BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7110_g1_i2 len=723 path=[1:0-414 416:415-722]

Length=723
                                                                      Score     E

ref|XP_004241237.1|  PREDICTED: uncharacterized protein LOC101251387    223   5e-70   
ref|XP_006350758.1|  PREDICTED: uncharacterized protein LOC102591677    223   6e-70   
ref|XP_009593668.1|  PREDICTED: uncharacterized protein LOC104090307    221   3e-69   
ref|XP_009757554.1|  PREDICTED: uncharacterized protein LOC104210360    217   6e-68   
ref|NP_001049720.1|  Os03g0277500                                       210   3e-65   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89460.1|  hypothetical protein OsI_10993                          210   4e-65   Oryza sativa Indica Group [Indian rice]
gb|ABF95269.1|  glyoxalase family protein, expressed                    211   3e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784517.1|  PREDICTED: uncharacterized protein LOC103703445    206   1e-63   
ref|XP_010937659.1|  PREDICTED: uncharacterized protein LOC105056961    205   5e-63   
ref|XP_010920635.1|  PREDICTED: uncharacterized protein LOC105044439    204   7e-63   
ref|XP_004294574.1|  PREDICTED: uncharacterized protein YraH-like       204   3e-62   
ref|XP_002531367.1|  catalytic, putative                                202   8e-62   Ricinus communis
ref|XP_002299885.1|  lactoylglutathione lyase family protein            201   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009148013.1|  PREDICTED: uncharacterized protein LOC103871511    200   4e-61   
ref|XP_010685804.1|  PREDICTED: uncharacterized protein LOC104900146    200   4e-61   
ref|XP_010475533.1|  PREDICTED: uncharacterized protein LOC104754937    200   6e-61   
emb|CDX93631.1|  BnaA06g04170D                                          201   7e-61   
ref|XP_006417780.1|  hypothetical protein EUTSA_v10009069mg             199   8e-61   
gb|KDP44216.1|  hypothetical protein JCGZ_05683                         199   1e-60   
ref|XP_002892412.1|  lactoylglutathione lyase family protein            198   1e-60   
emb|CDX95137.1|  BnaC05g05340D                                          198   2e-60   
ref|XP_009353814.1|  PREDICTED: uncharacterized protein LOC103945035    198   2e-60   
ref|XP_010457958.1|  PREDICTED: uncharacterized protein LOC104739340    196   8e-60   
ref|XP_006306385.1|  hypothetical protein CARUB_v10012292mg             196   1e-59   
ref|NP_973779.1|  dessication-induced 1VOC-like protein                 196   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008385224.1|  PREDICTED: uncharacterized protein LOC103447797    196   1e-59   
ref|XP_011000271.1|  PREDICTED: uncharacterized protein LOC105107891    196   2e-59   
ref|XP_011000270.1|  PREDICTED: uncharacterized protein LOC105107890    196   2e-59   
gb|KFK43085.1|  hypothetical protein AALP_AA1G077300                    195   3e-59   
emb|CDY61966.1|  BnaCnng38880D                                          195   3e-59   
ref|XP_002284138.1|  PREDICTED: uncharacterized protein LOC100250180    195   3e-59   Vitis vinifera
ref|XP_009118422.1|  PREDICTED: uncharacterized protein LOC103843439    194   5e-59   
ref|XP_004505878.1|  PREDICTED: uncharacterized protein Mb0911c-like    194   6e-59   
ref|XP_006649854.1|  PREDICTED: uncharacterized protein LOC102715925    194   8e-59   
ref|XP_008448396.1|  PREDICTED: uncharacterized protein LOC103490595    194   1e-58   
ref|XP_007016472.1|  Dessication-induced 1VOC superfamily protein       194   1e-58   
gb|EMT29398.1|  hypothetical protein F775_29044                         193   1e-58   
ref|XP_003558224.1|  PREDICTED: uncharacterized protein LOC100826172    193   2e-58   
gb|EYU29486.1|  hypothetical protein MIMGU_mgv1a015999mg                193   2e-58   
ref|XP_004143102.1|  PREDICTED: uncharacterized protein Mb0911c-like    192   3e-58   
ref|XP_011097109.1|  PREDICTED: uncharacterized protein LOC105176104    192   3e-58   
ref|XP_007206109.1|  hypothetical protein PRUPE_ppa013012mg             192   6e-58   
gb|AES88846.2|  dessication-induced 1VOC superfamily protein            191   1e-57   
gb|EPS73258.1|  hypothetical protein M569_01497                         190   2e-57   
ref|XP_008223274.1|  PREDICTED: uncharacterized protein LOC103323091    191   2e-57   
ref|XP_010043570.1|  PREDICTED: uncharacterized protein LOC104432749    189   4e-57   
gb|EMS64128.1|  hypothetical protein TRIUR3_21203                       189   5e-57   
ref|XP_007132082.1|  hypothetical protein PHAVU_011G065500g             189   8e-57   
dbj|BAK07401.1|  predicted protein                                      188   2e-56   
gb|KHG01311.1|  putative yraH                                           188   2e-56   
ref|XP_010106438.1|  hypothetical protein L484_025194                   187   3e-56   
ref|NP_001238248.1|  uncharacterized protein LOC100527071               187   5e-56   
ref|NP_001146848.1|  LOC100280456                                       186   1e-55   Zea mays [maize]
gb|AAT45010.1|  unknown                                                 186   1e-55   Xerophyta humilis
gb|KHN32114.1|  hypothetical protein glysoja_028909                     185   2e-55   
gb|AFK38142.1|  unknown                                                 184   5e-55   
ref|XP_002465467.1|  hypothetical protein SORBIDRAFT_01g039380          184   5e-55   Sorghum bicolor [broomcorn]
gb|EYU17837.1|  hypothetical protein MIMGU_mgv1a024458mg                182   2e-54   
gb|KDO36426.1|  hypothetical protein CISIN_1g045980mg                   181   7e-54   
ref|XP_003574698.1|  PREDICTED: uncharacterized protein LOC100831759    181   8e-54   
ref|XP_010521827.1|  PREDICTED: uncharacterized protein LOC104800652    179   4e-53   
ref|XP_009419953.1|  PREDICTED: uncharacterized protein LOC103999815    176   1e-51   
ref|XP_002984687.1|  hypothetical protein SELMODRAFT_156754             169   2e-49   
ref|XP_004984744.1|  PREDICTED: uncharacterized protein LOC101766089    169   3e-49   
ref|XP_002978774.1|  hypothetical protein SELMODRAFT_177122             166   6e-48   
ref|XP_004294575.1|  PREDICTED: uncharacterized protein LOC101293858    163   9e-47   
gb|KEH30117.1|  dessication-induced 1VOC superfamily protein            162   1e-46   
ref|XP_007132083.1|  hypothetical protein PHAVU_011G065500g             159   1e-45   
ref|XP_006424790.1|  hypothetical protein CICLE_v10029580mg             159   4e-45   
ref|XP_010501363.1|  PREDICTED: uncharacterized protein LOC104778607    147   2e-40   
gb|EEC74969.1|  hypothetical protein OsI_10991                          145   3e-39   Oryza sativa Indica Group [Indian rice]
gb|KFK22717.1|  hypothetical protein AALP_AAs75063U000200               139   9e-38   
emb|CAN74417.1|  hypothetical protein VITISV_028914                     126   3e-32   Vitis vinifera
ref|XP_003606649.1|  hypothetical protein MTR_4g063500                  126   2e-31   
ref|WP_011980905.1|  glyoxalase                                         103   1e-23   
ref|WP_015189426.1|  Glyoxalase/bleomycin resistance protein/diox...  99.0    4e-22   
dbj|BAJ95575.1|  predicted protein                                    94.7    7e-21   
ref|WP_024336519.1|  glyoxalase                                       95.1    9e-21   
ref|WP_027834487.1|  glyoxalase                                       94.7    1e-20   
ref|WP_002631628.1|  Lactoylglutathione lyase                         94.7    1e-20   
gb|KFA93576.1|  glyoxalase                                            94.4    2e-20   
ref|WP_028535658.1|  glyoxalase                                       94.0    3e-20   
ref|WP_008233831.1|  glyoxalase                                       92.8    7e-20   
ref|WP_011550629.1|  glyoxalase                                       91.3    2e-19   
ref|WP_015346030.1|  glyoxalase                                       90.9    3e-19   
ref|WP_018342223.1|  hypothetical protein                             90.9    3e-19   
ref|WP_036140734.1|  glyoxalase                                       90.9    4e-19   
ref|WP_029413028.1|  glyoxalase                                       89.4    1e-18   
ref|WP_008904821.1|  glyoxalase                                       89.4    1e-18   
ref|WP_015466791.1|  Lactoylglutathione lyase                         88.2    3e-18   
ref|WP_013901462.1|  glyoxalase                                       88.2    3e-18   
ref|WP_034799542.1|  glyoxalase                                       87.8    5e-18   
ref|WP_027419605.1|  glyoxalase                                       87.4    5e-18   
ref|WP_014331858.1|  glyoxalase                                       87.0    7e-18   
ref|WP_017455571.1|  MULTISPECIES: hypothetical protein               87.0    8e-18   
ref|WP_037453323.1|  glyoxalase                                       87.0    8e-18   
ref|WP_039596750.1|  glyoxalase                                       86.7    9e-18   
ref|WP_019094154.1|  glyoxalase                                       86.3    1e-17   
ref|WP_011061699.1|  glyoxalase                                       86.3    1e-17   
ref|WP_013564887.1|  glyoxalase/bleomycin resistance protein/diox...  86.7    2e-17   
ref|WP_013924921.1|  glyoxalase                                       85.9    2e-17   
gb|KHN21970.1|  hypothetical protein glysoja_008882                   84.0    2e-17   
ref|WP_015807594.1|  glyoxalase                                       85.9    2e-17   
ref|WP_029284335.1|  glyoxalase                                       85.9    2e-17   
gb|KIA77935.1|  Uncharacterized protein ysfE                          85.9    3e-17   
ref|WP_011811577.1|  glyoxalase                                       85.5    3e-17   
ref|WP_014429302.1|  glyoxalase                                       85.5    3e-17   
ref|WP_006340789.1|  glyoxalase                                       85.1    3e-17   
ref|WP_011550522.1|  glyoxalase                                       85.1    4e-17   
ref|WP_020471573.1|  hypothetical protein                             84.7    4e-17   
ref|WP_020294673.1|  glyoxalase family protein superfamily            85.1    5e-17   
ref|WP_026996455.1|  glyoxalase                                       84.7    5e-17   
ref|WP_010104240.1|  glyoxalase                                       84.7    6e-17   
ref|WP_012374195.1|  glyoxalase/bleomycin resistance protein/diox...  85.5    6e-17   
ref|WP_013687656.1|  glyoxalase                                       84.7    6e-17   
ref|WP_008002535.1|  glyoxalase                                       84.7    6e-17   
ref|WP_018631682.1|  hypothetical protein                             84.7    6e-17   
ref|WP_035996404.1|  glyoxalase                                       84.3    7e-17   
ref|WP_010176560.1|  glyoxalase                                       84.3    7e-17   
ref|WP_008437902.1|  glyoxalase                                       84.3    8e-17   
dbj|BAO75693.1|  lactoylglutathione lyase and related lyases          84.0    1e-16   
ref|WP_017137361.1|  glyoxalase                                       84.0    1e-16   
ref|WP_020895088.1|  Lactoylglutathione lyase                         83.6    1e-16   
gb|AII86154.1|  glyoxalase/bleomycin resistance protein               83.6    1e-16   
ref|WP_029292314.1|  glyoxalase                                       83.6    1e-16   
ref|WP_008013669.1|  glyoxalase                                       83.6    2e-16   
ref|WP_006220211.1|  glyoxalase                                       83.2    2e-16   
ref|WP_007981752.1|  glyoxalase                                       83.2    2e-16   
ref|WP_008022067.1|  glyoxalase                                       83.2    2e-16   
ref|WP_026381530.1|  glyoxalase                                       82.8    2e-16   
ref|WP_012238405.1|  lyase                                            82.4    3e-16   
ref|WP_009837778.1|  glyoxalase                                       82.4    4e-16   
ref|WP_006814415.1|  glyoxalase                                       82.0    5e-16   
ref|WP_032125583.1|  glyoxalase                                       81.6    6e-16   
ref|WP_017736316.1|  glyoxalase                                       81.6    7e-16   
ref|WP_038995777.1|  glyoxalase                                       81.6    8e-16   
gb|EXU81805.1|  glyoxalase                                            81.3    9e-16   
ref|WP_015158396.1|  hypothetical protein                             81.3    9e-16   
ref|WP_035660457.1|  glyoxalase                                       81.3    1e-15   
ref|WP_025809612.1|  glyoxalase                                       81.3    1e-15   
ref|WP_019973578.1|  hypothetical protein                             81.3    1e-15   
ref|WP_030130986.1|  glyoxalase                                       81.3    1e-15   
ref|WP_009048365.1|  glyoxalase                                       80.9    1e-15   
ref|WP_008075081.1|  glyoxalase                                       80.9    1e-15   
ref|WP_024530735.1|  glyoxalase                                       80.5    2e-15   
ref|WP_007904828.1|  glyoxalase                                       80.5    2e-15   
ref|WP_017498467.1|  glyoxalase                                       80.1    2e-15   
ref|WP_028682644.1|  glyoxalase                                       80.1    2e-15   
ref|WP_019960774.1|  hypothetical protein                             80.1    3e-15   
ref|WP_008008493.1|  glyoxalase                                       79.7    3e-15   
ref|WP_027264980.1|  glyoxalase                                       79.7    3e-15   
ref|WP_013936437.1|  glyoxalase                                       79.7    3e-15   
ref|WP_027475249.1|  glyoxalase                                       79.7    4e-15   
ref|WP_019965976.1|  glyoxalase                                       79.7    4e-15   
ref|WP_021182186.1|  hypothetical protein                             79.3    4e-15   
ref|WP_006658462.1|  glyoxalase                                       79.3    5e-15   
ref|WP_029032048.1|  glyoxalase                                       79.0    5e-15   
ref|WP_017010442.1|  hypothetical protein                             79.0    5e-15   
ref|WP_036967546.1|  glyoxalase                                       79.0    5e-15   
ref|WP_017878582.1|  glyoxalase                                       79.0    5e-15   
ref|WP_039115749.1|  glyoxalase                                       79.0    5e-15   
ref|WP_006662485.1|  glyoxalase/bleomycin resistance protein/diox...  79.0    5e-15   
ref|WP_037546053.1|  glyoxalase                                       78.6    7e-15   
ref|WP_014247982.1|  glyoxalase                                       78.6    9e-15   
ref|WP_002636258.1|  glyoxalase                                       78.6    9e-15   
gb|AHF03138.1|  glyoxalase                                            78.2    1e-14   
ref|WP_018109996.1|  hypothetical protein                             78.2    1e-14   
ref|WP_014019814.1|  glyoxalase                                       78.2    1e-14   
ref|WP_017012721.1|  hypothetical protein                             78.2    1e-14   
ref|WP_016657269.1|  hypothetical protein                             77.8    1e-14   
gb|KGT09947.1|  glyoxalase                                            77.8    1e-14   
ref|WP_028627347.1|  glyoxalase                                       77.8    1e-14   
emb|CEF48918.1|  unnamed protein product                              77.8    1e-14   
ref|WP_031209962.1|  glyoxalase                                       77.8    2e-14   
ref|WP_039119454.1|  glyoxalase                                       77.8    2e-14   
ref|WP_017017859.1|  hypothetical protein                             77.4    2e-14   
ref|WP_026686765.1|  glyoxalase                                       77.4    2e-14   
ref|WP_028978208.1|  glyoxalase                                       77.4    2e-14   
ref|WP_024567119.1|  glyoxalase                                       77.4    2e-14   
ref|WP_022639132.1|  glyoxalase                                       77.0    2e-14   
ref|WP_036976167.1|  glyoxalase                                       77.0    3e-14   
ref|WP_011921584.1|  glyoxalase                                       77.0    3e-14   
ref|WP_036949202.1|  glyoxalase                                       77.0    3e-14   
ref|XP_004352956.1|  glyoxalase, putative                             80.9    3e-14   
ref|WP_031254016.1|  glyoxalase                                       77.0    3e-14   
ref|WP_012389135.1|  glyoxalase                                       77.0    3e-14   
ref|WP_019689642.1|  glyoxalase                                       76.6    4e-14   
ref|WP_034867526.1|  glyoxalase                                       76.6    4e-14   
ref|WP_021070238.1|  hypothetical protein                             76.6    4e-14   
ref|WP_028217490.1|  glyoxalase                                       76.3    5e-14   
ref|WP_039048478.1|  MULTISPECIES: glyoxalase                         76.3    5e-14   
ref|WP_012165702.1|  glyoxalase                                       76.3    5e-14   
ref|WP_012411273.1|  glyoxalase/bleomycin resistance protein/diox...  76.3    6e-14   
ref|WP_029633085.1|  glyoxalase/bleomycin resistance protein/diox...  75.9    7e-14   
ref|WP_024564460.1|  glyoxalase                                       75.9    8e-14   
ref|WP_009461425.1|  MULTISPECIES: glyoxalase/bleomycin resistance    75.9    8e-14   
ref|WP_034369388.1|  glyoxalase                                       75.9    8e-14   
ref|WP_003056394.1|  glyoxalase                                       75.5    9e-14   
ref|WP_027618740.1|  glyoxalase                                       75.5    9e-14   
ref|WP_019011379.1|  hypothetical protein                             75.5    1e-13   
ref|WP_009084294.1|  glyoxalase                                       75.5    1e-13   
ref|WP_003063209.1|  glyoxalase                                       75.5    1e-13   
ref|WP_020738758.1|  hypothetical protein                             75.1    1e-13   
ref|WP_028379450.1|  glyoxalase                                       75.1    1e-13   
ref|WP_026039430.1|  glyoxalase                                       75.1    1e-13   
ref|WP_003001923.1|  glyoxalase                                       75.1    1e-13   
ref|WP_020285958.1|  glyoxalase/bleomycin resistance protein/diox...  75.1    2e-13   
ref|WP_014200502.1|  glyoxalase                                       75.9    2e-13   
ref|WP_012837890.1|  glyoxalase                                       74.7    2e-13   
ref|WP_003080539.1|  glyoxalase                                       74.3    2e-13   
ref|WP_027182733.1|  glyoxalase                                       74.3    2e-13   
ref|WP_029272344.1|  glyoxalase                                       74.3    3e-13   
ref|WP_009832979.1|  glyoxalase                                       74.3    3e-13   
ref|WP_038839084.1|  glyoxalase                                       73.9    3e-13   
ref|WP_035649631.1|  glyoxalase                                       73.9    3e-13   
emb|CBA30829.1|  hypothetical protein Csp_C25510                      73.9    4e-13   Curvibacter putative symbiont of Hydra magnipapillata
ref|WP_021346764.1|  glyoxalase                                       73.9    4e-13   
emb|CDT03229.1|  Glyoxalase/bleomycin resistance protein/dioxygenase  73.9    4e-13   
dbj|BAP42040.1|  glyoxylase                                           73.6    4e-13   
ref|WP_034766564.1|  glyoxalase                                       73.6    4e-13   
ref|WP_026483986.1|  glyoxalase                                       73.6    4e-13   
ref|WP_035622730.1|  glyoxalase                                       73.6    5e-13   
ref|WP_003007639.1|  glyoxalase                                       73.6    5e-13   
ref|WP_032863523.1|  glyoxalase                                       73.6    5e-13   
gb|AHE97514.1|  glyoxalase                                            73.2    7e-13   
ref|WP_022561640.1|  putative Glyoxalase/Bleomycin resistance pro...  72.8    8e-13   
ref|WP_033562864.1|  glyoxalase                                       72.8    8e-13   
ref|WP_035269501.1|  glyoxalase                                       72.8    8e-13   
ref|WP_022613724.1|  putative Glyoxalase/Bleomycin resistance pro...  72.8    9e-13   
ref|WP_026984069.1|  glyoxalase                                       72.8    9e-13   
ref|WP_034351770.1|  glyoxalase                                       72.8    1e-12   
ref|WP_014437934.1|  glyoxalase                                       72.4    1e-12   
ref|WP_020889650.1|  Lactoylglutathione lyase                         72.0    1e-12   
ref|WP_017479222.1|  glyoxalase                                       72.0    1e-12   
ref|WP_008151854.1|  glyoxalase                                       72.0    1e-12   
ref|WP_003800776.1|  glyoxalase                                       72.0    2e-12   
ref|WP_019645916.1|  hypothetical protein                             72.0    2e-12   
ref|WP_002990178.1|  MULTISPECIES: glyoxalase                         72.0    2e-12   
ref|WP_027721334.1|  glyoxalase                                       71.6    2e-12   
ref|WP_005503528.1|  glyoxalase                                       71.6    2e-12   
ref|WP_008464891.1|  glyoxalase                                       71.2    3e-12   
ref|WP_022602522.1|  putative Glyoxalase/Bleomycin resistance pro...  70.9    4e-12   
ref|WP_019644618.1|  hypothetical protein                             70.9    4e-12   
ref|WP_034745546.1|  glyoxalase                                       70.9    4e-12   
ref|WP_034786072.1|  glyoxalase                                       70.9    4e-12   
ref|WP_034714565.1|  glyoxalase                                       70.9    4e-12   
ref|WP_004398095.1|  glyoxalase                                       70.9    4e-12   
ref|WP_034730479.1|  glyoxalase                                       70.9    4e-12   
ref|WP_015486659.1|  glyoxalase                                       70.9    4e-12   
ref|WP_006932564.1|  glyoxalase                                       70.5    5e-12   
ref|WP_012911729.1|  glyoxalase                                       70.5    6e-12   
ref|WP_006262020.1|  glyoxalase                                       70.5    6e-12   
emb|CDP09029.1|  unnamed protein product                              68.6    6e-12   
ref|WP_002977428.1|  glyoxalase                                       70.1    7e-12   
ref|WP_015852338.1|  glyoxalase                                       70.1    8e-12   
ref|WP_035679739.1|  glyoxalase                                       69.7    9e-12   
ref|WP_035058334.1|  glyoxalase                                       69.7    1e-11   
ref|WP_028993596.1|  glyoxalase                                       69.7    1e-11   
gb|EGG98689.1|  hypothetical protein imdm_2033                        69.7    1e-11   
ref|WP_036471665.1|  glyoxalase                                       69.3    1e-11   
gb|KGY25955.1|  glyoxalase                                            69.3    1e-11   
ref|WP_039328469.1|  glyoxalase                                       69.3    2e-11   
ref|WP_028497617.1|  glyoxalase                                       69.3    2e-11   
ref|WP_021190678.1|  hypothetical protein                             69.3    2e-11   
ref|WP_034704406.1|  glyoxalase                                       68.9    2e-11   
ref|WP_038446687.1|  glyoxalase                                       68.9    2e-11   
ref|WP_024707878.1|  glyoxalase                                       68.9    2e-11   
ref|WP_018526034.1|  hypothetical protein                             68.9    2e-11   
ref|WP_023468993.1|  MULTISPECIES: glyoxalase                         68.6    2e-11   
ref|WP_029057947.1|  glyoxalase                                       68.6    3e-11   
dbj|GAJ29179.1|  glyoxalase                                           68.6    3e-11   
ref|WP_009830998.1|  glyoxalase                                       68.2    4e-11   
emb|CEA06690.1|  Glyoxalase-like domain protein                       67.8    4e-11   
ref|WP_038988140.1|  glyoxalase                                       67.8    5e-11   
ref|WP_036494369.1|  glyoxalase                                       67.8    5e-11   
ref|WP_037484773.1|  glyoxalase                                       67.4    7e-11   
ref|WP_006298340.1|  glyoxalase                                       67.4    7e-11   
ref|WP_019700326.1|  glyoxalase                                       67.0    8e-11   
ref|WP_021478073.1|  glyoxalase                                       67.0    9e-11   
ref|WP_020593919.1|  hypothetical protein                             67.0    1e-10   
ref|WP_034699362.1|  glyoxalase                                       67.0    1e-10   
ref|WP_013394629.1|  glyoxalase                                       66.6    1e-10   
ref|WP_008061608.1|  glyoxalase                                       67.0    1e-10   
ref|WP_027174679.1|  glyoxalase                                       66.2    2e-10   
ref|WP_027440307.1|  glyoxalase                                       66.2    2e-10   
ref|WP_014746204.1|  glyoxalase/bleomycin resistance protein/diox...  66.2    2e-10   
ref|WP_006225338.1|  glyoxalase                                       66.2    2e-10   
ref|WP_026832379.1|  glyoxalase                                       65.9    2e-10   
ref|WP_031448239.1|  hypothetical protein                             66.2    2e-10   
ref|WP_026433576.1|  glyoxalase                                       65.9    2e-10   
ref|WP_010223993.1|  glyoxalase                                       65.9    2e-10   
ref|WP_012568062.1|  glyoxalase                                       65.9    3e-10   
ref|WP_036994752.1|  glyoxalase                                       65.9    3e-10   
dbj|BAP32923.1|  glyoxalase                                           65.5    3e-10   
ref|WP_013594462.1|  glyoxalase                                       65.5    3e-10   
ref|WP_020407808.1|  hypothetical protein                             65.5    3e-10   
ref|WP_026827775.1|  glyoxalase                                       65.1    4e-10   
ref|WP_028450086.1|  glyoxalase                                       65.1    4e-10   
ref|WP_030128931.1|  glyoxalase                                       65.1    5e-10   
ref|WP_011135568.1|  glyoxalase                                       65.1    5e-10   
ref|WP_018228029.1|  glyoxalase                                       65.5    6e-10   
ref|WP_028105890.1|  glyoxalase                                       64.7    6e-10   
ref|WP_019657042.1|  glyoxalase                                       64.7    6e-10   
ref|WP_038640153.1|  glyoxalase                                       64.7    6e-10   
ref|WP_035406375.1|  glyoxalase                                       64.3    7e-10   
gb|EZP60542.1|  Glyoxalase                                            64.3    8e-10   
ref|WP_019259122.1|  glyoxalase                                       64.3    9e-10   
ref|WP_024889583.1|  glyoxalase                                       64.3    1e-09   
ref|WP_028448277.1|  glyoxalase                                       64.3    1e-09   
ref|WP_009983299.1|  glyoxalase family protein                        63.9    1e-09   
ref|WP_002540948.1|  Lactoylglutathione lyase                         63.9    1e-09   
gb|EKB02211.1|  hypothetical protein HMPREF9711_03417                 63.5    1e-09   
ref|WP_010414027.1|  glyoxalase                                       63.5    1e-09   
ref|WP_023734383.1|  glyoxalase                                       63.5    1e-09   
ref|WP_015102912.1|  hypothetical protein                             63.5    1e-09   
ref|WP_003237698.1|  glyoxalase family protein                        63.5    2e-09   
ref|WP_028904539.1|  glyoxalase                                       63.5    2e-09   
ref|WP_027118893.1|  glyoxalase                                       63.2    2e-09   
ref|WP_016920284.1|  hypothetical protein                             63.2    2e-09   
dbj|GAK86107.1|  lactoylglutathione lyase                             62.8    3e-09   
ref|WP_038487269.1|  glyoxalase                                       62.8    3e-09   
ref|WP_027274584.1|  glyoxalase                                       62.8    3e-09   
gb|EHO06393.1|  hypothetical protein HMPREF9715_03114                 62.4    3e-09   
gb|KFC95038.1|  lactoylglutathione lyase                              62.8    3e-09   
ref|XP_006677740.1|  hypothetical protein BATDEDRAFT_10586            62.0    4e-09   
ref|WP_027050439.1|  glyoxalase                                       62.4    4e-09   
ref|WP_027010674.1|  glyoxalase                                       62.4    4e-09   
ref|WP_006260320.1|  glyoxalase                                       62.4    4e-09   
ref|WP_027426930.1|  glyoxalase                                       62.4    5e-09   
ref|WP_027374521.1|  MULTISPECIES: glyoxalase                         62.4    5e-09   
ref|WP_023805252.1|  MULTISPECIES: glyoxalase                         62.0    5e-09   
ref|WP_027106038.1|  glyoxalase                                       62.4    5e-09   
ref|WP_023829540.1|  MULTISPECIES: glyoxalase                         62.0    6e-09   
ref|WP_008548478.1|  glyoxalase                                       62.0    6e-09   
ref|WP_023688409.1|  MULTISPECIES: glyoxalase                         62.0    6e-09   
ref|WP_010335233.1|  glyoxalase                                       61.6    6e-09   
ref|WP_019868218.1|  glyoxalase                                       61.6    7e-09   
ref|WP_013064470.1|  DJ-1/PfpI family/glyoxalase family protein       64.7    7e-09   
ref|WP_027427846.1|  glyoxalase                                       61.6    1e-08   
ref|WP_014283652.1|  glyoxalase                                       61.2    1e-08   
ref|WP_029331101.1|  glyoxalase                                       61.2    1e-08   
ref|WP_012371032.1|  glyoxalase                                       61.2    1e-08   
ref|WP_010560874.1|  glyoxalase                                       60.8    1e-08   
ref|WP_026829978.1|  glyoxalase                                       60.8    1e-08   
ref|WP_003222456.1|  glyoxalase                                       60.8    2e-08   
ref|WP_033147694.1|  glyoxalase                                       60.8    2e-08   
ref|WP_028521242.1|  glyoxalase                                       60.5    2e-08   
ref|WP_026499335.1|  glyoxalase                                       60.5    2e-08   
ref|WP_021591569.1|  hypothetical protein                             60.5    2e-08   
ref|WP_010251343.1|  glyoxalase                                       60.1    2e-08   
ref|WP_036972420.1|  glyoxalase                                       60.1    3e-08   
ref|WP_034597994.1|  glyoxalase [                                     60.1    3e-08   
ref|WP_024714792.1|  glyoxalase                                       60.1    3e-08   
ref|WP_031269217.1|  MULTISPECIES: glyoxalase                         60.1    3e-08   
ref|WP_031471738.1|  glyoxalase [                                     60.1    3e-08   
ref|WP_026671297.1|  glyoxalase                                       60.1    3e-08   
gb|ERP93968.1|  glyoxalase                                            60.1    3e-08   
ref|WP_014664757.1|  hypothetical protein                             59.7    4e-08   
ref|WP_036159162.1|  glyoxalase                                       59.7    4e-08   
ref|WP_023695300.1|  MULTISPECIES: glyoxalase                         59.3    5e-08   
ref|XP_006846134.1|  hypothetical protein AMTR_s00012p00160060        57.8    5e-08   
ref|WP_005816710.1|  glyoxalase                                       59.3    5e-08   
ref|WP_014114714.1|  glyoxalase                                       59.3    5e-08   
ref|WP_005339665.1|  glyoxalase                                       59.7    5e-08   
emb|CDM25477.1|  Glyoxalase family protein                            62.0    5e-08   
ref|WP_018212896.1|  glyoxalase                                       59.3    6e-08   
ref|WP_023667449.1|  glyoxalase                                       59.3    6e-08   
ref|WP_024122417.1|  glyoxalase                                       58.9    6e-08   
ref|WP_010329726.1|  glyoxalase                                       58.9    7e-08   
ref|WP_034283805.1|  glyoxalase                                       58.9    7e-08   
ref|WP_009215805.1|  glyoxalase                                       59.3    7e-08   
ref|WP_009533171.1|  glyoxalase                                       59.3    7e-08   
gb|KFF55785.1|  glyoxalase                                            58.9    7e-08   
ref|WP_034234223.1|  glyoxalase                                       58.9    8e-08   
ref|WP_039074706.1|  glyoxalase                                       58.9    8e-08   
ref|WP_014664906.1|  glyoxalase                                       58.5    9e-08   
ref|WP_034284454.1|  glyoxalase                                       58.5    9e-08   
ref|WP_026429988.1|  glyoxalase                                       58.5    1e-07   
ref|WP_029113010.1|  hypothetical protein                             58.9    1e-07   
ref|WP_032722327.1|  glyoxalase                                       58.5    1e-07   
ref|WP_032726360.1|  glyoxalase                                       58.5    1e-07   
ref|WP_005868435.1|  glyoxalase                                       58.5    1e-07   
ref|WP_019715318.1|  glyoxalase                                       58.2    1e-07   
ref|WP_039611833.1|  glyoxalase                                       58.2    1e-07   
ref|WP_008177389.1|  glyoxalase                                       58.2    1e-07   
ref|WP_029707784.1|  glyoxalase                                       58.2    1e-07   
ref|WP_033714398.1|  hypothetical protein                             58.2    1e-07   
ref|WP_014076477.1|  glyoxalase                                       58.2    1e-07   
ref|WP_010789428.1|  Lactoylglutathione lyase                         57.8    2e-07   
ref|WP_027554559.1|  glyoxalase                                       58.2    2e-07   
ref|WP_038429430.1|  glyoxalase                                       57.8    2e-07   
ref|WP_009105863.1|  glyoxalase                                       57.8    2e-07   
ref|WP_029939523.1|  hypothetical protein                             57.8    2e-07   
ref|WP_024866842.1|  glyoxalase                                       57.8    2e-07   
ref|WP_023364296.1|  glyoxalase/bleomycin resistance protein/diox...  57.4    2e-07   
ref|WP_016706375.1|  hypothetical protein                             57.8    2e-07   
ref|WP_015714487.1|  glyoxalase                                       57.4    2e-07   
ref|WP_019510281.1|  MULTISPECIES: hypothetical protein               58.2    2e-07   
ref|WP_029318213.1|  glyoxalase                                       57.4    2e-07   
ref|WP_027728440.1|  glyoxalase                                       57.8    2e-07   
ref|WP_032745214.1|  glyoxalase                                       57.8    2e-07   
ref|WP_012931998.1|  glyoxalase                                       57.4    2e-07   
ref|WP_014794471.1|  glyoxalase                                       57.8    2e-07   
ref|WP_015251599.1|  MULTISPECIES: hypothetical protein               57.4    3e-07   
ref|WP_026655582.1|  glyoxalase                                       57.8    3e-07   
ref|WP_028518450.1|  glyoxalase                                       57.4    3e-07   
ref|WP_014477606.1|  MULTISPECIES: glyoxalase                         57.4    3e-07   
ref|WP_018213988.1|  glyoxalase                                       57.4    3e-07   
ref|WP_034563221.1|  glyoxalase                                       57.0    3e-07   
ref|WP_024836145.1|  glyoxalase                                       57.0    3e-07   
gb|KIH41819.1|  glyoxalase                                            57.0    4e-07   
ref|WP_017696692.1|  glyoxalase                                       57.0    4e-07   
ref|WP_015098263.1|  hypothetical protein                             57.4    4e-07   
ref|WP_014480381.1|  hypothetical protein                             57.0    4e-07   
gb|AHF23725.1|  glyoxalase/bleomycin resistance protein/dioxygenase   57.0    4e-07   
ref|WP_010362778.1|  glyoxalase                                       57.0    4e-07   
ref|WP_027423144.1|  glyoxalase                                       57.0    4e-07   
ref|WP_039176573.1|  glyoxalase                                       56.6    4e-07   
ref|WP_023399891.1|  hypothetical protein                             57.0    4e-07   
ref|WP_033881440.1|  glyoxalase                                       56.6    4e-07   
ref|WP_015384319.1|  glyoxalase family protein                        56.6    4e-07   
ref|WP_025093624.1|  glyoxalase                                       56.6    4e-07   
ref|WP_026520288.1|  glyoxalase                                       56.6    5e-07   
ref|WP_034622913.1|  glyoxalase                                       56.6    5e-07   
ref|WP_012974425.1|  glyoxalase                                       56.6    5e-07   
ref|WP_026522107.1|  glyoxalase                                       56.6    5e-07   
ref|WP_007868432.1|  glyoxalase [                                     56.6    6e-07   
ref|WP_022768916.1|  glyoxalase                                       56.6    6e-07   
ref|WP_003325164.1|  MULTISPECIES: glyoxalase                         56.6    6e-07   
ref|WP_022765506.1|  glyoxalase                                       56.6    6e-07   
ref|WP_010383955.1|  glyoxalase                                       56.2    7e-07   
gb|KFF55911.1|  hypothetical protein CM50_07350                       56.2    7e-07   
ref|WP_027463621.1|  glyoxalase                                       56.2    7e-07   
ref|WP_019381237.1|  glyoxalase                                       56.2    7e-07   
ref|WP_017624083.1|  glyoxalase                                       56.2    7e-07   
ref|WP_008253889.1|  MULTISPECIES: hypothetical protein               56.6    7e-07   
ref|WP_009408846.1|  glyoxalase family protein superfamily            56.2    8e-07   
ref|WP_039324897.1|  hypothetical protein                             56.2    8e-07   
ref|WP_028398611.1|  hypothetical protein                             55.8    8e-07   
ref|WP_025056719.1|  glyoxalase                                       56.2    8e-07   
ref|WP_034324702.1|  glyoxalase                                       55.8    9e-07   
ref|WP_038949901.1|  MULTISPECIES: glyoxalase                         56.2    9e-07   
ref|WP_017610752.1|  glyoxalase                                       56.2    9e-07   
ref|WP_027208665.1|  glyoxalase                                       56.2    9e-07   
ref|WP_026668336.1|  glyoxalase                                       56.2    9e-07   
ref|WP_030133266.1|  MULTISPECIES: hypothetical protein               56.2    9e-07   
ref|WP_021621243.1|  glyoxalase family protein                        55.8    9e-07   
ref|WP_009616975.1|  glyoxalase                                       55.8    1e-06   
gb|ETP72684.1|  putative ring-cleavage extradiol dioxygenase          55.8    1e-06   
ref|WP_026668650.1|  glyoxalase                                       55.8    1e-06   
ref|WP_026580718.1|  glyoxalase                                       55.8    1e-06   
ref|WP_021623902.1|  glyoxalase family protein                        55.8    1e-06   
ref|WP_019850785.1|  glyoxalase                                       55.8    1e-06   
ref|WP_005493405.1|  glyoxalase family protein superfamily protein    55.8    1e-06   
ref|WP_031422087.1|  glyoxalase                                       55.5    1e-06   
ref|WP_026685664.1|  glyoxalase                                       55.5    1e-06   
ref|WP_037571980.1|  hypothetical protein                             57.8    1e-06   
ref|WP_006837279.1|  glyoxalase                                       55.5    1e-06   
ref|WP_028141135.1|  MULTISPECIES: glyoxalase                         55.8    1e-06   
gb|KIH41986.1|  hypothetical protein SC22_08330                       55.5    1e-06   
ref|WP_003890154.1|  hypothetical protein                             55.8    1e-06   
ref|WP_007168700.1|  hypothetical protein                             56.2    1e-06   
ref|WP_003930166.1|  hypothetical protein                             55.8    1e-06   
ref|WP_025128029.1|  glyoxalase                                       55.5    2e-06   
ref|WP_007777129.1|  hypothetical protein                             55.8    2e-06   
ref|WP_024425550.1|  glyoxalase                                       55.1    2e-06   
ref|WP_036044017.1|  glyoxalase                                       55.5    2e-06   
ref|WP_009336327.1|  glyoxalase                                       55.1    2e-06   
emb|CDP09030.1|  unnamed protein product                              54.3    2e-06   
emb|CDN79919.1|  Glyoxalase/bleomycin resistance protein/dioxygenase  54.7    2e-06   
ref|WP_036029655.1|  glyoxalase                                       55.1    2e-06   
ref|WP_013483927.1|  glyoxalase                                       55.1    2e-06   
ref|WP_034738615.1|  glyoxalase                                       54.7    2e-06   
ref|WP_028504243.1|  glyoxalase                                       55.1    2e-06   
ref|WP_015557776.1|  Predicted ring-cleavage extradiol dioxygenase    55.1    2e-06   
ref|WP_008720951.1|  glyoxalase                                       54.7    2e-06   
ref|WP_006566474.1|  MULTISPECIES: glyoxalase                         54.7    2e-06   
ref|WP_004398984.1|  MULTISPECIES: hypothetical protein               54.7    2e-06   
ref|WP_012631492.1|  glyoxalase                                       54.7    3e-06   
ref|WP_025037131.1|  glyoxalase                                       55.1    3e-06   
gb|EKF36136.1|  glyoxylase                                            55.1    3e-06   
ref|WP_014443569.1|  hypothetical protein                             54.7    3e-06   
ref|WP_019999404.1|  MULTISPECIES: hypothetical protein               54.7    3e-06   
ref|WP_003884671.1|  hypothetical protein                             55.1    3e-06   
ref|WP_029001846.1|  glyoxalase                                       54.7    3e-06   
ref|WP_032726268.1|  hypothetical protein                             54.7    3e-06   
ref|WP_008962214.1|  glyoxalase                                       54.7    3e-06   
ref|WP_007680691.1|  glyoxalase                                       54.7    3e-06   
ref|WP_003214168.1|  glyoxalase                                       54.3    3e-06   
ref|WP_017696053.1|  hypothetical protein                             54.3    3e-06   
ref|WP_028778497.1|  glyoxalase                                       54.3    3e-06   
ref|WP_025483819.1|  glyoxalase                                       54.3    3e-06   
ref|WP_028181136.1|  MULTISPECIES: glyoxalase                         54.3    3e-06   
dbj|GAJ36204.1|  hypothetical protein BDOA9_0154200                   54.7    4e-06   
ref|WP_007414598.1|  Glyoxalase/bleomycin resistance protein/diox...  54.3    4e-06   
ref|WP_010051418.1|  glyoxylase                                       54.3    4e-06   
ref|WP_014381853.1|  hypothetical protein                             54.7    4e-06   
ref|WP_028969099.1|  glyoxalase                                       54.7    4e-06   
ref|WP_008733980.1|  glyoxalase                                       54.7    4e-06   
ref|WP_008400135.1|  glyoxalase                                       54.3    4e-06   



