN  61

Query  256  ELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTN  435
             L+K YG+++AGLRA+GYD D DEYHSFVHGRLPY  IKPDP LRSLL ++  RKIIFTN
Sbjct  62   LLYKNYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTN  121

Query  436  SDRVHAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDE--------------------  555
            +D++HA K L R+G++D FE IICFET+NP    +   DE                    
Sbjct  122  ADKIHAAKALSRLGLEDIFEGIICFETLNPIHKNTVSDDEDDIEFVGLSSTTTTTSSSQI  181

Query  556  ------------------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAV  681
                               P+V KP+ +A+  A+  A+++P+RTLF +D+ RNI AG  V
Sbjct  182  FDIIGHFATPNPTSKLPKTPIVCKPSEDAIERALKIANINPQRTLFFEDSVRNIQAGKRV  241

Query  682  GLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            GL+T LVGT+ + K +DYA+E +  + + IPE+W
Sbjct  242  GLQTVLVGTSQRVKGADYALESIHNLREAIPELW  275



>ref|XP_002463244.1| hypothetical protein SORBIDRAFT_02g040450 [Sorghum bicolor]
 gb|EER99765.1| hypothetical protein SORBIDRAFT_02g040450 [Sorghum bicolor]
Length=253

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 161/227 (71%), Gaps = 1/227 (0%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + + FD ++FDMDDTLY   +GI  A +KNI+++++ K    E++   + ++L+++YG++
Sbjct  6    AGAKFDCLLFDMDDTLYPLSLGINLACRKNIEEYMLNKLRIEESQVPKMCLDLYREYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ LGYD D D++H+ VHG LPY  +KPDP LR LL S+ QRKIIFTNSD+ HA +V
Sbjct  66   MAGLKVLGYDFDYDDFHACVHGTLPYEKVKPDPVLRQLLLSLPQRKIIFTNSDKAHAARV  125

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFL  642
            L+++G++DCFE IICFET+NP  +   + D   ++ KP++E+M   ++ A +D +RT+F 
Sbjct  126  LEKLGLEDCFEGIICFETLNPPPTE-KKDDGRGILCKPSLESMEAVIEIAKLDAKRTVFF  184

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            DD+ RNIAAG A G  T +VG++     +D A+E +  + + +PE+W
Sbjct  185  DDSARNIAAGKAAGFHTVIVGSSALVPGADVALESIHNIKEALPELW  231



>ref|XP_009122797.1| PREDICTED: uncharacterized protein C24B11.05 [Brassica rapa]
 emb|CDY40341.1| BnaA10g27270D [Brassica napus]
Length=280

 Score =   236 bits (602),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 165/247 (67%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            ++  +D ++FD+DDTLY    GI +   +NI D++VE+ G P+ +   L   L+K YG++
Sbjct  11   TTQKYDCLLFDLDDTLYPLSTGIARECGQNIKDYMVEELGIPKDKIVELSNLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D DEYHSFVHGRLPY+ IKPDP LRSLL S+  RK+IFTN+DRVHA+K 
Sbjct  71   MAGLRAIGYDFDYDEYHSFVHGRLPYDNIKPDPVLRSLLLSLPLRKVIFTNADRVHAVKA  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSR--SSRPDEF------------------PVVLKPAM  582
            L R+G++DCFE IICFET+NP  ++  S   D F                  P+V KP+ 
Sbjct  131  LKRLGLEDCFEGIICFETLNPTHTKTASGNTDIFDIVGHFDRSESVSLLPKTPIVCKPSD  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG + K K +DY +E +  M 
Sbjct  191  SAIENALEIANIDPSRTLFFEDSVRNVQAGKRVGLDTVLVGASNKVKGADYVLENIHNMK  250

Query  763  QVIPEIW  783
            + +PE+W
Sbjct  251  EALPELW  257



>ref|XP_004302743.1| PREDICTED: uncharacterized protein LOC101294772 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=302

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/265 (43%), Positives = 162/265 (61%), Gaps = 42/265 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A + NI+D++VEK G   +    L   L+K YG+++AGL
Sbjct  16   YDCLLFDLDDTLYPLSTGVATACRINIEDYMVEKLGIERSIIPELGNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  IKPDP LRSLL ++  RKIIFTN+D+VHA K L R+
Sbjct  76   RAIGYDFDYDEYHSFVHGRLPYENIKPDPVLRSLLLNLPYRKIIFTNADKVHAAKALSRL  135

Query  475  GIKDCFEQIICFETMNP------------------------------------------N  528
            G++DCFE I+CFET+NP                                           
Sbjct  136  GLEDCFEGILCFETLNPIHKSTVSDDEDDIEFVGLSTAQVPPTTTTSSSEIFDIIAHFAQ  195

Query  529  LSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
             + SS+  + P+V KP+  A+  A+  A+++P+RTLF +D+ RNI AG  VGL T LVGT
Sbjct  196  ANPSSKLPKTPIVCKPSEAAIEKALKIANINPQRTLFFEDSVRNIQAGKRVGLHTVLVGT  255

Query  709  ATKTKESDYAMEKVTEMVQVIPEIW  783
            + + K +D+A+E +  + + +PE+W
Sbjct  256  SQRVKGADFALESIHNLREALPELW  280



>ref|XP_008349600.1| PREDICTED: uncharacterized protein C24B11.05-like [Malus domestica]
Length=273

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 115/251 (46%), Positives = 161/251 (64%), Gaps = 20/251 (8%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY    GI   + +NI ++++++ G  E+E   L + L+K YG+++AGL
Sbjct  10   YECLLFDLDDTLYPLSSGISVQITRNIKEYMIQRLGMDESEVPELCISLYKDYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +A GY+ D D++HSFVHGRLPY L+ PDP LR LL S+  RK+IFTNSD+ HA  VL R+
Sbjct  70   KAQGYNFDYDDFHSFVHGRLPYELLTPDPVLRGLLLSLPIRKVIFTNSDKKHADTVLKRL  129

Query  475  GIKDCFEQIICFETMNP--NLSRSSRPDE---------------FPVVLKPAMEAMNIAV  603
            GI+DCFE +ICFET+NP  N   S   +E                PVV KP   A   A 
Sbjct  130  GIEDCFESVICFETLNPTNNADDSVGAEETEHIEQPNTGAVVPKTPVVCKPFELAYEEAF  189

Query  604  DFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
             FA++DP+RTLF DD+ RNI      GL T LVGT+ +TK +DYA+E +  M + +PE+W
Sbjct  190  KFANIDPQRTLFFDDSIRNIQTAKQCGLHTVLVGTSHRTKGADYALESIHNMKEALPELW  249

Query  784  FEEEVRCSRSE  816
               E+   +SE
Sbjct  250  ---EITTMQSE  257



>ref|XP_010676721.1| PREDICTED: suppressor of disruption of TFIIS [Beta vulgaris subsp. 
vulgaris]
Length=255

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/252 (42%), Positives = 170/252 (67%), Gaps = 8/252 (3%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            V  + + +D ++FD+DDTLY    GI  A +KNI+D++++     E+E   + +EL+++Y
Sbjct  5    VNFNGAKYDCLLFDLDDTLYPLSSGINFACRKNIEDYMLKYLHMEESEVPRMCLELYREY  64

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGL+ALGY+ D DE+H +VHG LPY  ++PDP LR+LL S  QRKI+FTNSD+ H 
Sbjct  65   GTTMAGLKALGYEFDNDEFHEYVHGNLPYETLRPDPVLRNLLLSTPQRKIVFTNSDKAHT  124

Query  454  MKVLDRIGIKDCFEQIICFETMNPNLSRSSRP-DEFPVVLKPAMEAMNIAVDFADVDPRR  630
             +VL+++G+ DCFE +ICFET+N    + + P  +  ++ KP++EA+  A+  A++DP R
Sbjct  125  ARVLNKLGLGDCFEGVICFETLN---HKDNEPVSKSNILCKPSVEAIEAAISIANLDPTR  181

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSR  810
            T+F DD+ RNIA+G A GL T +VG +     +DYA+  +  M + +PEIW +E    ++
Sbjct  182  TIFFDDSVRNIASGKAAGLHTVIVGKSELIPGADYALRSIHNMKEALPEIWEDE----AK  237

Query  811  SEMDSYLATTSV  846
               D  L + +V
Sbjct  238  EHHDQVLQSNAV  249



>ref|XP_008227762.1| PREDICTED: uncharacterized protein C24B11.05 [Prunus mume]
Length=274

 Score =   235 bits (599),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 113/267 (42%), Positives = 177/267 (66%), Gaps = 21/267 (8%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R   + +D ++FD+DDTLY    G+  A +KNI++F++      E+E   + +EL+++YG
Sbjct  6    RSGGAKYDYLLFDLDDTLYPLSSGLNLACRKNIEEFMLHHLQIEESEVPRMCLELYREYG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+HS VHGRLPY+ +K D  LR+LL S+ QRKIIFTN+D+ HA 
Sbjct  66   TTMAGLKALGYEFDNDEFHSHVHGRLPYDSLKHDLVLRNLLLSMPQRKIIFTNADKAHAA  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNL-----SRSS--------RPDEF----PVVLKPAME  585
            +VL+R+G++DCFE IICFET+NP+       R+S        R  E     P++ KP++E
Sbjct  126  QVLNRLGLEDCFEGIICFETLNPHHLEPVDCRTSDDQMVLIERTPEGKANSPILCKPSVE  185

Query  586  AMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQ  765
            A+  A+  A+VDP +T+F DD+ RNIA+G A GL T +VG++     +D+A+  +  + +
Sbjct  186  AIEAAIRIANVDPEKTIFFDDSARNIASGKAAGLHTVIVGSSVLVPGADHALSSIHNIKE  245

Query  766  VIPEIWFEEEVRCSRSEMDSYLATTSV  846
             IPEIW  E       +++ ++ +T+V
Sbjct  246  AIPEIWEGE----GGQQLEQFIQSTAV  268



>emb|CDY33043.1| BnaA10g12490D [Brassica napus]
Length=263

 Score =   234 bits (598),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 117/262 (45%), Positives = 169/262 (65%), Gaps = 9/262 (3%)
 Frame = +1

Query  100  DSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            +SS+P ++ ++FD+DDTLY    G+ +A   NI +F+VEK G  E     L   L+KKYG
Sbjct  5    NSSTPRYECLLFDLDDTLYPLSSGLSEACANNIIEFMVEKLGIDEDGVVELNQILYKKYG  64

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +S+AGL+A+GY+ D DEYH FVHGRLPY  ++PDP LR+L+ ++  RK++F+N D VH M
Sbjct  65   TSMAGLKAVGYEFDNDEYHRFVHGRLPYENLRPDPVLRNLVLTLPLRKMVFSNGDEVHVM  124

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRS-----SRPDEFPVVLKPAMEAMNIAVDFADVD  621
            K L R+GI+DCFE+II FE++NP ++ +     +   E PV+ KPA  A   A D A ++
Sbjct  125  KSLKRLGIEDCFERIISFESLNPKVNETEVSLENYLPEIPVICKPAEIAFEKAFDIAQLN  184

Query  622  PRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVR  801
            P  TLF DD+ RNI  G  +GL T LVG + K + SD+A++ +  M +  PE+W E   +
Sbjct  185  PHTTLFFDDSIRNIQTGKVMGLHTVLVGKSEKVEGSDHALKSIHNMKEAFPELWSESNNK  244

Query  802  CSRSEMDSYLATTSVGA*SIHS  867
               SE  SY    S+   S+H+
Sbjct  245  --ESERISYATQISIET-SVHA  263



>ref|XP_010544915.1| PREDICTED: uncharacterized protein C24B11.05 [Tarenaya hassleriana]
 ref|XP_010544916.1| PREDICTED: uncharacterized protein C24B11.05 [Tarenaya hassleriana]
Length=248

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 156/224 (70%), Gaps = 6/224 (3%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ + FDMDDTLY    GI  A + NI +F++ + G  ET    + ++L+K+YG+++AGL
Sbjct  8    YECLFFDMDDTLYPLSTGINLACRNNIQEFMLNRLGIEETLVPKMCLDLYKEYGTTMAGL  67

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            + +GY+ D DE+H++VHG+LPY  +KPDP LR+LL S+ Q KIIFTN+D VHA +VL R+
Sbjct  68   KVMGYEFDNDEFHAYVHGKLPYEKLKPDPVLRNLLLSMPQHKIIFTNADMVHAARVLSRL  127

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNT  654
            G++DCFE +ICFET+NP +       E P++ KP ++A   A+  A VDP++T+FLDD+T
Sbjct  128  GLEDCFEGVICFETLNPPIES-----EAPILCKPDVKAFEAAIRLAGVDPKKTMFLDDST  182

Query  655  RNIAAGNAVGLRTALV-GTATKTKESDYAMEKVTEMVQVIPEIW  783
            RNIA+  A GL T LV G+     E+DY +  +  + + +P+IW
Sbjct  183  RNIASAKAAGLTTVLVGGSVANIPEADYVLSSIHNIKEAVPDIW  226



>ref|XP_009600978.1| PREDICTED: uncharacterized protein C24B11.05 [Nicotiana tomentosiformis]
Length=277

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/251 (44%), Positives = 166/251 (66%), Gaps = 18/251 (7%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
             R +S  ++ ++FDMDDTLY    G+  A +KNI++F++      ETE   + +EL+++Y
Sbjct  5    TRSNSLKYECLLFDMDDTLYPLSSGLNLACRKNIEEFMLHFLDIEETEVPKMCLELYREY  64

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYN-LIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            G+++AGL+ LGY+ D D++H FVHGRLPY+ ++KPDP LR+LL S+ QRKIIFTN D+ H
Sbjct  65   GTTMAGLKELGYEFDNDKFHGFVHGRLPYDEVLKPDPLLRNLLLSMPQRKIIFTNGDKAH  124

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSR--PDEFP---------------VVLKPA  579
            A++VL ++G+ DCFE IICFET+NP    +     DE P               ++ KP+
Sbjct  125  AIRVLSKMGLADCFEGIICFETLNPPQEDTDHNYEDEVPMTTPEKSQGEVVKPRILCKPS  184

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
            +EAM  A+  A+VDP +T+F DD+ RNIA+G   GL T +VGT+T    +D+A+  +  +
Sbjct  185  LEAMEAAIRIANVDPMKTIFFDDSARNIASGKQAGLHTVIVGTSTLVPGADHALRSIHNI  244

Query  760  VQVIPEIWFEE  792
             + IP IW E+
Sbjct  245  KEAIPHIWEED  255



>ref|NP_191763.3| haloacid dehalogenase-like hydrolase superfamily protein [Arabidopsis 
thaliana]
 emb|CAB71911.1| putative protein [Arabidopsis thaliana]
 gb|AAR24677.1| At3g62040 [Arabidopsis thaliana]
 gb|AEE80300.1| haloacid dehalogenase-like hydrolase superfamily protein [Arabidopsis 
thaliana]
Length=249

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/224 (46%), Positives = 158/224 (71%), Gaps = 6/224 (3%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ + FDMDDTLY   +GI  A + NI +F++ + G  E+E   L ++L+K+YG+++AGL
Sbjct  8    YECLFFDMDDTLYPLSIGINLACRNNIQEFMLNQLGIEESEVPKLCLDLYKEYGTTMAGL  67

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            + +GY+ D DE+H +VHGRLPY  +KPDP LR+LL S+  RKIIFTN+D+ HA + L+R+
Sbjct  68   KVMGYEFDNDEFHEYVHGRLPYEKLKPDPLLRNLLLSMPHRKIIFTNADKAHATRALNRL  127

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFAD-VDPRRTLFLDDN  651
            G++DCFE IICFET+NP+   +++     ++ KP++EA   A+  AD VDPR+T+F DD+
Sbjct  128  GLEDCFEGIICFETLNPSSDSNTQ-----ILCKPSVEAFEAAIRIADIVDPRKTIFFDDS  182

Query  652  TRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
             RNIA+  A GL+T  VG +     +DYA+  +  + + IP++W
Sbjct  183  IRNIASAKATGLKTVFVGESVLVPGADYALSSIHNIKEAIPDLW  226



>ref|XP_010468992.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=249

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/227 (45%), Positives = 157/227 (69%), Gaps = 6/227 (3%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
            ++ ++ + FDMDDTLY   +GI  A + NI +F++ + G  E E   + ++L+K+YG+++
Sbjct  5    AAKYECLFFDMDDTLYPLSIGINLACRNNIQEFMLNQLGIEENEVPKMCLDLYKEYGTTM  64

