BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c71167_g1_i1 len=116 path=[94:0-115]

Length=116
                                                                      Score     E

ref|XP_006356167.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  58.9    7e-09   
ref|XP_006356165.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  58.9    9e-09   
ref|XP_004242212.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  58.5    1e-08   
ref|XP_006356166.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  58.5    1e-08   
ref|XP_009778128.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  56.2    6e-08   
ref|XP_009587608.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  53.9    5e-07   
ref|XP_009763097.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  52.8    1e-06   
ref|XP_006343107.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  50.4    8e-06   
ref|XP_009602654.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  50.4    9e-06   
emb|CDP09003.1|  unnamed protein product                              50.1    9e-06   
ref|XP_004235699.1|  PREDICTED: F-box/kelch-repeat protein At1g80...  50.1    1e-05   
emb|CDO98076.1|  unnamed protein product                              48.5    4e-05   



>ref|XP_006356167.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Solanum 
tuberosum]
Length=362

 Score = 58.9 bits (141),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAASVC+ WN  I  PEFRRRRK S LTR
Sbjct  17   IRLPVDQFSKAASVCKKWNGEITLPEFRRRRKVSGLTR  54



>ref|XP_006356165.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Solanum 
tuberosum]
Length=362

 Score = 58.9 bits (141),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAASVC+ WN  I  PEFRRRRK S LTR
Sbjct  17   IRLPVDQFSKAASVCKKWNGEITLPEFRRRRKVSGLTR  54



>ref|XP_004242212.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Solanum 
lycopersicum]
Length=367

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAASVC+ WN  I  PEFRRRRK S LTR
Sbjct  22   IRLPVDQFSKAASVCKKWNGEITSPEFRRRRKFSGLTR  59



>ref|XP_006356166.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Solanum 
tuberosum]
Length=362

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAASVCR WN  IK PEF RRRK S LTR
Sbjct  17   IRLPVDQFSKAASVCRKWNGEIKLPEFLRRRKFSGLTR  54



>ref|XP_009778128.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Nicotiana 
sylvestris]
Length=357

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAAS+C+ WN  I  PEFR+RRK S  TR
Sbjct  17   IRLPIDQFSKAASICKTWNGEITLPEFRKRRKTSGFTR  54



>ref|XP_009587608.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Nicotiana 
tomentosiformis]
Length=358

 Score = 53.9 bits (128),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAASVC+ WN  I  PEFR+RR  S L R
Sbjct  17   IRLPIDQFSKAASVCKTWNGEIMLPEFRKRRTTSGLAR  54



>ref|XP_009763097.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Nicotiana 
sylvestris]
Length=360

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ SKAASVC  W   IK P FR+RRK+S  TR
Sbjct  17   IRLPLDQFSKAASVCSHWKNEIKHPAFRQRRKSSGFTR  54



>ref|XP_006343107.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Solanum 
tuberosum]
Length=398

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+   Q SKAASVC +W   IK P FR+RRK S LTR
Sbjct  55   IRLPLHQFSKAASVCTSWKTEIKHPLFRQRRKESGLTR  92



>ref|XP_009602654.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Nicotiana 
tomentosiformis]
Length=362

 Score = 50.4 bits (119),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+  DQ  KAASVC  W   IK P FR+RRK+S  TR
Sbjct  17   IRLPLDQFFKAASVCSNWKNEIKHPAFRQRRKSSGFTR  54



>emb|CDP09003.1| unnamed protein product [Coffea canephora]
Length=288

 Score = 50.1 bits (118),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+ F Q SKAASV + W A I+ PEFR+RRKA+  T+
Sbjct  17   IRVPFSQISKAASVSKNWKAEIQLPEFRQRRKAAGFTQ  54



>ref|XP_004235699.1| PREDICTED: F-box/kelch-repeat protein At1g80440-like [Solanum 
lycopersicum]
Length=361

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALTR  2
            IR+   Q SKAASVC+ W   IK P FR+RRK S LTR
Sbjct  17   IRLPLHQFSKAASVCKNWKKEIKHPLFRQRRKESGLTR  54



>emb|CDO98076.1| unnamed protein product [Coffea canephora]
Length=356

 Score = 48.5 bits (114),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -2

Query  115  IRISFDQSSKAASVCRAWNAVIKQPEFRRRRKASALT  5
            +R+ +D  S  ASVC++W   I+QPEF RRRKA+  T
Sbjct  17   VRVPYDHFSSVASVCKSWKLQIQQPEFMRRRKAAGCT  53



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 521190666984