>ref|XP_004241237.1| PREDICTED: uncharacterized protein LOC101251387 [Solanum lycopersicum]
Length=137

 Score =   223 bits (567),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 121/138 (88%), Gaps = 2/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+LG PAFAYTVVYC DVAKS  FYAKAFGYNVRR + NRKW ELESG+TTIAFTP+H
Sbjct  1    MASNLG-PAFAYTVVYCKDVAKSVAFYAKAFGYNVRRLDENRKWGELESGATTIAFTPVH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD +TG V+TPQSRG+R+ PIELCFDY D+DAA+KRA+ENGA+ V+ PE+K WGQ+V
Sbjct  60   QHETDDITGHVQTPQSRGDRQ-PIELCFDYVDIDAAYKRAIENGAMAVSEPEEKKWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRD DGN+VR+GSHV 
Sbjct  119  GYVRDPDGNIVRLGSHVK  136



>ref|XP_006350758.1| PREDICTED: uncharacterized protein LOC102591677 [Solanum tuberosum]
Length=137

 Score =   223 bits (567),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 120/137 (88%), Gaps = 2/137 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+LG PAFAYTVVYC DVAKS  FYAKAFGYNVRR + NRKW ELESG+TTIAFTP+H
Sbjct  1    MASNLG-PAFAYTVVYCKDVAKSVAFYAKAFGYNVRRLDENRKWGELESGATTIAFTPMH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD +TG V+TPQSRG+R+  IELCFDY D+DAA+KRA+ENGAV V+ PE+K WGQ+V
Sbjct  60   QHETDDITGHVQTPQSRGDRQ-AIELCFDYVDIDAAYKRAIENGAVAVSEPEEKKWGQKV  118

Query  349  GYVRDIDGNVVRMGSHV  299
            GYVRD DGNVVRMGSHV
Sbjct  119  GYVRDPDGNVVRMGSHV  135



>ref|XP_009593668.1| PREDICTED: uncharacterized protein LOC104090307 [Nicotiana tomentosiformis]
Length=138

 Score =   221 bits (562),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 123/141 (87%), Gaps = 3/141 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+LG PA+AYTVVY  DVAKS  FYAKAFGYNVRR + NRKW ELESG+TTIAFTPIH
Sbjct  1    MASNLG-PAYAYTVVYVKDVAKSVAFYAKAFGYNVRRLDDNRKWGELESGATTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+TP SR +R+ P+ELCFDY D+DAA+KRAVENGAV V+ PE+K WGQ+V
Sbjct  60   QHETDDLTGQVQTPHSRDDRQ-PVELCFDYVDIDAAYKRAVENGAVAVSEPEEKKWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRD+DGN+VRMGSHV +PK
Sbjct  119  GYVRDLDGNIVRMGSHV-DPK  138



>ref|XP_009757554.1| PREDICTED: uncharacterized protein LOC104210360 [Nicotiana sylvestris]
Length=138

 Score =   217 bits (553),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 123/141 (87%), Gaps = 3/141 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+ G PA+AYTVVY  DVAKS  FYA+AFGYNVRR + NRKW ELESG+TTIAFTPIH
Sbjct  1    MASNSG-PAYAYTVVYVKDVAKSVAFYAEAFGYNVRRLDDNRKWGELESGATTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+TP SRG+R+ P+ELCFDY D+DAA+KRAVENGAV V+ PE+K WGQ+V
Sbjct  60   QHETDDLTGQVQTPHSRGDRQ-PVELCFDYVDIDAAYKRAVENGAVAVSQPEEKKWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRD+DGN+VR+GSHV+ PK
Sbjct  119  GYVRDLDGNIVRLGSHVH-PK  138



>ref|NP_001049720.1| Os03g0277500 [Oryza sativa Japonica Group]
 dbj|BAF11634.1| Os03g0277500 [Oryza sativa Japonica Group]
Length=139

 Score =   210 bits (535),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -3

Query  691  APAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDG  512
            +PAFAYTVVY  DVAKSA FY+ AFGY VRR + + KWAELESG+TTIAFTP+HQRETD 
Sbjct  8    SPAFAYTVVYVKDVAKSAAFYSAAFGYTVRRLDQSHKWAELESGTTTIAFTPLHQRETDA  67

Query  511  LTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
            LTG V+ P S GE R P+E+CFDYAD+DAA++RAV++GAVPV+PPE K+WGQ+VGYVRDI
Sbjct  68   LTGAVQLPDSAGE-RGPVEICFDYADVDAAYRRAVDSGAVPVSPPEQKSWGQKVGYVRDI  126

Query  331  DGNVVRMGSHV  299
            DG +VRMGSHV
Sbjct  127  DGIIVRMGSHV  137



>gb|EAY89460.1| hypothetical protein OsI_10993 [Oryza sativa Indica Group]
Length=139

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -3

Query  691  APAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDG  512
            +PAFAYTVVY  DVAKSA FY+ AFGY +RR + + KWAELESG+TTIAFTP+HQRETD 
Sbjct  8    SPAFAYTVVYVKDVAKSAAFYSAAFGYTIRRLDQSHKWAELESGTTTIAFTPLHQRETDA  67

Query  511  LTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
            LTG V+ P S GE R P+E+CFDYAD+DAA++RAV++GAVPV+PPE K+WGQ+VGYVRDI
Sbjct  68   LTGAVQLPDSAGE-RGPVEICFDYADVDAAYRRAVDSGAVPVSPPEQKSWGQKVGYVRDI  126

Query  331  DGNVVRMGSHV  299
            DG +VRMGSHV
Sbjct  127  DGIIVRMGSHV  137



>gb|ABF95269.1| glyoxalase family protein, expressed [Oryza sativa Japonica Group]
 gb|EAZ26450.1| hypothetical protein OsJ_10338 [Oryza sativa Japonica Group]
Length=216

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 119/140 (85%), Gaps = 3/140 (2%)
 Frame = -3

Query  712  SMASSLGA--PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFT  539
            S+ +S GA  PAFAYTVVY  DVAKSA FY+ AFGY VRR + + KWAELESG+TTIAFT
Sbjct  76   SVMASEGAVSPAFAYTVVYVKDVAKSAAFYSAAFGYTVRRLDQSHKWAELESGTTTIAFT  135

Query  538  PIHQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWG  359
            P+HQRETD LTG V+ P S GE R P+E+CFDYAD+DAA++RAV++GAVPV+PPE K+WG
Sbjct  136  PLHQRETDALTGAVQLPDSAGE-RGPVEICFDYADVDAAYRRAVDSGAVPVSPPEQKSWG  194

Query  358  QRVGYVRDIDGNVVRMGSHV  299
            Q+VGYVRDIDG +VRMGSHV
Sbjct  195  QKVGYVRDIDGIIVRMGSHV  214



>ref|XP_008784517.1| PREDICTED: uncharacterized protein LOC103703445 [Phoenix dactylifera]
Length=140

 Score =   206 bits (525),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA +L  PAFAYTVVY  DVAKS  FY+ AFGY+VRR + + KW EL+SG TTIAFTP+H
Sbjct  1    MAPNL-IPAFAYTVVYVQDVAKSVAFYSNAFGYSVRRLDESHKWGELDSGQTTIAFTPVH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETDGLTG V+TP + G  R P+E+CF YAD+DAA+KRAVENGAVPV+PPEDK WGQRV
Sbjct  60   QRETDGLTGAVQTPDA-GWERAPVEVCFAYADVDAAYKRAVENGAVPVSPPEDKVWGQRV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRD DG VVR+GS+V EP+
Sbjct  119  GYVRDGDGIVVRLGSYVVEPR  139



>ref|XP_010937659.1| PREDICTED: uncharacterized protein LOC105056961 [Elaeis guineensis]
Length=140

 Score =   205 bits (521),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 1/135 (1%)
 Frame = -3

Query  691  APAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDG  512
            +PAFAYTVVY  DVAKS  FY+ AFGY+VRR + + KW EL+SG TTIAFTP+HQRETDG
Sbjct  6    SPAFAYTVVYVKDVAKSVAFYSNAFGYSVRRLDESHKWGELDSGQTTIAFTPVHQRETDG  65

Query  511  LTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
            LTGEV+TP   G  R P+E+ F YAD+DAA++RAVENGA+PVNPPEDK WGQ+VGYVRDI
Sbjct  66   LTGEVQTPAG-GWERGPVEVSFAYADVDAAYRRAVENGAIPVNPPEDKVWGQKVGYVRDI  124

Query  331  DGNVVRMGSHVNEPK  287
            DG VVR+GS V EP+
Sbjct  125  DGIVVRLGSFVVEPR  139



>ref|XP_010920635.1| PREDICTED: uncharacterized protein LOC105044439 [Elaeis guineensis]
Length=140

 Score =   204 bits (520),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/141 (70%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA +L +PAFAYTVVY  DVAKS  FY+ AFGY+VRR + + KW EL+SG TTIAFTP+H
Sbjct  1    MAPNL-SPAFAYTVVYVQDVAKSVAFYSNAFGYSVRRLDESHKWGELDSGQTTIAFTPVH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETDGLTG V+ P   G  R P+E+CF +AD+DAA+KRAVENGAVPV+ PEDK WGQRV
Sbjct  60   QRETDGLTGAVQAPAG-GLERGPVEVCFAFADVDAAYKRAVENGAVPVSKPEDKVWGQRV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRDIDG VVR+GS+V EP+
Sbjct  119  GYVRDIDGIVVRLGSYVEEPR  139



>ref|XP_004294574.1| PREDICTED: uncharacterized protein YraH-like [Fragaria vesca 
subsp. vesca]
Length=158

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MASSL  PA+AYTVVY  DVAKS  FY+KAFGY VRR + + +W ELESG TTIAFTP H
Sbjct  1    MASSLN-PAYAYTVVYVKDVAKSIAFYSKAFGYAVRRIDESHRWGELESGQTTIAFTPKH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+ P S G+ R P+E+CFDY D+DAA+KRAVENGAV V+ PE K WGQ+V
Sbjct  60   QHETDDLTGKVQKPSS-GDERQPVEVCFDYPDVDAAYKRAVENGAVAVSAPEQKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYVRD DG VVRMGS+VNEPK+
Sbjct  119  GYVRDPDGIVVRMGSYVNEPKQ  140



>ref|XP_002531367.1| catalytic, putative [Ricinus communis]
 gb|EEF31015.1| catalytic, putative [Ricinus communis]
Length=144

 Score =   202 bits (513),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 1/142 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MASS   PAFAYTVVY  DVA+S DFYA+AFGY+VRR + + +W ELESG TTIAFTPIH
Sbjct  2    MASSNLNPAFAYTVVYVKDVARSVDFYARAFGYHVRRLDDSHRWGELESGQTTIAFTPIH  61

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD L+G V TP   G  R PIE+CF YAD+D A+KRAVENGA PV+ PE+K WGQRV
Sbjct  62   QHETDDLSGTVRTPHF-GRERAPIEVCFAYADVDVAYKRAVENGAAPVSEPEEKQWGQRV  120

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYVRD+DG VVRMGS+V++P +
Sbjct  121  GYVRDLDGIVVRMGSYVSKPAK  142



>ref|XP_002299885.1| lactoylglutathione lyase family protein [Populus trichocarpa]
 gb|EEE84690.1| lactoylglutathione lyase family protein [Populus trichocarpa]
Length=142

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L +P +AYT+VY  DVAKS  FYAKAFGY+VRR + + +W EL+SG TTIAFTPIH
Sbjct  1    MASNL-SPEYAYTIVYAKDVAKSVAFYAKAFGYHVRRLDESNRWGELDSGPTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD  +G V+TP S  E R P+E+CF Y D+DAA+KRAVENGA+PV+ PEDK WGQRV
Sbjct  60   QRETDDRSGAVQTPHSDRE-RPPMEVCFSYTDVDAAYKRAVENGAIPVSKPEDKEWGQRV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYVRDIDG VVRMGSHV +P +
Sbjct  119  GYVRDIDGIVVRMGSHVVKPTK  140



>ref|XP_009148013.1| PREDICTED: uncharacterized protein LOC103871511 [Brassica rapa]
Length=138

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PA+AYTVVY  DVAKS +FY++AFGYNVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASNVIKPAYAYTVVYVRDVAKSVEFYSRAFGYNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++       R P+E+CF YAD+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQSSTRSERERAPLEVCFCYADVDAAFKRAVENGAVAVSEPEDKEWGQKV  120

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  121  GYVRDIDGIVVRIGSHVK  138



>ref|XP_010685804.1| PREDICTED: uncharacterized protein LOC104900146 [Beta vulgaris 
subsp. vulgaris]
Length=140

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA++L  PA+AYTVVY  DVAKS  FYAKAFG NVRR +++ +W ELESG TTIAFTPIH
Sbjct  1    MATNLN-PAYAYTVVYVKDVAKSVAFYAKAFGINVRRLDNSHRWGELESGQTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETDG+TG+V  P S  ER  PIE+CFD+AD+DAAFK AVENGA  V+ PE K WGQ+V
Sbjct  60   QHETDGVTGQVRVPHSNNERG-PIEVCFDFADVDAAFKMAVENGAEAVSEPEQKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRDIDG V+R+GSHV  PK
Sbjct  119  GYVRDIDGMVIRLGSHVTPPK  139



>ref|XP_010475533.1| PREDICTED: uncharacterized protein LOC104754937 [Camelina sativa]
Length=155

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 114/140 (81%), Gaps = 1/140 (1%)
 Frame = -3

Query  715  RSMASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTP  536
            + MA+++  PAFAY+VVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP
Sbjct  17   KIMAANMMRPAFAYSVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTP  76

Query  535  IHQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQ  356
            +HQ ETD LTG+V+   S  ER  PIELCF YAD+DAAFKRAVENGAV V+ PEDK WGQ
Sbjct  77   LHQHETDDLTGKVQATHSARERA-PIELCFCYADVDAAFKRAVENGAVAVSEPEDKEWGQ  135

Query  355  RVGYVRDIDGNVVRMGSHVN  296
            +VGYVRDIDG VVR+GSHV 
Sbjct  136  KVGYVRDIDGIVVRIGSHVK  155



>emb|CDX93631.1| BnaA06g04170D [Brassica napus]
Length=171

 Score =   201 bits (510),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 0/141 (0%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PA+AYTVVY  DVAKS +FY++AFGYNVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASNVIKPAYAYTVVYVRDVAKSVEFYSRAFGYNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++       R P+E+CF YAD+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQSSTRSERERAPLEVCFCYADVDAAFKRAVENGAVAVSEPEDKEWGQKV  120

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRDIDG VVR+GSHV   K
Sbjct  121  GYVRDIDGIVVRIGSHVKSYK  141



>ref|XP_006417780.1| hypothetical protein EUTSA_v10009069mg [Eutrema salsugineum]
 gb|ESQ36133.1| hypothetical protein EUTSA_v10009069mg [Eutrema salsugineum]
Length=137

 Score =   199 bits (506),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTPIH
Sbjct  1    MASNIMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPIH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++  S  ER  PIE+CF Y D+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQSTHSARERA-PIEVCFCYPDVDAAFKRAVENGAVAVSEPEDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>gb|KDP44216.1| hypothetical protein JCGZ_05683 [Jatropha curcas]
Length=146

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = -3

Query  709  MASSLGA-PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPI  533
            MAS+    PAFAYTVVY  DVAKS DFYA+AFGY+VRR +++ +WAEL+SG TTIAFTP+
Sbjct  1    MASNTNINPAFAYTVVYVKDVAKSVDFYARAFGYHVRRLDNSHRWAELDSGETTIAFTPV  60

Query  532  HQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQR  353
            HQ ETD  +GEV+TP++ G  R P+E+CF YAD+DAA+KRAVENGAVPV+ PE+K WGQ+
Sbjct  61   HQHETDDRSGEVQTPRN-GHERPPLEVCFAYADVDAAYKRAVENGAVPVSQPEEKEWGQK  119

Query  352  VGYVRDIDGNVVRMGSHVNEPK  287
            VGYVRDIDG VV MGS+VN  K
Sbjct  120  VGYVRDIDGIVVTMGSYVNGAK  141



>ref|XP_002892412.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68671.1| lactoylglutathione lyase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   198 bits (504),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA+++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MAANMMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+  QS  ER  PIE+CF Y D+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQATQSARERA-PIEVCFCYPDVDAAFKRAVENGAVTVSEPEDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>emb|CDX95137.1| BnaC05g05340D [Brassica napus]
Length=138

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PA+AYTVVY  DVAKS +FY++AFGYNVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASNIIKPAYAYTVVYVRDVAKSVEFYSRAFGYNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++       R P+E+CF Y D+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQSSTRSDRERAPLEVCFCYHDVDAAFKRAVENGAVAVSEPEDKEWGQKV  120

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  121  GYVRDIDGIVVRIGSHVK  138



>ref|XP_009353814.1| PREDICTED: uncharacterized protein LOC103945035 [Pyrus x bretschneideri]
Length=143

 Score =   198 bits (503),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -3

Query  712  SMASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPI  533
            +MAS      FAYTVVY  DVAKS  FY+KAFGY++RR + + +W ELESG TTIAFTP+
Sbjct  2    AMASKTNT-VFAYTVVYVKDVAKSTTFYSKAFGYDIRRLDDSNRWGELESGQTTIAFTPL  60

Query  532  HQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQR  353
            HQ ETD LTG V+TP S G  R PIE+CF Y D+DAA+KRAVENGAVPV+ PE K WGQ+
Sbjct  61   HQHETDDLTGAVQTPSS-GRERQPIEVCFAYGDVDAAYKRAVENGAVPVSAPEAKEWGQK  119

Query  352  VGYVRDIDGNVVRMGSHVNEPKR  284
            VGYVRD+DG VVR+GS+VN P +
Sbjct  120  VGYVRDLDGIVVRLGSYVNPPTK  142



>ref|XP_010457958.1| PREDICTED: uncharacterized protein LOC104739340 [Camelina sativa]
Length=137

 Score =   196 bits (499),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA+++  PAFAY+VVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MAANMMRPAFAYSVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+   S  ER  PIELCF Y D+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQATHSARERA-PIELCFCYPDVDAAFKRAVENGAVAVSEPEDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>ref|XP_006306385.1| hypothetical protein CARUB_v10012292mg [Capsella rubella]
 gb|EOA39283.1| hypothetical protein CARUB_v10012292mg [Capsella rubella]
Length=137

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA+++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MAANVMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDDSHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++ QS  ER  PIE+CF Y D+DAAFKRAVENGAV V+ PE+K WGQ+V
Sbjct  61   QHETDDLTGKVQSTQSARERA-PIEVCFCYPDVDAAFKRAVENGAVAVSEPENKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>ref|NP_973779.1| dessication-induced 1VOC-like protein [Arabidopsis thaliana]
 gb|AAF75090.1|AC007583_26 ESTs gb|Z27026 and gb|29860 come from this gene [Arabidopsis 
thaliana]
 gb|AAG48811.1|AF332448_1 putative receptor serine/threonine kinase [Arabidopsis thaliana]
 dbj|BAC42889.1| unknown protein [Arabidopsis thaliana]
 gb|AEE28157.1| dessication-induced 1VOC-like protein [Arabidopsis thaliana]
Length=137

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA+++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MAANMMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+  QS  ER  PIE+CF Y D+DAAFKRAVENGA  V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQATQSARERA-PIEVCFCYPDVDAAFKRAVENGAEAVSKPEDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>ref|XP_008385224.1| PREDICTED: uncharacterized protein LOC103447797 [Malus domestica]
Length=143

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -3

Query  712  SMASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPI  533
            +MAS      FAYTVVY  DVAKS  FY+KAFGY++RR + + +W ELESG TTIAFTP+
Sbjct  2    AMASKTNT-VFAYTVVYVKDVAKSTTFYSKAFGYDIRRLDDSNRWGELESGQTTIAFTPL  60

Query  532  HQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQR  353
            HQ ETD LTG V+TP S G  R PIE+CF Y D+DAA+K AVENGAVPV+ PE+K WGQ+
Sbjct  61   HQHETDDLTGAVKTPSS-GHERQPIEVCFAYGDVDAAYKXAVENGAVPVSEPEEKEWGQK  119

Query  352  VGYVRDIDGNVVRMGSHVNEPKR  284
            VGYVRD+DG VVR+GS+VN P +
Sbjct  120  VGYVRDLDGIVVRLGSYVNPPTK  142



>ref|XP_011000271.1| PREDICTED: uncharacterized protein LOC105107891 [Populus euphratica]
Length=142

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L +P +AY +VY  DVAKS  FYAKAFGY+VRR + + +W EL+SG TTIAFTPIH
Sbjct  1    MASNL-SPEYAYAIVYAKDVAKSVAFYAKAFGYHVRRLDESNRWGELDSGPTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD  +G V+TP S  E R P+E+CF Y D+DAA+KRAVENGA+PV+ PEDK WGQRV
Sbjct  60   QRETDDRSGAVQTPHSDRE-RPPMEVCFSYTDVDAAYKRAVENGAIPVSKPEDKEWGQRV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYVRDIDG VVRMGS V +P +
Sbjct  119  GYVRDIDGIVVRMGSRVVKPAK  140



>ref|XP_011000270.1| PREDICTED: uncharacterized protein LOC105107890 [Populus euphratica]
Length=142