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL+ LGY+ D DE+H +VHGRLPY  +KPDP LR+LL S+  RKIIFTN+D+ HA + L
Sbjct  65   AGLKVLGYEFDNDEFHEYVHGRLPYEKLKPDPVLRNLLLSMPHRKIIFTNADKAHATRAL  124

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFAD-VDPRRTLFL  642
             R+G++DCFE IICFET+NP+    ++     ++ KP++EA   A+  AD VDPR+T+F 
Sbjct  125  TRLGLEDCFEGIICFETLNPSSDSKTQ-----ILCKPSVEAFEAAIRIADIVDPRKTMFF  179

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            DD+ RNIA+  A GL+T  VG +     +DYA+  +  + + IP++W
Sbjct  180  DDSIRNIASAKATGLKTVFVGNSVLVPGADYALSSIHNIKEAIPDLW  226



>ref|XP_007221494.1| hypothetical protein PRUPE_ppa009851mg [Prunus persica]
 gb|EMJ22693.1| hypothetical protein PRUPE_ppa009851mg [Prunus persica]
Length=274

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/275 (42%), Positives = 181/275 (66%), Gaps = 24/275 (9%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   +SV    + +D ++FD+DDTLY    G+  A +KNI++F++      E+E   + 
Sbjct  1    MDDVGRSV---GAKYDYLLFDLDDTLYPLSSGLNLACRKNIEEFMLHHLQIEESEVPRMC  57

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            +EL+++YG+++AGL+ALGY+ D DE+HS VHGRLPY+ +K D  LR+LL S+ QRKIIFT
Sbjct  58   LELYREYGTTMAGLKALGYEFDNDEFHSHVHGRLPYDSLKHDLVLRNLLLSMPQRKIIFT  117

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPNL-----SRSS--------RPDEF----P  561
            N+D+ HA +VL+R+G++DCFE IICFET+NP+       R+S        R  E     P
Sbjct  118  NADKAHAAQVLNRLGLEDCFEGIICFETLNPHHLEPVDCRTSDDQMVLIERTPEGKANSP  177

Query  562  VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAM  741
            ++ KP++EA+  A+  A+VDP +T+F DD+ RNIA+G A GL T +VG++     +D+A+
Sbjct  178  ILCKPSVEAIEAAIRIANVDPEKTIFFDDSARNIASGKAAGLHTVIVGSSVLVPGADHAL  237

Query  742  EKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
              +  + + IPEIW  E       +++ ++ +T+V
Sbjct  238  SSIHNIKEAIPEIWEGE----GGQQLEQFIQSTAV  268



>ref|XP_010423885.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=280

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 162/247 (66%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +    NI D++VEK G P+ +   L   L+K YG++
Sbjct  11   TSQKYDCLLFDLDDTLYPLSSGIARECGNNIKDYMVEKLGIPKDKIVELSDLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D DEYHSFVHGRL Y+ IKPDP +RSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDEYHSFVHGRLTYDNIKPDPVIRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNP--NLSRSSRPDEF------------------PVVLKPAM  582
            L R+G++DCFE IICFET+N    +  S  P+ F                  PVV KP+ 
Sbjct  131  LKRLGLEDCFEGIICFETLNQMHKIDASKNPEIFDIVGHFHRSEPVSSLPKTPVVCKPSE  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG + K K +DYA+E +  + 
Sbjct  191  SAIEKAIEIANIDPNRTLFFEDSVRNVQAGKRVGLHTVLVGKSNKVKGADYALENIHNLK  250

Query  763  QVIPEIW  783
            + IPE+W
Sbjct  251  EAIPELW  257



>ref|XP_008222324.1| PREDICTED: uncharacterized protein C24B11.05 isoform X2 [Prunus 
mume]
 ref|XP_008222332.1| PREDICTED: uncharacterized protein C24B11.05 isoform X2 [Prunus 
mume]
Length=270

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 160/243 (66%), Gaps = 20/243 (8%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY    G+ +   KNI++++V+K G  ET  + L   L+K YG+S+AGL
Sbjct  4    YECLLFDLDDTLYPLSSGMSKQCTKNIEEYMVQKLGIAETTVTQLNQLLYKNYGTSMAGL  63

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GY+ D D+YHSFVHGRLPY +++PD  LR+LL S+  RK+IF+N D+ H  K L ++
Sbjct  64   RAIGYNFDNDDYHSFVHGRLPYEVLRPDHVLRTLLLSLPYRKLIFSNGDKFHVAKTLSKL  123

Query  475  GIKDCFEQIICFETMNPNL----SRSSRPDEF----------------PVVLKPAMEAMN  594
            G+KDCFE ++CFET+NP +    S+S+   +                 PVV KP   A  
Sbjct  124  GLKDCFEGVVCFETLNPIIDNEDSKSTGCRKVFDHSCLFDAGSALPVTPVVCKPFANAYE  183

Query  595  IAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIP  774
             A+  A+++PRRTLF DD+ RNI AG  +GL T LVGT+ +TK  DYA+E +  + + +P
Sbjct  184  QALQKANINPRRTLFFDDSIRNIQAGKDMGLHTVLVGTSNRTKGVDYAIESIHNIREALP  243

Query  775  EIW  783
            E+W
Sbjct  244  ELW  246



>ref|XP_007150342.1| hypothetical protein PHAVU_005G145500g [Phaseolus vulgaris]
 gb|ESW22336.1| hypothetical protein PHAVU_005G145500g [Phaseolus vulgaris]
Length=283

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/263 (44%), Positives = 163/263 (62%), Gaps = 27/263 (10%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            S   +D ++FD+DDTLY    G+ + +KKNI  ++++K G PE +   L + L+K YG++
Sbjct  11   SKKKYDCLLFDLDDTLYPLSSGLAEQVKKNIQVYMLQKLGIPEAKVPELCLSLYKTYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+A+GYD D D +H FVHG LPY+L+KPDP LR +L S+  RKIIFTNSD+ HA +V
Sbjct  71   MAGLKAIGYDFDYDNFHGFVHGTLPYDLLKPDPVLRGVLLSLPVRKIIFTNSDKAHASRV  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSS-----------------RPDE------FPVVLK  573
            L R+G++DCFE++I FET+N +    S                 RP+        PVV K
Sbjct  131  LHRLGLEDCFERVISFETLNSSNEDGSEYKPSSTEIFDFYEYIHRPNSDVVLPRTPVVCK  190

Query  574  PAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVT  753
            P  +A     + AD+DP RTLF DD+ RN+  G + GL T LVGT+ KT   D+A++ + 
Sbjct  191  PFQDAFEKVFNMADIDPPRTLFFDDSLRNLQTGKSSGLHTVLVGTSVKTTGVDHALDSIH  250

Query  754  EMVQVIPEIWFEEE----VRCSR  810
             M +  PE+W  +E    V CSR
Sbjct  251  NMKEAFPELWESDEKAESVECSR  273



>ref|XP_004514386.1| PREDICTED: uncharacterized protein LOC101507684 [Cicer arietinum]
Length=301

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 122/288 (42%), Positives = 175/288 (61%), Gaps = 43/288 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +A  +NI D++VEK G  +     L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSCGIAKACGQNIKDYMVEKLGIDKNIIDDLSNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +K DP LR+LL S+  RK+IFTN+D+VHA+K L+R+
Sbjct  75   RAIGYDFDYDEYHSFVHGRLPYENLKQDPILRNLLLSLPYRKLIFTNADKVHAVKALNRL  134

Query  475  GIKDCFEQIICFETMNP----NLS----------------------------------RS  540
            G++DCFE IICFET+NP    N+S                                    
Sbjct  135  GLEDCFEGIICFETLNPIHKNNVSDDEDDIEFVGSSTNNSNTSDCGSNFQIFDIISHFAQ  194

Query  541  SRPDEF----PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
            S P E     P++ KP+  A+ +A+  A++DP+RTLF +D+ RNI AG  VGL T LVG 
Sbjct  195  SNPTEVLPKTPIICKPSEYAIELALKIANLDPQRTLFFEDSARNIQAGKRVGLDTVLVGK  254

Query  709  ATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            + + K +DYA+E +  + + +PE+W E +++   +  ++    TSV A
Sbjct  255  SQRIKGADYALESIHNLREAVPELW-ECDIKSEVAYPNNLAVETSVTA  301



>ref|XP_002309065.1| hypothetical protein POPTR_0006s08720g [Populus trichocarpa]
 gb|ABK95108.1| unknown [Populus trichocarpa]
 gb|EEE92588.1| hypothetical protein POPTR_0006s08720g [Populus trichocarpa]
Length=305

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 116/278 (42%), Positives = 165/278 (59%), Gaps = 46/278 (17%)
 Frame = +1

Query  88   KSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFK  267
            + ++  +  +  ++FD+DDTLY    GI  A  KNI D++VE+ G  E++ + L   L+K
Sbjct  6    RYLQAQTPKYSCLLFDLDDTLYPLSSGIAAACGKNIKDYMVERLGIEESKLAELGNLLYK  65

Query  268  KYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRV  447
             YG+++AGLRA+GYD D DEYHSFVHGRLPY  +KPDP LR LL S+  RK+IFTN+D+V
Sbjct  66   NYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRGLLLSLPVRKVIFTNADKV  125

Query  448  HAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDE------------------------  555
            HA KVL ++G++DCFE IICFET+NP    +   DE                        
Sbjct  126  HARKVLRKLGLEDCFEGIICFETLNPTHKNTVSDDEDDIEFVGSVVTPSTTNGSYTTTTS  185

Query  556  ----------------------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAA  669
                                   P+V KP+  A+  A+  A+++P+RTLF DD+ RNI A
Sbjct  186  APEIFDIVGHFAQPNPNSVLPKTPIVCKPSEAAIERALKIANINPQRTLFFDDSVRNIQA  245

Query  670  GNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            G  VGL+T LVG + + K +D+A+E +  + Q +PE+W
Sbjct  246  GKRVGLQTVLVGYSQRVKGADFALESIHNIRQALPELW  283



>ref|XP_011019847.1| PREDICTED: uncharacterized protein LOC105122445 [Populus euphratica]
Length=305

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 115/278 (41%), Positives = 166/278 (60%), Gaps = 46/278 (17%)
 Frame = +1

Query  88   KSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFK  267
            + ++  +  +  ++FD+DDTLY    GI  A  KNI D++VE+ G  E++ + L   L++
Sbjct  6    RYLQAQTPKYSCLLFDLDDTLYPLSSGIAAACGKNIKDYMVERLGIEESKLTELGNLLYR  65

Query  268  KYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRV  447
             YG+++AGLRA+GYD D DEYHSFVHGRLPY  +KPDP LR LL S+  RK+IFTN+D+V
Sbjct  66   NYGTTMAGLRAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRGLLLSLPIRKVIFTNADKV  125

Query  448  HAMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDE------------------------  555
            HA KVL ++G++DCFE IICFET+NP    +   DE                        
Sbjct  126  HARKVLRKLGLEDCFEGIICFETLNPTHKNTVSDDEDDIEFVGSVVTPSTTNGSYTTTTS  185

Query  556  ----------------------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAA  669
                                   P+V KP+  A+  A+  A+++P+RTLF DD+ RNI A
Sbjct  186  APEIFDIVGHFAQPNPNSVLPKTPIVCKPSEAAIERALKIANINPQRTLFFDDSVRNIQA  245

Query  670  GNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            G  VGL+T LVG++ + K +D+A+E +  + Q +PE+W
Sbjct  246  GKRVGLQTVLVGSSQRVKGADFALESIHNIRQALPELW  283



>ref|XP_004288663.1| PREDICTED: uncharacterized protein C24B11.05-like [Fragaria vesca 
subsp. vesca]
Length=270

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/263 (41%), Positives = 180/263 (68%), Gaps = 17/263 (6%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            + S + ++ ++FD+DDTLY    G+  A +KNI++++++     E+E   + +EL++++G
Sbjct  6    KSSGAKYEYLLFDLDDTLYPMSSGLNSACRKNIEEYMLQHLDIEESEVPRICLELYREHG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALG++ D DE+H++VHGRLPY+ +KPD  LR+LL S+ QRKIIFTN+D+ HA 
Sbjct  66   TTMAGLKALGHEFDDDEFHAYVHGRLPYDALKPDLVLRNLLLSMPQRKIIFTNADKAHAA  125

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRS----SRPDEF---------PVVLKPAMEAMNI  597
            +V  R+ ++DCFE IICFET+NP   +     + PD+          P++ KP++EA+ +
Sbjct  126  EVRSRLCLEDCFEGIICFETLNPPHPQPVDFITAPDDCTGNNLNSKSPILCKPSVEAIEV  185

Query  598  AVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPE  777
            A+  A+VDP++TLF DD+ RNIA+G A GL T +VG++     +DY +  +  + + IPE
Sbjct  186  AIRIANVDPQKTLFFDDSARNIASGKAAGLHTVIVGSSELVPGADYVLRSIHNIREAIPE  245

Query  778  IWFEEEVRCSRSEMDSYLATTSV  846
            IW  EE +    +++ ++ +T+V
Sbjct  246  IWEGEEGQ----QLEQFIQSTAV  264



>ref|XP_008222317.1| PREDICTED: uncharacterized protein C24B11.05 isoform X1 [Prunus 
mume]
Length=282

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/248 (44%), Positives = 161/248 (65%), Gaps = 20/248 (8%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            D    ++ ++FD+DDTLY    G+ +   KNI++++V+K G  ET  + L   L+K YG+
Sbjct  11   DQMPKYECLLFDLDDTLYPLSSGMSKQCTKNIEEYMVQKLGIAETTVTQLNQLLYKNYGT  70

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            S+AGLRA+GY+ D D+YHSFVHGRLPY +++PD  LR+LL S+  RK+IF+N D+ H  K
Sbjct  71   SMAGLRAIGYNFDNDDYHSFVHGRLPYEVLRPDHVLRTLLLSLPYRKLIFSNGDKFHVAK  130

Query  460  VLDRIGIKDCFEQIICFETMNPNL----SRSSRPDEF----------------PVVLKPA  579
             L ++G+KDCFE ++CFET+NP +    S+S+   +                 PVV KP 
Sbjct  131  TLSKLGLKDCFEGVVCFETLNPIIDNEDSKSTGCRKVFDHSCLFDAGSALPVTPVVCKPF  190

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
              A   A+  A+++PRRTLF DD+ RNI AG  +GL T LVGT+ +TK  DYA+E +  +
Sbjct  191  ANAYEQALQKANINPRRTLFFDDSIRNIQAGKDMGLHTVLVGTSNRTKGVDYAIESIHNI  250

Query  760  VQVIPEIW  783
             + +PE+W
Sbjct  251  REALPELW  258



>ref|XP_003543518.1| PREDICTED: uncharacterized protein C24B11.05-like [Glycine max]
 gb|KHN30154.1| Hypothetical protein glysoja_010532 [Glycine soja]
Length=283

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/263 (43%), Positives = 164/263 (62%), Gaps = 27/263 (10%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            S   +D ++FD+DDTLY    G+ + +KKNI +++++K    E +   L   L+K YG++
Sbjct  11   SKGKYDCLLFDLDDTLYPLSSGLAEQVKKNIQEYMLQKLWISEAKVPELCFSLYKTYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+A+GYD D D++H FVHGRLPY+++KPDP LR +L S+  RK++FTNSD+ HA +V
Sbjct  71   MAGLKAIGYDFDYDDFHGFVHGRLPYDMLKPDPVLRGILLSLPVRKVVFTNSDKAHASRV  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSS-----------------RPDE------FPVVLK  573
            L R+G++DCFE++I FET+N +    S                 RPD        PVV K
Sbjct  131  LHRLGLEDCFERVISFETLNSSNEDGSEYKQSSTEIFDFYEYIGRPDSDIVLPRTPVVCK  190

Query  574  PAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVT  753
            P  +A     + AD+DP+RTLF DD+ RN+  G ++GL T LVGT+ +T   D+A+E + 
Sbjct  191  PFQDAYEKVFNMADIDPQRTLFFDDSLRNLQTGKSLGLHTVLVGTSVRTTGVDHALESIH  250

Query  754  EMVQVIPEIWFEEE----VRCSR  810
             M +  PE+W   E    V CSR
Sbjct  251  NMKEAFPELWEANEKPESVECSR  273



>ref|XP_009779692.1| PREDICTED: uncharacterized protein LOC104228845 [Nicotiana sylvestris]
Length=294

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 175/287 (61%), Gaps = 44/287 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  +++KNI+D++VEK G  +++ + L   L+K YG+++AGL
Sbjct  11   YDCLLFDLDDTLYPLSTGLASSVRKNIEDYMVEKLGIEQSKIAELGNLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  ++PDP LRSLL S+  RK+IFTN+D+VHA+K L+R+
Sbjct  71   RAIGYDFDYDEYHSFVHGRLPYENLRPDPVLRSLLLSLPIRKVIFTNADKVHALKALNRL  130

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE I+CFET+NP + +S+  D     EF                           
Sbjct  131  GLEDCFEGILCFETLNP-IHKSTPSDDEDDIEFLGSATSSNTAANNGTEIFDIIGHFAQP  189

Query  559  ---------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTA  711
                     P+V KP+  A+  A+  A+++P RTLF +D+ RNI AG  VGL T LVG +
Sbjct  190  KPGSVLPKTPIVCKPSEIAIERALKIANINPHRTLFFEDSVRNIQAGKRVGLDTVLVGNS  249

Query  712  TKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
             +   +DYA+E +  + + +P++W  E  R +          TSV A
Sbjct  250  QRVVGADYALESIHNIREALPQLW--EVDRVAEVNYSGVAVETSVTA  294



>ref|NP_001241637.1| uncharacterized protein LOC100795391 [Glycine max]
 ref|XP_006582921.1| PREDICTED: uncharacterized protein LOC100795391 isoform X1 [Glycine 
max]
 gb|ACU20537.1| unknown [Glycine max]
Length=297

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/290 (41%), Positives = 175/290 (60%), Gaps = 46/290 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +A  +NI D++ EK G  +++   L   L+K YG+++AGL
Sbjct  10   YDCLLFDLDDTLYPLSTGLAKACGQNIKDYMAEKLGIEKSKIDDLSNLLYKNYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  R++IFTNSD+VHA+K L R+
Sbjct  70   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRNLLLSLPYRRLIFTNSDKVHAVKALSRL  129

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE IICFET+NP + +S+  D     EF                           
Sbjct  130  GLEDCFEGIICFETLNP-IHKSTVSDDEDDIEFVGGSGTTNPTTKKDASSFQIFDIIGHF  188

Query  559  ------------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALV  702
                        P++ KP+  A+ +A+  A+++P+RTLF +D+ RN  AG  VGL T LV
Sbjct  189  AQPNPHTVLPKTPIICKPSENAIELALKIANLNPQRTLFFEDSVRNTQAGKRVGLHTVLV  248

Query  703  GTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            G + + K +DYA+E +  + + +PE+W E++++   +        TSV A
Sbjct  249  GKSQRIKGADYALESIHNLREAVPELW-EDDIKSEVAYPGKLAVETSVTA  297



>ref|XP_009116877.1| PREDICTED: uncharacterized protein C24B11.05 [Brassica rapa]
Length=249

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 159/227 (70%), Gaps = 6/227 (3%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
             + ++ + FDMDDTLY   +GI  A + NI +F++ + G  E+E   + ++L+K+YG+++
Sbjct  5    GAKYECLFFDMDDTLYPLSIGINLACRNNIQEFMLNQLGIEESEVPKMCLDLYKEYGTTM  64

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL+ +GY+ D DE+H +VHGRLPY  +KPDP LR+LL S+  RKIIFTN+D+ HA + L
Sbjct  65   AGLKVMGYEFDNDEFHEYVHGRLPYEKLKPDPVLRNLLLSMPHRKIIFTNADKAHATRTL  124

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFAD-VDPRRTLFL  642
            +R+G++DCFE IICFET+NP+   +++     V+ KP+++A   A+  AD VDPR+T+F 
Sbjct  125  NRLGLEDCFEGIICFETLNPSSDTNTQ-----VLCKPSVQAFEAAIRIADIVDPRKTMFF  179

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            DD+ RNIA+  A GL+T  VG +     +DYA+  +  + + IP++W
Sbjct  180  DDSVRNIASAKAAGLKTVFVGDSVLVPGADYALSSIHNIKEAIPDLW  226



>ref|XP_004981147.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Setaria italica]
Length=278

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/268 (42%), Positives = 174/268 (65%), Gaps = 29/268 (11%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY   VGI  + +KNI D++       E++ + + + L+K+YG+++AGL
Sbjct  10   YECLLFDLDDTLYPFSVGINLSCRKNIQDYMRHHLQIEESQIAEMCLNLYKEYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H+ VHG LPY+ ++PDP L++LL SI QRKI+FTNSD+ HA + L R+
Sbjct  70   KALGYEFDNDEFHANVHGTLPYHNLRPDPVLKTLLLSIPQRKIVFTNSDKAHAEEALHRL  129

Query  475  GIKDCFEQIICFETMNP--NLSRSS----------------------RPDEFPVVLKPAM  582
            G++ CF+ +ICFET+NP   LSRS                       RP   P++ KP++
Sbjct  130  GLQGCFDGVICFETLNPCNGLSRSQNCMLFKDETSADLVDLNESNGFRPKS-PILCKPSI  188

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
            EAM  A+  A+VDP++T+F DD+TRNIA+G A G  T +VG  T    +D+A+E +  + 
Sbjct  189  EAMKAAIQIANVDPKKTIFFDDSTRNIASGKAAGFHTVVVGRWTLVPGADHALESIHNIK  248

Query  763  QVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            + +P+IW  ++    RSE D  L ++S+
Sbjct  249  EALPDIWDGQD----RSESDVVLTSSSI  272



>ref|XP_004971429.1| PREDICTED: uncharacterized protein C24B11.05-like [Setaria italica]
Length=279

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/260 (43%), Positives = 166/260 (64%), Gaps = 19/260 (7%)
 Frame = +1

Query  73   MDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALR  252
            MD   +  +D S   D ++FD+DDTLY    GI   + KNI D++V K G  E+ +  L 
Sbjct  1    MDYDGRYNKDQSLKCDCLLFDLDDTLYPFASGIAADIAKNIKDYMVHKLGVDESVSLELC  60

Query  253  VELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFT  432
            + L+K+YG+++AGLRA+GY  D D++HSFVHGRL Y+ IKPDP LR++L S+  RKI+FT
Sbjct  61   ILLYKQYGTTMAGLRAVGYQFDYDDFHSFVHGRLAYDKIKPDPVLRNILLSLPLRKIVFT  120

Query  433  NSDRVHAMKVLDRIGIKDCFEQIICFETMNPN-------------LSRSSRPD------E  555
            N DR+HA + L R+GI+DCFE+++CFET+NP              +   + P       +
Sbjct  121  NGDRIHASRALKRLGIEDCFERVVCFETLNPTSPALSDKLEIFDIMKHLAHPQPGVELPK  180

Query  556  FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDY  735
             P++ KP+ EAM  A++ A ++P  T+  DD+ RNI A   +G+RT LVGT+ + K +DY
Sbjct  181  SPILCKPSREAMLQALEVASINPHTTILFDDSFRNIEAAKQIGMRTVLVGTSERKKGADY  240

Query  736  AMEKVTEMVQVIPEIWFEEE  795
            A+  +  M + +PE+W E E
Sbjct  241  ALASLHNMKEALPELWEEAE  260



>ref|XP_010452055.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=280

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 119/247 (48%), Positives = 162/247 (66%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +    NI D++VEK G P+ +   L   L+K YG++
Sbjct  11   TSQKYDCLLFDLDDTLYPLSSGIARECGNNIKDYMVEKLGIPKDKIVELSDLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D DEYHSFVHGRL Y+ IKPDP +RSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDEYHSFVHGRLTYDNIKPDPVIRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNP--NLSRSSRPDEF------------------PVVLKPAM  582
            L R+G++DCFE IICFET+N    +  S  P+ F                  PVV KP+ 
Sbjct  131  LKRLGLEDCFEGIICFETLNQMHKIDASKNPEIFDIVGHFHRSEPVSSLPKTPVVCKPSE  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG + K K +DYA+E +  + 
Sbjct  191  SAIEKAIEIANIDPNRTLFFEDSVRNVEAGKRVGLHTVLVGKSDKVKGADYALENIHNLK  250

Query  763  QVIPEIW  783
            + IPE+W
Sbjct  251  EAIPELW  257



>ref|XP_010509295.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=276

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 174/270 (64%), Gaps = 29/270 (11%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            S +D ++FD+DDTLY    GI +   KNI D++VEK G  + +   L   L+K YG+++A
Sbjct  6    SKYDTLLFDLDDTLYPLSSGIAKECGKNIKDYMVEKLGIDKNKILELSNSLYKNYGTTMA  65

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GY+ D DEYHSFVHGRLPY  IKPDP LRSLL S+  RKIIFTN+D++HA + L+
Sbjct  66   GLRAIGYNFDYDEYHSFVHGRLPYENIKPDPILRSLLLSLPLRKIIFTNADKLHAARALE  125

Query  469  RIGIKDCFEQIICFETMNPNLSR------------------------SSRPDEFPVVLKP  576
            R+G++DCFE I+CFE++N   +R                        S+ P + P+V KP
Sbjct  126  RLGLEDCFEGILCFESLNSTSNRENVSYDKNEIFDIIGYLSDHEQTVSALP-KTPIVCKP  184

Query  577  AMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE  756
            +  A+  A++ A++DP+RTLF DD+ RNI AG  VGL T LVGT+ + K +DYA+E +  
Sbjct  185  SETAIAKALEIANIDPQRTLFFDDSVRNIQAGKRVGLDTVLVGTSQRMKYADYALENIHN  244

Query  757  MVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            + + +PE+W  E    ++ E  SY A  +V
Sbjct  245  LKEALPELWVSE----TKPEQVSYTAKLAV  270



>ref|XP_009387379.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=280

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 162/249 (65%), Gaps = 24/249 (10%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+     KNI D++VE+ G  E + S L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLSSGVASECLKNIGDYMVERLGIEERKISDLCNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GY+ D ++YHSFVHGRLPY  +KPDP LR LL S+  RK+IFTN+D VHA KVL R+
Sbjct  75   RAIGYEFDYNDYHSFVHGRLPYGKLKPDPVLRHLLLSLPIRKVIFTNADEVHAAKVLRRL  134

Query  475  GIKDCFEQIICFETMNPNLSRSS---RPDEF-------------------PVVLKPAMEA  588
            G++DCF+ IICFET+NP  + SS   R  E                    PV+ KP+++A
Sbjct  135  GLEDCFQGIICFETLNPLPASSSDQERKTEVFDIVGHFSHPTDGVELPKTPVLCKPSVDA  194

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
            M  A+  A +DP+RT+F DD+ RNI +G  +GL T  VGT+ + K +D+A+E +  M + 
Sbjct  195  MEHALRVAGIDPQRTMFFDDSVRNIQSGKHIGLHT--VGTSRRIKGADHALESIHNMKEA  252

Query  769  IPEIWFEEE  795
             PE+W E E
Sbjct  253  FPELWEEGE  261



>ref|XP_002302699.2| haloacid dehalogenase-like hydrolase family protein [Populus 
trichocarpa]
 gb|EEE81972.2| haloacid dehalogenase-like hydrolase family protein [Populus 
trichocarpa]
Length=305

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/290 (39%), Positives = 176/290 (61%), Gaps = 45/290 (16%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +   ++ ++FDMDDTLY   +G+  A +KNI++F++ +    E+E   + +EL++++G
Sbjct  15   RANGPKYECLLFDMDDTLYPLSLGLNMACRKNIEEFMLHQLHIEESEVPRMCLELYREHG  74

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+H+FVHGRLPY  +KPDP LR++L S+ QRKIIFTN+D+ HA 
Sbjct  75   TTMAGLKALGYEFDNDEFHAFVHGRLPYETLKPDPVLRNILLSVPQRKIIFTNADKAHAA  134

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFP-------------------------  561
            +VL R+G +DCFE +ICFET+NP L  ++  D                            
Sbjct  135  EVLKRMGFEDCFEGVICFETLNPPLEIANNMDALDNDAMIAGGEPEPSGFDGTIATGNKN  194

Query  562  ---------------VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTA  696
                           ++ KP++EA+  A+  A+VDPR+T+F DD+ RNIA+G A GL T 
Sbjct  195  KIKNDLDNGISSKSRILCKPSLEAIEAAIQIANVDPRKTIFFDDSARNIASGKAAGLHTV  254

Query  697  LVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            +VG++     +D A+  +  + + IPEIW +E       EM+  + +T+V
Sbjct  255  IVGSSVLVPGADNALRSIHNIKEAIPEIWEDE-----GEEMELVIQSTTV  299



>ref|XP_009587188.1| PREDICTED: uncharacterized protein LOC104084931 [Nicotiana tomentosiformis]
Length=294

 Score =   233 bits (595),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 119/287 (41%), Positives = 174/287 (61%), Gaps = 44/287 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  +++KNI+D++VEK G  +++ + L   L+K YG+++AGL
Sbjct  11   YDCLLFDLDDTLYPLSTGLAASVRKNIEDYMVEKLGIEQSKIAELGNLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYH+FVHGRLPY  ++PDP LRSLL S+  RK+IFTN+D+VHA+K L R+
Sbjct  71   RAIGYDFDYDEYHNFVHGRLPYENLRPDPVLRSLLLSLPIRKVIFTNADKVHALKALSRL  130

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE I+CFET+NP + +SS  D     EF                           
Sbjct  131  GLEDCFEGILCFETLNP-IHKSSPSDDEDDIEFLGSATFSNTAATNGTEIFDIIGHFAQP  189

Query  559  ---------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTA  711
                     P+V KP+  A+  A+  A+++P RTLF +D+ RNI AG  VGL T LVG +
Sbjct  190  KVGSVLPKTPIVCKPSEIAIERALKIANINPHRTLFFEDSVRNIQAGKRVGLDTVLVGNS  249

Query  712  TKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
             +   +DYA+E +  + + +P++W  E  R +          TSV A
Sbjct  250  QRVVGADYALESIHNIREALPQLW--EVDRVAEVNYSGVAVETSVTA  294



>gb|EMS45749.1| Uncharacterized protein C24B11.05 [Triticum urartu]
Length=317

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 132/313 (42%), Positives = 185/313 (59%), Gaps = 67/313 (21%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
             SPFD ++ D+DDTLY    GIG AL++NID+FLV + G    +A+ALR +LF+ +GS+L
Sbjct  8    GSPFDCLLIDLDDTLYPGNTGIGPALRRNIDEFLVARFGLAADKAAALRADLFRSHGSTL  67

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL ALG+DV  DEYHS+VHGRLPY++I  DP+L + L+S+ QRKI+FTNSDR H  + L
Sbjct  68   AGLIALGHDVHPDEYHSYVHGRLPYDVITTDPQLAAALQSMPQRKILFTNSDRAHMKRAL  127

Query  466  DRIGIKD-CFEQIICFETMNPNL--------------SRSSRPDEFPVVLKPAMEAMNIA  600
            +R+G+ + CF+ ++CFETMNP+L              +   RP    VVLKP++ A   A
Sbjct  128  ERLGVDEACFDGVVCFETMNPHLFGEELEGEDDEAAAADVDRP---AVVLKPSVHAFVAA  184

Query  601  VDFADVDPRRTLFLDDNTRNIAAGNAVGLRTAL---------------------------  699
            +  A  +PRRTLFLDD+ RNIAAG A+GLRTAL                           
Sbjct  185  LRVAGTNPRRTLFLDDSERNIAAGKALGLRTALFIRLACERPVLKLTDAESLVAPSQFSV  244

Query  700  ---------VGTATKTKESDYAMEKVTEMVQVIPEIWFE-------------EEVRCSRS  813
                     VG   ++KE+DYA+E +  + + IPEIW               E+ +  R+
Sbjct  245  SSLSVVVGRVGKRARSKEADYALESIGGLRRAIPEIWGGAAADGELQPDHNVEKNKSMRA  304

Query  814  EMDSYLATTSVGA  852
            ++D+ +  TS+ A
Sbjct  305  DLDAVIQPTSIQA  317



>ref|NP_001150461.1| LOC100284091 [Zea mays]
 gb|ACG39188.1| catalytic/ hydrolase [Zea mays]
Length=263

 Score =   232 bits (592),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/250 (41%), Positives = 168/250 (67%), Gaps = 3/250 (1%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + + FD ++FDMDDTLY   +GI  A +KNI +++++K    E++   + ++L+++YG++
Sbjct  6    AGAKFDCLLFDMDDTLYPLSLGINLACRKNIQEYMLKKLRIEESQVPRMCLDLYREYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ LGYD D D++H+ VHG LPY  +KPDP LR LL S+ QRKIIFTNSD+ HA +V
Sbjct  66   MAGLKVLGYDFDYDDFHACVHGTLPYEKVKPDPVLRQLLLSLPQRKIIFTNSDKAHAARV  125