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L +P +AY +VY  DVAKS  FYAKAFGY+VRR + + +W EL+SG TTIAFTPIH
Sbjct  1    MASNL-SPEYAYAIVYAKDVAKSVAFYAKAFGYHVRRLDESNRWGELDSGPTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD  +G V+TP S  E R P+E+CF Y D+DAA+KRAVENGA+PV+ PEDK WGQRV
Sbjct  60   QRETDDRSGAVQTPHSDRE-RPPMEVCFSYTDVDAAYKRAVENGAIPVSKPEDKEWGQRV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYVRDIDG VVRMGS V +P +
Sbjct  119  GYVRDIDGIVVRMGSRVVKPTK  140



>gb|KFK43085.1| hypothetical protein AALP_AA1G077300 [Arabis alpina]
Length=137

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASNMMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++  S  ER  PIE+CF Y D+DAAFKRAVENGAV V+ P DK WGQ+V
Sbjct  61   QHETDDLTGKVQSTHSSRERP-PIEVCFCYPDVDAAFKRAVENGAVAVSEPVDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>emb|CDY61966.1| BnaCnng38880D [Brassica napus]
Length=137

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 112/138 (81%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP H
Sbjct  1    MASNIMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPRH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+  +S  ER  PIE+CF Y D+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQATRSDRERT-PIEVCFCYPDVDAAFKRAVENGAVAVSEPEDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>ref|XP_002284138.1| PREDICTED: uncharacterized protein LOC100250180 [Vitis vinifera]
 emb|CBI16163.3| unnamed protein product [Vitis vinifera]
Length=144

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+  +PAFAY V+Y  DVAKS  FYAKAFG NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASN-PSPAFAYVVLYVKDVAKSTAFYAKAFGCNVRRLDESHRWGELESGKTTIAFTPVH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD +TG V+ P S G  R P+ELCF Y D+DAA+KRAVENGA+ V+ PE+K WGQ+V
Sbjct  60   QRETDRITGAVQDPWS-GRERPPVELCFAYVDVDAAYKRAVENGAMSVSEPEEKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYVRDIDG VVRMGSHV+ PK+
Sbjct  119  GYVRDIDGIVVRMGSHVSPPKQ  140



>ref|XP_009118422.1| PREDICTED: uncharacterized protein LOC103843439 [Brassica rapa]
 emb|CDY06276.1| BnaA09g49270D [Brassica napus]
Length=137

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 111/138 (80%), Gaps = 1/138 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP H
Sbjct  1    MASNIMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPRH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+   S  ER  PIE+CF Y D+DAAFKRAVENGAV V+ PEDK WGQ+V
Sbjct  61   QHETDDLTGKVQATHSDPERA-PIEVCFCYPDVDAAFKRAVENGAVAVSEPEDKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVN  296
            GYVRDIDG VVR+GSHV 
Sbjct  120  GYVRDIDGIVVRIGSHVK  137



>ref|XP_004505878.1| PREDICTED: uncharacterized protein Mb0911c-like [Cicer arietinum]
Length=142

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 1/141 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MASS  +PAFAYTV+Y  DVA+S  FY KAFGY+VRR + + +W ELESG TTIAFTPIH
Sbjct  1    MASSNLSPAFAYTVLYVKDVAESVAFYVKAFGYSVRRLDESNRWGELESGHTTIAFTPIH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG V T +S+ ER  P+E+CF Y D+DAA+KRAVENGA+ V+ PE K WGQ+V
Sbjct  61   QHETDDLTGAVHTARSKQERP-PVEICFIYTDVDAAYKRAVENGALAVSQPEVKEWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRDIDG V+RMGSHV   K
Sbjct  120  GYVRDIDGIVIRMGSHVKPAK  140



>ref|XP_006649854.1| PREDICTED: uncharacterized protein LOC102715925 [Oryza brachyantha]
Length=138

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS   +PAFAYTVVY  DVA+SA FY+ AFGY+VRR + + KWAELESG+TTIAFTP+H
Sbjct  1    MASGAVSPAFAYTVVYVKDVARSAAFYSAAFGYSVRRLDQSLKWAELESGATTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD LTG  + P + GE R P+E+CFDYAD+DAA++ AV++GAVPV+ PE K+WGQ+V
Sbjct  61   QRETDALTGAGQAPGAAGE-RGPVEICFDYADVDAAYRHAVDSGAVPVSAPEQKSWGQKV  119

Query  349  GYVRDIDGNVVRMGSHV  299
            GYVRDIDG VVRMGSHV
Sbjct  120  GYVRDIDGIVVRMGSHV  136



>ref|XP_008448396.1| PREDICTED: uncharacterized protein LOC103490595 [Cucumis melo]
Length=141

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 112/143 (78%), Gaps = 2/143 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L  P FAYT++Y  DVAKS DFY+KAFG+ VRR + + +W EL SG TTIAFTP H
Sbjct  1    MASNL-KPTFAYTILYVKDVAKSVDFYSKAFGFTVRRLDDSNRWGELVSGETTIAFTPQH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ET+ LTG V+TP S  E R+PIE+C DYAD+DAAF+RAVENGA  V  PE K W Q+V
Sbjct  60   QHETEDLTGVVQTPSSNRE-RNPIEICVDYADVDAAFQRAVENGATEVTRPEGKEWNQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKRS  281
            GYVRDIDG VVR+GSHVN PK++
Sbjct  119  GYVRDIDGMVVRIGSHVNHPKQN  141



>ref|XP_007016472.1| Dessication-induced 1VOC superfamily protein [Theobroma cacao]
 gb|EOY34091.1| Dessication-induced 1VOC superfamily protein [Theobroma cacao]
Length=142

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L  P F YTVVY  DVAKS DFYAKAFGY+VRR + + +W ELESG TTIAFTP H
Sbjct  1    MASNL-KPTFGYTVVYVKDVAKSVDFYAKAFGYDVRRLDESHRWGELESGHTTIAFTPRH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDK-TWGQR  353
            Q ETD LTG V+ P+S  ER  P+E+C  Y D+DAAFKRAVENGAVPV+ PEDK  WGQ+
Sbjct  60   QHETDDLTGAVQVPKSDSERP-PVEICLVYTDVDAAFKRAVENGAVPVSQPEDKQNWGQK  118

Query  352  VGYVRDIDGNVVRMGSHVNEPKR  284
            VGYVRDIDG  VRMGS+V+  K+
Sbjct  119  VGYVRDIDGLTVRMGSYVHASKQ  141



>gb|EMT29398.1| hypothetical protein F775_29044 [Aegilops tauschii]
Length=138

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 1/139 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS    P  AY V Y  DV KSA FYA AFGY+VRR + + KWAEL++GSTTIAFTP+H
Sbjct  1    MASGAVRPKLAYIVCYVKDVPKSAAFYADAFGYSVRRVDDSHKWAELDTGSTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD LTGEV+ P+S  E R P+E+CFDY D+DAA++RAVENGAVPV+ PE K WGQ+V
Sbjct  61   QRETDALTGEVQLPKSPRE-RGPVEICFDYDDVDAAYRRAVENGAVPVSAPEQKNWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRD DG  VR+GSHV E
Sbjct  120  GYVRDCDGITVRLGSHVRE  138



>ref|XP_003558224.1| PREDICTED: uncharacterized protein LOC100826172 [Brachypodium 
distachyon]
Length=138

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS    PA AY VVY  DVAKSA  YA AFGY+VRR + + KWAEL++GSTTIAFTP+H
Sbjct  1    MASGAVRPALAYIVVYVEDVAKSAACYAAAFGYSVRRIDQSHKWAELDTGSTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD LTGEV+ P+S  E R P+E+CFDY D+DAA++RAV+NGAVPV PPE K WGQ+V
Sbjct  61   QRETDALTGEVQLPKSPRE-RGPVEICFDYTDVDAAYRRAVDNGAVPVTPPEQKNWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRD+DGN+VRMGSHV E
Sbjct  120  GYVRDLDGNIVRMGSHVRE  138



>gb|EYU29486.1| hypothetical protein MIMGU_mgv1a015999mg [Erythranthe guttata]
Length=138

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 2/139 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L  P +AYTVVY +DVAKS  FYAKAFGY+VRR + +R+W ELESG TTIAFTP  
Sbjct  1    MASNLN-PKYAYTVVYVSDVAKSVAFYAKAFGYHVRRLDDSRRWGELESGQTTIAFTPAK  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ET+ LTG+V+ P S    R+ +E+CFDY+D+DAA+KRAVENGAV V+ PEDK WGQ+V
Sbjct  60   QHETEDLTGKVQIPHS-DRHRNSVEVCFDYSDVDAAYKRAVENGAVGVSEPEDKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRDIDG VVRMGSHV +
Sbjct  119  GYVRDIDGIVVRMGSHVRQ  137



>ref|XP_004143102.1| PREDICTED: uncharacterized protein Mb0911c-like [Cucumis sativus]
 ref|XP_004164679.1| PREDICTED: uncharacterized protein Mb0911c-like [Cucumis sativus]
 gb|KGN47167.1| hypothetical protein Csa_6G191550 [Cucumis sativus]
Length=141

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L  P  AY ++Y  DVAKS DFY+KAFG+ VRR + + +W EL SG TTIA TPIH
Sbjct  1    MASNL-KPTLAYIILYVQDVAKSVDFYSKAFGFTVRRLDDSNRWGELVSGETTIALTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ET+ LTG V+TP S  ER +PIE+C DY+D+DAA++RAVENGA  V+ PE K W Q+V
Sbjct  60   QHETEDLTGVVQTPSSNRER-NPIEICIDYSDVDAAYQRAVENGAAEVSRPEGKEWNQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPKRS  281
            GYVRDIDG VVRMGSHVN PK+S
Sbjct  119  GYVRDIDGMVVRMGSHVNHPKQS  141



>ref|XP_011097109.1| PREDICTED: uncharacterized protein LOC105176104 [Sesamum indicum]
Length=136

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 2/137 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L +P +AYTVVY  DVAKS  FYAKAFG+ VRR + +R+W ELESG TTIAFTP  
Sbjct  1    MASNL-SPVYAYTVVYVKDVAKSVAFYAKAFGHQVRRLDDSRRWGELESGQTTIAFTPAR  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTGEV+ P+S   +R+PIE+CFDY+D+DAA+K AVENGA  V+ PE+K WGQ+V
Sbjct  60   QHETDDLTGEVQIPRST-HQRNPIEVCFDYSDVDAAYKAAVENGAEAVSAPEEKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHV  299
            GYVRDIDG VVRMGSHV
Sbjct  119  GYVRDIDGIVVRMGSHV  135



>ref|XP_007206109.1| hypothetical protein PRUPE_ppa013012mg [Prunus persica]
 gb|EMJ07308.1| hypothetical protein PRUPE_ppa013012mg [Prunus persica]
Length=144

 Score =   192 bits (488),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYTVVY  DVAKS  FY+KAFGYN+RR + + +W ELESG TTIAFTP+HQ ETD LTG
Sbjct  12   FAYTVVYVKDVAKSTTFYSKAFGYNIRRIDDSNRWGELESGQTTIAFTPVHQHETDDLTG  71

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V+TP S G  R P+E+CF Y D+DAA+KRAVENGAV V+ PE+K WGQ+VGYVRD DG 
Sbjct  72   AVKTPSS-GRERQPVEVCFAYPDVDAAYKRAVENGAVAVSEPEEKEWGQKVGYVRDPDGI  130

Query  322  VVRMGSHVNEP  290
            VVR+GS+VN P
Sbjct  131  VVRLGSYVNPP  141



>gb|AES88846.2| dessication-induced 1VOC superfamily protein [Medicago truncatula]
Length=141

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS L +P FAYTV+Y  DVA+S  FY+KAFGY+VRR + + +W ELESG TTIAFTPIH
Sbjct  1    MASKL-SPEFAYTVLYVKDVAESVAFYSKAFGYSVRRLDESHRWGELESGHTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG V T +S  ER  P+E+CF Y D+DAA+KRAVENGAVPV+ PE K WGQ+V
Sbjct  60   QHETDDLTGVVHTTRSNKERP-PVEVCFVYTDVDAAYKRAVENGAVPVSEPEMKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRDIDG V+RMG+HV   K
Sbjct  119  GYVRDIDGIVIRMGNHVKPAK  139



>gb|EPS73258.1| hypothetical protein M569_01497, partial [Genlisea aurea]
Length=135

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 112/137 (82%), Gaps = 2/137 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA +L +PAFAYTVVY  DVAKS  FY++AFGY VRR +++ +W ELE+G TTIAFTP  
Sbjct  1    MAKNL-SPAFAYTVVYVKDVAKSVAFYSQAFGYQVRRLDNSHRWGELETGHTTIAFTPAK  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD  TGEV  P +  ER +P+E+CFDYAD+D+A++RA+ENGAV V+PPE+K WGQ+V
Sbjct  60   QHETDNRTGEVHLPSTDRER-NPVEVCFDYADVDSAYQRALENGAVAVSPPEEKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHV  299
            GYVRDIDG VVRMGSHV
Sbjct  119  GYVRDIDGIVVRMGSHV  135



>ref|XP_008223274.1| PREDICTED: uncharacterized protein LOC103323091 [Prunus mume]
Length=144

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 106/131 (81%), Gaps = 1/131 (1%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYTVVY  DVAKS  FY+KAFGYN+RR + + +W ELESG TTIAFTP+HQ ETD LTG
Sbjct  12   FAYTVVYVKDVAKSTAFYSKAFGYNIRRIDDSNRWGELESGQTTIAFTPVHQHETDDLTG  71

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V+TP S G  R P+E+CF Y D+DAA+KRA+ENGAV V+ PE+K WGQ+VGYVRD DG 
Sbjct  72   AVKTPSS-GRERQPVEVCFAYPDVDAAYKRALENGAVAVSEPEEKEWGQKVGYVRDPDGI  130

Query  322  VVRMGSHVNEP  290
            VVR+GS+VN P
Sbjct  131  VVRLGSYVNPP  141



>ref|XP_010043570.1| PREDICTED: uncharacterized protein LOC104432749 [Eucalyptus grandis]
 gb|KCW85589.1| hypothetical protein EUGRSUZ_B02382 [Eucalyptus grandis]
Length=137

 Score =   189 bits (481),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            PA AY VVY  DVAKS  FYAKAFGY VRR + + +W ELESG TTIAFTP HQRETD L
Sbjct  3    PALAYVVVYVKDVAKSVAFYAKAFGYTVRRIDESHRWGELESGQTTIAFTPRHQRETDDL  62

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V+ P+S G  R P+E+CF Y D+DAA+KRAVE+GA PV+ PE+K WGQ+VGYVRDID
Sbjct  63   TGVVQNPKS-GYDRPPVEVCFAYRDVDAAYKRAVESGAEPVSKPEEKEWGQKVGYVRDID  121

Query  328  GNVVRMGSHVNEPKR  284
            G V+RMGS+V  PK+
Sbjct  122  GIVIRMGSYVQAPKQ  136



>gb|EMS64128.1| hypothetical protein TRIUR3_21203 [Triticum urartu]
Length=138

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS    P  AY V Y  DV KSA FYAKAF Y+VRR + + KWAEL++GSTTIAFTP H
Sbjct  1    MASGAVRPKLAYIVCYVEDVGKSAAFYAKAFNYSVRRVDDSHKWAELDTGSTTIAFTPRH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD LTGEV+ P+S  E R P+E+CFDY D+DAA++R VENGAVPV+ PE K WGQ+V
Sbjct  61   QRETDALTGEVQLPKSPRE-RGPVEICFDYDDVDAAYRRGVENGAVPVSAPEQKNWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRD DG  VR+GSHV E
Sbjct  120  GYVRDCDGITVRLGSHVRE  138



>ref|XP_007132082.1| hypothetical protein PHAVU_011G065500g [Phaseolus vulgaris]
 gb|ESW04076.1| hypothetical protein PHAVU_011G065500g [Phaseolus vulgaris]
Length=139

 Score =   189 bits (480),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 103/134 (77%), Gaps = 1/134 (1%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            P F Y VVY  DVA S  FY KAFGY+VRR + + +W ELE+G+TTIAFTPIHQ ETD L
Sbjct  7    PVFGYVVVYVKDVAASVAFYGKAFGYDVRRLDESHRWGELETGNTTIAFTPIHQHETDNL  66

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V    S GER  P+E+CF Y+D+DAA+KRAVENGAV V  PE K WGQ+VGYVRDID
Sbjct  67   TGAVHNSGSGGERP-PMEVCFVYSDVDAAYKRAVENGAVAVREPEGKEWGQKVGYVRDID  125

Query  328  GNVVRMGSHVNEPK  287
            GNVVRMGSHV  PK
Sbjct  126  GNVVRMGSHVKPPK  139



>dbj|BAK07401.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=138

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS    P  AY V Y  DV KS  FYA AFGYNVRR + ++KWAEL++GSTTIAFT +H
Sbjct  1    MASGAVRPKLAYIVCYVKDVPKSVAFYADAFGYNVRRVDDSQKWAELDTGSTTIAFTALH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD LTGEV+ P+S  E R P+E+CFDY D+ AA++RAVE GAVPV+ PE K WGQ+V
Sbjct  61   QRETDALTGEVQLPKSPRE-RGPVEICFDYDDVVAAYRRAVEKGAVPVSAPEQKNWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRD+DG  VR+GSHV E
Sbjct  120  GYVRDVDGITVRLGSHVRE  138



>gb|KHG01311.1| putative yraH [Gossypium arboreum]
Length=142

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 3/142 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  P   Y + Y  DVAKS DFYAKAFGYNVRR + + +W ELESG TTIAFTP H
Sbjct  1    MASNV-KPVLGYAIFYVKDVAKSVDFYAKAFGYNVRRLDESHRWGELESGQTTIAFTPKH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKT-WGQR  353
            Q ETD LTGEV+ P+S    R P+ELCF Y+D+DAAF RA+ENGA+ V+ PEDK  WGQR
Sbjct  60   QHETDELTGEVQVPKS-DVHRPPMELCFIYSDVDAAFTRAMENGAMAVSEPEDKKDWGQR  118

Query  352  VGYVRDIDGNVVRMGSHVNEPK  287
            VGYVRDIDG +VRMGS+V  PK
Sbjct  119  VGYVRDIDGMLVRMGSYVKSPK  140



>ref|XP_010106438.1| hypothetical protein L484_025194 [Morus notabilis]
 gb|EXC10614.1| hypothetical protein L484_025194 [Morus notabilis]
Length=141

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 113/141 (80%), Gaps = 2/141 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS L +P FAYTVVY  DVA+  +FY  AFG++VRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASKL-SPEFAYTVVYVKDVARCVEFYKNAFGFSVRRLDESHRWGELESGQTTIAFTPLH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG V+TP+   +R  P+E+CF Y+D+DAA+K+AVENGAVPV+ PE K WGQ+V
Sbjct  60   QHETDDLTGSVQTPEYARDRA-PVEVCFVYSDVDAAYKKAVENGAVPVSEPEQKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GY+RD++G VVR+GSHV+ PK
Sbjct  119  GYLRDLNGIVVRIGSHVHPPK  139



>ref|NP_001238248.1| uncharacterized protein LOC100527071 [Glycine max]
 gb|ACU16112.1| unknown [Glycine max]
Length=139

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            P   Y V+Y  DVA+S  FYAKAFGY+VRR + + +W ELE+G+TTIAFTPIHQ ETD L
Sbjct  7    PVLGYVVLYVKDVAESVAFYAKAFGYSVRRLDESHRWGELETGNTTIAFTPIHQHETDDL  66

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V  P S  ER  P+E+CF Y+D+DAA+K AVENGAV V+ PE K WGQ+VGYVRDID
Sbjct  67   TGAVHNPGSCRERP-PMEVCFVYSDVDAAYKHAVENGAVAVSEPELKEWGQKVGYVRDID  125

Query  328  GNVVRMGSHVNEPK  287
            GNVVRMGSHVN PK
Sbjct  126  GNVVRMGSHVNPPK  139



>ref|NP_001146848.1| LOC100280456 [Zea mays]
 gb|ACG23936.1| glyoxalase family protein superfamily [Zea mays]
 tpg|DAA44686.1| TPA: glyoxalase family protein family protein [Zea mays]
Length=139

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS    P  AY ++Y  DV K+A FY  AFGY VRR + +RKWAELESG+TTIAFTP+H
Sbjct  1    MASGGPKPKLAYIILYVRDVEKAASFYDAAFGYTVRRLDQSRKWAELESGATTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD L+G V+ P S    R  +E+CF YAD+DAA+KRAV+NGAV V+ PEDK WGQ+ 
Sbjct  61   QRETDELSGAVQLPDSSAAGRGSVEVCFAYADVDAAYKRAVDNGAVAVSAPEDKPWGQKS  120

Query  349  GYVRDIDGNVVRMGSHVNE  293
            G+VRD+DGN+VR+ S+V E
Sbjct  121  GFVRDMDGNIVRIASYVRE  139



>gb|AAT45010.1| unknown [Xerophyta humilis]
Length=140

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 112/143 (78%), Gaps = 3/143 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA++L  P + YTV Y  DV +S  FYAKAFGY VRR +++ +W ELESG TTIAFTP+H
Sbjct  1    MAANL-RPVYGYTVFYVKDVTESVAFYAKAFGYRVRRVDNSNRWGELESGETTIAFTPMH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q+ETDG +G V  P+  GE+ +P+E+C  Y D+DAA+KRAVENGAVPV+PPED+ WGQ+V
Sbjct  60   QKETDGRSGVVHIPEP-GEK-NPVEVCLAYEDVDAAYKRAVENGAVPVSPPEDQVWGQKV  117

Query  349  GYVRDIDGNVVRMGSHVNEPKRS  281
            GYVRDI+G  VR+GSHV EP R 
Sbjct  118  GYVRDINGITVRLGSHVKEPTRQ  140



>gb|KHN32114.1| hypothetical protein glysoja_028909 [Glycine soja]
Length=139

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            P   Y V+Y  DVA+S  FYAKAFGY VRR + + +W ELE+G+TTIAFTPIHQ ETD L
Sbjct  7    PVLGYVVLYVKDVAESVAFYAKAFGYPVRRLDESHRWGELETGNTTIAFTPIHQHETDDL  66

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V  P S  ER  P+E+CF Y+D+DAA+K AVENGAV V+ PE K WGQ+VGYVRDID
Sbjct  67   TGAVHNPGSCRERP-PMEVCFVYSDVDAAYKHAVENGAVAVSEPELKEWGQKVGYVRDID  125

Query  328  GNVVRMGSHVNEPK  287
            GNVVRMGSHVN PK
Sbjct  126  GNVVRMGSHVNPPK  139



>gb|AFK38142.1| unknown [Lotus japonicus]
Length=136

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L  PAFAYTV+Y  DVA+S DFYAKAFGY+VRR + + +W ELESG+TTIAFTP+ 
Sbjct  1    MASNLN-PAFAYTVLYVKDVAQSVDFYAKAFGYSVRRLDDSHRWGELESGNTTIAFTPMI  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ET+ LTG V   QS  ER   +E+CF Y D+DAA+KRAVENGAV V+ PE K WGQ+V
Sbjct  60   QHETNDLTGAVHATQSPRERPQ-LEVCFVYHDVDAAYKRAVENGAVAVSEPELKEWGQKV  118

Query  349  GYVRDIDGNVVRMGSHV  299
            GYVRDIDGN +RMGSHV
Sbjct  119  GYVRDIDGNFIRMGSHV  135



>ref|XP_002465467.1| hypothetical protein SORBIDRAFT_01g039380 [Sorghum bicolor]
 gb|EER92465.1| hypothetical protein SORBIDRAFT_01g039380 [Sorghum bicolor]
Length=139

 Score =   184 bits (467),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS    P   Y ++Y +DV K+A FY  AFGY VRR + +RKWAELESG+TTIAFTP+H
Sbjct  1    MASGGLKPRLGYIIMYTSDVEKAASFYDAAFGYTVRRLDESRKWAELESGATTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD  +GEV+ P S    R  +E+CF Y D+DAA++RAVENGAVPV+ PE+K WGQ+ 
Sbjct  61   QRETDARSGEVQLPDSAAAERGALEVCFAYEDVDAAYRRAVENGAVPVSAPEEKPWGQKS  120

Query  349  GYVRDIDGNVVRMGSHVNE  293
            G+VRD+DGNVVR+ S+V E
Sbjct  121  GFVRDMDGNVVRIASYVRE  139



>gb|EYU17837.1| hypothetical protein MIMGU_mgv1a024458mg, partial [Erythranthe 
guttata]
Length=128

 Score =   182 bits (463),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 107/130 (82%), Gaps = 2/130 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+L  P +AYTVVY +DVAKS  FYAKAFGY+VRR + +R+W ELESG TTIAFTP  
Sbjct  1    MASNLN-PKYAYTVVYVSDVAKSVAFYAKAFGYHVRRLDDSRRWGELESGQTTIAFTPAK  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ET+ LTG+V+ P S  + R+ +E+CFDY+D+DAA+KRAVENGAV V+ PEDK WGQ+V
Sbjct  60   QHETEDLTGKVQIPHSDSQ-RNSVEVCFDYSDVDAAYKRAVENGAVGVSEPEDKEWGQKV  118

Query  349  GYVRDIDGNV  320
            GYVRDIDGNV
Sbjct  119  GYVRDIDGNV  128



>gb|KDO36426.1| hypothetical protein CISIN_1g045980mg, partial [Citrus sinensis]
Length=125

 Score =   181 bits (459),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 100/127 (79%), Gaps = 2/127 (2%)
 Frame = -3

Query  667  VYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEVETP  488
            +Y  DVAKS  FYAKAF Y VR  +H+ +W ELESG TTIAFT +HQ ETD LTG V+TP
Sbjct  1    IYVTDVAKSVAFYAKAFDYTVRTLDHSHRWGELESGQTTIAFTRLHQHETDELTGSVQTP  60

Query  487  QSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVVRMG  308
             S   +R PIE+CF YAD+DAA+KRAVENGAVPV+ PEDK WGQ+VGYVRDI+G VVRMG
Sbjct  61   SS--PQRQPIEVCFAYADVDAAYKRAVENGAVPVSEPEDKEWGQKVGYVRDINGIVVRMG  118

Query  307  SHVNEPK  287
            S+V   K
Sbjct  119  SYVQASK  125



>ref|XP_003574698.1| PREDICTED: uncharacterized protein LOC100831759 [Brachypodium 
distachyon]
Length=138

 Score =   181 bits (460),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS +  P     V+Y  DVAK+  FYA AFG+ VRR +H+RKWAE+E+GST +AFTPIH
Sbjct  1    MASGVVGPVLPNIVIYVEDVAKTTAFYAFAFGHTVRRLDHSRKWAEMETGSTILAFTPIH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q+ETD  TG+V   +   ER  P+E+CF+YAD+DAA++RAV+NGAV V+ PE K WGQ+V
Sbjct  61   QKETDPHTGKVRLLKGPHER-GPVEICFEYADVDAAYRRAVDNGAVAVSAPELKKWGQKV  119

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRD+DGNVVRMGSHV +
Sbjct  120  GYVRDLDGNVVRMGSHVRK  138



>ref|XP_010521827.1| PREDICTED: uncharacterized protein LOC104800652 [Tarenaya hassleriana]
Length=136

 Score =   179 bits (455),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 107/140 (76%), Gaps = 5/140 (4%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PAF YT+VY  DV KS DFYA+AFG+NVRR + + +W ELESG TTIAFT  H
Sbjct  1    MASNV-KPAFGYTIVYVEDVEKSVDFYARAFGHNVRRLDESHRWGELESGETTIAFTKKH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG V + + R     PIELCF Y D+DAAF RAV NGAV V+PPE+K WGQ+V
Sbjct  60   QHETDDLTGTVHSARDRP----PIELCFCYPDVDAAFTRAVSNGAVGVSPPEEKEWGQKV  115

Query  349  GYVRDIDGNVVRMGSHVNEP  290
            GYVRD+DG VVR+GS+V+ P
Sbjct  116  GYVRDLDGFVVRLGSYVHTP  135



>ref|XP_009419953.1| PREDICTED: uncharacterized protein LOC103999815 [Musa acuminata 
subsp. malaccensis]
Length=137

 Score =   176 bits (445),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 101/139 (73%), Gaps = 7/139 (5%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA  L  PAFAYT VY  D A+S  FY+ AFGY VRR     +W +LESG TTIAFTP+H
Sbjct  1    MARQL-VPAFAYTAVYVKDAARSVAFYSDAFGYKVRRLMRRHRWGKLESGQTTIAFTPLH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            QRETD  TG V TP   GE R P+E+CFDY D+DAA+KR     AVPV+PPE K WGQ+V
Sbjct  60   QRETDERTGAVRTPAREGE-RCPVEVCFDYPDVDAAYKR-----AVPVSPPEVKEWGQKV  113

Query  349  GYVRDIDGNVVRMGSHVNE  293
            GYVRD+DG VVRMGSHV +
Sbjct  114  GYVRDMDGIVVRMGSHVGD  132



>ref|XP_002984687.1| hypothetical protein SELMODRAFT_156754 [Selaginella moellendorffii]
 gb|EFJ14332.1| hypothetical protein SELMODRAFT_156754 [Selaginella moellendorffii]
Length=133

 Score =   169 bits (429),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 102/133 (77%), Gaps = 2/133 (2%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            P FAY  VYC DV KS DFY+KAFG  VRR ++ RKWAEL++GSTT+AFTP+ Q ET  +
Sbjct  3    PKFAYITVYCKDVTKSVDFYSKAFGLKVRRIDNARKWAELDTGSTTLAFTPLEQHET-AI  61

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V+T  S+ E RH +E+ F Y D+DAA++ AV  GAV V  PE+K WGQ+VGYVRDID
Sbjct  62   TGGVQTA-SKDEPRHNVEISFSYQDVDAAYEHAVRAGAVSVAKPEEKKWGQKVGYVRDID  120

Query  328  GNVVRMGSHVNEP  290
            G ++R+GS+V+EP
Sbjct  121  GVMIRLGSYVHEP  133



>ref|XP_004984744.1| PREDICTED: uncharacterized protein LOC101766089 [Setaria italica]
Length=140

 Score =   169 bits (429),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 112/141 (79%), Gaps = 3/141 (2%)
 Frame = -3

Query  709  MASSLGAP--AFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTP  536
            MAS   +P   +AYT+VY  DV K+A FYA AFGY VRR + + KWAELESG+TTIAFTP
Sbjct  1    MASGDASPDAKYAYTIVYVTDVEKAAAFYAAAFGYAVRRLDQSHKWAELESGATTIAFTP  60

Query  535  IHQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQ  356
            +HQRETDGL+G+V+ P +    R P+E+CF YAD+DAA++RAVE+GA PV+ PE K WGQ
Sbjct  61   LHQRETDGLSGQVQLPDATAA-RGPVEICFVYADVDAAYRRAVEHGATPVSAPEQKPWGQ  119

Query  355  RVGYVRDIDGNVVRMGSHVNE  293
            + G+VRD+DGNVVR+GSHV E
Sbjct  120  KSGFVRDMDGNVVRIGSHVRE  140



>ref|XP_002978774.1| hypothetical protein SELMODRAFT_177122 [Selaginella moellendorffii]
 gb|EFJ20221.1| hypothetical protein SELMODRAFT_177122 [Selaginella moellendorffii]
Length=135