Query  463  LDRIGIKDCFEQIICFETMN---PNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRT  633
            L+++G++DCF+ I+CFET+N   P  +  +      ++ KP++ +M   ++ A +D  RT
Sbjct  126  LZKLGLQDCFQGIVCFETLNPPPPTETEKNSGSAGTILCKPSLASMEAVIEIAKLDAERT  185

Query  634  LFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRS  813
            +F DD+TRNIAAG A G RT +VG++     +D A+E +  + + +PE+W       +  
Sbjct  186  VFFDDSTRNIAAGKAAGFRTVIVGSSALVPGADVALESIHNIKEALPELWEVAAAAAAGD  245

Query  814  EMDSYLATTS  843
             +D+ L +T+
Sbjct  246  RVDAVLRSTT  255



>ref|XP_009764836.1| PREDICTED: uncharacterized protein C24B11.05 [Nicotiana sylvestris]
Length=263

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 152/234 (65%), Gaps = 7/234 (3%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            S   ++ ++FD+DDTLY  + GI     KNI D++VEK G  E +   + V L+K+YG++
Sbjct  11   SEPKYECLLFDVDDTLYPLRSGISAQCTKNIIDYMVEKLGIDEAKVPEMCVSLYKEYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D D+YHSFVHGRLPY L+K D  LR+LL S+  RK+IF+N++  H  KV
Sbjct  71   MAGLRAIGYDFDYDDYHSFVHGRLPYELLKTDHVLRNLLHSLPVRKVIFSNANEAHVAKV  130

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPDEFP-------VVLKPAMEAMNIAVDFADVD  621
            L R+G++DCF+ IICFET+NP    S   D          VV KP  EA   A   A+++
Sbjct  131  LSRLGLEDCFDDIICFETVNPTRDSSVAQDNINAESARTLVVCKPFEEAYEQAFKIANIN  190

Query  622  PRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            P++TLF DD+ RN+     +GL T  VG + KTK  DYA+E +  M + +PE+W
Sbjct  191  PQKTLFFDDSVRNLQTAKLMGLHTVWVGASHKTKAIDYALESIHNMKEALPELW  244



>ref|XP_006288408.1| hypothetical protein CARUB_v10001663mg [Capsella rubella]
 gb|EOA21306.1| hypothetical protein CARUB_v10001663mg [Capsella rubella]
Length=280

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/247 (49%), Positives = 163/247 (66%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +   KNI D++VEK G P+ +   L   L+K YG++
Sbjct  11   TSHMYDCLLFDLDDTLYPLSTGIARECGKNIKDYMVEKLGIPKDKIVELSDLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D D+YHSFVHGRLPY+ IKPDP LRSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDDYHSFVHGRLPYDNIKPDPVLRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNP--NLSRSSRPDEF------------------PVVLKPAM  582
            L ++G++DCFE IICFET+N       S  P+ F                  PVV KP+ 
Sbjct  131  LKKLGLEDCFEGIICFETLNTMHKTDASKDPEIFDIAGHFDRSEPVGSLPKTPVVCKPSE  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG + K K +DYA+E +  + 
Sbjct  191  SAIERALEIANIDPNRTLFFEDSVRNVQAGKRVGLHTVLVGKSNKVKGADYALENIHNLK  250

Query  763  QVIPEIW  783
            + IPE+W
Sbjct  251  EAIPELW  257



>ref|XP_003554584.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Glycine max]
 ref|XP_006604769.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Glycine max]
 gb|KHN43399.1| Suppressor of disruption of TFIIS [Glycine soja]
Length=279

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 107/255 (42%), Positives = 168/255 (66%), Gaps = 24/255 (9%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            S R +   +D ++FDMDDTLY    G+  A +KNI++++++     E+E   + V+L+++
Sbjct  4    SRRIAGFKYDCLLFDMDDTLYPLSTGLNLACRKNIEEYMLKHLHMEESEVPKICVDLYRE  63

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YG+++AGL+A G++ D DE+H++VHGRLPY  +KPDP LR+LL S+ QRKI+FTN+D+ H
Sbjct  64   YGTTMAGLKAFGHEFDNDEFHAYVHGRLPYKKLKPDPVLRNLLFSMPQRKIVFTNADQAH  123

Query  451  AMKVLDRIGIKDCFEQIICFETMNP-------------NLSRSSRPD-----------EF  558
            A +VL+R+G+K+CF+ IICFET+NP               S S   D           + 
Sbjct  124  AHQVLNRLGLKECFDSIICFETLNPPNYTNVPTDNLALTWSNSFNKDCNQVENRCFNSKT  183

Query  559  PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYA  738
             ++ KP++EA+ +A+  A++DPR+TLF DD+ RNIA+G A GL T +VG +     +DYA
Sbjct  184  QILCKPSVEAIEVAIQIANLDPRKTLFFDDSARNIASGKAAGLNTVIVGRSDLVPGADYA  243

Query  739  MEKVTEMVQVIPEIW  783
            +  +  + + +PEIW
Sbjct  244  LSSIHNIKEALPEIW  258



>ref|XP_003521627.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Glycine max]
 ref|XP_006577189.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Glycine max]
Length=279

 Score =   232 bits (592),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/255 (43%), Positives = 165/255 (65%), Gaps = 24/255 (9%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            S R S   +D ++ DMDDTLY    G+  A +KNI+ ++++     E+E   L V+L+++
Sbjct  4    SRRISGFKYDCLLLDMDDTLYPLSTGLNLACRKNIEGYMLKHLLMEESEVPKLCVDLYRE  63

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YG+++AGL+A GY+ D DE+H++VHGRLPY  +KPDP LRSLL S+ QRKI+FTN+D+ H
Sbjct  64   YGTTMAGLKAFGYEFDNDEFHAYVHGRLPYEKLKPDPVLRSLLLSMPQRKIVFTNADQAH  123

Query  451  AMKVLDRIGIKDCFEQIICFETMNP-------------NLSRSSRPD-----------EF  558
            A +VL+R+G+ DCF+ IICFET+NP               S+S   D           + 
Sbjct  124  AHQVLNRLGLNDCFDGIICFETLNPPNYTNVPTDTHLLTWSKSFNKDCNQVESGCFNSKT  183

Query  559  PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYA  738
             ++ KP++EA+  A+  A+VDPR+TLF DD+ RNIA+G A GL T +VG +     +DYA
Sbjct  184  QILCKPSVEAIEAAIQIANVDPRKTLFFDDSARNIASGKAAGLNTVIVGRSDLVPGADYA  243

Query  739  MEKVTEMVQVIPEIW  783
            +  +  + + +P+IW
Sbjct  244  LNSIHNIKEALPKIW  258



>ref|XP_010490640.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=280

 Score =   232 bits (592),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/247 (48%), Positives = 161/247 (65%), Gaps = 20/247 (8%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +    NI D++VEK G  + +   L   L+K YG++
Sbjct  11   TSQKYDCLLFDLDDTLYPLSSGIARECGNNIKDYMVEKLGIAKDKIVELSDHLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D DEYHSFVHGRL Y+ IKPDP +RSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDEYHSFVHGRLTYDNIKPDPVIRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMNP--NLSRSSRPDEF------------------PVVLKPAM  582
            L R+G++DCFE IICFET+N    +  S  P+ F                  PVV KP+ 
Sbjct  131  LKRLGLEDCFEGIICFETLNQMHKIDASKNPEIFDIVGHFHRSEPVSSLPKTPVVCKPSE  190

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG + K K +DYA+E +  + 
Sbjct  191  SAIEKALEIANIDPNRTLFFEDSVRNVQAGKRVGLHTVLVGKSNKVKGADYALESIHNLK  250

Query  763  QVIPEIW  783
            + IPE+W
Sbjct  251  EAIPELW  257



>ref|XP_010543295.1| PREDICTED: uncharacterized protein C24B11.05-like [Tarenaya hassleriana]
 ref|XP_010543296.1| PREDICTED: uncharacterized protein C24B11.05-like [Tarenaya hassleriana]
Length=294

 Score =   233 bits (593),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 120/261 (46%), Positives = 162/261 (62%), Gaps = 38/261 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +A  KNI D+L+EK G  E +   +   L+K YG+++AGL
Sbjct  11   YDCLLFDLDDTLYPLSTGISKACGKNIKDYLIEKLGIQEDKVVEMSNLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+G+D D D+YHSFVHGRLPY  IKPDP LRSLL S+  RK+IFTN+DRVH +K L R+
Sbjct  71   RAIGHDFDYDDYHSFVHGRLPYENIKPDPILRSLLLSLPLRKVIFTNADRVHTVKALSRL  130

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G+K CFE IICFET+NP    ++  DE                                 
Sbjct  131  GLKGCFEGIICFETLNPTHKNAASDDEDDIEFIGRSETRENAPRSEIYDIVGHFAMSKPV  190

Query  556  -----FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKT  720
                  P+V KP++EA+  A+  AD+DP RTLF +D+ RNI AG  VGL T LVG++ K 
Sbjct  191  GSLPKTPIVCKPSVEAIEKALKIADIDPHRTLFFEDSFRNIQAGKRVGLHTVLVGSSQKV  250

Query  721  KESDYAMEKVTEMVQVIPEIW  783
            K +DYA+E +  + + +PE+W
Sbjct  251  KGADYALESIHNLKEALPELW  271



>ref|XP_010682722.1| PREDICTED: uncharacterized protein C24B11.05-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010682723.1| PREDICTED: uncharacterized protein C24B11.05-like [Beta vulgaris 
subsp. vulgaris]
Length=300

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/274 (43%), Positives = 171/274 (62%), Gaps = 45/274 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ + + KNI D++VEK G   ++   L   L+K YG+++AGL
Sbjct  13   YDCLLFDLDDTLYPLSSGLAKGVLKNIHDYMVEKLGIDRSKLDDLSNLLYKNYGTTMAGL  72

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHG+LPY  +KPDP L+SLL S+  RK+IFTN+D++HA+KVL ++
Sbjct  73   RAIGYDFDYDEYHSFVHGKLPYEHLKPDPVLKSLLLSLPFRKVIFTNADKIHAVKVLSKL  132

Query  475  GIKDCFEQIICFETMNP-----------------------NLSRSSRPDE----------  555
            G++DCFE IICFET+NP                       N++++S  ++          
Sbjct  133  GLEDCFEGIICFETLNPTHKNFASEDEDDIAFVGSKPMVSNINKASDTNDTQIFDIISHF  192

Query  556  ----------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVG  705
                       P+V KP+  A+  A+  A++DP RT+F DD+ RNI AG  VGL T LVG
Sbjct  193  ANQNVATLPKTPIVCKPSEYAIEQALKIANLDPHRTIFFDDSVRNILAGKRVGLDTVLVG  252

Query  706  TATKTK-ESDYAMEKVTEMVQVIPEIWFEEEVRC  804
            T+ + K  +DYA+E +  + + +PE+W E +VR 
Sbjct  253  TSHRPKGGADYALESIHNLREALPELW-EADVRA  285



>ref|XP_006365453.1| PREDICTED: suppressor of disruption of TFIIS-like [Solanum tuberosum]
Length=234

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 99/219 (45%), Positives = 155/219 (71%), Gaps = 5/219 (2%)
 Frame = +1

Query  136  MDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRALGYDV  315
            MDDTLY    G+  A +KNI+++++      E+E   + ++L+++YG+++AGL+ LGY+ 
Sbjct  1    MDDTLYPLSSGVNLACRKNIEEYMLHHLNIEESEVPKMCLDLYREYGTTMAGLKELGYEF  60

Query  316  DADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIKDCFE  495
            D D++H +VHGRLPY ++KPDP LR+LL S+ QRKIIFTN D+ HA++VL ++G+ DCFE
Sbjct  61   DNDKFHEYVHGRLPYEVLKPDPLLRNLLLSMPQRKIIFTNGDKAHAIRVLSKLGLGDCFE  120

Query  496  QIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGN  675
             IICFET+NP+L      D   ++ KP+++AM  A+  A++DP +T+F DD+ RNIA+G 
Sbjct  121  GIICFETLNPSLE-----DNATILCKPSLKAMEAAIQIANLDPNKTIFFDDSARNIASGK  175

Query  676  AVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
              GL T +VG++T    +D+A+  +  + + +P IW EE
Sbjct  176  QAGLHTVVVGSSTLVAGADHALRSIHNIREALPHIWEEE  214



>ref|XP_002280756.1| PREDICTED: uncharacterized protein C24B11.05 isoform X2 [Vitis 
vinifera]
Length=287

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/253 (42%), Positives = 166/253 (66%), Gaps = 30/253 (12%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FDMDDTLY    G+  A +KNI+D++++     E+E   + +EL+++YG+++AGL
Sbjct  12   YECLLFDMDDTLYPMSSGLNLACRKNIEDYMLQHLNIEESEVPRMCLELYREYGTTMAGL  71

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H++VHGRLPY  +KPDP LR+LL S+ QRKIIFTN+DR HA +VL+R+
Sbjct  72   KALGYEFDDDEFHAYVHGRLPYESLKPDPVLRNLLLSMPQRKIIFTNADREHAAQVLNRL  131

Query  475  GIKDCFEQIICFETMNP--------------------------NLSRSSRPDEF----PV  564
            G++ CFE +ICFET+NP                          N +  +  + F    P+
Sbjct  132  GLEGCFEGVICFETLNPPPEPTEYNEELEGNGVCKEGASEPEDNAADMAESNSFRPRSPI  191

Query  565  VLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAME  744
            + KP++EA+  A+  A+VDP++T+F DD+ RNI +G A GL T +VG++     +D+A+ 
Sbjct  192  LCKPSVEAIEAAIRIANVDPKKTIFFDDSARNITSGKAAGLHTVIVGSSVLVPGADHALG  251

Query  745  KVTEMVQVIPEIW  783
             +  + + +PEIW
Sbjct  252  SIHNIKEALPEIW  264



>ref|XP_006341015.1| PREDICTED: uncharacterized protein LOC102599760 [Solanum tuberosum]
Length=294

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/264 (42%), Positives = 166/264 (63%), Gaps = 42/264 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  ++++NI+D++VEK G  +++   L   L+K YG+++AGL
Sbjct  11   YDCLLFDLDDTLYPLSAGLATSVRQNIEDYMVEKLGIEQSKIEELGNLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSF+HGRLPY  ++PDP LR+LL SI  RK+IFTN+D+VHA+K L ++
Sbjct  71   RAIGYDFDYDEYHSFIHGRLPYENLRPDPVLRNLLLSIPIRKVIFTNADKVHALKALSKL  130

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE I+CFET+NP + +S+  D     EF                           
Sbjct  131  GLEDCFEGILCFETLNP-VHKSTLSDDEDDIEFVGSAISFNATATNGSEIFDIIGHFSQP  189

Query  559  ---------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTA  711
                     P+V KP+  A+  A+  A+++P RTLF +D+ RNI AG  VGL T LVG +
Sbjct  190  KAGSVLPKTPIVCKPSEVAIERALKIANINPHRTLFFEDSVRNIKAGKHVGLDTVLVGNS  249

Query  712  TKTKESDYAMEKVTEMVQVIPEIW  783
             +   +DYA+E +  + + IP++W
Sbjct  250  QRVAGADYALESIHNIREAIPQLW  273



>gb|KHN13997.1| Hypothetical protein glysoja_025014 [Glycine soja]
Length=297

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 117/290 (40%), Positives = 176/290 (61%), Gaps = 46/290 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +A  +NI D++VEK G  +++   L   L++ YG+++AGL
Sbjct  10   YDCLLFDLDDTLYPLSTGLAKACGQNIKDYMVEKLGIDKSKIDDLSNLLYENYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD + DEYHS+VHGRLPY  +KPDP LR+LL S+  RK+IFTNSD+VHA+K L ++
Sbjct  70   RAIGYDFEYDEYHSYVHGRLPYENLKPDPVLRNLLLSLPYRKLIFTNSDKVHAVKALSKL  129

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE IICFET+NP + +SS  D     EF                           
Sbjct  130  GLEDCFEGIICFETLNP-IHKSSVSDDEDDIEFVGGSGTTIPAPKKDVNSFQIFDLISHF  188

Query  559  ------------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALV  702
                        P++ KP+   + +A+  A+++P+RTLF +D+ RNI AG  VGL T LV
Sbjct  189  AKPNPNTVLPKTPIICKPSENVIELALKIANLNPQRTLFFEDSVRNIQAGKRVGLHTVLV  248

Query  703  GTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            G + + K +DYA+E +  + + +PE+W E +++   +    +   TSV A
Sbjct  249  GKSQRIKGADYALESIHNLREAVPELW-EGDIKSEVAYPGKHSVETSVTA  297



>ref|XP_002533744.1| catalytic, putative [Ricinus communis]
 gb|EEF28631.1| catalytic, putative [Ricinus communis]
Length=281

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 163/267 (61%), Gaps = 21/267 (8%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G  + + KNI +++V+K G  E + +AL   L++ YG+S+AGL
Sbjct  15   YDTLLFDVDDTLYPLSTGFSKEVTKNIQEYMVQKLGMQENKVAALNQVLYRNYGTSMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +A+GYD D D+YHSFVHGRLPY  +KPD  LRSLL S+  R++IF+N+D +H  K L ++
Sbjct  75   KAIGYDFDNDDYHSFVHGRLPYEKLKPDHFLRSLLLSLPVRRVIFSNADEIHVAKTLSKL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------FPVVLKPAMEAM  591
            G++DCFE I+CFET+NPN   S+  D+                      P+V KP   A 
Sbjct  135  GLEDCFESIVCFETINPNHKTSTCNDQSEVKFGSEMLENFEIGSVLPKTPIVCKPFENAF  194

Query  592  NIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVI  771
              A   A+++P+RT+F DD+ RNI  G  +GL+T LVG++ +   +D+ +E +  + + +
Sbjct  195  EQAFKLANINPQRTVFFDDSIRNIQTGKRMGLKTVLVGSSNRVSGADHVLESIHNLKEAL  254

Query  772  PEIWFEEEVRCSRSEMDSYLATTSVGA  852
            PE+W   E   +R         TSV A
Sbjct  255  PELWEATEKTKTRKYAGKVAIETSVTA  281



>ref|XP_008799742.1| PREDICTED: uncharacterized protein C24B11.05-like [Phoenix dactylifera]
Length=286

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/253 (44%), Positives = 166/253 (66%), Gaps = 26/253 (10%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+     KNI D++VEK G  E++   L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPYSSGLATECCKNIGDYMVEKLGIEESKMPDLCNLLYKYYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GY+ D ++YHSFVHGRLPY+ +KPDP LR LL S+  RK+IFTN+D+VHA KVL ++
Sbjct  75   RAIGYNFDYEDYHSFVHGRLPYDKLKPDPVLRHLLLSLPIRKVIFTNADKVHAAKVLSKL  134

Query  475  GIKDCFEQIICFETMNPN------------------LSRSSRPD--------EFPVVLKP  576
            G++DCFE IICFET+NP                   L   ++PD        + P+  KP
Sbjct  135  GLEDCFEGIICFETLNPPGDSPSPCGLPATADVFDILDYFAQPDAGAGSELPKTPIRCKP  194

Query  577  AMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE  756
            +++AM  A+  A+++P+RT+F DD+ RNI +G  +GL T  VGT+ + K +D+A+E +  
Sbjct  195  SIDAMEHALKIANINPQRTIFFDDSLRNIQSGKRIGLHTVRVGTSHRVKGADHALESIHN  254

Query  757  MVQVIPEIWFEEE  795
            + + +PE+W + E
Sbjct  255  IREALPELWEDAE  267



>ref|XP_010107302.1| hypothetical protein L484_009436 [Morus notabilis]
 gb|EXC14782.1| hypothetical protein L484_009436 [Morus notabilis]
Length=306

 Score =   233 bits (593),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/269 (43%), Positives = 161/269 (60%), Gaps = 46/269 (17%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  + + NI+D++VEK G  +++ + L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPLCSGLATSCRNNIEDYMVEKLGLEKSKIAQLGNLLYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY+ +KPDP LR LL S+  R+IIFTN+DRVHA + L R+
Sbjct  75   RAIGYDFDYDEYHSFVHGRLPYDNLKPDPVLRHLLLSLPYRRIIFTNADRVHAAESLRRL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFE +NP    +   DE                                 
Sbjct  135  GLEDCFEGIICFEILNPTHKSAPSDDEDDIEFVRLDHNSADHNNYPTTTTGTSAIFDIIG  194

Query  556  -------------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTA  696
                          P+V KP+  A+  A+  A V+P+RTLF DD+ RNI AG  VGL T 
Sbjct  195  HFAQPNPVSALPKTPIVCKPSESAIERALKIAKVNPQRTLFFDDSVRNIQAGKRVGLYTV  254

Query  697  LVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            LVGT+ + K +DYA+E +  + + +PE+W
Sbjct  255  LVGTSQRIKGADYALESIHNIREALPELW  283



>gb|KDP42242.1| hypothetical protein JCGZ_02972 [Jatropha curcas]
Length=282

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/247 (45%), Positives = 161/247 (65%), Gaps = 25/247 (10%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY    G+ Q + KNI++++V+K G  E++ S L V L+K YG++LAGL
Sbjct  14   YECLLFDLDDTLYPLSSGLSQHVTKNIEEYMVQKLGIDESKVSELCVSLYKYYGTTLAGL  73

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GY  D D++HSFVHGRLPY+++KPDP LR+LL SI  RK+IFTN D+ HA +VL R+
Sbjct  74   RAIGYRFDYDDFHSFVHGRLPYDILKPDPVLRNLLHSIPARKVIFTNGDKTHAGRVLSRL  133

Query  475  GIKDCFEQIICFETMNPNLSRSSRP-----------DEF-------------PVVLKPAM  582
            G++DCFE  ICFET+N N ++ + P           +E+             PV+ KP  
Sbjct  134  GLEDCFEGTICFETLN-NANKGNDPVVEEENGVFDINEYSAAPNAGIELPRSPVICKPFD  192

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
            EA       A ++P+RTLF DD+ RNI  G+ +GL T  VG + +T   DYA+E +  M 
Sbjct  193  EAFEQTFKIACINPQRTLFFDDSLRNIQTGSRLGLTTVWVGASHRTLGVDYALESIHNMK  252

Query  763  QVIPEIW  783
            + +PE+W
Sbjct  253  EALPELW  259



>gb|EMS52722.1| Uncharacterized protein C24B11.05 [Triticum urartu]
Length=520

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/263 (44%), Positives = 165/263 (63%), Gaps = 23/263 (9%)
 Frame = +1

Query  70   EMDSFCKSVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASAL  249
            E D  C  V+D    FD ++FD+DDTLY    GI   +K NI+ ++VEK G  E++   L
Sbjct  151  EFDERCLKVQDPK--FDCLLFDLDDTLYPLSSGISSHVKTNIEAYMVEKLGIEESKIENL  208

Query  250  RVELFKKYGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIF  429
               L+K YG+++AGLRA+GY+ D DEYHSFVHGRLPY+ IKPDP L+ +L+++  RK+IF
Sbjct  209  GNLLYKNYGTTMAGLRAIGYNFDYDEYHSFVHGRLPYDNIKPDPVLKQILKNMRMRKLIF  268

Query  430  TNSDRVHAMKVLDRIGIKDCFEQIICFETMNP---------------------NLSRSSR  546
            TN D +HA++ L R+G++DCFE IICFET+NP                      L  +  
Sbjct  269  TNGDMIHAVRALKRLGLEDCFEGIICFETLNPPCLLTPCDQAPEIFDIAGHFAGLGSADD  328

Query  547  PDEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKE  726
                PV+ KP + AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT+ + K 
Sbjct  329  LPRTPVLCKPNVGAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLVGTSQRVKG  388

Query  727  SDYAMEKVTEMVQVIPEIWFEEE  795
            +D+A+E +  + + +P +W E E
Sbjct  389  ADHALESIHNIREALPGLWGEAE  411


 Score = 69.3 bits (168),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 49/82 (60%), Gaps = 0/82 (0%)
 Frame = +1

Query  550  DEFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKES  729
            D   +   P + AM  A+  A+V+P + +F DD+ RNI AG  +GL T LVGT+ + K +
Sbjct  420  DRVAIETSPNVGAMEAALRIANVNPYKAIFFDDSVRNIQAGKRIGLHTVLVGTSQRVKGA  479

Query  730  DYAMEKVTEMVQVIPEIWFEEE  795
            D+A+E +  + +   E+W E E
Sbjct  480  DHALESIHNIREARRELWEEAE  501



>ref|XP_003522172.1| PREDICTED: suppressor of disruption of TFIIS-like isoform X1 
[Glycine max]
Length=305

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 170/279 (61%), Gaps = 45/279 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A+ KNI D++VEK G   ++   L   L+  YG+++AGL
Sbjct  18   YDCLLFDLDDTLYPLNSGLANAIDKNIKDYMVEKLGAEPSKTGELVNLLYSNYGTTIAGL  77

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD+D +EY+SFVHG+LPY  +KPDP LR+LL S+  RK+IFTNSD+VH +K L+R+
Sbjct  78   RAIGYDIDYEEYYSFVHGKLPYENLKPDPVLRNLLLSLPYRKLIFTNSDKVHTIKALERL  137

Query  475  GIKDCFEQIICFETMNP---------------NLSRSSRPD-------------------  552
            G++DCFE +ICFET+NP                 S+S  P                    
Sbjct  138  GLEDCFEGMICFETLNPIQKSTVFYYEADIKFEGSKSINPTPKNGVECSEIFDIIEHFAQ  197

Query  553  --------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
                    E P++ KP+  A+ +A+  A+++P+RTLF +D+ RNI +G  +GL T LVG 
Sbjct  198  PEPSAVLPETPIICKPSEHAIKLALKMANLNPQRTLFFEDSVRNIQSGKRLGLHTVLVGR  257

Query  709  ATKTKESDYAMEKVTEMVQVIPEIW---FEEEVRCSRSE  816
            + + K +DYAME +  + + +PE+W    + +V C  +E
Sbjct  258  SYRVKGADYAMESIHNLKEAVPELWEADIKAQVACPGTE  296



>ref|XP_010652318.1| PREDICTED: uncharacterized protein C24B11.05 isoform X1 [Vitis 
vinifera]
Length=300

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/253 (42%), Positives = 166/253 (66%), Gaps = 30/253 (12%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FDMDDTLY    G+  A +KNI+D++++     E+E   + +EL+++YG+++AGL
Sbjct  25   YECLLFDMDDTLYPMSSGLNLACRKNIEDYMLQHLNIEESEVPRMCLELYREYGTTMAGL  84

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H++VHGRLPY  +KPDP LR+LL S+ QRKIIFTN+DR HA +VL+R+
Sbjct  85   KALGYEFDDDEFHAYVHGRLPYESLKPDPVLRNLLLSMPQRKIIFTNADREHAAQVLNRL  144

Query  475  GIKDCFEQIICFETMNP--------------------------NLSRSSRPDEF----PV  564
            G++ CFE +ICFET+NP                          N +  +  + F    P+
Sbjct  145  GLEGCFEGVICFETLNPPPEPTEYNEELEGNGVCKEGASEPEDNAADMAESNSFRPRSPI  204

Query  565  VLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAME  744
            + KP++EA+  A+  A+VDP++T+F DD+ RNI +G A GL T +VG++     +D+A+ 
Sbjct  205  LCKPSVEAIEAAIRIANVDPKKTIFFDDSARNITSGKAAGLHTVIVGSSVLVPGADHALG  264

Query  745  KVTEMVQVIPEIW  783
             +  + + +PEIW
Sbjct  265  SIHNIKEALPEIW  277



>gb|KHN27240.1| Hypothetical protein glysoja_046608 [Glycine soja]
Length=306

 Score =   232 bits (592),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 170/279 (61%), Gaps = 45/279 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A+ KNI D++VEK G   ++   L   L+  YG+++AGL
Sbjct  18   YDCLLFDLDDTLYPLNSGLANAIDKNIKDYMVEKLGAEPSKTGELVNLLYSNYGTTIAGL  77

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD+D +EY+SFVHG+LPY  +KPDP LR+LL S+  RK+IFTNSD+VH +K L+R+
Sbjct  78   RAIGYDIDYEEYYSFVHGKLPYENLKPDPVLRNLLLSLPYRKLIFTNSDKVHTIKALERL  137

Query  475  GIKDCFEQIICFETMNP---------------NLSRSSRPD-------------------  552
            G++DCFE +ICFET+NP                 S+S  P                    
Sbjct  138  GLEDCFEGMICFETLNPIQKSTVFYYEADIKFEGSKSINPTPKNGVECSEIFDIIEHFAQ  197

Query  553  --------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
                    E P++ KP+  A+ +A+  A+++P+RTLF +D+ RNI +G  +GL T LVG 
Sbjct  198  PEPSAVLPETPIICKPSEHAIKLALKMANLNPQRTLFFEDSVRNIQSGKRLGLHTVLVGR  257

Query  709  ATKTKESDYAMEKVTEMVQVIPEIW---FEEEVRCSRSE  816
            + + K +DYAME +  + + +PE+W    + +V C  +E
Sbjct  258  SYRVKGADYAMESIHNLKEAVPELWEADIKAQVACPGTE  296



>ref|XP_008448042.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Cucumis melo]
Length=290

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/249 (45%), Positives = 162/249 (65%), Gaps = 27/249 (11%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            FD ++FD+DDTLY    G+  A K NI  ++ EK G   ++   L   L+K YG+++AGL
Sbjct  16   FDCLLFDLDDTLYPLSSGLATACKNNIHAYIAEKLGVETSKIPELSNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYH FVHGRLPY+ +KPDP LR+LL ++  RK+IFTN+D+ H  KVL+++
Sbjct  76   RAIGYDFDYDEYHRFVHGRLPYDNLKPDPILRNLLLTLPYRKLIFTNADKDHTAKVLNKL  135

Query  475  GIKDCFEQIICFETMNPN--------------------LSRSSRPDE-------FPVVLK  573
            G++DCFE IICFET+NP                     ++  S+P+         P+V K
Sbjct  136  GLEDCFEGIICFETLNPPQKSSVLDEKEHIPSSEIFDIIAHFSQPNHPLMELPITPIVCK  195

Query  574  PAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVT  753
            P+  A+  A+  A++DP+RTLF +D+ RNI AG  +GL+T LVGT+ ++K +DYA+E + 
Sbjct  196  PSEAAIEWALKIANIDPQRTLFFEDSLRNIQAGKGLGLQTVLVGTSHRSKGADYAIESIH  255

Query  754  EMVQVIPEI  780
             + + IPE+
Sbjct  256  NIKEAIPEL  264



>ref|XP_009759728.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein C24B11.05 
[Nicotiana sylvestris]
Length=272

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 166/245 (68%), Gaps = 13/245 (5%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +S  ++ ++FDMDDTLY    G+  A +KN+++F++      ETE   + +EL++++G
Sbjct  6    RSNSLKYECLLFDMDDTLYPLSSGLNLACRKNLEEFMLHYLDIEETEVPKMCLELYREHG  65

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYN-LIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            +++AGL+ LGY+ D D++H  VHGRLPY+ ++KPDP LR+LL S+ QRKIIFTN D+ HA
Sbjct  66   TTMAGLKELGYEFDNDKFHGLVHGRLPYDEVLKPDPLLRNLLLSMPQRKIIFTNGDKAHA  125

Query  454  MKVLDRIGIKDCFEQIICFETMNP------------NLSRSSRPDEFPVVLKPAMEAMNI  597
            ++VL ++G+ DCFE IICFET+NP            N  +  +  +  ++ KP++EAM  
Sbjct  126  IRVLTKMGLADCFEGIICFETLNPPQENXNYEYQVSNKRQGEQVAKPRILCKPSLEAMEA  185

Query  598  AVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPE  777
            A+  A+VDP++T+F DD+ RNIA+G   GL T +VGT++    +D+A+  +  + + IP 
Sbjct  186  AIRIANVDPKKTIFFDDSARNIASGKQAGLHTVIVGTSSLVAGADHALRSIHNIKEAIPH  245

Query  778  IWFEE  792
            IW E+
Sbjct  246  IWEED  250



>ref|XP_007051329.1| Haloacid dehalogenase-like hydrolase superfamily protein [Theobroma 
cacao]
 gb|EOX95486.1| Haloacid dehalogenase-like hydrolase superfamily protein [Theobroma 
cacao]
Length=286