 Score =   166 bits (420),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 100/133 (75%), Gaps = 2/133 (2%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            P  AY  +YC DV KS DFY+KAFG  VRR ++ RKWAELE+GSTT++FTP+ Q ET  +
Sbjct  5    PKLAYITIYCKDVTKSVDFYSKAFGLKVRRIDNTRKWAELETGSTTLSFTPLEQHET-AI  63

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V+T  S+ E RH +E+ F Y D+DAA++  V  GAV V  PE+K WGQ+VGYVRDID
Sbjct  64   TGGVQTA-SKDEPRHNVEISFSYQDVDAAYEHVVRAGAVSVAKPEEKKWGQKVGYVRDID  122

Query  328  GNVVRMGSHVNEP  290
            G ++R+GS+V+EP
Sbjct  123  GVMIRVGSYVHEP  135



>ref|XP_004294575.1| PREDICTED: uncharacterized protein LOC101293858 [Fragaria vesca 
subsp. vesca]
Length=129

 Score =   163 bits (412),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 102/142 (72%), Gaps = 14/142 (10%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MASSL  P +AYTVVY  DVAKS  FY+KAFGY VRR +      E  SG TTIAFTP H
Sbjct  1    MASSLN-PTYAYTVVYVKDVAKSIAFYSKAFGYAVRRID------ESHSGQTTIAFTPKH  53

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V+ P S GE R P+E+CFDY D+  A+KRAVENGAV V+ PE K WGQ+V
Sbjct  54   QHETDDLTGKVQKPSS-GEERQPVEVCFDYPDV--AYKRAVENGAVAVSAPEQKEWGQKV  110

Query  349  GYVRDIDGNVVRMGSHVNEPKR  284
            GYV       VRMGS+VNEPK+
Sbjct  111  GYVP----KQVRMGSYVNEPKQ  128



>gb|KEH30117.1| dessication-induced 1VOC superfamily protein [Medicago truncatula]
Length=128

 Score =   162 bits (411),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 100/141 (71%), Gaps = 15/141 (11%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS L +P FAYTV+Y  DVA+S  FY+KAFGY+VRR + + +W ELESG TTIAFTPIH
Sbjct  1    MASKL-SPEFAYTVLYVKDVAESVAFYSKAFGYSVRRLDESHRWGELESGHTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG V T +S  ER  P+E             RAVENGAVPV+ PE K WGQ+V
Sbjct  60   QHETDDLTGVVHTTRSNKERP-PVE-------------RAVENGAVPVSEPEMKEWGQKV  105

Query  349  GYVRDIDGNVVRMGSHVNEPK  287
            GYVRDIDG V+RMG+HV   K
Sbjct  106  GYVRDIDGIVIRMGNHVKPAK  126



>ref|XP_007132083.1| hypothetical protein PHAVU_011G065500g [Phaseolus vulgaris]
 gb|ESW04077.1| hypothetical protein PHAVU_011G065500g [Phaseolus vulgaris]
Length=126

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 91/134 (68%), Gaps = 14/134 (10%)
 Frame = -3

Query  688  PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGL  509
            P F Y VVY  DVA S  FY KAFGY+VRR + + +W ELE+G+TTIAFTPIHQ ETD L
Sbjct  7    PVFGYVVVYVKDVAASVAFYGKAFGYDVRRLDESHRWGELETGNTTIAFTPIHQHETDNL  66

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
            TG V    S GER  P+E             RAVENGAV V  PE K WGQ+VGYVRDID
Sbjct  67   TGAVHNSGSGGERP-PME-------------RAVENGAVAVREPEGKEWGQKVGYVRDID  112

Query  328  GNVVRMGSHVNEPK  287
            GNVVRMGSHV  PK
Sbjct  113  GNVVRMGSHVKPPK  126



>ref|XP_006424790.1| hypothetical protein CICLE_v10029580mg [Citrus clementina]
 ref|XP_006488291.1| PREDICTED: uncharacterized protein LOC102607194 [Citrus sinensis]
 gb|ESR38030.1| hypothetical protein CICLE_v10029580mg [Citrus clementina]
Length=126

 Score =   159 bits (401),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/117 (66%), Positives = 89/117 (76%), Gaps = 2/117 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA+S   P FAYTV+Y  DVAKS  FYAKAF Y VR  +H+ +W ELESG TT AFT +H
Sbjct  1    MAASNLCPVFAYTVIYVTDVAKSVAFYAKAFDYTVRTLDHSHRWGELESGQTTKAFTRLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWG  359
            Q ETD LTG V+TP S   +R PIE+CF YAD+DAA+KRAVENGAVPV+ PEDK WG
Sbjct  61   QHETDELTGSVQTPSS--PQRQPIEVCFAYADVDAAYKRAVENGAVPVSEPEDKEWG  115



>ref|XP_010501363.1| PREDICTED: uncharacterized protein LOC104778607 [Camelina sativa]
Length=137

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MA+++  PAFAY+VVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MAANMMRPAFAYSVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTIAFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDK  368
            Q ETD LTG+V+   S  ER  PIELCF Y D+DAAFKRAVENGAV     E K
Sbjct  61   QHETDDLTGKVQATHSARERA-PIELCFCYPDVDAAFKRAVENGAVAXFSNEQK  113



>gb|EEC74969.1| hypothetical protein OsI_10991 [Oryza sativa Indica Group]
Length=183

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 3/103 (3%)
 Frame = -3

Query  712  SMASSLGA--PAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFT  539
            S+ +S GA  PAFAYTVVY  DVAKSA FY+ AFGY VRR + + KWAELESG+TTIAFT
Sbjct  76   SVMASEGAVSPAFAYTVVYVKDVAKSAAFYSAAFGYTVRRLDQSHKWAELESGTTTIAFT  135

Query  538  PIHQRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRA  410
            P+HQRETD LTG V+ P S GER  P+E+CFDYAD+DAA++RA
Sbjct  136  PLHQRETDALTGAVQLPDSAGERG-PVEICFDYADVDAAYRRA  177



>gb|KFK22717.1| hypothetical protein AALP_AAs75063U000200 [Arabis alpina]
Length=128

 Score =   139 bits (351),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 89/121 (74%), Gaps = 2/121 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS++  PAFAYTVVY  DVAKS +FY++AFG+NVRR + + +W ELESG TTI FTP+H
Sbjct  1    MASNMMRPAFAYTVVYVKDVAKSVEFYSRAFGHNVRRLDESHRWGELESGQTTITFTPLH  60

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRV  350
            Q ETD LTG+V++  S  ER  PIE+CF Y D+DAAFKRAVE G    +  E +  GQ +
Sbjct  61   QHETDDLTGKVQSTHSSRERP-PIEVCFCYPDVDAAFKRAVEGGGERCSGSE-RAGGQGM  118

Query  349  G  347
            G
Sbjct  119  G  119



>emb|CAN74417.1| hypothetical protein VITISV_028914 [Vitis vinifera]
Length=146

 Score =   126 bits (316),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS+  +P FAY V+Y  DVAKS  FYAKAFG NVRR + + +W ELESG TTIAFTP+H
Sbjct  1    MASN-PSPVFAYVVLYVKDVAKSTAFYAKAFGCNVRRLDESHRWGELESGKTTIAFTPVH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFK  416
            QRETD +TG V+ P S G  R P+ELCF Y D+DAA+K
Sbjct  60   QRETDRITGAVQDPWS-GRERPPVELCFAYXDVDAAYK  96



>ref|XP_003606649.1| hypothetical protein MTR_4g063500 [Medicago truncatula]
Length=227

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/100 (63%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = -3

Query  709  MASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH  530
            MAS L +P FAYTV+Y  DVA+S  FY+KAFGY+VRR + + +W ELESG TTIAFTPIH
Sbjct  1    MASKL-SPEFAYTVLYVKDVAESVAFYSKAFGYSVRRLDESHRWGELESGHTTIAFTPIH  59

Query  529  QRETDGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRA  410
            Q ETD LTG V T +S  ER  P+E+CF Y D+DAA+KR 
Sbjct  60   QHETDDLTGVVHTTRSNKERP-PVEVCFVYTDVDAAYKRT  98


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = -3

Query  421  FKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVVRMGSHVNEPK  287
              RAVENGAVPV+ PE K WGQ+VGYVRDIDG V+RMG+HV   K
Sbjct  181  INRAVENGAVPVSEPEMKEWGQKVGYVRDIDGIVIRMGNHVKPAK  225



>ref|WP_011980905.1| glyoxalase [Sulfurovum sp. NBC37-1]
 ref|YP_001358529.1| hypothetical protein SUN_1218 [Sulfurovum sp. NBC37-1]
 dbj|BAF72172.1| conserved hypothetical protein [Sulfurovum sp. NBC37-1]
Length=130

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 79/128 (62%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT++Y + V ++ +FY+KAFG+ ++    ++ + EL +G TT+AF   H+     L G
Sbjct  3    YGYTIIYVSSVEETLEFYSKAFGFEIKFIHESKAYGELNTGETTLAFAS-HEMGNMNLGG  61

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            +        E    IEL F   ++ +AF +AVE+GA+P+  PE+K WGQ VGYVR +DG+
Sbjct  62   KYIKASVEAEP-FGIELAFVTENVASAFNKAVESGAIPIKEPEEKPWGQLVGYVRAVDGS  120

Query  322  VVRMGSHV  299
            V+ + S +
Sbjct  121  VIELCSPI  128



>ref|WP_015189426.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Gloeocapsa 
sp. PCC 7428]
 ref|YP_007128716.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Gloeocapsa 
sp. PCC 7428]
 gb|AFZ31556.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Gloeocapsa 
sp. PCC 7428]
Length=128

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 78/129 (60%), Gaps = 5/129 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEH-NRKWAELESGSTTIAFTPIHQRETDGLT  506
            F YT+ Y  DV+ +  FY +AFG + RRF H + ++AE+E+GST +AF      +++GLT
Sbjct  3    FGYTIFYVPDVSAAVSFYEQAFGLS-RRFVHESSQYAEMETGSTILAFASEEMAKSNGLT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                TP         +E+ F    ++ AF +A++ GAV V P E K WGQ VGYVRD++G
Sbjct  62   ---ITPHRLENNAAAVEVAFITETIEEAFNQAIKAGAVAVKPIEVKPWGQTVGYVRDLNG  118

Query  325  NVVRMGSHV  299
             VV + + V
Sbjct  119  VVVELCTPV  127



>dbj|BAJ95575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=113

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 49/57 (86%), Gaps = 0/57 (0%)
 Frame = -3

Query  463  PIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVVRMGSHVNE  293
            P+E+CFDY D+DAA++RAVE GAVPV+ PE K WGQ+VGYVRD+DG  VR+GSHV E
Sbjct  57   PVEICFDYDDVDAAYRRAVEKGAVPVSAPEQKNWGQKVGYVRDVDGITVRLGSHVRE  113



>ref|WP_024336519.1| glyoxalase [Desulfotignum balticum]
Length=130

 Score = 95.1 bits (235),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 77/124 (62%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT+VY + V ++ +FY +AFG++V+    ++ + EL++G T +AF   H+     L G
Sbjct  3    YGYTIVYVSSVVETLEFYHRAFGFDVKFVHESKAYGELDTGETILAFAS-HEMGDMNLGG  61

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            +  T  +  +    IEL F   D+ AA+++AV  GA+P+  PE+K WGQ VGYVR  +G+
Sbjct  62   KY-TKSNINDTPLGIELAFVTEDVSAAYEKAVSAGALPIKEPEEKPWGQVVGYVRSAEGS  120

Query  322  VVRM  311
            ++ +
Sbjct  121  IIEL  124



>ref|WP_027834487.1| glyoxalase [Maritalea myrionectae]
Length=129

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 71/128 (55%), Gaps = 3/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  +V ++  FY KAFG   R    +  +AE+E+G T + F      E   L  
Sbjct  3    FGYTIIYVENVLETVAFYEKAFGLPRRFIHESNLYAEMETGDTALTFAGEEAAEMSNLAI  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP  + +     E+C    D+  A+  AVENGA+P++PPE+K W Q V YV+D++G 
Sbjct  63   ---TPNRKDKLSAGWEICLVCEDVHKAYAHAVENGALPLSPPEEKPWNQTVSYVKDLNGC  119

Query  322  VVRMGSHV  299
            +V + S V
Sbjct  120  LVEIASPV  127



>ref|WP_002631628.1| Lactoylglutathione lyase [Cystobacter fuscus]
 gb|EPX58150.1| Lactoylglutathione lyase [Cystobacter fuscus DSM 2262]
Length=129

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 71/124 (57%), Gaps = 3/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y ++Y  +V  + DFY KAFG   R    + ++AELE+G+T +AF      + +GLT 
Sbjct  3    LGYVILYVANVPATVDFYEKAFGLQRRFLHESGQYAELETGATALAFASEEMAKNNGLTV  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P+   E    +E+     D++AA++RAV+ GA    PP+ K WGQ V YVRD+DG 
Sbjct  63   RFNRPK---EDAAAVEVALVTPDVEAAYERAVKAGARAAQPPKQKPWGQTVAYVRDLDGV  119

Query  322  VVRM  311
            +V +
Sbjct  120  LVEL  123



>gb|KFA93576.1| glyoxalase [Cystobacter violaceus Cb vi76]
Length=129

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 76/130 (58%), Gaps = 5/130 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
              Y ++Y  +V  + DFY KAFG   RRF H   ++AE+E+G+T +AF      + +GLT
Sbjct  3    LGYVILYVANVPATVDFYEKAFGLQ-RRFLHESGQYAEMETGATALAFAAEEMAKDNGLT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P+   E    +E+    +D+ AA++RAV+ GA    PP+ K WGQ V YVRD+DG
Sbjct  62   VRFNRPK---EDAAAVEVALVTSDVKAAYERAVKAGAGAAQPPKQKPWGQTVAYVRDLDG  118

Query  325  NVVRMGSHVN  296
             +V + + ++
Sbjct  119  VLVELCTPIS  128



>ref|WP_028535658.1| glyoxalase [Paludibacterium yongneupense]
Length=130

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 72/126 (57%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y N VA +  FY KAFG+  R    + ++ EL++G+T +AF  +   E +   G
Sbjct  3    FGYTIIYVNSVADALVFYEKAFGFKSRFLHESGEYGELDTGATALAFASLGLAEAN--FG  60

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            E   P +       IEL F   D+ AA++ A++ GA P+  P +K WGQ V YVR I+G 
Sbjct  61   EAYLPVNAEAAAPGIELAFVTDDVPAAYQNAIDCGASPIRGPVEKPWGQIVAYVRSIEGT  120

Query  322  VVRMGS  305
            ++ + S
Sbjct  121  LIELCS  126



>ref|WP_008233831.1| glyoxalase [Roseobacter sp. CCS2]
 gb|EBA12598.1| glyoxalase family protein [Roseobacter sp. CCS2]
Length=131

 Score = 92.8 bits (229),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 69/130 (53%), Gaps = 3/130 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DV ++  FY  AFG + R    +  +AE+E+G T +AF      E +GL  
Sbjct  3    LGYTIIYVADVPETVAFYEAAFGLSQRFIHDSNLYAEMETGETILAFAGNEAAEMNGLAI  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P          E+CF   D+ AA+ RAV +G  PV+ P  K WGQ V YVRD++G 
Sbjct  63   LPNDPTGPAAGW---EVCFVTGDVSAAYTRAVSHGCSPVSAPSQKPWGQTVSYVRDLNGC  119

Query  322  VVRMGSHVNE  293
            +V + S + +
Sbjct  120  IVEIASPIAQ  129



>ref|WP_011550629.1| glyoxalase [Myxococcus xanthus]
 ref|YP_628766.1| glyoxalase [Myxococcus xanthus DK 1622]
 gb|ABF89756.1| glyoxalase family protein [Myxococcus xanthus DK 1622]
Length=129

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 72/131 (55%), Gaps = 5/131 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRK-WAELESGSTTIAFTPIHQRETDGLT  506
              Y ++Y  DV+ +  FY KAFG   RRF H    +AE+E+G+T +AF      +  G T
Sbjct  3    LGYIILYVPDVSATIAFYEKAFGL-ARRFIHESGGYAEMETGTTALAFVEEGAAKEHGFT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P+   E    IEL    AD+ AA+ RAVE GA    PP+ K WGQ V YVRD++G
Sbjct  62   VRHLRPK---EEAAAIELALVTADVAAAYTRAVEAGAEATQPPKQKPWGQTVAYVRDLNG  118

Query  325  NVVRMGSHVNE  293
             +V + S + E
Sbjct  119  VLVELCSPMKE  129



>ref|WP_015346030.1| glyoxalase [Myxococcus stipitatus]
 ref|YP_007357451.1| glyoxalase [Myxococcus stipitatus DSM 14675]
 gb|AGC41767.1| glyoxalase [Myxococcus stipitatus DSM 14675]
Length=129

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 3/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y + Y  DV  +  FY  AFG   R    +  + E+E+G+T +AF       ++GLT 
Sbjct  3    LGYVIFYVADVPATLAFYETAFGLKRRFLHESNSYGEVETGTTALAFASEDMAGSNGLTV  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P   GE    +EL     D+ AAF+ AV++GA+ V PP+ K WGQ V YV+D++G 
Sbjct  63   RFHRP---GETPSAVELGLVTPDVPAAFQHAVKSGAISVQPPKQKPWGQTVAYVKDLNGV  119

Query  322  VVRMGS  305
            +V + S
Sbjct  120  LVELCS  125



>ref|WP_018342223.1| hypothetical protein [Cytophaga aurantiaca]
Length=130

 Score = 90.9 bits (224),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 72/124 (58%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y  DV K+  FY  AFG+  R    +  + E+ +G TT++F  I   +T+   G
Sbjct  4    FAYTILYVQDVVKTIQFYTSAFGFEQRFIAPDNSYGEIVTGDTTLSFAAISLAKTNLKDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  SR ++   IE+ F   +++A  + AV+ GA  +  P+ K WGQ V YVRD DG 
Sbjct  64   FIES--SRTQKPFAIEIGFTTDNVEATIESAVDAGATLIEKPKTKPWGQVVAYVRDPDGF  121

Query  322  VVRM  311
            ++ +
Sbjct  122  LIEI  125



>ref|WP_036140734.1| glyoxalase [Luteibacter sp. 9135]
Length=129

 Score = 90.9 bits (224),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 50/127 (39%), Positives = 71/127 (56%), Gaps = 5/127 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRK-WAELESGSTTIAFTPIHQRETDGLT  506
              YT++Y  DVA + +FY +AFG   RRF H    +AE+ +G TT++F      E +G+ 
Sbjct  3    LGYTIIYVPDVAATVEFYERAFGLQ-RRFVHESGLYAEMATGETTLSFAGESMAELNGVA  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P SR E     E+C      +  + +AVE GA+ +   E K WGQRVGYVRDI+G
Sbjct  62   IR---PNSRSELCAGFEICLVTEAPEQGYSQAVEAGALALKAVEAKPWGQRVGYVRDING  118

Query  325  NVVRMGS  305
             +V + S
Sbjct  119  CLVEICS  125



>ref|WP_029413028.1| glyoxalase [Acidovorax radicis]
Length=130

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 72/132 (55%), Gaps = 7/132 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
            F YT++Y  DV K+  FY +AFG+  RRF H    + EL++G+T++AF  +      G  
Sbjct  3    FGYTILYVEDVPKTIAFYEQAFGF-ARRFLHEAGDFGELDTGATSLAFASLRLMVELG--  59

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
               + PQ         E+ F  AD+ AA +RAV+ GA  V  PE   WGQ V YV D++G
Sbjct  60   ---KNPQRASADAPSFEIAFTTADVAAALQRAVDAGARLVQAPEQMPWGQTVAYVADLNG  116

Query  325  NVVRMGSHVNEP  290
             +V + + +  P
Sbjct  117  ALVELCTPMGAP  128



>ref|WP_008904821.1| glyoxalase [Acidovorax sp. NO-1]
 gb|EHL22820.1| hypothetical protein KYG_10655 [Acidovorax sp. NO-1]
Length=130

 Score = 89.4 bits (220),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/132 (39%), Positives = 70/132 (53%), Gaps = 7/132 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
            F YT++Y  DV K+  FY  AFGY  RRF H    + EL++G+T +AF+ +      G  
Sbjct  3    FGYTILYVEDVPKTIAFYEAAFGY-ARRFVHEAGDFGELDTGATALAFSSLRLMSELG--  59

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
               + PQ         E+ F  AD+ AA +RAV+ G   V  PE   WGQ V YV DI+G
Sbjct  60   ---KNPQRASADAPSFEIAFTTADVAAAVQRAVDAGGRLVQAPEQMPWGQTVAYVADING  116

Query  325  NVVRMGSHVNEP  290
             +V + + V  P
Sbjct  117  ALVELCTPVAPP  128



>ref|WP_015466791.1| Lactoylglutathione lyase [Micavibrio aeruginosavorus]
 ref|YP_007641854.1| Lactoylglutathione lyase [Micavibrio aeruginosavorus EPB]
 gb|AGH97234.1| Lactoylglutathione lyase [Micavibrio aeruginosavorus EPB]
Length=128

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 68/128 (53%), Gaps = 3/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV K+  FY  AFG  +R    + ++ ELE+G+T +AF        +G+  
Sbjct  3    FGYTIIYVPDVQKAISFYESAFGLKLRFLHDSNQYGELETGATALAFASEDMHTINGIEA  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +  P ++      IE+     D+  A   AV +GA  +  P+ K WGQ V YVRD++G 
Sbjct  63   TLNRPSNKAAG---IEIALVTEDVVTAHAHAVASGATEITKPDQKPWGQTVSYVRDLNGV  119

Query  322  VVRMGSHV  299
            +V + S +
Sbjct  120  LVEICSPI  127



>ref|WP_013901462.1| glyoxalase [Ramlibacter tataouinensis]
 ref|YP_004619249.1| hypothetical protein Rta_21340 [Ramlibacter tataouinensis TTB310]
 gb|AEG93230.1| Conserved hypothetical protein [Ramlibacter tataouinensis TTB310]
Length=136

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 71/132 (54%), Gaps = 7/132 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
            FAYT+VY  DVA++  FY  AFG   RRF H    +AELE+G+T +AF+        G  
Sbjct  3    FAYTIVYVEDVARTLAFYEAAFGL-ARRFLHESGDYAELETGATALAFSSRRLMRELG--  59

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
               + PQ         E+ F  AD+ AA +RAV  GA  V PP    WGQ + YV D++G
Sbjct  60   ---KNPQPADAAAPVFEVAFTCADVPAAVQRAVGAGARLVKPPTPMPWGQTLAYVADLNG  116

Query  325  NVVRMGSHVNEP  290
             +V + + V  P
Sbjct  117  VLVELCTPVAPP  128



>ref|WP_034799542.1| glyoxalase [Ensifer adhaerens]
 gb|KDP72866.1| glyoxalase [Ensifer adhaerens]
Length=131

 Score = 87.8 bits (216),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 72/131 (55%), Gaps = 13/131 (10%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRK-WAELESGSTTIAFTPIHQRETDGLT  506
            F YT++Y  DV  +  FY  AFG   RRF H    +AE+E+G T +AF      E +GL 
Sbjct  5    FGYTILYVPDVPATVSFYEAAFGLK-RRFVHESSLYAEMETGVTALAFASETMAELNGLA  63

Query  505  GEVETPQSRGERRHPIELCFDYADLDAA----FKRAVENGAVPVNPPEDKTWGQRVGYVR  338
                    R  RR  +   F+ A + +A    +++AV  GA PV PPE+K  GQ VGYVR
Sbjct  64   -------VRANRRSDLAAGFEIALVCSAPHEAYEKAVSAGASPVKPPEEKPSGQVVGYVR  116

Query  337  DIDGNVVRMGS  305
            D++G +V + S
Sbjct  117  DLNGCLVELCS  127



>ref|WP_027419605.1| glyoxalase [Crocinitomix catalasitica]
Length=131

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 8/132 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETD---G  512
            FAYT++Y  DV K+  FY  AFG+  +     + +AEL +G TTI+F  I   +++   G
Sbjct  4    FAYTILYVEDVEKTLSFYENAFGFKRKMLTPEKDYAELNTGETTISFASIELGKSNFSKG  63

Query  511  LTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
                V T     E+   +EL F    ++  F++A+  GA+     + K WGQ+VGYV+DI
Sbjct  64   FQKSVIT-----EKPFGVELAFTTEQIEIDFEKALNAGAIEFESIKQKPWGQKVGYVQDI  118

Query  331  DGNVVRMGSHVN  296
            +G ++ + + ++
Sbjct  119  NGFLIEICTPIS  130



>ref|WP_014331858.1| glyoxalase [Sinorhizobium fredii]
 ref|YP_005192344.1| putative glyoxalase/bleomycin resistance protein/dioxygenase 
[Sinorhizobium fredii HH103]
 emb|CCF00205.1| putative glyoxalase/bleomycin resistance protein/dioxygenase 
[Sinorhizobium fredii HH103]
Length=131

 Score = 87.0 bits (214),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 13/135 (10%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEH-NRKWAELESGSTTIAFTPIHQRETDGLT  506
            F Y+++Y  DV  +  FY  AFG   R+F H +  +AE+E+GST +AF      + +GL 
Sbjct  5    FGYSILYVPDVVATVSFYETAFGLK-RKFIHESNLYAEMETGSTILAFAGEAMADLNGLA  63

Query  505  GEVETPQSRGERRHPIELCFDYADLDAA----FKRAVENGAVPVNPPEDKTWGQRVGYVR  338
                    R  R+  +   F+ A + +A    + +AV  GA PV PPE K WGQ V YVR
Sbjct  64   -------IRANRKADLAAGFEIALVCSAPLEAYDKAVSAGAAPVKPPESKPWGQVVAYVR  116

Query  337  DIDGNVVRMGSHVNE  293
            D++G +V + S + E
Sbjct  117  DLNGCLVELCSAMPE  131



>ref|WP_017455571.1| MULTISPECIES: hypothetical protein [Herbaspirillum]
Length=130

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 71/130 (55%), Gaps = 4/130 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y + VA    FY KAFG+  +    + ++ EL++G T +AF  +   E +   G
Sbjct  3    FGYTIIYVDSVADVLTFYEKAFGFKSKFLHESGEYGELDTGFTALAFASLGLAEANLGRG  62

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +       E   P IEL F   D+  A++ A++ GA+PV  P +K WGQ V YVR I+G
Sbjct  63   YLAI---SAETAPPGIELAFVTEDVQLAYQNAIDCGAIPVRGPIEKPWGQVVAYVRSIEG  119

Query  325  NVVRMGSHVN  296
             ++ + S + 
Sbjct  120  TLIELCSPIE  129



>ref|WP_037453323.1| glyoxalase [Sinorhizobium fredii]
Length=129

 Score = 87.0 bits (214),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/135 (37%), Positives = 74/135 (55%), Gaps = 13/135 (10%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEH-NRKWAELESGSTTIAFTPIHQRETDGLT  506
            F Y+++Y  DV  +  FY  AFG   R+F H +  +AE+E+GST +AF      + +GL 
Sbjct  3    FGYSILYVPDVVATVSFYETAFGLK-RKFIHESNLYAEMETGSTILAFAGEAMADLNGLA  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAA----FKRAVENGAVPVNPPEDKTWGQRVGYVR  338
                    R  R+  +   F+ A + +A    + +AV  GA PV PPE K WGQ V YVR
Sbjct  62   -------IRANRKADLAAGFEIALVCSAPLEAYDKAVSAGAAPVKPPESKPWGQVVAYVR  114

Query  337  DIDGNVVRMGSHVNE  293
            D++G +V + S + E
Sbjct  115  DLNGCLVELCSAMPE  129



>ref|WP_039596750.1| glyoxalase [Ralstonia sp. A12]
 gb|KHK57961.1| glyoxalase [Ralstonia sp. A12]
Length=129

 Score = 86.7 bits (213),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 68/129 (53%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+VY  DV  S  F+  AFG+  R       + ELE+G+TT+AF      E+    G
Sbjct  3    FGYTIVYVPDVPASLAFFEAAFGFERRFLAETNDYGELETGATTLAFAARELAESHSPAG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   QS  ++   IEL F   D++AA + A+  GA  +  P+ K WGQ V YVR  DG 
Sbjct  63   FVYASQS--DKPLGIELAFITPDVEAAHRHAIATGATEIAVPQIKPWGQTVSYVRCPDGT  120

Query  322  VVRMGSHVN  296
            +V + + + 
Sbjct  121  LVELCTPIG  129



>ref|WP_019094154.1| glyoxalase [Pseudomonas fluorescens]
Length=130

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  +V  S  F+ +AFG+  R    +  + ELE+GSTT+AF      E +   G
Sbjct  3    FGYTIIYVPEVEGSLRFFEQAFGFKRRFLHESGTYGELETGSTTLAFADHDLAEMNFPAG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S   R   +EL    AD+ AA  RA+E+GA  + PP  K WGQ V YVR  DG 
Sbjct  63   HVAAHSS--PRPLGMELGLVTADVQAAHARALEHGARELAPPTSKPWGQTVSYVRCPDGT  120

Query  322  VVRMGSHV  299
            +V + + V
Sbjct  121  LVELCTPV  128



>ref|WP_011061699.1| glyoxalase [Pseudomonas protegens]
 ref|YP_260522.1| glyoxalase [Pseudomonas protegens Pf-5]
 ref|YP_008000722.1| glyoxalase family protein superfamily [Pseudomonas protegens 
CHA0]
 gb|AAY92686.1| glyoxalase family protein [Pseudomonas protegens Pf-5]
 gb|AGL85218.1| glyoxalase family protein superfamily [Pseudomonas protegens 
CHA0]
 dbj|BAO62788.1| glyoxalase [Pseudomonas protegens Cab57]
Length=130

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 71/131 (54%), Gaps = 8/131 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  +V  S  F+ +AFG+  R    +  + ELE+GSTT+AF      E +   G
Sbjct  3    FGYTIIYVPEVEGSLRFFEQAFGFKRRFLHESGTYGELETGSTTLAFADHDLAEMNFPAG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +P+  G     +EL    AD+ AA  RA+E+GA  + PP  K WGQ V YVR  
Sbjct  63   HVAAHSSPKPLG-----MELGLVTADVQAAHARALEHGARELAPPTSKPWGQTVSYVRCP  117

Query  331  DGNVVRMGSHV  299
            DG +V + + V
Sbjct  118  DGTLVELCTPV  128



>ref|WP_013564887.1| glyoxalase/bleomycin resistance protein/dioxygenase [Isosphaera 
pallida]
 ref|YP_004179148.1| glyoxalase/bleomycin resistance protein/dioxygenase [Isosphaera 
pallida ATCC 43644]
 gb|ADV62599.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Isosphaera 
pallida ATCC 43644]
Length=151

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 4/143 (3%)
 Frame = -3

Query  712  SMASSLGAPAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPI  533
            S A+    P   Y +VY NDV ++  FY KAFG   R    + ++ ELE+G T + F   
Sbjct  10   SNAAEFTPPRLGYVIVYVNDVPEALRFYGKAFGLPTRFLHESNQYGELETGGTALTFAS-  68

Query  532  HQRETDGLTGEVE---TPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTW  362
            H      L   +     P     R   +EL    AD+  A++RA+ +G + V  P  K W
Sbjct  69   HALGAANLAVSLPEGYQPVEPAGRPFGLELSLTVADVPLAYQRALTHGGIGVTEPTIKPW  128