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/261 (41%), Positives = 166/261 (64%), Gaps = 28/261 (11%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R + + ++ ++FDMDDTLY    G+  A +KNI++F+++     E+E   + +EL+++YG
Sbjct  8    RATGTKYECLLFDMDDTLYPLSTGVNLACRKNIEEFMLQYLNIEESEVPRMCLELYREYG  67

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+H++VHGRLPY  ++ DP LR+LL S+ QRKIIFTN+D+ HA 
Sbjct  68   TTMAGLKALGYEFDNDEFHAYVHGRLPYETLRSDPVLRNLLLSMPQRKIIFTNADKAHAS  127

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEF--------------------------  558
            +VL R+G++DCFE IICFET+NP L  +   D                            
Sbjct  128  QVLRRLGLEDCFEGIICFETLNPPLEPADFMDALDDNQVLAGADLEPNTADRTDASCVNS  187

Query  559  --PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESD  732
              P++ KP++EA   A+  A+V+P++T+F DD+ RNI +G A GL T +VG++     +D
Sbjct  188  NSPILCKPSLEAFEAAIRIANVNPKKTIFFDDSARNIGSGKAAGLHTVIVGSSVLVPGAD  247

Query  733  YAMEKVTEMVQVIPEIWFEEE  795
            YA+  +  + + IPEI   EE
Sbjct  248  YALSSIHNIKEAIPEICEGEE  268



>ref|XP_008653771.1| PREDICTED: uncharacterized protein LOC100193647 isoform X1 [Zea 
mays]
 ref|XP_008653820.1| PREDICTED: uncharacterized protein LOC100193647 isoform X1 [Zea 
mays]
 ref|XP_008653870.1| PREDICTED: uncharacterized protein LOC100193647 isoform X1 [Zea 
mays]
 tpg|DAA52307.1| TPA: hypothetical protein ZEAMMB73_663366 [Zea mays]
Length=280

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/269 (42%), Positives = 171/269 (64%), Gaps = 29/269 (11%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY    GI  A +KNI D++       E + + + ++L+K+YG+++AGL
Sbjct  10   YECLLFDLDDTLYPFSAGINLACRKNIQDYMRHHLHIEERQVADMCLDLYKEYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H+ VHG LPY+ ++PDP LR+LL SI QRKI+FTNSD+ HA + L R+
Sbjct  70   KALGYEFDNDEFHATVHGTLPYHNLRPDPVLRTLLLSIPQRKIVFTNSDKAHAEEALCRL  129

Query  475  GIKDCFEQIICFETMNPNLSRSS--------RPDEF-----------------PVVLKPA  579
            G++ CF+ +ICFET+NP    S+         PDE                  P++ KP+
Sbjct  130  GLQGCFDGVICFETLNPCNGPSAFRDGNGMLFPDETFPDSADLNESDGFRPISPILCKPS  189

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
            +EAM      A+VDP++T+F DD+TRNIA+G A G  T +VG  T    +D+A+E +  M
Sbjct  190  IEAMEAVTRIANVDPKKTIFFDDSTRNIASGKAAGFHTVIVGRPTLVPGADHALESIHNM  249

Query  760  VQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
             + +PEIW  ++    RSE D+ L+ T+V
Sbjct  250  KEALPEIWDGQD----RSESDALLSPTAV  274



>ref|XP_002463591.1| hypothetical protein SORBIDRAFT_01g002590 [Sorghum bicolor]
 gb|EER90589.1| hypothetical protein SORBIDRAFT_01g002590 [Sorghum bicolor]
Length=277

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 161/246 (65%), Gaps = 23/246 (9%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FD+DDTLY   VGI  A +KNI D++       E+  + + ++L+K+YG+++AGL
Sbjct  10   YECLLFDLDDTLYPFSVGINLACRKNIQDYMRHHLHIEESHIADMCLDLYKEYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALGY+ D DE+H+ VHG LPY+ ++PDP LR+LL SI QRKI+FTNSD+ HA + L R+
Sbjct  70   KALGYEFDNDEFHATVHGTLPYHNLRPDPVLRTLLLSIPQRKIVFTNSDKAHAEEALHRL  129

Query  475  GIKDCFEQIICFETMN-------------------PNLSRSSRPDEF----PVVLKPAME  585
            G++ CF+ +ICFET+N                   PNL   +  D F    P++ KP++E
Sbjct  130  GLQGCFDGVICFETLNPYDGLSEFRNSMLFPDETSPNLVDLNESDGFRPISPILCKPSIE  189

Query  586  AMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQ  765
            AM   +  A+VDP++T+F DD+TRNIA+G A G  T +VG  T    +D+A+E +  M +
Sbjct  190  AMEAVIRIANVDPKKTIFFDDSTRNIASGKAAGFHTVIVGRPTLVPGADHALESIQNMKE  249

Query  766  VIPEIW  783
             +PEIW
Sbjct  250  ALPEIW  255



>ref|XP_004166506.1| PREDICTED: uncharacterized protein C24B11.05-like [Cucumis sativus]
 gb|KGN58864.1| hypothetical protein Csa_3G734170 [Cucumis sativus]
Length=289

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/260 (43%), Positives = 166/260 (64%), Gaps = 31/260 (12%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P +D ++FD+DDTLY    GI  +  +NI D++VEK G  +++   L   L+K Y
Sbjct  8    RQAQRPKYDCLLFDLDDTLYPLSSGIAASCLQNIKDYMVEKLGIEQSKIPDLCNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GYD D DEYH FVHGRLPY+ +KPDP LR+LL ++  RK+IFTN+D++HA
Sbjct  68   GTTMAGLRAIGYDFDYDEYHKFVHGRLPYDNLKPDPVLRNLLLNLPYRKVIFTNADKIHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPN------------------------LSRSSRPD---  552
            +KVL ++G++DCF+ IICFET+NP                         +     P+   
Sbjct  128  VKVLKKLGLEDCFQGIICFETLNPTNKNFVSVDKDEMNPIPSDSKIFDIIGHFLHPNPGT  187

Query  553  ---EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTK  723
               + P++ KP+  A+  A+  A ++P+RTLF +D+ RNI AG  VGL T L+GT+ + K
Sbjct  188  ELPKTPIICKPSEAAIERALKIAGLNPQRTLFFEDSVRNIQAGKRVGLDTVLIGTSQRVK  247

Query  724  ESDYAMEKVTEMVQVIPEIW  783
             +DYA+E +  + + IPE+W
Sbjct  248  GADYALESIHNLREGIPELW  267



>ref|XP_007205709.1| hypothetical protein PRUPE_ppa009908mg [Prunus persica]
 gb|EMJ06908.1| hypothetical protein PRUPE_ppa009908mg [Prunus persica]
Length=272

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/258 (43%), Positives = 161/258 (62%), Gaps = 21/258 (8%)
 Frame = +1

Query  100  DSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGS  279
            D    +D ++FD+DDTLY    GI   + KNI +++++K G  E+E   L + L+K YG+
Sbjct  5    DQYQQYDCLLFDLDDTLYPQSSGISVQITKNIQEYMLQKLGMKESEVPELCISLYKDYGT  64

Query  280  SLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMK  459
            ++AGL+A GY+ + D++HSFVHGRLPY+ + PDP LR LL S+  RK+IFTNSDR HA  
Sbjct  65   TMAGLKAQGYNFEYDDFHSFVHGRLPYDSLNPDPILRGLLLSLPIRKVIFTNSDRAHAAS  124

Query  460  VLDRIGIKDCFEQIICFETMNPN-----------LSRSSRPD------EFPVVLKPAMEA  588
            VL ++GI+DCFE IICFET+NP               + +P+      + PVV KP   A
Sbjct  125  VLGKLGIEDCFEMIICFETLNPTNNADDSVGAKETENTEQPNTGSVISKTPVVCKPFERA  184

Query  589  MNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQV  768
                   A+++P+RTLF DD+ RN+     +GL T ++GT+ +TK +D+A E +  + + 
Sbjct  185  YEETFKIANINPKRTLFFDDSIRNLQTAKELGLHTVMIGTSHRTKGADHAFESIHNIKEA  244

Query  769  IPEIWFE----EEVRCSR  810
            +PE+W      E VR SR
Sbjct  245  LPELWETTEQCENVRYSR  262



>ref|XP_011025285.1| PREDICTED: uncharacterized protein C24B11.05 [Populus euphratica]
Length=305

 Score =   232 bits (591),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 171/272 (63%), Gaps = 40/272 (15%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            R +   ++ ++FDMDDTLY   +G+  A ++NI++F++ +    E+E   + +EL++++G
Sbjct  15   RANGPKYECLLFDMDDTLYPLILGLNMACRRNIEEFMLHELHIEESEVPRMCLELYREHG  74

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+ALGY+ D DE+H+FVHGRLPY  +KPDP LR++L S+ QRKIIFTN+D+ HA 
Sbjct  75   TTMAGLKALGYEFDNDEFHAFVHGRLPYETLKPDPVLRNILLSVPQRKIIFTNADKAHAA  134

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRS------------SRPDEFP-------------  561
            +VL R+G +DCFE +ICFET+NP L  +            +R D  P             
Sbjct  135  EVLKRMGFEDCFEGVICFETLNPPLETANNMDALDNDTMIARGDPEPSDFDGTTATGNKN  194

Query  562  ---------------VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTA  696
                           ++ KP++EA+  A+  A+VDPR+T+F DD+ RNIA+G A GL T 
Sbjct  195  KIKNNLDNGISSKSRILCKPSLEAIEAAIQIANVDPRKTIFFDDSARNIASGKAAGLHTV  254

Query  697  LVGTATKTKESDYAMEKVTEMVQVIPEIWFEE  792
            +VG++     +D+A+  +  + + +PEIW +E
Sbjct  255  IVGSSVLVPGADHALRSIHNIKEAMPEIWEDE  286



>ref|XP_006576591.1| PREDICTED: suppressor of disruption of TFIIS-like isoform X2 
[Glycine max]
Length=321

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/279 (41%), Positives = 170/279 (61%), Gaps = 45/279 (16%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+  A+ KNI D++VEK G   ++   L   L+  YG+++AGL
Sbjct  34   YDCLLFDLDDTLYPLNSGLANAIDKNIKDYMVEKLGAEPSKTGELVNLLYSNYGTTIAGL  93

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD+D +EY+SFVHG+LPY  +KPDP LR+LL S+  RK+IFTNSD+VH +K L+R+
Sbjct  94   RAIGYDIDYEEYYSFVHGKLPYENLKPDPVLRNLLLSLPYRKLIFTNSDKVHTIKALERL  153

Query  475  GIKDCFEQIICFETMNP---------------NLSRSSRPD-------------------  552
            G++DCFE +ICFET+NP                 S+S  P                    
Sbjct  154  GLEDCFEGMICFETLNPIQKSTVFYYEADIKFEGSKSINPTPKNGVECSEIFDIIEHFAQ  213

Query  553  --------EFPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGT  708
                    E P++ KP+  A+ +A+  A+++P+RTLF +D+ RNI +G  +GL T LVG 
Sbjct  214  PEPSAVLPETPIICKPSEHAIKLALKMANLNPQRTLFFEDSVRNIQSGKRLGLHTVLVGR  273

Query  709  ATKTKESDYAMEKVTEMVQVIPEIW---FEEEVRCSRSE  816
            + + K +DYAME +  + + +PE+W    + +V C  +E
Sbjct  274  SYRVKGADYAMESIHNLKEAVPELWEADIKAQVACPGTE  312



>ref|XP_010512588.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=249

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/227 (45%), Positives = 157/227 (69%), Gaps = 6/227 (3%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
             + ++ + FDMDDTLY   +GI  A + NI +F++ + G  E+E   + ++L+K+YG+++
Sbjct  5    GAKYECLFFDMDDTLYPLSLGINLACRNNIQEFMLNQLGIEESEVPKMCLDLYKEYGTTM  64

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL+ LGY+ D DE+H +VHGRLPY  +KPDP LR+LL S+  RKIIFTN+D+ HA + L
Sbjct  65   AGLKVLGYEFDNDEFHEYVHGRLPYEKLKPDPVLRNLLLSMPHRKIIFTNADKAHATRAL  124

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFAD-VDPRRTLFL  642
             R+G++DCFE IICFET+NP+   +++     ++ KP++EA   A+  AD VDP +T+F 
Sbjct  125  TRLGLEDCFEGIICFETLNPSSDSTTQ-----ILCKPSVEAFEAALRIADIVDPLKTMFF  179

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            DD+ RNIA+  A GL+T  VG +     +DYA+  +  + + IP++W
Sbjct  180  DDSIRNIASAKATGLKTVFVGNSVLVPGADYALSSIHNIKEAIPDLW  226



>emb|CDP09081.1| unnamed protein product [Coffea canephora]
Length=265

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/235 (43%), Positives = 156/235 (66%), Gaps = 9/235 (4%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            S   ++ ++FD+DDTLY+   GI     KNI +++V K G  +T  + + ++L+K YG++
Sbjct  10   SGQKYECVLFDVDDTLYALSSGISAETTKNIAEYMVTKLGIDQTNVTEMALQLYKDYGTT  69

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GYD D D+YHSFVHGRLPY ++KPDP LR+LL S+  RK+IF+N +  H  +V
Sbjct  70   MAGLRAIGYDFDYDDYHSFVHGRLPYEMLKPDPVLRNLLHSLPIRKVIFSNGNEAHVAQV  129

Query  463  LDRIGIKDCFEQIICFETMNPNLSRSSRPD--------EFPVVLKPAMEAMNIAVDFADV  618
            + R+G++DCF+ +ICFET+NP  + SS P+        + PV+ KP  EA   A   A +
Sbjct  130  VSRLGLEDCFDGVICFETLNPTYN-SSEPNNDDVSELPKTPVICKPFEEAFEKAFKIAGI  188

Query  619  DPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            +P +TLF DD+ RN+    + GL T  VG++ +T   D+A+E +  M + +PE+W
Sbjct  189  NPEKTLFFDDSIRNLKTAKSTGLHTIWVGSSHRTTGVDHALESIHNMREALPELW  243



>ref|XP_010106511.1| hypothetical protein L484_025271 [Morus notabilis]
 gb|EXC10687.1| hypothetical protein L484_025271 [Morus notabilis]
Length=284

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/266 (41%), Positives = 170/266 (64%), Gaps = 28/266 (11%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            +DS S ++ ++FD+DDTLY    G+   + +NI +++++K G  E++   L + L+K YG
Sbjct  9    QDSQSKYECLLFDLDDTLYPLASGLSAQVTRNIQEYMLQKLGIEESKVPELCISLYKDYG  68

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            +++AGL+A+GYD D D++HSFVHGRLPYNL+KPDP LRSLL S+  RK++FTN D+ H  
Sbjct  69   TTMAGLKAIGYDFDYDDFHSFVHGRLPYNLLKPDPVLRSLLLSLPIRKVVFTNGDKAHGA  128

Query  457  KVLDRIGIKDCFEQIICFETMNP----NLSRSSRP-------DEF-------------PV  564
            + L R+G++DCF++++ FET+NP    N+  ++ P       DE+             PV
Sbjct  129  RALSRLGLEDCFQEVMSFETLNPTTNENIPVNTNPSTRILDADEYLKQPNTDLVLPKTPV  188

Query  565  VLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAME  744
            V KP  +A     + + ++P+RTLF DD+ RN+  G  +GL T LVG++ +    DYA+E
Sbjct  189  VCKPFEDAFQKVFEISKMNPQRTLFFDDSIRNLQTGKRLGLTTVLVGSSHRISGVDYALE  248

Query  745  KVTEMVQVIPEIWFEEE----VRCSR  810
             +  + + +PE+W  EE    VR SR
Sbjct  249  SIHNIKEALPELWEAEEKSTSVRYSR  274



>ref|XP_008442536.1| PREDICTED: uncharacterized protein LOC103486381 [Cucumis melo]
Length=285

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/256 (43%), Positives = 166/256 (65%), Gaps = 27/256 (11%)
 Frame = +1

Query  97   RDSSSP-FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            R +  P +D ++FD+DDTLY    GI  +  +NI D++VEK G  +++   L   L+K Y
Sbjct  8    RQAQRPKYDCLLFDLDDTLYPLSSGIAASCLQNIKDYMVEKLGIEQSKIPDLCNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GY+ D DEYH FVHGRLPY+ +KPDP LR+LL ++  RK+IFTN+D++HA
Sbjct  68   GTTMAGLRAIGYNFDYDEYHKFVHGRLPYDNLKPDPVLRNLLLNLPYRKVIFTNADKIHA  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPN--------------------LSRSSRPD------E  555
            +KVL ++G++DCF+ IICFET+NP                     +     P+      +
Sbjct  128  VKVLKKLGLEDCFQGIICFETLNPTNKNFVDEMNPIPSDSEIFDIIGHFLHPNPGTELPK  187