Query  361  GQRVGYVRDIDGNVVRMGSHVNE  293
            GQ V  VRD  G +V +G+ +NE
Sbjct  129  GQTVAVVRDPFGLLVEIGTAINE  151



>ref|WP_013924921.1| glyoxalase [Parachlamydia acanthamoebae]
 ref|YP_004652201.1| hypothetical protein PUV_13970 [Parachlamydia acanthamoebae UV-7]
 emb|CCB86347.1| uncharacterized protein ysfE [Parachlamydia acanthamoebae UV-7]
Length=128

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 67/129 (52%), Gaps = 4/129 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y ++Y  DV+ +  FY KAFG  +R    + ++AE+E+G TT+AF      E   +  
Sbjct  3    LGYIIIYVLDVSATISFYEKAFGLKLRFMHESNQYAEMETGQTTLAFA----NENFAMAS  58

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P  + E+    E+ F    ++  FK AV  GAV V  P  K WGQ V YVRD +G 
Sbjct  59   LQFRPNRQKEQAAGAEIAFVVESVEEKFKHAVNFGAVEVAKPVQKPWGQIVSYVRDNNGF  118

Query  322  VVRMGSHVN  296
            +V + S +N
Sbjct  119  LVELCSAIN  127



>gb|KHN21970.1| hypothetical protein glysoja_008882 [Glycine soja]
Length=57

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = -3

Query  448  FDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVVRMGSHVNEPK  287
            F Y+D+DAA+K AVENGAV V+ PE K W Q+VGYVRDIDGNVVRMGSHVN P+
Sbjct  4    FVYSDVDAAYKCAVENGAVAVSEPELKEWEQKVGYVRDIDGNVVRMGSHVNPPR  57



>ref|WP_015807594.1| glyoxalase [Pedobacter heparinus]
 ref|YP_003092042.1| glyoxalase/bleomycin resistance protein/dioxygenase [Pedobacter 
heparinus DSM 2366]
 gb|ACU03980.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Pedobacter 
heparinus DSM 2366]
Length=131

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 78/133 (59%), Gaps = 8/133 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+ Y  DV K+ +FY +AFG+         ++ +L++GST ++F+ I     D +TG
Sbjct  4    FAYTIFYVQDVVKTIEFYERAFGFRRTFIADTAEFGQLDTGSTALSFSSI-----DLITG  58

Query  502  EVETPQSRGE-RRHPI--ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
            E+     + +  + P+  E+ F   +++ A++ A++ GA  V  P  K WGQ VGY+RDI
Sbjct  59   EITDGFIKSDISKKPLGMEVAFSTENVEQAYQAALDAGATKVAAPSVKPWGQTVGYLRDI  118

Query  331  DGNVVRMGSHVNE  293
            +G ++ + + + +
Sbjct  119  NGFLIELCTPITD  131



>ref|WP_029284335.1| glyoxalase [Pedobacter sp. R20-19]
Length=130

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F+YT++Y  +V++S +FY KAFG+  +       + EL SG TTI+F  + Q  +  L+ 
Sbjct  4    FSYTILYVENVSESIEFYEKAFGFKRKFITPENNYGELISGDTTISFADL-QLASSNLSN  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              +    +GE    IEL F   +++  F  AV+ GA+P+   + K WGQ V YV+DI+G 
Sbjct  63   GFKV-SVKGETPFGIELGFTTENVELVFNHAVKMGALPLEKIKVKPWGQAVAYVQDINGF  121

Query  322  VVRMGS  305
            ++ + S
Sbjct  122  LIEICS  127



>gb|KIA77935.1| Uncharacterized protein ysfE [Parachlamydia acanthamoebae]
Length=143

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = -3

Query  676  YTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEV  497
            Y ++Y  DV+ +  FY KAFG  +R    + ++AE+E+G TT+AF      E   +    
Sbjct  20   YIIIYVLDVSATISFYEKAFGLKLRFMHESNQYAEMETGQTTLAFA----NENFAMASLQ  75

Query  496  ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVV  317
              P  + E+    E+ F    ++  FK AV  GAV V  P  K WGQ V YVRD +G +V
Sbjct  76   FRPNRQKEQAAGAEIAFVVESVEEKFKHAVNFGAVEVAKPVQKPWGQIVSYVRDNNGFLV  135

Query  316  RMGSHVN  296
             + S +N
Sbjct  136  ELCSAIN  142



>ref|WP_011811577.1| glyoxalase [Verminephrobacter eiseniae]
 ref|YP_998608.1| glyoxalase/bleomycin resistance protein/dioxygenase [Verminephrobacter 
eiseniae EF01-2]
 gb|ABM59590.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Verminephrobacter 
eiseniae EF01-2]
Length=129

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 72/129 (56%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT+VY  DVA S  F+ KAFG+  R       + ELE+G TTI+F      E++   G
Sbjct  3    YGYTIVYVPDVAVSLAFFEKAFGFERRFMTEEGDYGELETGGTTISFASHKLAESNSKQG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   Q+  E+   +EL F   D++ A   A+E GA+ +  P+ K WGQ V Y+R  DG+
Sbjct  63   FVYCSQT--EQPLGVELAFITDDVEKAHATALEAGAIEIAAPKRKPWGQSVSYLRCPDGS  120

Query  322  VVRMGSHVN  296
            +V + + ++
Sbjct  121  LVELCTALS  129



>ref|WP_014429302.1| glyoxalase [Rubrivivax gelatinosus]
 ref|YP_005437940.1| glyoxalase/bleomycin resistance protein/dioxygenase [Rubrivivax 
gelatinosus IL144]
 dbj|BAL96441.1| glyoxalase/bleomycin resistance protein/dioxygenase [Rubrivivax 
gelatinosus IL144]
Length=132

 Score = 85.5 bits (210),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 70/130 (54%), Gaps = 7/130 (5%)
 Frame = -3

Query  685  AFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLT  506
            AFAYT++Y +DVA+S  FY  AFG   R       + EL++G TT+AF+      +  L 
Sbjct  2    AFAYTILYVDDVARSLAFYGAAFGLAQRFLHEGGDYGELDTGGTTLAFS------SRRLL  55

Query  505  GEVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
             E+     R +   P  E+   + D+ AA +RAVE GA P+  P    WGQ V YV D +
Sbjct  56   REIGHHPQRADADAPCFEIALTFDDVPAAMRRAVEAGARPMQEPRQMPWGQTVAYVADPE  115

Query  328  GNVVRMGSHV  299
            G ++ + + +
Sbjct  116  GVLIELCTPI  125



>ref|WP_006340789.1| glyoxalase [Parachlamydia acanthamoebae]
 gb|EFB41765.1| hypothetical protein pah_c022o040 [Parachlamydia acanthamoebae 
str. Hall's coccus]
Length=128

 Score = 85.1 bits (209),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 67/129 (52%), Gaps = 4/129 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y ++Y  DV+ +  FY KAFG  +R    + ++AE+E+G TT+AF      E   +  
Sbjct  3    LGYIIIYVLDVSATISFYEKAFGLKLRFMHESNQYAEMETGQTTLAFA----NENFAMAS  58

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P  + E+    E+ F    ++  FK AV  GAV V  P  K WGQ V YVRD +G 
Sbjct  59   LQFRPNRQKEQPAGAEIAFVVESVEEKFKHAVNFGAVEVAKPVQKPWGQIVSYVRDNNGF  118

Query  322  VVRMGSHVN  296
            +V + S +N
Sbjct  119  LVELCSAIN  127



>ref|WP_011550522.1| glyoxalase [Myxococcus xanthus]
 ref|YP_628658.1| glyoxylase [Myxococcus xanthus DK 1622]
 gb|ABF90142.1| glyoxylase family protein [Myxococcus xanthus DK 1622]
Length=129

 Score = 85.1 bits (209),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 68/127 (54%), Gaps = 5/127 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRK-WAELESGSTTIAFTPIHQRETDGLT  506
              Y ++Y  DV+ +  FY KAFG   RRF H    +AE+E+G+T +AF      +  G T
Sbjct  3    LGYIILYVPDVSAAIVFYEKAFGL-ARRFIHESGGYAEMETGTTALAFVEEGAAKEHGFT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P+   E    IEL     D+  A+ RAVE GA    PP+ K WGQ V YVRDI+G
Sbjct  62   VRHLRPK---EDAAAIELALVTPDVATAYTRAVEAGAEATQPPKQKPWGQTVAYVRDING  118

Query  325  NVVRMGS  305
             +V + S
Sbjct  119  VLVELCS  125



>ref|WP_020471573.1| hypothetical protein [Zavarzinella formosa]
Length=126

 Score = 84.7 bits (208),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 44/126 (35%), Positives = 67/126 (53%), Gaps = 4/126 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y +DV K+  FY   FG   RRF H   + E+++G T + F  +    ++G++ 
Sbjct  3    FGYAILYVDDVEKTVAFYESTFGLK-RRFVHESGYGEMDTGDTKLGFASVELARSNGVSF  61

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P+        +E+ F   D+  AF  AV  GA PV  P+ K WGQ V YVRD++G 
Sbjct  62   VPANPEGPSPA---VEVAFVTDDVKKAFDAAVNAGAFPVAKPKQKPWGQTVAYVRDLNGF  118

Query  322  VVRMGS  305
            +V + S
Sbjct  119  LVEICS  124



>ref|WP_020294673.1| glyoxalase family protein superfamily [Pseudomonas sp. CF161]
 gb|EPL15998.1| glyoxalase family protein superfamily [Pseudomonas sp. CF161]
Length=130

 Score = 85.1 bits (209),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 71/132 (54%), Gaps = 8/132 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+VY  DVA S  F+ +AFG++ R    +  + ELESG+TT+AF        +  +G
Sbjct  3    FGYTIVYVPDVAASLTFFEQAFGFSRRFLHESGTYGELESGATTLAFAAHELAAMNFASG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +PQ  G     IEL     D+ AA  +A+  GA  ++ P  K WGQ V Y+R  
Sbjct  63   HVAAHSSPQPLG-----IELGLVTDDVPAAHAKALAQGASELSAPSAKPWGQTVSYLRCP  117

Query  331  DGNVVRMGSHVN  296
            DG +V + + ++
Sbjct  118  DGTLVELCTPIH  129



>ref|WP_026996455.1| glyoxalase [Flectobacillus major]
Length=130

 Score = 84.7 bits (208),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 70/124 (56%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y +DV KS  FY KAF ++++    +  +AEL +G TT++F   H+        
Sbjct  4    FAYTILYVSDVEKSVAFYEKAFQFSLKFISPDSTYAELITGETTLSFA--HKELASSNLP  61

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            E     S   +   IE+ F   +++   ++A++ G + V  P+ K WGQ V YVRD++G 
Sbjct  62   EGFQESSLSTKPFAIEIGFATENVENLLEQAIQAGGILVAAPKQKPWGQTVAYVRDLEGF  121

Query  322  VVRM  311
            ++ +
Sbjct  122  LIEL  125



>ref|WP_010104240.1| glyoxalase [Verminephrobacter aporrectodeae]
Length=129

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 66/124 (53%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+VY  DVA S  F+ KAFG+  R     R + ELE+G T ++F      E+    G
Sbjct  3    FGYTIVYVPDVAASLAFFEKAFGFKQRFMTEQRDYGELETGGTILSFASHELAESHSKQG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   Q+  E+   +EL F   D+  A   A++ GAV +  P  K WGQ V Y+R  DG+
Sbjct  63   FVYCSQT--EKPLGVELAFVTDDVQQAHATALKAGAVEIAAPMLKPWGQTVSYLRCPDGS  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_012374195.1| glyoxalase/bleomycin resistance protein/dioxygenase [Opitutus 
terrae]
 ref|YP_001818257.1| glyoxalase/bleomycin resistance protein/dioxygenase [Opitutus 
terrae PB90-1]
 gb|ACB74657.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Opitutus 
terrae PB90-1]
Length=169

 Score = 85.5 bits (210),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 17/140 (12%)
 Frame = -3

Query  691  APAFAYTVVYCNDVAKSADFYAKAFGYNVRRFEHN---RKWAELESGSTTIAFTPIHQRE  521
            APA  Y ++Y NDV+ +  FY +AFG   RRF +N   +++ E+E+G+  +AF      E
Sbjct  37   APALGYVILYVNDVSATLAFYEEAFGLT-RRFYNNDAGKEYGEMETGAARLAFYSRALVE  95

Query  520  TD-GLTGEV-----ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWG  359
             D  L G V     + PQ         E+    AD+ A F+RAV+ GAV +  PE K WG
Sbjct  96   ADPALKGAVIARADQPPQG-------FEIALLTADVPALFERAVKAGAVALAKPETKPWG  148

Query  358  QRVGYVRDIDGNVVRMGSHV  299
            Q V +VR  DG+V+ + + +
Sbjct  149  QTVAWVRSKDGHVIELATPM  168



>ref|WP_013687656.1| glyoxalase [Fluviicola taffensis]
 ref|YP_004345725.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Fluviicola 
taffensis DSM 16823]
 gb|AEA44887.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Fluviicola 
taffensis DSM 16823]
Length=130

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 75/128 (59%), Gaps = 10/128 (8%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRET---DG  512
            FAYT++Y +DV ++A+FY+K FG+ VR      ++AEL +G+TT++F  +    +   DG
Sbjct  4    FAYTILYVSDVKRTAEFYSKTFGFEVRFIAPGDEYAELNTGTTTLSFASLSLANSNLKDG  63

Query  511  LT-GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRD  335
               G+++T      +   +E+ F   ++     +A+  GA  +  P++K WGQ V Y+RD
Sbjct  64   FQEGDLKT------KPFGMEIGFTTVNVQELVDKAIAAGATLLEEPKEKPWGQMVAYIRD  117

Query  334  IDGNVVRM  311
             DG ++ +
Sbjct  118  FDGILIEV  125



>ref|WP_008002535.1| glyoxalase [Pseudomonas sp. GM49]
 gb|EJM56028.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM49]
Length=137

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/135 (35%), Positives = 70/135 (52%), Gaps = 8/135 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG +VR    +  + ELE+G T +AF       ++  TG
Sbjct  3    FGYLIIYVKDVEASLKFFSAAFGLSVRFIHESGTYGELETGETALAFAADELAASNFSTG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +P+  G     IE+     D+ AA  +A++ GA  +  P  K WGQ V YVR  
Sbjct  63   HVSAHSSPKPLG-----IEVGLVTVDVPAAHAKAIQAGASEIAAPTTKPWGQTVSYVRCP  117

Query  331  DGNVVRMGSHVNEPK  287
            DG +V + + VN P+
Sbjct  118  DGTLVELCTPVNAPE  132



>ref|WP_018631682.1| hypothetical protein [Meganema perideroedes]
Length=133

 Score = 84.7 bits (208),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 50/136 (37%), Positives = 71/136 (52%), Gaps = 11/136 (8%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y VVY  DVA +  FY KAFG   R       +AE+E+G+T +AF    +    G   
Sbjct  3    FGYMVVYAPDVAATVAFYEKAFGVKARFVTPEADFAEMETGATALAFA--REGLMQGFAP  60

Query  502  EV-----ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVR  338
            ++     E P +  E    I    + A+L+AA+ RAV  GA P+  PE   WGQ + YVR
Sbjct  61   DLRPNRPEDPPAGAE----IAFVVEEAELEAAWTRAVAAGAAPLVKPERTPWGQMISYVR  116

Query  337  DIDGNVVRMGSHVNEP  290
            D++G +V +   V +P
Sbjct  117  DLNGVLVEICGPVPKP  132



>ref|WP_035996404.1| glyoxalase [Leptolyngbya sp. JSC-1]
Length=132

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 77/128 (60%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y  DV ++  FY KAFG   R    + ++AELE+G TT+AF      +++   G
Sbjct  4    FAYTILYVKDVPQAVAFYHKAFGLQARFVHESGQYAELETGGTTLAFATNDLAKSNLPQG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S  +    IE+ F  AD+ +AF +AVE GAV V  P+ K WGQ V YVRD+DG 
Sbjct  64   FVE--NSLSQPPAGIEVGFVTADVPSAFAQAVEAGAVAVAEPKVKPWGQTVAYVRDLDGI  121

Query  322  VVRMGSHV  299
            +V + S +
Sbjct  122  LVELCSSI  129



>ref|WP_010176560.1| glyoxalase [Pseudomonas sp. PAMC 25886]
Length=129

 Score = 84.3 bits (207),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+VY  DV+ S  F+ KAFG++ R    +  + EL++G TT++F      E +   G
Sbjct  3    FAYTIVYVPDVSASLQFFEKAFGFSRRFLHESGTYGELDTGGTTLSFAAHELGEMNFKGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   SR  +   +EL F   D+  A  RA+  GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVEAHASR--QPLGMELGFVTEDVPKAHARALAEGATELAAPNTKPWGQVVAYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_008437902.1| glyoxalase [Pseudomonas sp. Ag1]
 gb|EJF68852.1| glyoxalase [Pseudomonas sp. Ag1]
Length=130

 Score = 84.3 bits (207),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 67/124 (54%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+VY  DVA S  F+ KAFG++ R    +  + EL++G TT++F      E +   G
Sbjct  3    FAYTIVYVPDVAASLQFFEKAFGFSRRFLHESGTYGELDTGDTTLSFAAHELGEMNFKGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S  ++   +EL F   D+  A  RA+  GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVEAHAS--QQPLGMELGFVTEDVSKAHARALAEGATELAAPSTKPWGQVVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>dbj|BAO75693.1| lactoylglutathione lyase and related lyases [Winogradskyella 
sp. PG-2]
Length=130

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 73/128 (57%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            +AYT++Y  DV K+  FYA AFG+  +       + EL SG TTI F       ++   G
Sbjct  3    YAYTILYVEDVEKTITFYANAFGFQKKFLTPEADYGELISGETTITFASYVLGNSNFKQG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              +   +  E+ + IE+ F   +++A FK+A++ GAV      +K WGQ+VGY+RD++G 
Sbjct  63   FKKITLT--EKPNGIEMAFTSENIEADFKKAIDAGAVEYESIIEKPWGQKVGYLRDLNGF  120

Query  322  VVRMGSHV  299
            ++ + + +
Sbjct  121  LIEICTPI  128



>ref|WP_017137361.1| glyoxalase [Pseudomonas fluorescens]
Length=130

 Score = 84.0 bits (206),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 69/124 (56%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y  DVA S  F+  AFG++ R    +  + ELE+G TT++F      E +   G
Sbjct  3    FAYTIIYVPDVAASLAFFEAAFGFSRRFLHESGTYGELETGDTTLSFAAHELGEMNFDGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   SR  +   +E+ F   D+  A  +A+ +GA  ++PP  K WGQ V YVR  DG 
Sbjct  63   HVEAHASR--KPLGMEVGFVTEDVFVAHAKALLHGAKELSPPSTKPWGQVVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_020895088.1| Lactoylglutathione lyase [Winogradskyella psychrotolerans]
 gb|EPR72252.1| Lactoylglutathione lyase [Winogradskyella psychrotolerans RS-3]
Length=130

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 69/124 (56%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            +AYT++Y  DV K+  FY  AFG+  +       + EL SG TTIAF       ++   G
Sbjct  3    YAYTILYVEDVEKTMSFYENAFGFQKKFITPEHDYGELLSGETTIAFASHSLGNSNFKKG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              +   S  E+ + IE+ F   ++   F +A++ GA+   P  +K WGQ+VGY+RDI+G 
Sbjct  63   FKQL--SINEKPNGIEMAFTTENIKDDFNKAIKAGAIEYEPIIEKPWGQKVGYLRDINGF  120

Query  322  VVRM  311
            ++ +
Sbjct  121  LIEI  124



>gb|AII86154.1| glyoxalase/bleomycin resistance protein [Planktomarina temperata 
RCA23]
Length=129

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 68/129 (53%), Gaps = 3/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y+++Y   V ++  FY KAFG        +  + EL++G+TT+AF      + +GL  
Sbjct  3    FGYSIIYVASVPETLAFYDKAFGLQTGFLHESELYGELKTGATTLAFAADEMAKVNGLPM  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P    ER    E+     D ++AF +AV  GAV V  P+ K WGQ VGY+RD +G 
Sbjct  63   R---PNRADERPAGYEIALVTDDPESAFDKAVSAGAVAVTAPQTKPWGQIVGYLRDNNGC  119

Query  322  VVRMGSHVN  296
            +V + S V 
Sbjct  120  LVEICSPVG  128



>ref|WP_029292314.1| glyoxalase [Pseudomonas fluorescens]
Length=130

 Score = 83.6 bits (205),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 66/124 (53%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+VY  DVA S  F+  AFG+N R    +  + EL++G TT++F      E +   G
Sbjct  3    FAYTIVYVPDVAASLQFFENAFGFNRRFLHESGTYGELDTGGTTLSFAAHELGEMNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S+  +   +EL F   D+ AA  +A+  GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVAAHSSK--QPLGMELGFVTNDVPAAHAKALSAGASELTAPSSKPWGQVVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_008013669.1| glyoxalase [Pseudomonas sp. GM50]
 gb|EJM61586.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM50]
Length=137

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 70/133 (53%), Gaps = 8/133 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y +DVA S  F++ AFG ++R    +  + ELE+G T +AF        +  TG
Sbjct  3    FGYMIIYVSDVATSLQFFSSAFGLSIRFLHESATYGELETGETALAFAADELAAMNFSTG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +P+  G     IE+     D+ AA  RA++ GA  ++ P  K WGQ + YVR  
Sbjct  63   HVSAHSSPKPLG-----IEVGLVTEDVPAAHARALQAGATEMSAPSTKPWGQTISYVRCP  117

Query  331  DGNVVRMGSHVNE  293
            DG +V + + V +
Sbjct  118  DGTLVELCTPVMQ  130



>ref|WP_006220211.1| glyoxalase [Achromobacter piechaudii]
 gb|EFF74545.1| glyoxalase family protein [Achromobacter piechaudii ATCC 43553]
Length=130

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA S  F+ +AFG+ +R    ++ + EL++G TT++F      + +  +G
Sbjct  3    FGYTIIYVPDVAASLSFFERAFGFPIRFLHESKTYGELDTGDTTLSFAAHELADMNFGSG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V+   S       +E+ F   D+ AA  +AV  GA  ++ P  K WGQ V YVR  DG 
Sbjct  63   HVQA--SSSSLPLGMEVAFVTDDVAAAHAKAVSEGASELSAPSAKPWGQVVSYVRCPDGT  120

Query  322  VVRMGSHVN  296
            +V + + V 
Sbjct  121  LVELCTPVQ  129



>ref|WP_007981752.1| glyoxalase [Pseudomonas sp. GM48]
 gb|EJM63018.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM48]
Length=138

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 69/134 (51%), Gaps = 2/134 (1%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG +VR    +  + ELE+G T +AF       ++  TG
Sbjct  3    FGYLIIYVKDVEASLKFFSAAFGLSVRFIHESGTYGELETGETALAFVADELAASNFSTG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S   +   IE+     ++  A  +A++ GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVSAHSSL--KPLGIEVGLVTENVPVAHAKAIQAGASEIAAPTTKPWGQTVSYVRCPDGT  120

Query  322  VVRMGSHVNEPKRS  281
            +V + + VN P+R+
Sbjct  121  LVELCTPVNAPERA  134



>ref|WP_008022067.1| glyoxalase [Pseudomonas sp. GM55]
 gb|EJM67518.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM55]
Length=135

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DVA S  F++ AFG +VR    +  + EL +G T +AF       ++  TG
Sbjct  3    FGYLIIYVKDVAASLKFFSSAFGLSVRFIHESGTYGELATGETALAFAADELASSNFSTG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V  P     +   IE+     D+ AA  +A++ GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HV--PAHSSLKPLGIEVGLVTEDVPAAHAKAIQAGASEIAAPTTKPWGQTVSYVRCPDGT  120

Query  322  VVRMGSHVN  296
            +V + + VN
Sbjct  121  LVELCTPVN  129



>ref|WP_026381530.1| glyoxalase [Afifella pfennigii]
Length=131

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 7/133 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DVA + DFY ++F    R    +  + EL +G T +AF+ I       L  
Sbjct  3    FRYAILYVEDVAATLDFYERSFALQRRFLHESGDYGELSTGETKLAFSSI------ALMQ  56

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            ++     R     P+ EL F+  D+ AA  RAVE GA PV    ++ WGQ   YVRD +G
Sbjct  57   QLGKAPGRPNPEAPVFELAFETQDVRAALARAVEAGAAPVQDVREEPWGQTTAYVRDPNG  116

Query  325  NVVRMGSHVNEPK  287
             ++ + S V  P 
Sbjct  117  YLIEICSPVQLPS  129



>ref|WP_012238405.1| lyase [Sorangium cellulosum]
 ref|YP_001616420.1| lyase [Sorangium cellulosum So ce56]
 emb|CAN95940.1| putative lyase [Sorangium cellulosum So ce56]
Length=131

 Score = 82.4 bits (202),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = -3

Query  673  TVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEVE  494
             +VY  D  ++A FY +AFG+         ++ EL+ G   + F     +E     G  E
Sbjct  8    VIVYVPDAVEAAAFYERAFGFERSFVSSGNEYCELK-GRVPLGFV----QEDFAQKGLPE  62

Query  493  TPQSR-GERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVV  317
              ++R GER    E+     D+DAAF RAVE GA PV+ P DK WGQRV YVRD++G +V
Sbjct  63   LAKNRPGERAAGFEIIVTSEDVDAAFARAVEAGAAPVSEPHDKPWGQRVSYVRDLNGVLV  122

Query  316  RMGSHVNEP  290
             + S    P
Sbjct  123  EICSPWTSP  131



>ref|WP_009837778.1| glyoxalase [Pseudoalteromonas tunicata]
 gb|EAR29905.1| glyoxalase family protein superfamily [Pseudoalteromonas tunicata 
D2]
Length=133

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/134 (32%), Positives = 75/134 (56%), Gaps = 13/134 (10%)
 Frame = -3

Query  673  TVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFT--PIHQRETDGLTGE  500
            TV+Y +DV ++ DFY +AFG +  +   + ++ EL +GS  +AF   P+ Q         
Sbjct  6    TVIYVDDVEETLDFYYQAFGISATKLHESGQYGELNTGSVKLAFAAHPLAQ-------SH  58

Query  499  VETPQSRGERRHP---IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
             +    R + + P    E+ F   ++ AA+ +A++ GA P++PP +K WG  V YVR I+
Sbjct  59   FKQNYIRAQPKQPALGFEISFHSDNVVAAYTKAIQAGAEPLSPPVEKPWGHTVAYVRSIE  118

Query  328  GNVVRMGSHVNEPK  287
            G ++ + S + EP+
Sbjct  119  GTLIALSSDI-EPE  131



>ref|WP_006814415.1| glyoxalase [Providencia rustigianii]
 gb|EFB72298.1| glyoxalase family protein [Providencia rustigianii DSM 4541]
Length=127

 Score = 82.0 bits (201),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 69/130 (53%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y NDVAK+ DFY +AFG        +  + EL++GSTTI+F+ +      G   
Sbjct  3    FKYAILYVNDVAKTLDFYHQAFGMKCAFLHESGDYGELDTGSTTISFSSLALMNQLGKGA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                PQ+      P+ EL F+  +++ A  +AV  GA  V   E   WGQ   YV DI+G
Sbjct  63   ISPNPQA------PVFELAFETDEVEKALNQAVLAGAKLVQSAEIMPWGQTTAYVHDING  116

Query  325  NVVRMGSHVN  296
             ++ + S V+
Sbjct  117  FLIEICSPVS  126



>ref|WP_032125583.1| glyoxalase [Chlamydia sp. 'Diamant']
Length=128

 Score = 81.6 bits (200),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 69/129 (53%), Gaps = 6/129 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y ++Y  DV ++  FY KAFG   R    + ++AE+E+G T +AF        + +T 
Sbjct  3    LGYVIIYVADVPQTLSFYEKAFGIKQRFLHESNQYAEMETGQTALAFA-----NENFVTF  57

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
              +  ++R   + P +E+ F   D++ AF  A+  GA  V  P  K WGQ V YVRD++G
Sbjct  58   AQQLRRNRTTEQSPGVEIAFVADDVEKAFNHAISAGATEVLKPTQKPWGQIVSYVRDLNG  117

Query  325  NVVRMGSHV  299
             +V + S +
Sbjct  118  FLVEICSAI  126



>ref|WP_017736316.1| glyoxalase [Pseudomonas sp. CBZ-4]
Length=130

 Score = 81.6 bits (200),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 68/124 (55%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y  DVA S +F+ KAFG++ R    +  + ELE+G TT++F      E +   G
Sbjct  3    FAYTILYVPDVAASLEFFEKAFGFSRRFLHESGTYGELETGETTLSFAAHELGEMNFKGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V+   S+  +   +E+ F   D+  A   A+  GA  ++ P  K WGQ V YVR  DG 
Sbjct  63   HVQAHASK--QPLGMEVGFVTEDVLVAHANALAQGATELSAPSAKPWGQVVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_038995777.1| glyoxalase [Pseudomonas putida]
Length=130

 Score = 81.6 bits (200),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DVA S  F+ +AFG N R    +  + EL++G+TT+AF  +    +    G
Sbjct  3    LGYTIIYVADVAVSLAFFEQAFGLNQRFLHESGDYGELDTGATTLAFASLALGNSHFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +   +S       I L  D  D+  A  RAV+ GAV +  PE K WGQ + YVR  DG 
Sbjct  63   VLAASESAKPLGMEIALVTD--DVANAHARAVKAGAVELKAPEAKPWGQTLSYVRCPDGT  120

Query  322  VVRMGSHVN  296
            +V + S V 
Sbjct  121  LVELCSPVG  129



>gb|EXU81805.1| glyoxalase [Comamonas aquatica DA1877]
Length=130

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 68/124 (55%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT+VY  +VA S  F++ AFG+ V+    +  + EL++G+TT+AF      E +   G
Sbjct  3    LGYTIVYVPEVAASLQFFSGAFGFAVKFLHESGTYGELDTGATTLAFAAHALGEGNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   +S       I L  +  D++ A+ RA++ GAV ++ P  K WGQ V YVR  DG 
Sbjct  63   HVAASESVQPLGMEIGLVTE--DVEQAYTRALQAGAVQLSAPTRKPWGQVVAYVRSPDGT  120

Query  322  VVRM  311
            ++ +
Sbjct  121  LIEL  124



>ref|WP_015158396.1| hypothetical protein [Chamaesiphon minutus]
 ref|YP_007095731.1| hypothetical protein Cha6605_0952 [Chamaesiphon minutus PCC 6605]
 gb|AFY92204.1| hypothetical protein Cha6605_0952 [Chamaesiphon minutus PCC 6605]
Length=130

 Score = 81.3 bits (199),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 70/132 (53%), Gaps = 8/132 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+VY + VA +  FY +AFG+  R    + ++ EL +G T +AF   H      L G
Sbjct  3    FGYTIVYVSSVADALTFYKEAFGFETRFLHESGQYGELNTGETVLAFAS-HAMGEMNLDG  61

Query  502  EVETPQSRGERRHP---IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
              +    + +   P   +EL F   D+ +++ +AV  GA+ V  P  K WGQ V YVR I
Sbjct  62   RYQ----KSDLNAPPLGVELAFVTDDVASSYAKAVAAGAISVKEPTAKPWGQVVAYVRAI  117

Query  331  DGNVVRMGSHVN  296
            +G+++ + S + 
Sbjct  118  EGSLIELCSPIG  129



>ref|WP_035660457.1| glyoxalase [Flavobacterium sp. EM1321]
 gb|KDN54535.1| hypothetical protein FEM21_22580 [Flavobacterium sp. EM1321]
Length=130

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 72/129 (56%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y  +V K+ DFY KAFG+  +       +AEL  G TT++F  +   +T+   G
Sbjct  4    FAYTILYVQNVTKTVDFYEKAFGFTRKFIAPGNDYAELLVGETTLSFAAVALAKTNLKNG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  +  ++   IE+ F   ++      A + GA+ V  P+ K WGQ V Y+RD DG 
Sbjct  64   FIES--NLEDKPFGIEIGFTTDNVIETIATAEKAGALIVENPKTKPWGQTVAYLRDPDGF  121

Query  322  VVRMGSHVN  296
            ++ + + +N
Sbjct  122  LIEICTPMN  130



>ref|WP_025809612.1| glyoxalase [Pseudomonas chlororaphis]
Length=130

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 69/129 (53%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+ Y  DV+ S  F+ +AFG   R    +  + ELE+G+T +AF      E +   G
Sbjct  3    FAYTIFYVPDVSASLAFFDRAFGLPTRFLHESGTYGELETGATALAFAAHELGEMNFSGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S   R   +E+    AD+ AA +RA++ GA  ++ P +K WGQ V YV   DG 
Sbjct  63   HVEAHSSA--RPLGMEIGLVCADVHAAHQRALDAGASELSAPSEKPWGQTVSYVHCPDGL  120

Query  322  VVRMGSHVN  296
            +V + + + 
Sbjct  121  LVELCTAIQ  129



>ref|WP_019973578.1| hypothetical protein [Empedobacter brevis]
Length=130

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 69/128 (54%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            +AYT+VY  +V ++  FY KAF +  +       + EL SG TTIAF  +    ++   G
Sbjct  3    YAYTIVYVKNVTETIAFYTKAFAFETKFITPENDYGELISGETTIAFASVELGNSNLKKG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               T   +  +   +EL F   +++  FK A++ GA+   P  +K WGQ+VGY+ D +G 
Sbjct  63   --FTAIEKSAKPFGVELAFTSENIETDFKTAIDAGAIEFEPLTEKPWGQKVGYLLDNNGF  120

Query  322  VVRMGSHV  299
            ++ + + +
Sbjct  121  LIEICTPI  128



>ref|WP_030130986.1| glyoxalase [Pseudomonas sp. QTF5]
Length=130

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 68/133 (51%), Gaps = 8/133 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG++VR    +  + ELE+G T +AF        +   G
Sbjct  3    FGYMIIYVPDVVASLQFFSSAFGFSVRFLHESNTYGELETGETALAFAADELAAMNFSAG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +P+  G     IE+     D+ AA  RA++ GA  ++ P  K WGQ V YVR  
Sbjct  63   HVSAHSSPKPLG-----IEVGLVTEDVPAAHARALKAGATEISAPSAKPWGQIVSYVRCP  117

Query  331  DGNVVRMGSHVNE  293
            DG +V + + V +
Sbjct  118  DGTLVELCTPVQQ  130



>ref|WP_009048365.1| glyoxalase [Pseudomonas chlororaphis]
 gb|EIM18534.1| glyoxalase family protein [Pseudomonas chlororaphis O6]
 gb|AIC19446.1| glyoxalase [Pseudomonas chlororaphis]
Length=130

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+ Y  DV+ S  F+ +AFG + R    +  + ELE+G+T +AF        +   G
Sbjct  3    FAYTIFYVPDVSASLAFFNRAFGLSTRFLHDSGTYGELETGATALAFAAHELGAMNFNGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S   R   +E+    AD+ AA +RA++ GA  ++ P +K WGQ V YVR  DG 
Sbjct  63   HVEAHSS--ARPLGMEIGLVCADVHAAHQRALDAGASELSAPGEKPWGQTVSYVRCPDGL  120

Query  322  VVRMGSHVN  296
            +V + + V 
Sbjct  121  LVELCTAVQ  129



>ref|WP_008075081.1| glyoxalase [Pseudomonas sp. GM79]
 gb|EJN18745.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM79]
Length=130

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 67/133 (50%), Gaps = 8/133 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG  VR    +  + ELE+G T +AF        +  TG
Sbjct  3    FGYMIIYVPDVVASLQFFSSAFGLGVRFLHESNTYGELETGETALAFAADELAAMNFSTG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +P+  G     IE+     D+ AA  RA++ GA  ++ P  K WGQ V YVR  
Sbjct  63   HVSAHSSPKPLG-----IEVGLVTEDVPAAHARALKAGASEISAPSAKPWGQIVSYVRCP  117

Query  331  DGNVVRMGSHVNE  293
            DG +V + + V +
Sbjct  118  DGTLVELCTPVQQ  130



>ref|WP_024530735.1| glyoxalase [Serratia fonticola]
Length=126

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 70/127 (55%), Gaps = 7/127 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y ++V ++ DFY +AFG+ +     +  W EL +G+T ++F     RE     G
Sbjct  3    FAYTILYVDNVQQTMDFYHRAFGFEIHCLHESGDWGELATGATRLSFC---SRELLAGQG  59

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            +     ++ +  HP+ E+ F   DL  A K A++ GAV V   +   WGQ + YV D + 
Sbjct  60   K---KSAKSDYNHPVFEIAFTTDDLPKALKTALDAGAVLVEDIQHMPWGQTICYVADPEH  116

Query  325  NVVRMGS  305
            N+V + S
Sbjct  117  NLVEICS  123



>ref|WP_007904828.1| glyoxalase [Pseudomonas sp. GM102]
 gb|EJL96401.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM102]
Length=130

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 66/130 (51%), Gaps = 2/130 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG +VR    +  + ELE+G T +AF        +  TG
Sbjct  3    FGYMIIYVPDVVASLQFFSSAFGLSVRFLHESNTYGELETGETALAFAADELAAMNFSTG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S   +   IE+     D+ AA  RA++ GA  ++ P  K WGQ V YVR  DG 
Sbjct  63   HVSAHSSA--KPLGIEVGLVTEDVPAAHARALKAGASEISAPSVKPWGQIVSYVRCPDGT  120

Query  322  VVRMGSHVNE  293
            +V + + V +
Sbjct  121  LVELCTPVQQ  130



>ref|WP_017498467.1| glyoxalase [Flavobacterium sp. WG21]
Length=130

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 69/133 (52%), Gaps = 10/133 (8%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH---QRETDG  512
            F YT++Y  +V KS  FY  AFG++ +       + EL +G TTI+F       Q   DG
Sbjct  4    FGYTILYVEEVEKSISFYENAFGFSRKFVTPEGDYGELSTGETTISFASKELAAQNLKDG  63

Query  511  LTGEVETPQSRGERR-HPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRD  335
                    +S+ E++   IEL F   D++   ++A+  GA  V  P  K WGQ V YVRD
Sbjct  64   FI------ESKPEQKPFAIELGFITDDVEELVQKAISAGATLVKEPAQKPWGQVVAYVRD  117

Query  334  IDGNVVRMGSHVN  296
            +DG ++ + + V 
Sbjct  118  LDGFLIEICTPVQ  130



>ref|WP_028682644.1| glyoxalase [Pseudomonas chlororaphis]
Length=130

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 69/129 (53%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+ Y  DV+ S  F+ +AFG   R    +  + ELE+G+T +AF        +   G
Sbjct  3    FAYTIFYVPDVSASLAFFNRAFGLPTRFLHESGTYGELETGATALAFAAHELGAMNFNGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S   R   +E+    AD+ AA +RA++ GA  ++ P +K WGQ V YVR  DG 
Sbjct  63   HVEAHSS--ARPLGMEIGLVCADVHAAHQRALDAGASELSAPGEKPWGQTVSYVRCPDGL  120

Query  322  VVRMGSHVN  296
            +V + + V 
Sbjct  121  LVELCTAVQ  129



>ref|WP_019960774.1| hypothetical protein [Woodsholea maritima]
Length=131

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 66/129 (51%), Gaps = 5/129 (4%)
 Frame = -3

Query  676  YTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEV  497
            Y ++Y +DVA + DFY +AFG  +        + E+ +G T +AF+ I   +  G     
Sbjct  5    YAILYVDDVAATLDFYERAFGLTLAFMHEGGDYGEMSTGETKLAFSSIALMKRLG-----  59

Query  496  ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVV  317
            +TP     +    E+ F+  ++ A++ RA+  GA P+  P D+ WGQ   YV D +G  V
Sbjct  60   KTPGKPSLKAPTFEIAFESDNVRASYDRAIAAGAKPIQEPRDEAWGQTTSYVSDPNGYWV  119

Query  316  RMGSHVNEP  290
             + S V  P
Sbjct  120  EICSSVQLP  128



>ref|WP_008008493.1| glyoxalase [Pseudomonas sp. GM50]
 gb|EJM67607.1| lactoylglutathione lyase-like lyase [Pseudomonas sp. GM50]
Length=130

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 66/133 (50%), Gaps = 8/133 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG  VR    +  + ELE+G T +AF        +  TG
Sbjct  3    FGYMIIYVPDVVASLQFFSSAFGLGVRFLHESNTYGELETGETALAFAADELAAMNFSTG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V    +P+  G     IE+     D+ AA  RA++ GA  +  P  K WGQ V YVR  
Sbjct  63   HVSAHSSPKPLG-----IEVGLVTEDVPAAHARALKAGASEICAPSAKPWGQIVSYVRCP  117

Query  331  DGNVVRMGSHVNE  293
            DG +V + + V +
Sbjct  118  DGTLVELCTPVQQ  130



>ref|WP_027264980.1| glyoxalase [Legionella pneumophila]
Length=129

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 69/131 (53%), Gaps = 5/131 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLT-  506
            F YT++Y  DV +S  F+ KAFG+  R F H   + ELE+G TT+AF   H      +T 
Sbjct  3    FGYTIIYVTDVKESLKFFEKAFGFKTR-FYHESGYGELETGETTLAFAS-HDLGAKNITK  60

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            G V  P     +   +E+      +  A K+A+E GA  +  P  K WGQ V Y+R  +G
Sbjct  61   GYV--PADSSPKPLGMEIALVTDSVADAHKKAIELGAESIEEPMQKPWGQTVSYIRCPNG  118

Query  325  NVVRMGSHVNE  293
             ++ + S ++E
Sbjct  119  TLIELCSPIHE  129



>ref|WP_013936437.1| glyoxalase [Myxococcus fulvus]
 ref|YP_004664346.1| glyoxalase family protein [Myxococcus fulvus HW-1]
 gb|AEI63268.1| glyoxalase family protein [Myxococcus fulvus HW-1]
Length=129

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 67/127 (53%), Gaps = 5/127 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
              Y + Y  DV+ +  FY KAFG   RRF H    +AE+E+G+T +AF      +  G T
Sbjct  3    LGYIIFYVPDVSATVAFYEKAFGL-ARRFVHESGTYAEMETGATALAFVEEGAAKEHGFT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P++       +E+    AD+  A+ RAV+  A    PP+ K WGQ V YVRD++G
Sbjct  62   VRHLRPKTNPAA---VEVALVTADVAGAYARAVDASAEATQPPKQKPWGQTVAYVRDLNG  118

Query  325  NVVRMGS  305
             +V + S
Sbjct  119  VLVELCS  125



>ref|WP_027475249.1| glyoxalase [Curvibacter gracilis]
Length=130

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 64/126 (51%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT+VY  DV  S  F+A AFG+ ++    +  + EL +G TT+AF        +   G
Sbjct  3    LGYTIVYVPDVKASLQFFATAFGFELKFLHESGTYGELATGETTLAFAAHELGHGNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   +S  ++   +EL    AD+  A  RA++ GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVAASES--QKPLGMELGLVTADVAGAHTRALQAGATELAAPSQKPWGQVVSYVRAPDGT  120

Query  322  VVRMGS  305
            ++ + S
Sbjct  121  LIELCS  126



>ref|WP_019965976.1| glyoxalase [Pannonibacter phragmitetus]
Length=131

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  676  YTVVYCNDVAKSADFYAKAFGYNVRRFEH-NRKWAELESGSTTIAFTPIHQRETDGLTGE  500
            YT++Y  DVA + DFY +AFG   R F H +  + EL +G T +AF+ +   +  G    
Sbjct  5    YTILYVEDVAATLDFYERAFGLK-RSFLHASGDYGELATGDTKLAFSSVELMKQLG----  59

Query  499  VETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNV  320
             + P     +    E+ F+  D+ AAF RAV  GA PV    D+ WGQ   Y  D++G +
Sbjct  60   -KKPGKPVLQAPVFEIAFETDDVQAAFDRAVAAGARPVQQVRDEPWGQTTAYAGDLNGYL  118

Query  319  VRMGSHVNEP  290
            V + S V  P
Sbjct  119  VEICSPVQLP  128



>ref|WP_021182186.1| hypothetical protein [Serratia fonticola]
 gb|ERK05239.1| hypothetical protein L581_2514 [Serratia fonticola AU-AP2C]
 gb|ERK05440.1| hypothetical protein L580_3360 [Serratia fonticola AU-P3(3)]
Length=126

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 70/127 (55%), Gaps = 7/127 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y ++V ++ DFY +AFG+ +     +  W EL +G+T ++F     RE     G
Sbjct  3    FAYTILYVDNVQQTMDFYHRAFGFEIHCLHESGDWGELATGATRLSFC---SRELLAGQG  59

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            +     ++ +  HP+ E+ F   D+  A K A++ GAV V   +   WGQ + YV D + 
Sbjct  60   K---KSAKSDYHHPVFEIAFTTDDVPKALKTALDAGAVLVEDIQHMPWGQTICYVADPEH  116

Query  325  NVVRMGS  305
            N+V + S
Sbjct  117  NLVEICS  123



>ref|WP_006658462.1| glyoxalase [Providencia alcalifaciens]
 gb|EEB46397.1| glyoxalase family protein [Providencia alcalifaciens DSM 30120]
Length=127

 Score = 79.3 bits (194),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  +V K+ DFY +AFG+       +  + EL++GSTTI+F+ +      G   
Sbjct  3    FKYAILYVENVEKTLDFYQRAFGFKKSFLHESGDYGELDTGSTTISFSSLALMNQLGKGA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                P +      P+ EL F+  D+  A  +AV  GA  V   +D  WGQ +GYV D++G
Sbjct  63   VAPNPSA------PVFELAFETDDVPKALHQAVNAGAELVQDAQDMPWGQTIGYVHDLNG  116

Query  325  NVVRMGSHVN  296
             ++ + + V 
Sbjct  117  FLIEICTLVQ  126



>ref|WP_029032048.1| glyoxalase [Salinarimonas rosea]
Length=127

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 66/126 (52%), Gaps = 5/126 (4%)
 Frame = -3

Query  676  YTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEV  497
            YT++Y  DV  S  FY +AFG        +  + EL +G+TT++F+   +R    L  + 
Sbjct  5    YTILYVEDVPASLAFYERAFGLARGMLHPSNDYGELATGNTTLSFS--SRRLIRALGKD-  61

Query  496  ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVV  317
              P +    R   E+ F+  D++AAF RAVE GA P   P  + WGQ   YV D DG +V
Sbjct  62   --PAAPDPARPSFEIAFETDDVEAAFARAVEAGATPKQAPRREEWGQTTSYVTDPDGYLV  119

Query  316  RMGSHV  299
             + S V
Sbjct  120  EICSAV  125



>ref|WP_017010442.1| hypothetical protein [Enterovibrio calviensis]
Length=128

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA +  FY  AFG        +  + EL SG TT++F+ +       L  
Sbjct  3    FKYTILYVEDVAATLAFYENAFGMKTAMLHESGDYGELSSGDTTLSFSSL------ALMA  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            ++    SRG+   P  E+ F+  +++ +  +A   GAV V   E   WGQ   YV+D++G
Sbjct  57   QLGKNPSRGDGSAPCFEIAFETEEVEKSLNKATAAGAVLVQDVEHMPWGQTTAYVKDLNG  116

Query  325  NVVRMGSHVN  296
             +V + S + 
Sbjct  117  FLVEICSSIQ  126



>ref|WP_036967546.1| glyoxalase [Providencia alcalifaciens]
 gb|EUD06324.1| glyoxalase-like domain protein [Providencia alcalifaciens R90-1475]
Length=127

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  +V K+ DFY +AFG+       +  + EL++GSTTI+F+ +      G   
Sbjct  3    FKYAILYVGNVEKTLDFYQRAFGFKKSFLHESGDYGELDTGSTTISFSSLALMNQLGKGA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                P +      P+ EL F+  D+  A  +AV  GA  V   +D  WGQ +GYV D++G
Sbjct  63   VAPNPSA------PVFELAFETDDVPKALHQAVNAGAELVQDAQDMPWGQTIGYVHDLNG  116

Query  325  NVVRMGSHVN  296
             ++ + + V 
Sbjct  117  FLIEICTPVQ  126



>ref|WP_017878582.1| glyoxalase [Janthinobacterium sp. CG3]
Length=130

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 66/125 (53%), Gaps = 4/125 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
            F YT+VY  DVA S  FY  AFG   RRF H+   + ELE+G+TT+AF      E +   
Sbjct  3    FGYTIVYVPDVAASLSFYETAFGLP-RRFLHDSGTYGELETGATTLAFAAHELGELNFPA  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            G V    S  ++   +E+     D+  A + A+  GA  V  P  K WGQ V YVR  DG
Sbjct  62   GHVR--ASASDKPLGVEIALVTEDVAQAHRTALAAGATEVAAPTAKPWGQVVSYVRCPDG  119

Query  325  NVVRM  311
            ++V +
Sbjct  120  SLVEL  124



>ref|WP_039115749.1| glyoxalase [Flavobacterium sp. KMS]
 gb|KIA94460.1| glyoxalase [Flavobacterium sp. KMS]
Length=130

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 65/124 (52%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y NDV+KS  FY  AFG+  +       + EL +G TTI+F       ++   G
Sbjct  4    FGYTILYVNDVSKSISFYENAFGFTRKFITPENDYGELSTGETTISFASKELANSNLKDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  +   +    EL F   +++    ++ E GA  +   + K WGQ V YVRDIDG 
Sbjct  64   FIESDLTN--KPFATELGFITDNVNEVLAKSKEAGATILQEAKQKPWGQTVAYVRDIDGF  121

Query  322  VVRM  311
            ++ +
Sbjct  122  LIEI  125



>ref|WP_006662485.1| glyoxalase/bleomycin resistance protein/dioxygenase [Providencia 
alcalifaciens]
 gb|EKT65367.1| glyoxalase/bleomycin resistance protein/dioxygenase [Providencia 
alcalifaciens Dmel2]
 gb|ETT08487.1| glyoxalase-like domain protein [Providencia alcalifaciens F90-2004]
 gb|EUC97007.1| glyoxalase-like domain protein [Providencia alcalifaciens PAL-2]
 gb|EUD10013.1| glyoxalase-like domain protein [Providencia alcalifaciens 205/92]
Length=127

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  +V K+ DFY +AFG+       +  + EL++GSTTI+F+ +      G   
Sbjct  3    FKYAILYVENVEKTLDFYQRAFGFKKSFLHESGDYGELDTGSTTISFSSLALMNQLGKGA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                P +      P+ EL F+  D+  A  +AV  GA  V   +D  WGQ +GYV D++G
Sbjct  63   VAPNPSA------PVFELAFETDDVPKALHQAVNAGAELVQDAQDMPWGQTIGYVHDLNG  116

Query  325  NVVRMGSHVN  296
             ++ + + V 
Sbjct  117  FLIEICTPVQ  126



>ref|WP_037546053.1| glyoxalase [Spirochaeta sp. JC230]
 gb|KGE73391.1| glyoxalase [Spirochaeta sp. JC230]
Length=125

 Score = 78.6 bits (192),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 65/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y ++Y  DVA + DFYA+AFG      + +  + E+++G T +AF     +E     G
Sbjct  3    LGYVIIYVKDVAAARDFYARAFGLEKGFIDESETFGEMKTGQTALAFA----QEELLTKG  58

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP     RR  IE+     D+ AAF RA++ GA  +  PE+K WGQ V YV D  G 
Sbjct  59   VGLTPPKEPNRR--IEIALTTPDVPAAFSRALDAGAGSLVEPEEKPWGQVVAYVEDPFGT  116

Query  322  VVRM  311
            +V +
Sbjct  117  LVEI  120



>ref|WP_014247982.1| glyoxalase [Azospirillum lipoferum]
 ref|YP_005039202.1| putative glyoxalase I [Azospirillum lipoferum 4B]
 emb|CBS86972.1| Putative glyoxalase I [Azospirillum lipoferum 4B]
Length=130

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 72/129 (56%), Gaps = 5/129 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEH-NRKWAELESGSTTIAFTPIHQRETDGLT  506
              YT++Y  DV  + DFY +AFG   RRF H +  +AEL++G TT+AF      E +GL 
Sbjct  3    LGYTIIYVADVLATIDFYERAFGLK-RRFVHESNLYAELDTGETTLAFAGEPMAEMNGLA  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P  +GE     E+     D  AA+  A+  GA  V+PP +K  GQ VGYVRDIDG
Sbjct  62   IR---PNLKGEISSGFEIALVTDDPRAAYATAIAAGADAVSPPVEKPCGQIVGYVRDIDG  118

Query  325  NVVRMGSHV  299
             +V + S V
Sbjct  119  CLVEICSPV  127



>ref|WP_002636258.1| glyoxalase [Myxococcus sp. (contaminant ex DSM 436)]
 gb|ERK87950.1| Lactoylglutathione lyase protein [Myxococcus sp. (contaminant 
ex DSM 436)]
Length=129

 Score = 78.6 bits (192),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 63/125 (50%), Gaps = 5/125 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
              Y + Y  DV  +  FY KAFG   RRF H    +AE+E+G+T +AF      +  G T
Sbjct  3    LGYIIFYVQDVTATVAFYEKAFGLK-RRFVHETGTYAEMETGTTALAFVEEGAAKDHGFT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P+   E    +E+     D+  A+  AVE GA     P+ K WGQ V YVRD++G
Sbjct  62   VRHLRPK---EEASAVEVALVTEDVTGAYAHAVEAGAEATQAPKQKPWGQTVAYVRDLNG  118

Query  325  NVVRM  311
             +V +
Sbjct  119  VLVEL  123



>gb|AHF03138.1| glyoxalase [Marichromatium purpuratum 984]
Length=129

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 69/133 (52%), Gaps = 7/133 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT++Y  DVA+S  F+  AFG++    + +  + EL++G T +AF+        G   
Sbjct  3    FAYTILYVEDVARSLAFFHNAFGFDSGFVDESGDYGELDTGGTRLAFSSRALMRQLGKVA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +  P +      P+ E+  +  D+  A +RA   GAV V  P +++WGQ   YVR  DG
Sbjct  63   GIADPNA------PVFEIAIETTDVATALERACTAGAVVVQEPREESWGQTTAYVRTPDG  116

Query  325  NVVRMGSHVNEPK  287
             +V + S V  P 
Sbjct  117  YLVELCSPVPMPS  129



>ref|WP_018109996.1| hypothetical protein [Bacteroides propionicifaciens]
Length=130

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 70/128 (55%), Gaps = 10/128 (8%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTP---IHQRETDG  512
            F YT++Y + V KS DFYA+ FG NV+       + EL +G   +AFT     +Q  + G
Sbjct  4    FKYTILYVDSVEKSMDFYAQVFGLNVKFITPEHDYGELSTGEVRLAFTSKELANQNLSRG  63

Query  511  L-TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRD  335
              +G++      G+    IEL F   +++   + A+  GA  V   ++K WGQ+V Y++D
Sbjct  64   FKSGKI------GDLPFGIELGFTTDNVEQLIEAAISQGAQLVEKIQEKPWGQKVAYIQD  117

Query  334  IDGNVVRM  311
            +DG ++ +
Sbjct  118  LDGFLIEV  125



>ref|WP_014019814.1| glyoxalase [Cyclobacterium marinum]
 ref|YP_004773750.1| glyoxalase/bleomycin resistance protein/dioxygenase [Cyclobacterium 
marinum DSM 745]
 gb|AEL25519.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Cyclobacterium 
marinum DSM 745]
Length=133

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 69/129 (53%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT+ Y  DV K+  FY KAFG+ ++       + EL SG TT++F    Q       G
Sbjct  3    YGYTIFYVEDVQKTVAFYEKAFGFKIKFITPENDYGELISGETTLSFAS--QELGKANFG  60

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                  S  E+ + +E+ F   ++   F +A+E GA+     E+K WGQ+VGY++D +G 
Sbjct  61   RDFQLASIREKAYTMEIAFVTENITEDFDKAIEAGALEFKGIEEKPWGQKVGYLKDHNGI  120

Query  322  VVRMGSHVN  296
            ++ + + ++
Sbjct  121  IIEICTPIS  129



>ref|WP_017012721.1| hypothetical protein [Enterovibrio calviensis]
Length=128

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA +  FY  AFG        +  + EL SG TT++F+ +       L  
Sbjct  3    FKYTILYVEDVAATLAFYENAFGMKTAMLHESGDYGELSSGDTTLSFSSL------ALMA  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            ++    SRG+   P  E+ F+  +++ +  +A   GAV V   E   WGQ   YV+D++G
Sbjct  57   QLGKNPSRGDGSAPCFEIAFETEEVEKSLNKATAAGAVLVQDVEHMPWGQTTAYVKDLNG  116

Query  325  NVVRMGSHVN  296
             +V + S + 
Sbjct  117  FLVEICSPIQ  126



>ref|WP_016657269.1| hypothetical protein [Acinetobacter rudis]
 gb|EPF70846.1| hypothetical protein F945_02885 [Acinetobacter rudis CIP 110305]
Length=127

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 67/125 (54%), Gaps = 7/125 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
            FAYT++Y  DV K+  FY  AF + ++ F+H +  +AELESG TTIAF+      + G  
Sbjct  3    FAYTILYVEDVKKTVQFYKDAFDFELK-FQHEKGDYAELESGQTTIAFSSFDLIRSLG--  59

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
               + P+    +    EL      L+ A ++A+  GA  +   E   WGQ + YV DI+G
Sbjct  60   ---KNPKRADSQTPNFELALVTDRLEDALQQAIAAGAKEIKAIERMPWGQSIAYVEDING  116

Query  325  NVVRM  311
             ++ +
Sbjct  117  FLIEL  121



>gb|KGT09947.1| glyoxalase [Elizabethkingia meningoseptica]
Length=130

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  +V KS +FY K+FG+  +       + EL +G T+IAF  +    T+   G
Sbjct  4    FGYTIFYVKNVTKSIEFYEKSFGFERKFITPENDYGELNTGETSIAFASLELANTNLADG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP +  ++    E+       +   +++++ GA  V  P  K WGQ V Y+RDIDG 
Sbjct  64   --ITPANLNDKPFATEIGLITDKPENTVQQSLQYGATLVQEPLQKPWGQTVAYIRDIDGF  121

Query  322  VVRMGSHV  299
            ++ + S +
Sbjct  122  LIEICSPI  129



>ref|WP_028627347.1| glyoxalase [Pseudomonas resinovorans]
Length=130

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/133 (34%), Positives = 70/133 (53%), Gaps = 8/133 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y +DV  + +F+  AFG   R    +  + ELE+G+TT+AF      + +   G
Sbjct  3    FGYTIAYVSDVRSTLEFFGLAFGLPARFLHESGDYGELETGATTLAFASHELGDMNLPGG  62

Query  502  EV---ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             V   E+ Q  G     IE+     D+ AA +RA+  GA  +  P+++ WGQ V Y+R  
Sbjct  63   HVRANESSQPLG-----IEIALVTCDVPAAHQRALAAGAQELAAPQERPWGQVVSYLRCP  117

Query  331  DGNVVRMGSHVNE  293
            DG +V + S + E
Sbjct  118  DGLLVELCSPMGE  130



>emb|CEF48918.1| unnamed protein product [uncultured bacterium]
Length=128

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 4/128 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              Y ++Y +D+  +  FY KAFG   RRF H+  +AE+++G+T +AF      +T+G+  
Sbjct  3    LGYVIIYVSDLEATVAFYEKAFGI-ARRFIHDSVYAEMDTGATALAFASETLGQTNGMAY  61

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                 +   +     E+ F   D+  A+ +AVE GA+    P  K WGQ V YVRD +G 
Sbjct  62   RTNRLK---DDAAGAEIAFVTDDVARAYSKAVEAGALAYKEPTKKPWGQTVAYVRDNNGF  118

Query  322  VVRMGSHV  299
            +V + S +
Sbjct  119  LVEICSPI  126



>ref|WP_031209962.1| glyoxalase [Marinobacter sp. EVN1]
Length=131

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 5/132 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA S  FY +AF         +  + EL +G+T +AF+ +    T G   
Sbjct  3    FRYTILYVEDVAASLAFYERAFAMERGFLHESGDYGELVTGATKLAFSSVKLMRTLG---  59

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              +TP          E+ F+  D+ AA+ RAV  GA PV     + WGQ   YV DI+G 
Sbjct  60   --KTPGKPAPETPVFEIAFETEDVYAAYTRAVAAGAQPVQEVRSEPWGQTTCYVTDINGY  117

Query  322  VVRMGSHVNEPK  287
            +V + S    P 
Sbjct  118  LVEICSPAQLPS  129



>ref|WP_039119454.1| glyoxalase [Flavobacterium sp. JRM]
 gb|KIC00771.1| glyoxalase [Flavobacterium sp. JRM]
Length=130

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 65/124 (52%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y NDV+KS  FY  AFG+  +       + EL +G TTI+F       ++   G
Sbjct  4    FGYTILYVNDVSKSISFYENAFGFTRKFITPENDYGELSTGETTISFASKELANSNLKDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  +   +    EL F   +++    ++ E GA  +   + K WGQ V Y+RDIDG 
Sbjct  64   FIESDLTN--KPFATELGFITDNVNEVLIKSKEAGASILQEAKQKPWGQTVAYIRDIDGF  121

Query  322  VVRM  311
            ++ +
Sbjct  122  LIEI  125



>ref|WP_017017859.1| hypothetical protein [Enterovibrio calviensis]
Length=128

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 66/130 (51%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA +  FY  AFG        +  + EL SG TT++F+ +       L  
Sbjct  3    FKYTILYVEDVAATLAFYENAFGMKTAMLHESGDYGELSSGDTTLSFSSL------ALMA  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            ++    SRG+   P  E+ F+  +++ +  +A   GAV V   +   WGQ   YV+D++G
Sbjct  57   QLGKNPSRGDGSAPCFEIAFETEEVEKSLNKATAAGAVLVQDVKHMPWGQTTAYVKDLNG  116

Query  325  NVVRMGSHVN  296
             +V + S + 
Sbjct  117  FLVEICSSIQ  126



>ref|WP_026686765.1| glyoxalase [Azovibrio restrictus]
Length=130

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 66/124 (53%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV +S  F+ +AFG   R  +    + EL++G+T +AF   H    D L  
Sbjct  3    FGYTIIYVEDVRESLAFFEQAFGLQARFIDPTGCYGELDTGATALAFAA-HSLMAD-LLP  60

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            E       G +   +E+     D++ A++RA+  GA+ +  P D  WGQRV ++R  DG 
Sbjct  61   EGYRAAREGSQPLGVEIGLFTDDVEGAYRRALACGAIGLTAPRDTPWGQRVSFIRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEI  124



>ref|WP_028978208.1| glyoxalase [Sporocytophaga myxococcoides]
Length=130

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (53%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV KS +FY KAFG+       +  + EL +G+T ++F  +   + +   G
Sbjct  4    FGYTILYVQDVNKSIEFYEKAFGFQRTFIAPDGDYGELTTGNTKLSFASVKLAKNNLKNG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+      +   IE+ F    +    + AV  GAV V  P+ K WGQ V YVRD DG 
Sbjct  64   FIES--DLNSKPFGIEIGFVTEAVGETTEIAVAAGAVLVEKPKTKPWGQVVSYVRDPDGF  121