Query  556  FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDY  735
             P++ KP+  A+  A+  A ++P+RTLF +D+ RNI AG  VGL T L+GT+ + K +DY
Sbjct  188  TPIICKPSEAAIERALKIAGLNPQRTLFFEDSVRNIQAGKRVGLDTVLIGTSQRVKGADY  247

Query  736  AMEKVTEMVQVIPEIW  783
            A+E +  + + IPE+W
Sbjct  248  ALESIHNLREGIPELW  263



>ref|XP_010914820.1| PREDICTED: uncharacterized protein C24B11.05-like [Elaeis guineensis]
Length=291

 Score =   231 bits (589),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/285 (39%), Positives = 178/285 (62%), Gaps = 50/285 (18%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            ++ ++FDMDDTLY S  GI  A +KNI D+++      E++   + +EL+K++G+++AGL
Sbjct  10   YECLLFDMDDTLYPSSSGINLACRKNIQDYMLHHLRIDESQVPRMCLELYKEHGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            +ALG++ D DE+H++VHGRLPY ++KPDP LR LL S+ QRKIIFTN+D+ HA +VL  +
Sbjct  70   KALGFEFDNDEFHAYVHGRLPYEILKPDPFLRGLLLSMPQRKIIFTNADKAHAEEVLKGL  129

Query  475  GIKDCFEQIICFETMNP-----------NLSRSSRPDEFP--------------------  561
            G++DCFE +ICFET+NP           N++RS   DEF                     
Sbjct  130  GLEDCFEGVICFETLNPPVLPNDSNEKININRS---DEFEDQILSQAKESKSESHTDSSI  186

Query  562  ----------VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTA  711
                      ++ KP++EA+ +A+  A++DP++T+F DD+ RNIAAG A GL T +VG++
Sbjct  187  ADGSKARSSRILCKPSIEAIKLAIQIANIDPQKTIFFDDSARNIAAGKAAGLTTVIVGSS  246

Query  712  TKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
                 +D+A+  +  + + +PEIW          ++D+ L++T+V
Sbjct  247  ELVPGADHALSSIHNIKEALPEIWE------GWKQLDAVLSSTAV  285



>ref|XP_010505362.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=277

 Score =   230 bits (587),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/270 (45%), Positives = 174/270 (64%), Gaps = 28/270 (10%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            S +D ++FD+DDTLY    GI +   +NI D++VEK G  + +   L   L+K YG+++A
Sbjct  6    SKYDTLLFDLDDTLYPLSSGIAKECGQNIKDYMVEKLGIDKNKILDLSNSLYKNYGTTMA  65

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GLRA+GY+ D DEYHSFVHGRLPY  IKPDP LRSLL S+  RKIIFTN+D++HA + L+
Sbjct  66   GLRAIGYNFDYDEYHSFVHGRLPYENIKPDPILRSLLLSLPLRKIIFTNADKLHAARALE  125

Query  469  RIGIKDCFEQIICFETMNPNLSRS------------------------SRPDEFPVVLKP  576
            R+G++DCFE I+CFE++N + SR+                        S   + P+V KP
Sbjct  126  RLGLEDCFEGILCFESLNSSTSRAKVSYDDKNEIFDIIGYLSDHEQPVSALPKTPIVCKP  185

Query  577  AMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTE  756
            +  A+  A++ A++DP+RTLF DD+ RNI AG  VGL T LVGT+ + K +DYA+E +  
Sbjct  186  SETAIVKALEIANIDPQRTLFFDDSVRNIQAGKRVGLDTVLVGTSQRVKYADYALENIHN  245

Query  757  MVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            + + +PE+W    V  ++ E  SY A  +V
Sbjct  246  LKEALPELW----VSQAKPEKVSYSAKLAV  271



>ref|XP_004246419.1| PREDICTED: uncharacterized protein LOC101251913 [Solanum lycopersicum]
Length=294

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/263 (41%), Positives = 162/263 (62%), Gaps = 40/263 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +++ +NI+D++VEK G  +++   L   L+K YG+++AGL
Sbjct  11   YDCLLFDLDDTLYPLSAGLAKSVCQNIEDYMVEKLGIEQSKIEKLGNLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSF+HGRLPY  ++PDP LR+LL SI  RK+IFTN+D+VHA+K L ++
Sbjct  71   RAIGYDFDYDEYHSFIHGRLPYENLRPDPVLRNLLLSIPIRKVIFTNADKVHALKALSKL  130

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE I+CFET+NP    +   DE                                 
Sbjct  131  GLEDCFEGILCFETLNPVHKSTPSDDEDDIEFVGSATSSNATATNGSGIFDIIGHFSQPK  190

Query  556  -------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTAT  714
                    P+V KP+  A+  A+  A+++P RTLF +D+ RNI AG  VGL T LVG + 
Sbjct  191  AGAELPKTPIVCKPSEVAIERALKIANINPHRTLFFEDSVRNIQAGKRVGLDTVLVGNSQ  250

Query  715  KTKESDYAMEKVTEMVQVIPEIW  783
            +   +DYA+E +  + + IP++W
Sbjct  251  RVAGADYALESIHNIREAIPQLW  273



>ref|XP_006488357.1| PREDICTED: uncharacterized protein C24B11.05-like [Citrus sinensis]
Length=275

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/265 (41%), Positives = 165/265 (62%), Gaps = 30/265 (11%)
 Frame = +1

Query  109  SPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLA  288
            + ++ ++FD+DDTLYS   G      KNI++++++K G  E+E S     L+K YG+S+A
Sbjct  2    TKYECLLFDVDDTLYSHSYGFSNKCSKNIEEYMIQKLGIEESEVSEFNRVLYKNYGTSMA  61

Query  289  GLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLD  468
            GL+A+GYD D D+YHSFVHGRLPY  +KPDP LR+LL S+  RK+IF+N+D +H  KVL 
Sbjct  62   GLKAIGYDFDNDDYHSFVHGRLPYENLKPDPVLRNLLLSLPIRKVIFSNADEIHVAKVLR  121

Query  469  RIGIKDCFEQIICFETMNPNLSRSSRPD--------------------------EFPVVL  570
            ++G++DCF+ I+ FE++NPN   S+  D                          + P+  
Sbjct  122  KLGLEDCFDGIVNFESLNPNNKTSNNFDGGYLVRSGSRTAINLDATNGYSSVLPKSPIFC  181

Query  571  KPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKV  750
            KP  +A   A   A+++P +TLF DD+TRNI    ++GL T LVGT+ +TK +DYA+E +
Sbjct  182  KPFEDAFEQAFKIANINPHKTLFFDDSTRNIECAKSIGLHTVLVGTSRRTKGADYALESI  241

Query  751  TEMVQVIPEIWFEEE----VRCSRS  813
              + +  PE+W  +E    ++CS +
Sbjct  242  HNIREAFPELWDADEISKNIKCSEN  266



>gb|ACF78996.1| unknown [Zea mays]
 gb|ACF85025.1| unknown [Zea mays]
 tpg|DAA63790.1| TPA: catalytic/ hydrolase [Zea mays]
Length=264

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 166/251 (66%), Gaps = 4/251 (2%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + + FD ++FDMDDTLY   +GI  A +KNI ++++ K    E++   + ++L+++YG++
Sbjct  6    AGAKFDCLLFDMDDTLYPLSLGINLACRKNIQEYMLNKLRIEESQVPRMCLDLYREYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ LGY  D D++H+ VHG LPY  +KPDP LR LL S+ QRKIIFTNSD+ HA +V
Sbjct  66   MAGLKVLGYGFDYDDFHACVHGTLPYEKVKPDPVLRQLLLSLPQRKIIFTNSDKAHAARV  125

Query  463  LDRIGIKDCFEQIICFETMNP----NLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            L+++G++DCF+ I+CFET+NP       ++S      ++ KP++ +M   ++ A +D  R
Sbjct  126  LEKLGLQDCFQGIVCFETLNPRPPTETEKNSSGSAGTILCKPSLASMEAVIEIAKLDAER  185

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSR  810
            T+F DD+ RNIAAG A G RT +VG++     +D A+E +  + + +PE+W       + 
Sbjct  186  TVFFDDSARNIAAGKAAGFRTVIVGSSALVPGADVALESIHNIKEALPELWEVAAAAAAG  245

Query  811  SEMDSYLATTS  843
              +D+ L +T+
Sbjct  246  DRVDAVLRSTT  256



>ref|XP_010529825.1| PREDICTED: uncharacterized protein C24B11.05-like [Tarenaya hassleriana]
Length=284

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 118/271 (44%), Positives = 174/271 (64%), Gaps = 29/271 (11%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    GI +   +NI D++VEK G  +++   L   L+K YG+++AGL
Sbjct  11   YDTLLFDLDDTLYPLSSGIARECGQNIKDYMVEKLGIEKSKIPELSNLLYKNYGTTMAGL  70

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GY+ D DEYHSFVHGRLPY  IKPDP L+SLL S+  RK+IFTN+D++HA + L+R+
Sbjct  71   RAIGYNFDYDEYHSFVHGRLPYENIKPDPVLKSLLLSLPLRKVIFTNADKLHAARALERL  130

Query  475  GIKDCFEQIICFETMNP----NLSRS-----------------SRPD-------EFPVVL  570
            G+++CFE +ICFE++NP    N++ S                 S P+       + P+  
Sbjct  131  GLQNCFEGVICFESLNPPNAKNVTDSHDQNSNEVEIFDIIRHFSDPEPNLSALPKTPIFC  190

Query  571  KPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKV  750
            KP+  AM  A++ A++DP+RTLF DD+ RNI AG  VGL T LVGT+ + K +DYA+E +
Sbjct  191  KPSETAMEKALEIANIDPQRTLFFDDSVRNIQAGKRVGLHTVLVGTSQRVKGADYALESI  250

Query  751  TEMVQVIPEIWFEEEVRCSRSEMDSYLATTS  843
              + + +PE+W E  V+  +      LA  +
Sbjct  251  HNIKEALPELW-ESAVKAGKVRYSGKLAVET  280



>ref|XP_010240834.1| PREDICTED: uncharacterized protein C24B11.05 [Nelumbo nucifera]
Length=284

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/280 (40%), Positives = 172/280 (61%), Gaps = 33/280 (12%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            S R S + ++ ++FDMDDTLY    G+    +KNI++++++     E+E   +  EL+++
Sbjct  4    SGRSSGAKYECLLFDMDDTLYPLSSGLNLKCRKNIEEYMLQHLKIEESEVPRMCWELYQE  63

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YG+++AGL+ALGY+ D DE+H+ VHGRLPY  +KPDP LR+LL SI QRKIIFTN+D+ H
Sbjct  64   YGTTMAGLKALGYEFDNDEFHACVHGRLPYETLKPDPVLRNLLHSIPQRKIIFTNADKAH  123

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNL---SRSSRPDEFP--------------------  561
            A +VL R+G++DCF+ IICFET+NP L   + S   DE                      
Sbjct  124  ATQVLKRLGVEDCFDGIICFETLNPPLEPDNCSGDTDEHAFSTESESDTEVVGHINSNGS  183

Query  562  -----VVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKE  726
                 ++ KP++EAM  A+  A +DP++T+F DD+ RNIA G A GL T +VG +     
Sbjct  184  GSKSRILCKPSLEAMEAAIRIAKIDPKKTIFFDDSARNIANGKAAGLHTVIVGRSVLVPG  243

Query  727  SDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSV  846
            +D A+  +  + + +PEIW  E       +++  L +T+V
Sbjct  244  ADLALNSIHNIREALPEIWEGE-----GDQLEQVLQSTAV  278



>ref|XP_004958439.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X2 
[Setaria italica]
Length=278

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/251 (42%), Positives = 162/251 (65%), Gaps = 24/251 (10%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + + FD ++FDMDDTLY   +GI  A +KNI  +++ K    E++   + ++L+K+YG++
Sbjct  6    AGAKFDCLLFDMDDTLYPLSLGINLACRKNIQGYMLNKLQIEESQVPKMCLDLYKEYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ LGYD D D++H+ VHG LPY  +KPDP LR LL S+ QRKIIFTNSD+ HA +V
Sbjct  66   MAGLKVLGYDFDYDDFHACVHGALPYEKLKPDPVLRQLLLSLPQRKIIFTNSDKAHAARV  125

Query  463  LDRIGIKDCFEQIICFETMNPNL--------------------SRSSRPDEFP----VVL  570
            L+++G++DCFE IICFET+NP+                     SR+   D  P    ++ 
Sbjct  126  LEKLGLEDCFEGIICFETLNPSTQQDANDQNQKNAGEADTDGGSRAGSDDPAPPRRGILC  185

Query  571  KPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKV  750
            KP++E+M   ++ A +D +RT+F DD+ RNIA+G A G  T +VGT+     +D A+E +
Sbjct  186  KPSLESMEAVIEIAKLDAKRTVFFDDSARNIASGKAAGFHTVVVGTSALVPGADVALESI  245

Query  751  TEMVQVIPEIW  783
              + + +PE+W
Sbjct  246  HNIKEALPELW  256



>ref|XP_004516490.1| PREDICTED: uncharacterized protein LOC101512518 [Cicer arietinum]
Length=303

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 115/296 (39%), Positives = 177/296 (60%), Gaps = 46/296 (16%)
 Frame = +1

Query  97   RDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYG  276
            +  +S +D ++FD+DDTLY    G+ +A  +N+ D++VEK G    +   L   L+K YG
Sbjct  10   KSHTSKYDCLLFDLDDTLYPLSSGLAKACLQNLKDYMVEKLGVEPRKTDDLCNLLYKNYG  69

Query  277  SSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAM  456
            ++LAGLRA+GYD D D+YHSFVHGRLPY  +KPDP LR++L S+  RK++FTN+D+VHA+
Sbjct  70   TTLAGLRAIGYDFDYDKYHSFVHGRLPYENLKPDPVLRNMLLSLPYRKLVFTNADKVHAL  129

Query  457  KVLDRIGIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------  558
            K L  +G++DCFE IICFET+NP + +SS  D     EF                     
Sbjct  130  KTLSILGLEDCFEGIICFETLNP-IHKSSVSDDEDDIEFVVSTSTTNPTTSNSASTSQIF  188

Query  559  ------------------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVG  684
                              P++ KP+  A+ +A++ A+++P RTLF +D+ RNI AG  +G
Sbjct  189  DIIGHFAQPNPSGNLPKTPIICKPSEHAIQLALNIANLNPHRTLFFEDSVRNIQAGKRLG  248

Query  685  LRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSRSEMDSYLATTSVGA  852
            L T LVGT+ +   +DYA+E +  + + +P++W E +++      ++    T+V A
Sbjct  249  LDTVLVGTSQRVTGADYALESIHNLTEAVPDLW-ESDIKSEVVYTETLAVETTVTA  303



>gb|AAM65114.1| unknown [Arabidopsis thaliana]
Length=280

 Score =   230 bits (586),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 164/248 (66%), Gaps = 22/248 (9%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +    NI D++ EK G P+ +   L   L+K YG++
Sbjct  11   TSQKYDCLLFDLDDTLYPLSSGIARECGNNIKDYMTEKLGIPKDKIVELSDLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D DEYHSFVHGRLPY+ IKPD  LRSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDEYHSFVHGRLPYDNIKPDLVLRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMN-----------------PNLSRS----SRPDEFPVVLKPA  579
            L ++G++DCFE IICFET+N                  + +RS    S P + PVV KP+
Sbjct  131  LKKLGLEDCFEGIICFETLNLMHTNAASNNSEIFDIVGHFNRSEPVGSLP-KTPVVCKPS  189

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
              A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG +TK K +DYA+E +  M
Sbjct  190  ESAIEKALEIANIDPNRTLFFEDSVRNVQAGKRVGLYTVLVGKSTKVKGADYALENIHNM  249

Query  760  VQVIPEIW  783
             + IPE+W
Sbjct  250  KEAIPELW  257



>ref|NP_195843.1| haloacid dehalogenase-like hydrolase superfamily protein [Arabidopsis 
thaliana]
 ref|NP_850754.1| haloacid dehalogenase-like hydrolase superfamily protein [Arabidopsis 
thaliana]
 emb|CAB82996.1| putative protein [Arabidopsis thaliana]
 gb|ABF83695.1| At5g02230 [Arabidopsis thaliana]
 dbj|BAF01283.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED90447.1| haloacid dehalogenase-like hydrolase superfamily protein [Arabidopsis 
thaliana]
 gb|AED90448.1| haloacid dehalogenase-like hydrolase superfamily protein [Arabidopsis 
thaliana]
Length=280