Query  322  VVRMGSHVN  296
            ++ + S +N
Sbjct  122  LIEICSPMN  130



>ref|WP_024567119.1| glyoxalase [Elizabethkingia anophelis]
Length=130

 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  +V KS +FY K+FG+  +       + EL +G T+IAF  +   +T+   G
Sbjct  4    FGYTIFYVKNVTKSIEFYEKSFGFKRKFITPENDYGELNTGETSIAFASLELAKTNLADG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP +   +    E+       +   +++++ GA  V  P  K WGQ V Y+RDIDG 
Sbjct  64   --FTPANLNNKPFATEIGLITDKPENTVQQSLQYGATLVQKPLQKPWGQTVAYIRDIDGF  121

Query  322  VVRMGS  305
            ++ + S
Sbjct  122  LIEICS  127



>ref|WP_022639132.1| glyoxalase [Pseudomonas sp. CMAA1215]
 gb|ERO65658.1| glyoxalase [Pseudomonas sp. CMAA1215]
Length=129

 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 64/124 (52%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y   V  S  F+ +AFG+  R    +  + ELE+GST +AF      + +   G
Sbjct  3    FGYTIIYVPQVEDSLRFFEQAFGFKRRFLHESGTYGELETGSTALAFADHQLAQMNFKDG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    SR  +   +EL     D+ AA  +A+E+GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVAAHSSR--QPLGMELGLVTEDVQAAHAKALEHGARELAAPTTKPWGQTVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_036976167.1| glyoxalase [Providencia alcalifaciens]
 gb|EUD01504.1| glyoxalase-like domain protein [Providencia alcalifaciens RIMD 
1656011]
Length=127

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 67/129 (52%), Gaps = 7/129 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  +V K+ DFY +AFG+       +  + EL++GSTTI+F+ +      G   
Sbjct  3    FKYAILYVENVEKTLDFYQRAFGFKKSFLHESGDYGELDTGSTTISFSSLALMNQLGKGA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                P +      P+ EL F+  D+     +AV  GA  V   +D  WGQ +GYV D++G
Sbjct  63   VAPNPSA------PVFELAFETDDVPKELNQAVNAGAELVQDAQDMPWGQTIGYVHDLNG  116

Query  325  NVVRMGSHV  299
             ++ + + V
Sbjct  117  FLIEICTPV  125



>ref|WP_011921584.1| glyoxalase [Flavobacterium johnsoniae]
 ref|YP_001192423.1| glyoxalase/bleomycin resistance protein/dioxygenase [Flavobacterium 
johnsoniae UW101]
 gb|ABQ03104.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Flavobacterium 
johnsoniae UW101]
Length=131

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (53%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV KS +FY   F +  +    +  + EL +G TTI+F        +   G
Sbjct  4    FGYTILYVEDVEKSIEFYENVFEFERKFISPDNDYGELNTGETTISFASKKLGAQNLEDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  S  ++   IEL F   D+    ++A   GAV V+ P+ K WGQ V YVRD DG 
Sbjct  64   FLES--SLEDKPFAIELAFITDDVGHLVQKATSFGAVLVSEPKKKPWGQVVAYVRDTDGF  121

Query  322  VVRMGSHVN  296
            ++ + + V+
Sbjct  122  LLEICTPVH  130



>ref|WP_036949202.1| glyoxalase [Providencia alcalifaciens]
 gb|ETT02793.1| glyoxalase-like domain protein [Providencia alcalifaciens PAL-3]
 gb|EUC98725.1| glyoxalase-like domain protein [Providencia alcalifaciens PAL-1]
Length=127

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/130 (31%), Positives = 69/130 (53%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  +V K+ DFY +AFG+          + EL++GSTTI+F+ +      G   
Sbjct  3    FKYAILYVENVEKTLDFYQQAFGFKQSFLHEGGDYGELDTGSTTISFSSLALMNQLGKGA  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                P +      P+ EL F+  +++ A  +AV+ GA  V   ++  WGQ +GYV D++G
Sbjct  63   VAPNPHA------PVFELAFETDNVENALAQAVKAGAKLVQDAQEMPWGQTIGYVHDLNG  116

Query  325  NVVRMGSHVN  296
             ++ + + V 
Sbjct  117  FLIEICTPVQ  126



>ref|XP_004352956.1| glyoxalase, putative [Acanthamoeba castellanii str. Neff]
 gb|ELR23428.1| glyoxalase, putative [Acanthamoeba castellanii str. Neff]
Length=408

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/134 (36%), Positives = 73/134 (54%), Gaps = 3/134 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEH-NRKWAELESGSTTIAFTPIHQRETDGLT  506
            F  T++Y  +V  + DFY +AFG   RRF H  +++AELE+GST +AF   ++   + L 
Sbjct  276  FGKTILYVREVETTVDFYERAFGLR-RRFVHETKQYAELETGSTALAFAS-NELARNNLA  333

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                 P         +E+     D+   +KRAVE GA  V+ P+   WGQ V YVRD++G
Sbjct  334  HIDFRPNDINAHPPGLEIALSSIDVHRDYKRAVEAGARSVSLPKTLPWGQVVAYVRDLNG  393

Query  325  NVVRMGSHVNEPKR  284
             +V + S +  P +
Sbjct  394  VLVEIASELKTPLK  407



>ref|WP_031254016.1| glyoxalase [Curvibacter lanceolatus]
Length=130

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 63/126 (50%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT+VY  DV  S  F+A AFG+ ++    +  + EL +G TT+AF        +   G
Sbjct  3    LGYTIVYVPDVKASLQFFATAFGFELKFLHESGTYGELATGETTLAFAAHELGHGNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   +S  ++   +EL     D+  A  RA++ GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVAASES--QKPLGMELGLVTPDVAGAHTRALQAGASELAAPSQKPWGQVVSYVRAPDGT  120

Query  322  VVRMGS  305
            ++ + S
Sbjct  121  LIELCS  126



>ref|WP_012389135.1| glyoxalase [Leptospira biflexa]
 ref|YP_001839541.1| putative glyoxalase family protein [Leptospira biflexa serovar 
Patoc strain 'Patoc 1 (Paris)']
 ref|YP_001963181.1| hypothetical protein LBF_2107 [Leptospira biflexa serovar Patoc 
strain 'Patoc 1 (Ames)']
 gb|ABZ94603.1| conserved hypothetical protein [Leptospira biflexa serovar Patoc 
strain 'Patoc 1 (Ames)']
 gb|ABZ98265.1| Putative glyoxalase family protein [Leptospira biflexa serovar 
Patoc strain 'Patoc 1 (Paris)']
Length=130

 Score = 77.0 bits (188),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 68/129 (53%), Gaps = 5/129 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT++Y  +V ++ DFY  AF Y  +       +AELE+G T +AF      + +    
Sbjct  4    YGYTILYVENVQRTIDFYENAFNYTQKFITPESDYAELETGETVLAFASYDVAKYN----  59

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            E++  +S   +  P  EL F   D+    K+A++ GA  V  P  K WGQ V YV+DI+G
Sbjct  60   EIDIVKSDSHKIPPAFELTFVTNDIINDLKKAIDAGAKLVKEPSSKPWGQIVAYVQDING  119

Query  325  NVVRMGSHV  299
             ++ + + +
Sbjct  120  FLIELCTPI  128



>ref|WP_019689642.1| glyoxalase [Pseudomonas fluorescens]
 gb|EXF96405.1| glyoxalase [Pseudomonas fluorescens HK44]
Length=130

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 64/132 (48%), Gaps = 8/132 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DVA S  F++ AFG   R       + ELE+G TT+AF        +  TG
Sbjct  3    FGYMIIYVPDVAASLQFFSSAFGIATRFLHEPATYGELETGETTLAFAADELAAMNFSTG  62

Query  502  EVE---TPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
             +    +P+  G     IE+     D+ AA  +A+  GA  +  P  K WGQ V YVR  
Sbjct  63   HISAHASPKPLG-----IEVGLVTDDVPAAHAKALHAGATEIAAPLIKPWGQTVSYVRCP  117

Query  331  DGNVVRMGSHVN  296
            DG +V + + V 
Sbjct  118  DGTLVELCTPVQ  129



>ref|WP_034867526.1| glyoxalase [Elizabethkingia miricola]
 gb|KGO11552.1| glyoxalase [Elizabethkingia miricola]
Length=130

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 65/126 (52%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  +V KS +FY K+FG+  +       + EL +G T+IAF  +    T+   G
Sbjct  4    FGYTIFYVKNVTKSIEFYEKSFGFERKFITPENDYGELNTGETSIAFASLELANTNLADG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP +   +    E+     + +   +++++ GA  V  P  K WGQ V Y+RDIDG 
Sbjct  64   --FTPANLNNKPFATEIGLITDNPENTVQQSLQYGATLVQEPVQKPWGQTVTYIRDIDGF  121

Query  322  VVRMGS  305
            ++ + S
Sbjct  122  LIEICS  127



>ref|WP_021070238.1| hypothetical protein [Sphingobacterium paucimobilis]
 gb|ERJ58745.1| hypothetical protein M472_08185 [Sphingobacterium paucimobilis 
HER1398]
Length=130

 Score = 76.6 bits (187),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 44/135 (33%), Positives = 68/135 (50%), Gaps = 14/135 (10%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAF---TPIHQRETDG  512
            F YT++Y  DVA++  FY + F +  +       + EL++G TTI+F   T   +  TDG
Sbjct  4    FKYTILYVADVAQAISFYERTFQFRKKFITPENDYGELDTGDTTISFASHTLASKNITDG  63

Query  511  LTGEVETPQSRGERRHP---IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYV  341
                        +  HP   IEL      ++   +RA+ NGA  V  P  K WGQ V Y+
Sbjct  64   FIA--------SDHSHPPFGIELGITTDTVEELVQRALHNGATLVASPVCKPWGQTVAYI  115

Query  340  RDIDGNVVRMGSHVN  296
            RDIDG ++ + + ++
Sbjct  116  RDIDGFLIEICTPIS  130



>ref|WP_028217490.1| glyoxalase [Burkholderia oxyphila]
Length=129

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 65/127 (51%), Gaps = 3/127 (2%)
 Frame = -3

Query  676  YTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEV  497
            YT+VY +DV  S  F+ KAFG   R F     + ELE+G TT AF   H+  +  L    
Sbjct  5    YTIVYVSDVVASLAFFEKAFGLKAR-FVLESGYGELETGQTTFAFAS-HELGSSNLPTGY  62

Query  496  ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVV  317
            E   +  ++   IE+ F    + AA  RAV  GA  +  P  K WGQ V YVR  DG +V
Sbjct  63   EAADAS-DKPLGIEIAFVTESVVAAHARAVSAGARSIKEPLLKPWGQMVSYVRCPDGTLV  121

Query  316  RMGSHVN  296
             + S V+
Sbjct  122  ELCSPVS  128



>ref|WP_039048478.1| MULTISPECIES: glyoxalase [Proteobacteria]
Length=130

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DV+ S +F+++AFG   R    +  + ELE+G TT+AF        +   G
Sbjct  3    LGYTIIYVPDVSASLEFFSRAFGIQQRFLHESGTYGELETGQTTLAFAAHELGALNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S   R    E+     D++ A + A+  GA+ +  P  K WGQ V Y+R  DG 
Sbjct  63   HVEAHSSA--RPLGFEIALVTEDVEQAHRSALSAGAIEMAAPTAKPWGQMVSYLRCPDGC  120

Query  322  VVRM  311
            VV +
Sbjct  121  VVEL  124



>ref|WP_012165702.1| glyoxalase [Acaryochloris marina]
 ref|YP_001519791.1| glyoxalase family protein [Acaryochloris marina MBIC11017]
 gb|ABW30472.1| glyoxalase family protein [Acaryochloris marina MBIC11017]
Length=127

 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 70/129 (54%), Gaps = 7/129 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV  + DF+ +AFG+N +    +  + EL +GSTT++F+         L  
Sbjct  3    FKYTILYVKDVTSTLDFFKRAFGFNQQFLHESGDYGELSTGSTTLSFSAF------SLMK  56

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            ++    ++ +   P+ E+ F+  D+ +   RA+E GAV      +++WGQ   YV D +G
Sbjct  57   DLGKSPAQAQAHAPVFEMAFESNDVRSDLTRALEAGAVLQQDIREESWGQTTAYVIDPNG  116

Query  325  NVVRMGSHV  299
             ++ + S V
Sbjct  117  FLIEICSPV  125



>ref|WP_012411273.1| glyoxalase/bleomycin resistance protein/dioxygenase [Nostoc punctiforme]
 ref|YP_001868261.1| glyoxalase/bleomycin resistance protein/dioxygenase [Nostoc punctiforme 
PCC 73102]
 gb|ACC83318.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Nostoc punctiforme 
PCC 73102]
Length=129

 Score = 76.3 bits (186),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 72/129 (56%), Gaps = 6/129 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRK---WAELESGSTTIAFTPIHQRETDG  512
            F YTV++ +DV K+ +FY KAFG  VRR   ++    WAE+E+G+TT+AF+     E   
Sbjct  3    FGYTVIWVDDVVKTVEFYEKAFGL-VRRTLLDKGQSIWAEIETGNTTLAFS--STSEAQN  59

Query  511  LTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
            L      P    +    I++ F   D+ +A+ RA+  GA  +N P+ +  GQ +  VRD 
Sbjct  60   LFPGGFHPNDPAQPPTLIQISFITPDVGSAYMRAIGAGAKALNAPKSQPGGQTIARVRDP  119

Query  331  DGNVVRMGS  305
            +G +V + S
Sbjct  120  NGVLVSLVS  128



>ref|WP_029633085.1| glyoxalase/bleomycin resistance protein/dioxygenase [[Scytonema 
hofmanni] UTEX B 1581]
Length=129

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 68/128 (53%), Gaps = 4/128 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEH--NRKWAELESGSTTIAFTPIHQRETDGL  509
            F YTV++ +DV K+ +FY KAFG   R  E   N  WAELE+GSTT+AF+     E   L
Sbjct  3    FGYTVIWVDDVVKTVEFYEKAFGLVRRTLEEKGNFIWAELETGSTTLAFSS--SNEAQKL  60

Query  508  TGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
                  P    +    I+L F   D+  A+ +A+  GA  ++ P+ +  G  +  VRD +
Sbjct  61   FPGGCHPNHSAQLPASIQLSFITPDVGTAYMKAIGAGAKGLDVPKTQHGGHTIARVRDPN  120

Query  328  GNVVRMGS  305
            G +V + S
Sbjct  121  GVLVSLVS  128



>ref|WP_024564460.1| glyoxalase [Elizabethkingia anophelis]
 gb|AIL45640.1| Lactoylglutathione lyase-related lyase [Elizabethkingia anophelis 
NUHP1]
Length=130

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 65/126 (52%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  +V KS +FY K+FG+  +       + EL +G T+IAF  +    T+   G
Sbjct  4    FGYTIFYVKNVTKSIEFYEKSFGFKRKFITPENDYGELNTGETSIAFASLELANTNLADG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP +  ++    E+       +   +++++ GA  V  P  K WGQ V Y+RD+DG 
Sbjct  64   --FTPGNLNDKPFATEIGLITDKPENTVQQSLQYGATLVQEPLQKPWGQTVAYIRDLDGF  121

Query  322  VVRMGS  305
            ++ + S
Sbjct  122  LIEICS  127



>ref|WP_009461425.1| MULTISPECIES: glyoxalase/bleomycin resistance [Alcaligenes]
 gb|EKU28915.1| glyoxalase/bleomycin resistance [Alcaligenes sp. HPC1271]
 gb|ERI33001.1| glyoxalase [Alcaligenes sp. EGD-AK7]
Length=129

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV ++ D++ +AFG   +       + ELE+G TT+AF        +   G
Sbjct  3    FGYTIIYVPDVGQALDYFNRAFGLTTKMLHETGLYGELETGQTTLAFAGEMLAYMNYPKG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             + +P +  E    IE+     D+ AA  +A+  G   + PP+DK WGQ V YV+  +  
Sbjct  63   HL-SPHAS-EVPLGIEIALVCDDVPAAHAKALAEGGTELAPPQDKPWGQVVSYVQTPERI  120

Query  322  VVRMGSHVN  296
            VV + + VN
Sbjct  121  VVELCTPVN  129



>ref|WP_034369388.1| glyoxalase [Comamonas testosteroni]
 gb|KGH29433.1| glyoxalase [Comamonas testosteroni]
Length=130

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 62/124 (50%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT+VY  DV+ S DF+++AFG   R    +  + ELE+G TT+AF        +   G
Sbjct  3    LGYTIVYVPDVSASLDFFSRAFGLQRRFLHESGTYGELETGQTTLAFAAHELGALNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S       I L  +  D++ A + A+  GA  +  P  K WGQ V Y+R  DG 
Sbjct  63   HVEAHSSAKPLGFEIALVTE--DVEQAHRNALSAGAAEMAAPTAKPWGQMVSYLRCPDGC  120

Query  322  VVRM  311
            VV +
Sbjct  121  VVEL  124



>ref|WP_003056394.1| glyoxalase [Comamonas testosteroni]
 gb|EED68155.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Comamonas 
testosteroni KF-1]
 gb|AIJ46335.1| glyoxalase [Comamonas testosteroni TK102]
Length=130

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 65/132 (49%), Gaps = 8/132 (6%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLT-  506
              YT+VY  DV  S DF+ +AFG   R    +  + ELE+G TT+AF      E  GL  
Sbjct  3    LGYTIVYVPDVPASLDFFTRAFGMQRRFLHESGTYGELETGQTTLAFA---AHELGGLNF  59

Query  505  --GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDI  332
              G VE   S       I L  +  D++ A + A+  GA  +  P  K WGQ V Y+R  
Sbjct  60   PGGHVEAHSSAKPLGFEIALVTE--DVEQAHRNALSAGAAEMAAPTAKPWGQVVSYLRCP  117

Query  331  DGNVVRMGSHVN  296
            DG VV + + +N
Sbjct  118  DGCVVELCTPMN  129



>ref|WP_027618740.1| glyoxalase [Pseudomonas sp. URHB0015]
Length=129

 Score = 75.5 bits (184),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV+ S +F++ AFG   R    +  + ELE+G+T +AF        +   G
Sbjct  3    FGYLIIYVPDVSASLEFFSAAFGLPTRFLHESGTYGELETGATALAFAADELAAMNFHGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S   +   +E+     D+ AA  +A++ GA  +  P++K WGQ V YVR  DG 
Sbjct  63   HVSAHSSA--KPLGMEVALVTEDVPAAHAQALKAGASEIAAPQEKPWGQTVSYVRCPDGT  120

Query  322  VVRMGSHV  299
            +V + S +
Sbjct  121  LVELCSPI  128



>ref|WP_019011379.1| hypothetical protein [Deinococcus aquatilis]
Length=129

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 75/129 (58%), Gaps = 3/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT ++   V ++ DFY +AFG+       + ++ EL++GSTT+AFT     +T  L+ 
Sbjct  3    YGYTALFVESVYETIDFYERAFGFERGTILESGEYGELKTGSTTLAFTARSIVKT--LSD  60

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P +  +   P+EL      +DA F+RAV  GAV V PPE+KTWG RV YVRD +G 
Sbjct  61   VAFEPAALHKPAPPLELGMVTDSVDADFERAVAAGAVVVKPPENKTWG-RVAYVRDNNGF  119

Query  322  VVRMGSHVN  296
            ++ + SH  
Sbjct  120  LIEIVSHTT  128



>ref|WP_009084294.1| glyoxalase [Elizabethkingia anophelis]
 gb|EHM99341.1| glyoxalase/bleomycin resistance protein/dioxygenase [Elizabethkingia 
anophelis Ag1]
 gb|ELR78578.1| glyoxalase/bleomycin resistance protein/dioxygenase [Elizabethkingia 
anophelis R26]
Length=130

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/126 (32%), Positives = 64/126 (51%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  +V KS +FY K+FG+  +       + EL +G T+IAF  +    T+   G
Sbjct  4    FGYTIFYVKNVTKSIEFYEKSFGFKRKFITPENDYGELNTGETSIAFASLELANTNLADG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
               TP +  ++    E+       +    ++++ GA  V  P  K WGQ V Y+RDIDG 
Sbjct  64   --FTPGNLNDKPFATEIGLITDKPENTVLQSLQYGATLVQEPLKKPWGQTVAYIRDIDGF  121

Query  322  VVRMGS  305
            ++ + S
Sbjct  122  LIEICS  127



>ref|WP_003063209.1| glyoxalase [Comamonas testosteroni]
 gb|EFI62818.1| Glyoxalase/bleomycin resistance [Comamonas testosteroni S44]
Length=130

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 63/124 (51%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DV+ S +F+++AFG   R    +  + ELE+G TT+AF        +   G
Sbjct  3    LGYTIIYVPDVSASLEFFSRAFGIQQRFLHESGTYGELETGQTTLAFAAHELGALNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S       I L  +  D++ A + A+  GA+ +  P  K WGQ V Y+R  DG 
Sbjct  63   HVEAHSSAKPLGFEIALVTE--DVEQAHRSALSAGAIEMAAPTAKPWGQMVSYLRCPDGC  120

Query  322  VVRM  311
            VV +
Sbjct  121  VVEL  124



>ref|WP_020738758.1| hypothetical protein [Sorangium cellulosum]
 ref|YP_008153239.1| hypothetical protein SCE1572_34330 [Sorangium cellulosum So0157-2]
 gb|AGP39119.1| hypothetical protein SCE1572_34330 [Sorangium cellulosum So0157-2]
Length=124

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 64/128 (50%), Gaps = 4/128 (3%)
 Frame = -3

Query  673  TVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEVE  494
             +VY  D  ++A FY +AFG+  +       + E++ G   + F  + +     L  E  
Sbjct  1    MIVYVPDAVEAAAFYERAFGFERKFVSDGNDYCEMQ-GDVPLGF--VREESLQKLLPEF-  56

Query  493  TPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVVR  314
                 G R    E+     D+DAAF RAV+ GA PV  P D  WGQRV YVRD++G +V 
Sbjct  57   VKNRPGARPAGFEILVTSKDVDAAFARAVQAGATPVAEPHDMPWGQRVSYVRDLNGVLVE  116

Query  313  MGSHVNEP  290
            + S  + P
Sbjct  117  ICSPWSAP  124



>ref|WP_028379450.1| glyoxalase [Legionella pneumophila]
Length=128

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 66/129 (51%), Gaps = 5/129 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLT-  506
            F YT++Y  DV +S  F+ KAFG+  R F H   + ELE+G T +AF   H      +T 
Sbjct  3    FGYTIIYVTDVKESLTFFEKAFGFKTR-FYHESGYGELETGETILAFAS-HDLGAKNITK  60

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            G V  P     +   +E+      +  A K+A+E GA  +  P  K WGQ V Y+R  +G
Sbjct  61   GYV--PADSSLKPLGMEIALVTESVVDAHKKAIELGAKSIEEPIQKPWGQTVSYIRCPNG  118

Query  325  NVVRMGSHV  299
             ++ + S +
Sbjct  119  TLIELCSPI  127



>ref|WP_026039430.1| glyoxalase [Limnohabitans sp. Rim28]
Length=128

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 68/129 (53%), Gaps = 4/129 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
              YT++Y   V  S  FY +AFG  V+RF H    + EL +G TT+AF      E +  T
Sbjct  3    LGYTIIYVPSVPSSLRFYEQAFGL-VKRFLHESGDYGELSTGETTLAFASHALGEANFPT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            G V+  +S       I L  +  ++D A + A+ +GA+ ++ P  K WGQ V Y+R  DG
Sbjct  62   GHVKASESNLPLGMEIALVTE--NVDTAHQSALLHGAIELSAPAQKPWGQVVSYLRAPDG  119

Query  325  NVVRMGSHV  299
             ++ + + V
Sbjct  120  TLIELCTSV  128



>ref|WP_003001923.1| glyoxalase [Sphingobacterium spiritivorum]
 gb|EFK60097.1| glyoxalase family protein [Sphingobacterium spiritivorum ATCC 
33861]
Length=131

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 66/129 (51%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y +DV KS  FY +AFG   +    +  +AEL +G TT++F       ++   G
Sbjct  4    LGYTILYVSDVTKSIQFYERAFGLERKFITAHNDYAELLTGETTLSFASKELAASNLPEG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              E   +   +   +E+ F    +D   + A+  GA  V+P   K WGQ+V Y+RD DG 
Sbjct  64   FTEA--NLQMKPFAVEIGFVTEQIDEVLETAISAGATVVSPLTTKPWGQQVVYLRDTDGF  121

Query  322  VVRMGSHVN  296
            ++ + + V 
Sbjct  122  LIELCTTVT  130



>ref|WP_020285958.1| glyoxalase/bleomycin resistance protein/dioxygenase [Osedax symbiont 
Rs2]
 gb|EPJ51224.1| glyoxalase/bleomycin resistance protein/dioxygenase [Osedax symbiont 
Rs2]
Length=128

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 68/130 (52%), Gaps = 5/130 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVAKS DFY +AF   ++       + EL++G TT+AF+ +      G   
Sbjct  3    FKYTILYVADVAKSLDFYRRAFAAKIKMLHPGNDYGELQTGVTTLAFSSLELIRESG---  59

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              +   +    R   E+ F+  D+ AA + A++ GA  +   E   WGQ + YV D DGN
Sbjct  60   --KNANAADIDRPCFEIAFETVDVVAAVEVALQAGAKLIQKTERMPWGQTIAYVADFDGN  117

Query  322  VVRMGSHVNE  293
            +V + S V +
Sbjct  118  LVEICSPVGQ  127



>ref|WP_014200502.1| glyoxalase [Owenweeksia hongkongensis]
 ref|YP_004987786.1| hypothetical protein [Owenweeksia hongkongensis DSM 17368]
 gb|AEV31141.1| hypothetical protein Oweho_0119 [Owenweeksia hongkongensis DSM 
17368]
Length=177

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/124 (30%), Positives = 70/124 (56%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT++Y  +V ++ +FY KA G++ +       + EL +G TTIAF       ++   G
Sbjct  49   YTYTILYVENVTETIEFYEKALGFSRKFITPENDYGELITGETTIAFASTELGNSNFKKG  108

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              E  ++ G +   +EL F   +++  F+ A+++GA    P  +K WGQ+VGY++D +G 
Sbjct  109  -FEKIKNSG-KPFGVELAFTTENIETYFQHAIKSGATEFEPLTEKPWGQKVGYLKDNNGF  166

Query  322  VVRM  311
            ++ +
Sbjct  167  LIEI  170



>ref|WP_012837890.1| glyoxalase [Comamonas testosteroni]
 ref|YP_003277807.1| Glyoxalase/bleomycin resistance [Comamonas testosteroni CNB-2]
 gb|ACY32511.1| Glyoxalase/bleomycin resistance [Comamonas testosteroni CNB-2]
Length=130

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 62/124 (50%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DV+ S +F+ +AFG   R    +  + ELE+G TT+AF        +   G
Sbjct  3    LGYTIIYVPDVSASLEFFNRAFGIEQRFLHESGTYGELETGQTTLAFAAHELGALNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S   R    E+     D++ A + A+  GA+ +  P  K WGQ V Y+R  DG 
Sbjct  63   HVEAHSSA--RPLGFEIALVTEDVEQAHRSALSAGAIEMAAPTAKPWGQMVSYLRCPDGC  120

Query  322  VVRM  311
            VV +
Sbjct  121  VVEL  124



>ref|WP_003080539.1| glyoxalase [Comamonas testosteroni]
 gb|EHN63388.1| glyoxalase/bleomycin resistance protein [Comamonas testosteroni 
ATCC 11996]
Length=130

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 61/124 (49%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DV+ S +F+ +AFG   R    +  + ELE+G TT+AF        +   G
Sbjct  3    LGYTIIYVPDVSASLEFFGRAFGIQQRFLHESGTYGELETGQTTLAFAAHELGALNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S       I L  +  D+  A + A+  GA+ +  P  K WGQ V Y+R  DG 
Sbjct  63   HVEAHSSAKPLGFEIALVTE--DVLQAHRNALSAGAIEMAAPTAKPWGQMVSYLRCPDGT  120

Query  322  VVRM  311
            VV +
Sbjct  121  VVEL  124



>ref|WP_027182733.1| glyoxalase [Desulfovibrio inopinatus]
Length=126

 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 65/128 (51%), Gaps = 5/128 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y +DVA + +FY  AFG        + ++ ELE+G+T +AF+     +  G   
Sbjct  3    FKYTIFYVDDVAATLEFYTNAFGLEKSFLHESGQYGELETGTTRLAFSSTSLMQQLGKNP  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            +  TP +        E+ F+  D+  A  +A++ GA  V     + WGQ   Y+ D++G 
Sbjct  63   KAPTPNAP-----TFEIAFETDDVAGALAQALKAGATLVQDVRHEPWGQTTAYIHDLNGY  117

Query  322  VVRMGSHV  299
            +V + S V
Sbjct  118  LVELCSPV  125



>ref|WP_029272344.1| glyoxalase [Flavobacterium sp. KJJ]
Length=130

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 68/130 (52%), Gaps = 4/130 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV KS  FY  AFG++ +    +  + EL +G TT++F   +    +   G
Sbjct  4    FGYTILYVEDVEKSLSFYENAFGFSRKFITPDHDYGELITGETTLSFASKNLASQNLKEG  63

Query  502  EVETPQSRGERR-HPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             V   QS  E +   IE+ F   ++    ++A   GA+ V  P  K WGQ V YVRD+DG
Sbjct  64   FV---QSNLEGKPFGIEIGFITDEVGELVQKATSLGAILVVEPTKKPWGQVVAYVRDLDG  120

Query  325  NVVRMGSHVN  296
             ++ + + + 
Sbjct  121  FLIEICTEMK  130



>ref|WP_009832979.1| glyoxalase [Marinomonas sp. MED121]
 gb|EAQ65349.1| hypothetical protein MED121_18950 [Marinomonas sp. MED121]
Length=130

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/128 (29%), Positives = 66/128 (52%), Gaps = 5/128 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  +V+++  FY  AFG N      +  + EL +G+T ++F+ +    + G   
Sbjct  6    FKYTILYVQNVSETLAFYEAAFGLNRAMLHESGDYGELVTGNTKLSFSSLALMTSLG---  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              + P ++ +     E+ F+  D+  A  +A+  GA  V   E   WGQ   YV+D++G 
Sbjct  63   --KKPGTQADLNACFEIAFETTDVPIALTKALAAGASLVQDVETMPWGQTTAYVKDLNGF  120

Query  322  VVRMGSHV  299
            +V + S V
Sbjct  121  LVELCSPV  128



>ref|WP_038839084.1| glyoxalase [Legionella pneumophila]
Length=127

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 65/128 (51%), Gaps = 3/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV +S  F+ KAFG+  R F H   + ELE+G T +AF   H      +T 
Sbjct  3    FGYTIIYVTDVKESLTFFEKAFGFKTR-FYHESGYGELETGETILAFAS-HDLGAKNIT-  59

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            +   P     +   +E+      +  A K+A++ GA  +  P  K WGQ V Y+R  +G 
Sbjct  60   KGYVPADSSPKPLGMEIALVTESVADAHKKAIDLGAESIEEPIQKPWGQTVSYIRCPNGT  119