 Score =   230 bits (586),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 164/248 (66%), Gaps = 22/248 (9%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +    NI D++ EK G P+ +   L   L+K YG++
Sbjct  11   TSQKYDCLLFDLDDTLYPLSSGIARECGNNIKDYMTEKLGIPKDKIVELSDLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D DEYHSFVHGRLPY+ IKPD  LRSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDEYHSFVHGRLPYDNIKPDLVLRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMN-----------------PNLSRS----SRPDEFPVVLKPA  579
            L ++G++DCFE IICFET+N                  + +RS    S P + PVV KP+
Sbjct  131  LKKLGLEDCFEGIICFETLNLMHTNAASNNSEIFDIVGHFNRSEPVGSLP-KTPVVCKPS  189

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
              A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG +TK K +DYA+E +  M
Sbjct  190  ESAIEKALEIANIDPNRTLFFEDSVRNVQAGKRVGLYTVLVGKSTKVKGADYALENIHNM  249

Query  760  VQVIPEIW  783
             + IPE+W
Sbjct  250  KEAIPELW  257



>gb|KCW46735.1| hypothetical protein EUGRSUZ_K00553 [Eucalyptus grandis]
Length=262

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/244 (44%), Positives = 158/244 (65%), Gaps = 24/244 (10%)
 Frame = +1

Query  136  MDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGLRALGYDV  315
            MDDTLY    G+  A +KNI++F++ K    E+E   + +EL++++G+++AGL+ALGY+ 
Sbjct  1    MDDTLYPMSSGLNLACRKNIEEFMLHKLHIEESEVPRMCLELYREHGTTMAGLQALGYEF  60

Query  316  DADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRIGIKDCFE  495
            D DE+H++ HGRLPY  +KPDP LR+LL S+ QRKIIFTN D+ H  +VL R+G++DCFE
Sbjct  61   DNDEFHAYAHGRLPYEALKPDPVLRNLLLSMPQRKIIFTNGDKAHVAQVLSRLGLEDCFE  120

Query  496  QIICFETMNPNLSRSSRP---DEFP---------------------VVLKPAMEAMNIAV  603
             IICFET+NP L     P   D  P                     ++ KP++EA+  A+
Sbjct  121  GIICFETLNPALETVMDPLDSDSVPEDGDIEVDGQIDSDGVSSKMRILCKPSVEAIEAAI  180

Query  604  DFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
              ADVDP +T+F DD+ RNIA+G A GL T +VG++     +D+A+E +  + + +PEIW
Sbjct  181  KIADVDPSKTIFFDDSARNIASGKAAGLHTVIVGSSALVPGADHALESIHNIREALPEIW  240

Query  784  FEEE  795
              +E
Sbjct  241  EGQE  244



>gb|ACG27085.1| catalytic/ hydrolase [Zea mays]
 gb|ACR37673.1| unknown [Zea mays]
Length=264

 Score =   229 bits (584),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 168/251 (67%), Gaps = 4/251 (2%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            + + FD ++FDMDDTLY   +GI  A +KNI +++++K    E++   + ++L+++YG++
Sbjct  6    AGAKFDCLLFDMDDTLYPLSLGINLACRKNIQEYMLKKLRIEESQVPRMCLDLYREYGTT  65

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGL+ LGYD D D++H+ VHG LPY  +KPDP LR LL S+ QRKIIFTNSD+ +A +V
Sbjct  66   MAGLKVLGYDFDYDDFHACVHGTLPYEKVKPDPVLRQLLLSLPQRKIIFTNSDKANAARV  125

Query  463  LDRIGIKDCFEQIICFETMNP----NLSRSSRPDEFPVVLKPAMEAMNIAVDFADVDPRR  630
            L+++G++DCF+ I+CFET+NP       ++S      ++ KP++ +M   ++ A +D  R
Sbjct  126  LEKLGLQDCFQGIVCFETLNPPPPTETEKNSGGSAGTILCKPSLASMEAVIEIAKLDAER  185

Query  631  TLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIWFEEEVRCSR  810
            T+F DD+ RNIAAG A G RT +VG++     +D A+E +  + + +PE+W       + 
Sbjct  186  TVFFDDSARNIAAGKAAGFRTVIVGSSALVPGADVALESIHNIKEALPELWEVAAAAAAG  245

Query  811  SEMDSYLATTS  843
              +D+ L +T+
Sbjct  246  DRVDAVLRSTT  256



>gb|KHF97741.1| putative C24B11.05 [Gossypium arboreum]
Length=298

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 113/262 (43%), Positives = 157/262 (60%), Gaps = 39/262 (15%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +   KNI D++VEK G  + +   L   L+K YG+++AGL
Sbjct  15   YDCLLFDLDDTLYPVSSGLQRECGKNIKDYMVEKLGIEKDKIVELSNALYKNYGTTMAGL  74

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHS+VHGRLPY  ++ DP+LRSLL S+  RKIIFTN+D+ HA K L ++
Sbjct  75   RAIGYDFDYDEYHSYVHGRLPYENLRQDPQLRSLLLSLPVRKIIFTNADKDHAQKALKKL  134

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE---------------------------------  555
            G++DCFE IICFET+NP    +   DE                                 
Sbjct  135  GLEDCFEGIICFETLNPIHKNTVSDDEDDIEFLGSSVTRNDSLKTPEIFDIIGHFDNPNP  194

Query  556  ------FPVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATK  717
                   P+V KP   A+  A+  A ++P+RTLF DD+ RNI AG  VGL T LVG++ +
Sbjct  195  DVTLPKTPIVCKPQESAIERALKIAKINPQRTLFFDDSVRNIQAGKRVGLHTVLVGSSQR  254

Query  718  TKESDYAMEKVTEMVQVIPEIW  783
             K +DYA+E +  + Q +PE+W
Sbjct  255  PKGADYALESIHNIKQALPELW  276



>ref|XP_004142063.1| PREDICTED: uncharacterized protein C24B11.05-like [Cucumis sativus]
 gb|KGN54260.1| hypothetical protein Csa_4G296140 [Cucumis sativus]
Length=291

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 113/250 (45%), Positives = 159/250 (64%), Gaps = 28/250 (11%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            FD ++FD+DDTLY    G+  A K NI  ++ EK G   ++   L   L+K YG+++AGL
Sbjct  16   FDCLLFDLDDTLYPLSSGLATACKNNIHAYMAEKLGVENSKIPELSNLLYKNYGTTMAGL  75

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYH FVHGRLPY+ +KPDP LR+LL S+  RK+IFTN+DR H  KVL+++
Sbjct  76   RAIGYDFDYDEYHRFVHGRLPYDNLKPDPILRNLLLSLPYRKLIFTNADRDHTAKVLNKL  135

Query  475  GIKDCFEQIICFETMNPNLSRSSRPDE----------------------------FPVVL  570
            G++DCFE IICFET+N    +SS  DE                             P+V 
Sbjct  136  GLEDCFEGIICFETLNTPPQKSSVLDEKEHIPSSEVFDIIAHFSQPNYPLMELPITPIVC  195

Query  571  KPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKV  750
            KP+  A+  A+  A++DP+ TLF +D+ RNI AG  +GL+T LVGT+ ++K +DYA+E +
Sbjct  196  KPSEAAIEWALKIANIDPQTTLFFEDSLRNIQAGKRLGLQTVLVGTSHRSKGADYAIESI  255

Query  751  TEMVQVIPEI  780
              + + IPE+
Sbjct  256  HNIKEAIPEL  265



>ref|XP_002870962.1| hypothetical protein ARALYDRAFT_908087 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47221.1| hypothetical protein ARALYDRAFT_908087 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/248 (49%), Positives = 164/248 (66%), Gaps = 22/248 (9%)
 Frame = +1

Query  103  SSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSS  282
            +S  +D ++FD+DDTLY    GI +    NI D++ EK G P+ +   L   L+K YG++
Sbjct  11   TSQKYDCLLFDLDDTLYPLSSGIARECGNNIKDYMTEKLGIPKDKLVELSDLLYKNYGTT  70

Query  283  LAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKV  462
            +AGLRA+GY+ D DEYHSFVHGRLPY+ IKPD  LRSLL S+  RK+IFTN+DRVHA K 
Sbjct  71   MAGLRAIGYEFDYDEYHSFVHGRLPYDNIKPDSVLRSLLLSLPLRKVIFTNADRVHAAKA  130

Query  463  LDRIGIKDCFEQIICFETMN-----------------PNLSRS----SRPDEFPVVLKPA  579
            L ++G++DCFE IICFET+N                  + +RS    S P + PVV KP+
Sbjct  131  LKKLGLEDCFEGIICFETLNLMHTNAASNNSEIFDIVGHFNRSEPVGSLP-KTPVVCKPS  189

Query  580  MEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEM  759
              A+  A++ A++DP RTLF +D+ RN+ AG  VGL T LVG +TK K +DYA+E +  M
Sbjct  190  ESAIEKALEIANIDPTRTLFFEDSVRNVQAGKRVGLHTVLVGKSTKVKGADYALENIHNM  249

Query  760  VQVIPEIW  783
             + IPE+W
Sbjct  250  KEAIPELW  257



>ref|XP_007145081.1| hypothetical protein PHAVU_007G208000g [Phaseolus vulgaris]
 gb|ESW17075.1| hypothetical protein PHAVU_007G208000g [Phaseolus vulgaris]
Length=272

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/251 (41%), Positives = 166/251 (66%), Gaps = 16/251 (6%)
 Frame = +1

Query  91   SVRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKK  270
            ++R++   ++ ++FDMDDTLY   +G+    +KNI ++++E     E E   + ++L+++
Sbjct  4    ALRNAGVKYECLLFDMDDTLYPLSIGLNLFCRKNIQEYMLEHLHIEENEVPKMCLDLYRE  63

Query  271  YGSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVH  450
            YG+++AGL+ LGY+ D DE+H++VHGRLPY  +KPDP LR+LL S+ QRKIIFTN+D  H
Sbjct  64   YGTTMAGLKVLGYEFDNDEFHAYVHGRLPYEKLKPDPVLRNLLISMPQRKIIFTNADHAH  123

Query  451  AMKVLDRIGIKDCFEQIICFETMNPNLSRSSRPDEFPV----------------VLKPAM  582
            A+KVL+R+G++DCFE IICFET+NP+      P++  V                + KP++
Sbjct  124  AVKVLNRMGLEDCFEGIICFETLNPHKQYMDLPNDNHVLTDIAESGCFNSHTRILCKPSV  183

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
            EA   A+  ++VDP++T+F DD+ RN+A+    GL T ++G +     +D+A+  +  + 
Sbjct  184  EAFEAAIRTSNVDPKKTIFFDDSVRNVASAKVAGLHTVILGHSDLVPGADHALNSIHNIK  243

Query  763  QVIPEIWFEEE  795
            + +PEIW  EE
Sbjct  244  EALPEIWEIEE  254



>gb|ACU19510.1| unknown [Glycine max]
Length=297

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/273 (41%), Positives = 168/273 (62%), Gaps = 46/273 (17%)
 Frame = +1

Query  115  FDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSLAGL  294
            +D ++FD+DDTLY    G+ +A  +NI D++ EK G  +++   L   L+K YG+++AGL
Sbjct  10   YDCLLFDLDDTLYPLSTGLAKACGQNIKDYMAEKLGIEKSKIDDLSNLLYKNYGTTMAGL  69

Query  295  RALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVLDRI  474
            RA+GYD D DEYHSFVHGRLPY  +KPDP LR+LL S+  R++IFTNSD+VHA+K L R+
Sbjct  70   RAIGYDFDYDEYHSFVHGRLPYENLKPDPVLRNLLLSLPYRRLIFTNSDKVHAVKALSRL  129

Query  475  GIKDCFEQIICFETMNPNLSRSSRPD-----EF---------------------------  558
            G++DCFE IICFET+NP + +S+  D     EF                           
Sbjct  130  GLEDCFEGIICFETLNP-IHKSTVSDDEDDIEFVGGSGTTNPTTKKDASSFQIFDIIGHF  188

Query  559  ------------PVVLKPAMEAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALV  702
                        P++ KP+  A+ +A+  A+++P+RTLF +D+ RN  AG  VG  T LV
Sbjct  189  AQPNPHTVLPKTPIICKPSENAIELALKIANLNPQRTLFFEDSVRNTQAGKRVGFHTVLV  248

Query  703  GTATKTKESDYAMEKVTEMVQVIPEIWFEEEVR  801
            G   + K +DYA+E +  + + +PE+W E++++
Sbjct  249  GKFQRIKGADYALESIHNLREAVPELW-EDDIK  280



>ref|XP_008777166.1| PREDICTED: uncharacterized protein C24B11.05-like isoform X1 
[Phoenix dactylifera]
Length=264

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/251 (46%), Positives = 166/251 (66%), Gaps = 17/251 (7%)
 Frame = +1

Query  94   VRDSSSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKY  273
            + D     + ++FD+DDTLY    G+   + KNI D+LV+K G  E++   +   L+K Y
Sbjct  8    LNDQGPKTECLLFDLDDTLYPLSSGLSTEILKNIGDYLVQKLGIEESKVPDMCNLLYKNY  67

Query  274  GSSLAGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHA  453
            G+++AGLRA+GY  D +EYHSFVHGRLPY  IKPDP LR LL S+  RK+IFTN+DR+H 
Sbjct  68   GTTMAGLRAIGYTFDCEEYHSFVHGRLPYEKIKPDPVLRHLLLSLPLRKVIFTNADRIHT  127

Query  454  MKVLDRIGIKDCFEQIICFETMNPNL--SRSSRPD---------------EFPVVLKPAM  582
             KVL R+G++ CFE IICFET+NP++  +R++  D               E PV+ KP+ 
Sbjct  128  AKVLKRLGLEGCFEGIICFETLNPSMEATRTNIFDIIEYSLQPVAGIELPETPVLCKPSE  187

Query  583  EAMNIAVDFADVDPRRTLFLDDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMV  762
             A+  A+  A++DP++TLF DD+ RNI AG  +GL T LVGT+ + K +D+A+E +  + 
Sbjct  188  YAIKKALKIANIDPQKTLFFDDSVRNIQAGKRIGLHTLLVGTSPRVKGADHALESIHNIR  247

Query  763  QVIPEIWFEEE  795
            + +PE+W E E
Sbjct  248  EALPELWEEAE  258



>ref|XP_010413314.1| PREDICTED: uncharacterized protein C24B11.05-like [Camelina sativa]
Length=249

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/227 (44%), Positives = 156/227 (69%), Gaps = 6/227 (3%)
 Frame = +1

Query  106  SSPFDAIIFDMDDTLYSSKVGIGQALKKNIDDFLVEKCGFPETEASALRVELFKKYGSSL  285
             + ++ + FD+DDTLY   +GI  A + NI +F++ +    E+E   + ++L+K+YG+++
Sbjct  5    GAKYECLFFDLDDTLYPLSIGINLACRNNIQEFMLNQLEIEESEVPKMCLDLYKEYGTTM  64

Query  286  AGLRALGYDVDADEYHSFVHGRLPYNLIKPDPELRSLLRSINQRKIIFTNSDRVHAMKVL  465
            AGL+ LGY+ D DE+H +VHGRLPY  +KPDP LR+LL S+  RKIIFTN+D+ HA + L
Sbjct  65   AGLKVLGYEFDNDEFHEYVHGRLPYEKLKPDPVLRNLLLSMPHRKIIFTNADKSHATRAL  124

Query  466  DRIGIKDCFEQIICFETMNPNLSRSSRPDEFPVVLKPAMEAMNIAVDFAD-VDPRRTLFL  642
             R+G++DCFE IICFET+NP+    ++     ++ KP++EA   A+  AD VDPR+T+F 
Sbjct  125  TRLGLEDCFEGIICFETLNPSSDSKTQ-----ILCKPSVEAFKAAIRIADIVDPRKTMFF  179

Query  643  DDNTRNIAAGNAVGLRTALVGTATKTKESDYAMEKVTEMVQVIPEIW  783
            DD+ RNIA+  A GL+T  VG +     +DYA+  +  + + IP++W
Sbjct  180  DDSIRNIASAKATGLKTVFVGNSVLVPGADYALSSIHNIKEAIPDLW  226



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2833061748424