Query  322  VVRMGSHV  299
            ++ + S +
Sbjct  120  LIELCSPI  127



>ref|WP_035649631.1| glyoxalase [Flavobacterium sp. Fl]
Length=130

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 68/132 (52%), Gaps = 10/132 (8%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTP---IHQRETDG  512
            F YT++Y  +V K+ +FY  AFG++ R    +  + EL +G  T++F      +Q   DG
Sbjct  4    FGYTILYVEEVEKAIEFYENAFGFSRRFISPDNDYGELITGEITLSFASKNLANQNLKDG  63

Query  511  LTGEVETPQSRGERR-HPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRD  335
                    QS  E +   IE+ F   D+    ++A   GAV V  P  K+WGQ V YVRD
Sbjct  64   FI------QSNLENKPFAIEIGFITEDVGELVEKATSFGAVLVTEPTKKSWGQVVAYVRD  117

Query  334  IDGNVVRMGSHV  299
             +G ++ + + V
Sbjct  118  PEGFLIEICTPV  129



>emb|CBA30829.1| hypothetical protein Csp_C25510 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=136

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 6/129 (5%)
 Frame = -3

Query  694  GAPA-FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRET  518
            GAP    YT++Y  DV  +  FY  AFG   R    +  + ELE+GSTT+AF+     + 
Sbjct  8    GAPMQLGYTILYVPDVPATLKFYEAAFGLTTRFLHESGDYGELETGSTTLAFSAHSLMQQ  67

Query  517  DGLTGEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVR  338
             G     + PQ+        E+     D+ AA +RA+  GA P+ P E   WGQ + Y+ 
Sbjct  68   LG-----KNPQAASPTAPCFEIALCTPDVAAALERAIAAGATPMRPLEVMPWGQTIAYLA  122

Query  337  DIDGNVVRM  311
            DI+G +V +
Sbjct  123  DINGFLVEL  131



>ref|WP_021346764.1| glyoxalase [Elizabethkingia meningoseptica]
 gb|EQB93857.1| glyoxalase [Elizabethkingia meningoseptica 502]
 gb|KFC33597.1| glyoxalase [Elizabethkingia meningoseptica]
Length=130

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 64/126 (51%), Gaps = 2/126 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  +V KS +FY K+FG+  +       + EL +G T+IAF  +    T+   G
Sbjct  4    FGYTIFYVKNVTKSIEFYEKSFGFERKFITPENDYGELNTGETSIAFASLELANTNLADG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                P +  ++    E+       +   +++++ GA  V  P  K WGQ V Y+RDIDG 
Sbjct  64   --FRPGNLNDKPFATEIGLITDKPENTVQQSLQYGATLVQEPLQKPWGQTVAYIRDIDGF  121

Query  322  VVRMGS  305
            ++ + S
Sbjct  122  LIEICS  127



>emb|CDT03229.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Sphingobacterium 
sp. PM2-P1-29]
Length=131

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 70/131 (53%), Gaps = 4/131 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRF-EHNRKWAELESGSTTIAFTPIHQRETDGLT  506
            F YT++Y +DV +S  FY + FG+ VR+F      + EL +G TTI+F   H+     LT
Sbjct  4    FKYTILYVSDVTRSIQFYEQVFGF-VRKFITPENDYGELITGETTISFAS-HKLANTNLT  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                T  SR ++   IEL     +++    +  E   V V  P  K WGQ V YVRD+DG
Sbjct  62   AGY-TASSRLDKPFGIELGIVTDNVEDLVDKVWEFNGVIVEQPTIKPWGQTVSYVRDLDG  120

Query  325  NVVRMGSHVNE  293
             ++ + + ++E
Sbjct  121  FLIEICTPMHE  131



>dbj|BAP42040.1| glyoxylase [Pseudomonas sp. StFLB209]
Length=129

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA S  F+ +AFG   R    +  + ELE+G+T +AF      +++  TG
Sbjct  3    FGYTIIYVPDVAASLAFFNQAFGLATRFVHESGTYGELETGATALAFAADELAQSNFSTG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S       + L  D  D+ AA  RAV+ GA  +  P+ K WGQ V YVR  DG 
Sbjct  63   HVAAHSSSKPLGMEVALVTD--DVAAAHARAVQAGATELASPQTKPWGQTVSYVRCPDGT  120

Query  322  VVRMGSHVN  296
            +V + S + 
Sbjct  121  LVELCSPIG  129



>ref|WP_034766564.1| glyoxalase [Hyphomonas sp. CY54-11-8]
 gb|KCZ47219.1| glyoxalase [Hyphomonas sp. CY54-11-8]
Length=129

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 67/133 (50%), Gaps = 7/133 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIH-QRETDGLT  506
            F YT++Y +DV+ S DF+ +AFG        +  + E+ +G+T +AF+     R+ D   
Sbjct  3    FRYTILYVDDVSASLDFFERAFGLERAFLHESGDYGEMTTGTTKLAFSSKELMRQLD---  59

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
               + P S        E+ F+  D+  A +RAV+ GA  +    D+ WGQ   YV D +G
Sbjct  60   ---KNPASPRPDAPTFEIAFETDDVAGALQRAVDAGATLIQNARDEPWGQTTSYVSDPNG  116

Query  325  NVVRMGSHVNEPK  287
             ++ + S V  P 
Sbjct  117  YLIEICSAVQLPS  129



>ref|WP_026483986.1| glyoxalase [Alcaligenes faecalis]
Length=129

 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV ++ D++ +AFG   +       + ELE+G TT+AF        +   G
Sbjct  3    FGYTIIYVPDVGQALDYFNRAFGLTTKMLHETGLYGELETGQTTLAFAGEMLAYMNYPKG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             + T  S       I L  D  D+ AA  +A+  G   + PP++K WGQ V YV+  +  
Sbjct  63   HLSTHASDVPLAIEIALVCD--DVPAAHTKALAEGGTELAPPQNKPWGQMVSYVQTPERV  120

Query  322  VVRMGSHVN  296
            VV + + V 
Sbjct  121  VVELCTPVK  129



>ref|WP_035622730.1| glyoxalase [Flavobacterium hydatis]
 gb|KFF15787.1| glyoxalase [Flavobacterium hydatis]
Length=130

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 64/124 (52%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y NDV+KS  FY  AFG+  +       + EL +G TTI+F       ++   G
Sbjct  4    FGYTILYVNDVSKSISFYENAFGFTRKFVTPENDYGELSTGETTISFASKELANSNLKDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  +   +    EL F   +++    ++ E GA  +   + K W Q V Y+RDIDG 
Sbjct  64   FIESDLAN--KPFATELGFITDNVNEILIKSKEAGATILQEAKQKPWEQTVAYIRDIDGF  121

Query  322  VVRM  311
            ++ +
Sbjct  122  LIEV  125



>ref|WP_003007639.1| glyoxalase [Sphingobacterium spiritivorum]
 gb|EEI92834.1| glyoxalase family protein [Sphingobacterium spiritivorum ATCC 
33300]
Length=131

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 65/129 (50%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y +DV KS  FY KAFG   +       +AEL +G TT++F       ++   G
Sbjct  4    LGYTILYVSDVTKSIQFYEKAFGLERKFITPQNDYAELLTGETTLSFASKELAASNLPDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              E   +   +   +E+ F    ++   + A+  GA  V+P   K WGQ+V Y+RD DG 
Sbjct  64   FTEA--NLQIKPFAVEIGFVTEQIEEVLETAISVGATVVSPLTTKPWGQQVVYLRDTDGF  121

Query  322  VVRMGSHVN  296
            ++ + + V 
Sbjct  122  LIELCTAVQ  130



>ref|WP_032863523.1| glyoxalase [Pseudomonas sp. FH4]
 gb|ETK14078.1| glyoxalase [Pseudomonas sp. FH4]
Length=130

 Score = 73.6 bits (179),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 66/124 (53%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+VY  DVA S  F+  AFG+N R    +  + ELE+G TT++F      E +   G
Sbjct  3    FAYTIVYVPDVAASLQFFENAFGFNRRFLHESGTYGELETGGTTLSFAAHELGEMNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V  P    ++   +EL F   D+ AA  +A+  GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HV--PAHSSKQPLGMELGFVTDDVPAAHAKALAAGATELTAPISKPWGQVVSYVRGPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>gb|AHE97514.1| glyoxalase [Thioalkalivibrio thiocyanoxidans ARh 4]
Length=131

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 42/132 (32%), Positives = 66/132 (50%), Gaps = 7/132 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DVA + DFY +AFG        +  + EL +G T +AF+      +  L  
Sbjct  3    FRYTILYVGDVAATLDFYGRAFGLETAFLHPSGDYGELSTGETKLAFS------SRRLMQ  56

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            ++     R + + P+ EL  +  D+ AA  RA+  GA       ++ WGQ   YV D++G
Sbjct  57   QLGKAPGRPDVKTPVFELALETDDVHAALDRALAAGAALEQEVREEPWGQTTAYVSDVNG  116

Query  325  NVVRMGSHVNEP  290
             +V + S V  P
Sbjct  117  YLVEICSPVQLP  128



>ref|WP_022561640.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo]
 ref|YP_008642219.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo]
 emb|CCO61166.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo]
 emb|CCN80679.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo BLFn1]
 emb|CCN93365.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo ENn2]
 emb|CCO42205.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo SFn135]
 emb|CCO55260.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo Wn13]
 emb|CCN90021.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo SFn27]
Length=128

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  +V ++ +FY  AFG           +AEL++G+TT++F+ +       L  
Sbjct  3    LKYTILYVENVEQTLEFYESAFGLKRAMLHEGGDYAELDTGNTTLSFSSLD------LMN  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +     R  +  P  E+ F+  D+  + ++A++ GA  V P E+  WGQ   YV DI+G
Sbjct  57   RLGKGAQRPTKGKPNFEIAFETDDVAGSLQKALDAGAELVQPVEEMPWGQTTSYVHDING  116

Query  325  NVVRMGSHVN  296
             ++ + S V+
Sbjct  117  FLIEICSPVS  126



>ref|WP_033562864.1| glyoxalase [Sphingobacteriaceae bacterium DW12]
Length=130

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 67/127 (53%), Gaps = 4/127 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRK-WAELESGSTTIAFTPIHQRETDGLT  506
            FAYT++Y  DV +S  FY + FG+ VR+F    K +AEL++G TTIAF   H    + L+
Sbjct  4    FAYTILYVPDVIRSIQFYEQVFGF-VRKFVTPEKDYAELDTGDTTIAFAS-HSLAQNNLS  61

Query  505  GEVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
                   +  +R   IEL      ++    +  E+    V  P  K WGQ V YVRD++G
Sbjct  62   AGYRA-SNIADRPFGIELGIVTDQVEELIDKVWEHNGTIVEQPTQKPWGQTVAYVRDVNG  120

Query  325  NVVRMGS  305
             ++ + S
Sbjct  121  FLIEICS  127



>ref|WP_035269501.1| glyoxalase [Alcaligenes faecalis]
 gb|KGP02748.1| glyoxalase [Alcaligenes faecalis]
Length=129

 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 64/129 (50%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV ++ D++ +AFG   +       + ELE+G TT+AF        +   G
Sbjct  3    FGYTIIYVPDVGQALDYFNRAFGLPTKMLHETGLYGELETGQTTLAFAGEMLAYMNYPKG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             + T  S       I L  D  D+ AA  +A+  G   + PP++K WGQ V YV+  +  
Sbjct  63   HLSTHASDVPLAIEIALVCD--DVPAAHAKALAEGGTELAPPQNKPWGQMVSYVQTPERV  120

Query  322  VVRMGSHVN  296
            VV + + V 
Sbjct  121  VVELCTPVK  129



>ref|WP_022613724.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo]
 emb|CCO49679.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo SOn1]
Length=128

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 68/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  +V ++ +FY  AFG           +AEL++G+TT++F+ +       L  
Sbjct  3    LKYTILYVENVEQTLEFYENAFGLKRAMLHEGGDYAELDTGNTTLSFSSLD------LMN  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +     R  +  P  E+ F+  D+  + ++A++ GA  V P E+  WGQ   YV DI+G
Sbjct  57   RLGKGAQRPTKGKPNFEIAFETDDVAGSLQKALDAGAELVQPVEEMPWGQTTSYVHDING  116

Query  325  NVVRMGSHVN  296
             ++ + S V+
Sbjct  117  FLIEICSPVS  126



>ref|WP_026984069.1| glyoxalase [Flavobacterium sp. URHB0058]
Length=130

 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 66/128 (52%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  +V +S  FY   FG++ +       + EL +G TT++F   +    +   G
Sbjct  4    FGYTILYVENVEESIVFYENVFGFSRKFIAPGNDYGELITGETTLSFASKNLAAQNLKDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE+  +   +   IE+ F   D+    ++A   GAV V  P  K WGQ V YVRD+DG 
Sbjct  64   FVES--NLDNKPFAIEIGFITDDVPELVQKATSFGAVLVKEPTAKPWGQVVAYVRDLDGF  121

Query  322  VVRMGSHV  299
            +V + + V
Sbjct  122  LVEICTEV  129



>ref|WP_034351770.1| glyoxalase [Comamonas testosteroni]
 gb|KGG82738.1| glyoxalase [Comamonas testosteroni]
 gb|KGG83016.1| glyoxalase [Comamonas testosteroni]
 gb|KGG85235.1| glyoxalase [Comamonas testosteroni]
 gb|KGG92881.1| glyoxalase [Comamonas testosteroni]
 gb|KGH03332.1| glyoxalase [Comamonas testosteroni]
 gb|KGH08440.1| glyoxalase [Comamonas testosteroni]
 gb|KGH15578.1| glyoxalase [Comamonas testosteroni]
 gb|KGH18089.1| glyoxalase [Comamonas testosteroni]
 gb|KGH24824.1| glyoxalase [Comamonas testosteroni]
Length=130

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 62/124 (50%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  DV+ S +F+++AFG   R    +  + ELE+G TT+AF        +   G
Sbjct  3    LGYTIIYVPDVSASLEFFSRAFGIQQRFLHESGTYGELETGQTTLAFAAHELGALNFPGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S       I L  +  ++  A + A+  GA+ +  P  K WGQ V Y+R  DG 
Sbjct  63   HVEAHSSAKPLGFEIALVTE--EIVQAHRNALSAGAIEMAAPTAKPWGQMVSYLRCPDGC  120

Query  322  VVRM  311
            VV +
Sbjct  121  VVEL  124



>ref|WP_014437934.1| glyoxalase [Phycisphaera mikurensis]
 ref|YP_005446618.1| hypothetical protein PSMK_25620 [Phycisphaera mikurensis NBRC 
102666]
 dbj|BAM04721.1| hypothetical protein PSMK_25620 [Phycisphaera mikurensis NBRC 
102666]
Length=132

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 68/133 (51%), Gaps = 10/133 (8%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRET--DGL  509
            F++T+VY   V  S  F+ +AFG        +  + EL++G+T +AF       T  DG 
Sbjct  3    FSHTIVYVERVQDSLAFWQRAFGVRPGFVHESGDYGELDTGTTKLAFASHRLAATLFDGS  62

Query  508  TGEVETPQSRGERRHPI--ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRD  335
              E +        R PI  E+ F   D+ AA++RAV +GA     P +  WGQ V YVRD
Sbjct  63   YRETDAA------RRPIGFEVSFVVDDVQAAYERAVASGAEAFAAPVEHPWGQTVAYVRD  116

Query  334  IDGNVVRMGSHVN  296
             DG +V +GS + 
Sbjct  117  GDGTIVALGSEME  129



>ref|WP_020889650.1| Lactoylglutathione lyase [Cyclobacterium qasimii]
 gb|EPR66425.1| Lactoylglutathione lyase [Cyclobacterium qasimii M12-11B]
Length=122

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/121 (31%), Positives = 69/121 (57%), Gaps = 2/121 (2%)
 Frame = -3

Query  658  NDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEVETPQSR  479
            ++V ++  FY KAFG++ +       + EL SG TTI+F  I    ++   G    P  +
Sbjct  2    DNVKETIAFYEKAFGFHKKFVTPENDYGELLSGETTISFASIALGNSNFSKGY--NPMVK  59

Query  478  GERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVVRMGSHV  299
             ++   +E+ F   +++  FKRA++ GA      ++K WGQ+VGY+RDI+G ++ + + +
Sbjct  60   SDKPAGMEMAFVSENIEEDFKRALDAGATEFEAIKEKPWGQKVGYLRDINGILIEICTPI  119

Query  298  N  296
            +
Sbjct  120  D  120



>ref|WP_017479222.1| glyoxalase [Pseudomonas sp. PAMC 26793]
Length=129

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 66/124 (53%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            FAYT+VY  DVA S  F+ KAFG + R    +  + ELE+G TT++F      E +   G
Sbjct  3    FAYTIVYVPDVAASLQFFEKAFGLSRRFLHESGTYGELETGGTTLSFAAHELGEINFKGG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             VE   S  ++   +EL F   D+  A  RA+  GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVEAHAS--QQPLGMELGFVTEDVSKAHARALAAGAKELAAPSTKPWGQVVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_008151854.1| glyoxalase [Pseudomonas sp. GM41(2012)]
 gb|EUB75212.1| Glyoxalase-like domain containing protein [Pseudomonas sp. GM41(2012)]
Length=129

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 59/124 (48%), Gaps = 2/124 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV  S  F++ AFG   R    +  + ELE+G T +AF        +  +G
Sbjct  3    FGYLIIYVPDVPASLQFFSSAFGLTTRFLHESGTYGELETGETALAFAADELAAMNFSSG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V    S   +   IE+     D+ +A  +A+  GA  +  P  K WGQ V YVR  DG 
Sbjct  63   HVSAHSSA--KPLGIEVGLVTDDVPSAHAKALNAGATEITAPALKPWGQTVSYVRCPDGT  120

Query  322  VVRM  311
            +V +
Sbjct  121  LVEL  124



>ref|WP_003800776.1| glyoxalase [Alcaligenes faecalis]
 gb|EJC65170.1| glyoxalase/bleomycin resistance [Alcaligenes faecalis subsp. 
faecalis NCIB 8687]
Length=129

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV ++ D++ +AFG + +       + ELE+G TT++F        +   G
Sbjct  3    FGYTIIYVPDVGQALDYFNRAFGLSTKMLHETGLYGELETGQTTLSFAAEMLAYMNYPKG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             + +P +  E    IE+     D+ AA  +A+  G   + PP++K WGQ V YV+  +  
Sbjct  63   HL-SPHAS-EVPLGIEIALVCDDVPAAHAKALAEGGTELAPPQEKPWGQMVSYVQTPERI  120

Query  322  VVRMGSHVN  296
            VV + + V 
Sbjct  121  VVELCTPVK  129



>ref|WP_019645916.1| hypothetical protein [Novispirillum itersonii]
Length=128

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/130 (38%), Positives = 70/130 (54%), Gaps = 9/130 (7%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNR-KWAELESGSTTIAFTPIHQRETDGLT  506
            F YT+++  DVA S  FY +AFG   RRF H+   + EL +G T +AF+ +       L 
Sbjct  3    FRYTILFVEDVAASLAFYERAFGLT-RRFLHDGGDYGELATGETRLAFSSVR------LM  55

Query  505  GEVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDID  329
             ++    SR     P+ E+ F+  D+ AA  +A+  GAV V P   + WGQ   YVRD D
Sbjct  56   QQLGKSPSRPRPEAPVFEIAFETDDVAAALAQAMVAGAVLVQPVRQEDWGQTTAYVRDPD  115

Query  328  GNVVRMGSHV  299
            G +V + S V
Sbjct  116  GYLVELCSPV  125



>ref|WP_002990178.1| MULTISPECIES: glyoxalase [Myroides]
 gb|EHQ43253.1| Glyoxalase/bleomycin resistance protein/dioxygenase [Myroides 
odoratus DSM 2801]
 gb|EKB06638.1| hypothetical protein HMPREF9716_02293 [Myroides [odoratimimus] 
CIP 103059]
Length=130

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 65/129 (50%), Gaps = 3/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            ++YT++Y   V  +  FY  AFG+  +       +AEL SG TT+AF      +T+   G
Sbjct  4    YSYTIMYVKQVEVTVAFYESAFGFERKFITPEGDYAELISGDTTLAFAAEELAQTNLSKG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                 +   +R   IEL F   D++ A +RAV  GA    P + K WGQ V YV D +G 
Sbjct  64   FTVVSK---DRVMGIELGFVVEDVEQAVQRAVAAGASLYEPVKVKPWGQTVAYVTDCNGF  120

Query  322  VVRMGSHVN  296
            ++ + + + 
Sbjct  121  LIELCTAIQ  129



>ref|WP_027721334.1| glyoxalase [Desulfovibrio zosterae]
Length=128

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 67/129 (52%), Gaps = 7/129 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV  +  FY   FG+N +    + ++ EL++G TT+AF+        G + 
Sbjct  3    FKYTILYVEDVTSTIIFYEDVFGFNRKMIHESGEYGELDTGGTTLAFSSHKLMNQLGKSS  62

Query  502  EVETPQSRGERRHPI-ELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
            +   P +      P+ E+ F+  ++  A ++A   GA  +  P+ + WGQ + YV D +G
Sbjct  63   DTPNPSA------PVFEIAFETENVAEALEKARSAGAKIIQEPQQQPWGQTIAYVADNNG  116

Query  325  NVVRMGSHV  299
             ++ + S V
Sbjct  117  FLIEICSPV  125



>ref|WP_005503528.1| glyoxalase [Grimontia hollisae]
 gb|EEY72516.1| lactoylglutathione lyase [Grimontia hollisae CIP 101886]
Length=127

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (49%), Gaps = 5/129 (4%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y   V ++  FY KAFG        +  + EL++G T +AF+ +    + G   
Sbjct  3    FRYTILYVPSVEQTLAFYEKAFGCTRAFLHESGDYGELDTGETKLAFSSLELMTSLG---  59

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
              + P S   +    E+ F+  D+     RA+E GA  V   E   WGQ   YVRD++G 
Sbjct  60   --KHPSSGNAQSPNFEIAFETGDVAGHLARALEAGAELVQDTEHMPWGQTTAYVRDLNGY  117

Query  322  VVRMGSHVN  296
            +V + + V 
Sbjct  118  LVEICTPVG  126



>ref|WP_008464891.1| glyoxalase [Flavobacterium sp. F52]
 gb|EJG01733.1| glyoxalase/bleomycin resistance protein/dioxygenase [Flavobacterium 
sp. F52]
Length=131

 Score = 71.2 bits (173),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  +V +S  FY  AFG++ +       + EL +G TT++F            G
Sbjct  4    FGYTILYVENVEESIAFYENAFGFSRKFVTPEGDYGELITGETTLSFASKKLASKSLPDG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             +E+  S  ++   IE+ F   ++    ++A   GAV V+ P +K WGQ V Y RD++G 
Sbjct  64   FIES--SLEDKPFAIEIGFITENVPEVLQKATSFGAVIVSEPVEKPWGQIVAYARDLNGF  121

Query  322  VVRMGSHVN  296
            ++ + + V 
Sbjct  122  LIEICTEVK  130



>ref|WP_022602522.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo]
 emb|CCN69405.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo SFn118]
Length=128

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 67/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  +V ++ +FY  AFG           +AEL++G+TT++ + +       L  
Sbjct  3    LKYTILYVENVEQTLEFYESAFGLKRAMLHEGGDYAELDTGNTTLSLSSLD------LMN  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +     R  +  P  E+ F+  D+  + ++A++ GA  V P E+  WGQ   YV DI+G
Sbjct  57   RLGKGAQRPTKGKPNFEIAFETDDVAGSLQKALDAGAELVQPVEEMPWGQTTSYVHDING  116

Query  325  NVVRMGSHVN  296
             ++ + S V+
Sbjct  117  FLIEICSPVS  126



>ref|WP_019644618.1| hypothetical protein [Novispirillum itersonii]
Length=132

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 63/128 (49%), Gaps = 2/128 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT++Y  DV  S  F+ +AFG   R    +  + EL +G T +AF            G
Sbjct  3    FGYTIIYVADVPASLAFFGRAFGVETRYLHDSSDYGELATGDTVLAFAAHSVANALLPQG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             V   QS  +R   +E+     D+ AA ++AV  GAV +  P  + WGQ V ++R  DG 
Sbjct  63   YVAADQS--DRPLGMEVALVTDDVPAAHEKAVAAGAVSLQAPVRQPWGQTVSHLRCPDGL  120

Query  322  VVRMGSHV  299
            +V + S V
Sbjct  121  LVELCSPV  128



>ref|WP_034745546.1| glyoxalase [Chryseobacterium vrystaatense]
 gb|KFF25323.1| glyoxalase [Chryseobacterium vrystaatense]
Length=130

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 66/130 (51%), Gaps = 4/130 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV KS +FY   F   ++     + + EL +G T+++F  +    ++   G
Sbjct  4    FKYVILYVEDVEKSMNFYQDTFDTPIKFITPEKDYGELLTGETSLSFASVSLASSNIKEG  63

Query  502  EVETPQSRGERR-HPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +    S+ E +   IEL F   D++    +A+ENGAV       K WGQ+V Y++D D 
Sbjct  64   FL---SSKSEAKPFGIELGFTTDDVERLVAKAIENGAVLYEDITVKPWGQKVAYIKDTDN  120

Query  325  NVVRMGSHVN  296
             +V + + + 
Sbjct  121  YLVEICTEIQ  130



>ref|WP_034786072.1| glyoxalase [Exiguobacterium acetylicum]
Length=126

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 64/124 (52%), Gaps = 6/124 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            + YT++Y  D A++  FY    G +V+  EH   + E E+G TT+AF    + +   L  
Sbjct  5    YGYTILYVEDTARTLTFYRDVLGLSVKA-EHG-SYIEFETGQTTLAFN--TREDVQQLIP  60

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
            +   P   G+ +  +E+ F   D+   F++ VE G   V  P  K WGQ V YV D DG+
Sbjct  61   DYTIP--SGKTQQTLEIGFITDDVPTLFQKVVEAGYETVLAPSQKPWGQVVAYVLDPDGH  118

Query  322  VVRM  311
            ++ +
Sbjct  119  LIEL  122



>ref|WP_034714565.1| glyoxalase [Chryseobacterium soli]
 gb|KFF10553.1| glyoxalase [Chryseobacterium soli]
Length=130

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/130 (28%), Positives = 68/130 (52%), Gaps = 4/130 (3%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV KS +FY   F   ++     + + EL +G T+++F  +    ++   G
Sbjct  4    FKYVILYVADVEKSMNFYKDTFNLEIKFITPEKDYGELTTGETSLSFASLELASSNIKEG  63

Query  502  EVETPQSRGERR-HPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +   +S G+++   IEL F   D+++  + ++ NGA        K WGQ+V Y+RD+D 
Sbjct  64   FL---KSEGQQKPFGIELGFVTDDVESLVQTSIANGASLYEEITVKPWGQKVAYIRDVDH  120

Query  325  NVVRMGSHVN  296
             +V + + + 
Sbjct  121  YLVEICTEIK  130



>ref|WP_004398095.1| glyoxalase [Vibrio nigripulchritudo]
 gb|EGU61740.1| glyoxalase/bleomycin resistance protein/dioxygenase [Vibrio nigripulchritudo 
ATCC 27043]
 emb|CCN38325.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo AM115]
 emb|CCN65742.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo Pon4]
 emb|CCN43433.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo FTn2]
 emb|CCN56473.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo MADA3021]
 emb|CCN62033.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo MADA3029]
 emb|CCN75288.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo SO65]
 emb|CCN49884.1| putative Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl 
dioxygenase [Vibrio nigripulchritudo MADA3020]
Length=128

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 67/130 (52%), Gaps = 7/130 (5%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
              YT++Y  +V ++ +FY  AFG           +AEL++G+TT++ + +       L  
Sbjct  3    LKYTILYVENVEQTLEFYENAFGLKRAMLHEGGDYAELDTGNTTLSLSSLD------LMN  56

Query  502  EVETPQSRGERRHP-IELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDG  326
             +     R  +  P  E+ F+  D+  + ++A++ GA  V P E+  WGQ   YV DI+G
Sbjct  57   RLGKGAQRPTKGKPNFEIAFETDDVAGSLQKALDAGAELVQPVEEMPWGQTTSYVHDING  116

Query  325  NVVRMGSHVN  296
             ++ + S V+
Sbjct  117  FLIEICSPVS  126



>ref|WP_034730479.1| glyoxalase [Chryseobacterium sp. JM1]
 gb|KFF17186.1| glyoxalase [Chryseobacterium sp. JM1]
Length=130

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F Y ++Y  DV KS +FY + F   ++     + + EL +G T+++F  I    ++   G
Sbjct  4    FKYVILYVEDVEKSMNFYHQTFDLPIKFITPEKDYGELLTGETSLSFASISLASSNIKKG  63

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
             + +     E+   IEL F   +++   ++AV+NGAV       K WGQ+V YV+D D  
Sbjct  64   FLSSKSE--EKPFGIELGFTTDNVEKLVEKAVQNGAVLYEDIAVKPWGQQVAYVKDPDHY  121

Query  322  VVRMGSHVN  296
            +V + + + 
Sbjct  122  LVEICTEIQ  130



>ref|WP_015486659.1| glyoxalase [Thalassolituus oleivorans]
 ref|YP_007682165.1| glyoxalase [Thalassolituus oleivorans MIL-1]
 emb|CCU71926.1| glyoxalase [Thalassolituus oleivorans MIL-1]
Length=131

 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 63/129 (49%), Gaps = 2/129 (2%)
 Frame = -3

Query  682  FAYTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTG  503
            F YT+ Y  DV  +  F+ KAF    R       + EL+SG TT+AF   H+      +G
Sbjct  4    FGYTINYVCDVDMALTFFEKAFEMKRRFITDENDYGELDSGETTLAFAS-HELGLSNFSG  62

Query  502  EVETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGN  323
                  +  ++   IE+    AD+    +RA++ GAV +  PE K WGQ V Y+R   G 
Sbjct  63   GY-ISSTESDKPLGIEIALVTADVSGLHQRAIQYGAVELKSPETKPWGQIVSYIRCPSGI  121

Query  322  VVRMGSHVN  296
            ++ + + + 
Sbjct  122  LIELCTPIQ  130



>ref|WP_006932564.1| glyoxalase [Labrenzia aggregata]
 gb|EAV45264.1| glyoxalase family protein superfamily protein [Labrenzia aggregata 
IAM 12614]
Length=131

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/129 (32%), Positives = 63/129 (49%), Gaps = 5/129 (4%)
 Frame = -3

Query  676  YTVVYCNDVAKSADFYAKAFGYNVRRFEHNRKWAELESGSTTIAFTPIHQRETDGLTGEV  497
            YT++Y ++VA + DFY KAFG        +  + EL +G T +AF+     +  G     
Sbjct  5    YTILYVDNVAAALDFYEKAFGLQRLFLHESGDYGELATGETKLAFSSKSLMKQLG-----  59

Query  496  ETPQSRGERRHPIELCFDYADLDAAFKRAVENGAVPVNPPEDKTWGQRVGYVRDIDGNVV  317
            +TP +   +    EL F+  D+  +  RAV  GA  +    ++ WGQ   YV D  G +V
Sbjct  60   KTPGTSDPKSPVFELAFETDDVAGSLDRAVTAGATRLQDAREEPWGQITSYVSDPFGYLV  119

Query  316  RMGSHVNEP  290
             + S V  P
Sbjct  120  EICSPVQLP  128



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185754102464