BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7103_g1_i2 len=1663 path=[1845:0-694 103:695-1662]

Length=1663
                                                                      Score     E

ref|XP_006348233.1|  PREDICTED: lanC-like protein 2-like                624   0.0      
emb|CDP05888.1|  unnamed protein product                                603   0.0      
ref|XP_004244212.1|  PREDICTED: lanC-like protein GCR2                  602   0.0      
ref|XP_002284781.1|  PREDICTED: lanC-like protein GCR2                  593   0.0      Vitis vinifera
ref|XP_011042485.1|  PREDICTED: lanC-like protein GCR2                  593   0.0      
ref|XP_006370294.1|  hypothetical protein POPTR_0001s41360g             589   0.0      
gb|KDO74125.1|  hypothetical protein CISIN_1g015433mg                   586   0.0      
ref|XP_006464716.1|  PREDICTED: lanC-like protein GCR2-like             585   0.0      
ref|XP_009767466.1|  PREDICTED: lanC-like protein GCL2 isoform X2       584   0.0      
ref|XP_011098332.1|  PREDICTED: lanC-like protein GCR2                  584   0.0      
ref|XP_006451926.1|  hypothetical protein CICLE_v10008488mg             583   0.0      
ref|XP_009767465.1|  PREDICTED: lanC-like protein GCL2 isoform X1       579   0.0      
gb|KDP27026.1|  hypothetical protein JCGZ_20961                         579   0.0      
ref|XP_007021343.1|  G protein coupled receptor                         576   0.0      
ref|XP_010099009.1|  hypothetical protein L484_025669                   575   0.0      
ref|XP_008226665.1|  PREDICTED: lanC-like protein GCR2                  575   0.0      
ref|XP_002534246.1|  catalytic, putative                                575   0.0      Ricinus communis
ref|XP_010245303.1|  PREDICTED: lanC-like protein GCL2                  575   0.0      
ref|XP_009617549.1|  PREDICTED: lanC-like protein GCL2 isoform X2       571   0.0      
ref|XP_004244211.1|  PREDICTED: lanC-like protein GCL2                  570   0.0      
ref|XP_010062888.1|  PREDICTED: lanC-like protein GCR2                  568   0.0      
ref|XP_009343572.1|  PREDICTED: lanC-like protein GCR2                  567   0.0      
ref|XP_009617548.1|  PREDICTED: lanC-like protein GCL2 isoform X1       566   0.0      
ref|XP_011085355.1|  PREDICTED: lanC-like protein GCL2                  565   0.0      
gb|KHG14999.1|  LanC-like protein 2                                     563   0.0      
gb|AES74528.2|  G protein coupled receptor                              563   0.0      
ref|XP_003540453.1|  PREDICTED: lanC-like protein GCR2-like             560   0.0      
gb|EYU26400.1|  hypothetical protein MIMGU_mgv1a007259mg                560   0.0      
ref|XP_008366750.1|  PREDICTED: lanC-like protein GCL2                  560   0.0      
ref|XP_008229171.1|  PREDICTED: lanC-like protein GCL2                  560   0.0      
gb|KHN28043.1|  LanC-like protein 2                                     560   0.0      
ref|XP_006348234.1|  PREDICTED: lanC-like protein 2-like                559   0.0      
ref|XP_007212308.1|  hypothetical protein PRUPE_ppa006721mg             558   0.0      
ref|XP_004514463.1|  PREDICTED: lanC-like protein 2-like                560   0.0      
ref|XP_010462143.1|  PREDICTED: lanC-like protein GCR2                  558   0.0      
ref|XP_009766748.1|  PREDICTED: lanC-like protein GCL2                  558   0.0      
ref|XP_007215460.1|  hypothetical protein PRUPE_ppa006408mg             556   0.0      
gb|KDP24150.1|  hypothetical protein JCGZ_25807                         553   0.0      
ref|XP_002263345.1|  PREDICTED: lanC-like protein GCL2                  553   0.0      Vitis vinifera
ref|XP_010241999.1|  PREDICTED: lanC-like protein GCL2 isoform X3       552   0.0      
ref|XP_006303704.1|  hypothetical protein CARUB_v10011802mg             552   0.0      
ref|XP_010542278.1|  PREDICTED: lanC-like protein GCR2                  552   0.0      
emb|CAN64758.1|  hypothetical protein VITISV_008093                     551   0.0      Vitis vinifera
ref|XP_004291663.1|  PREDICTED: lanC-like protein 2-like                550   0.0      
ref|XP_004487685.1|  PREDICTED: lanC-like protein 2-like                550   0.0      
ref|XP_007132705.1|  hypothetical protein PHAVU_011G117700g             550   0.0      
ref|XP_010675629.1|  PREDICTED: lanC-like protein GCR2                  549   0.0      
gb|KHG20582.1|  LanC-like protein 2                                     549   0.0      
ref|XP_002894411.1|  predicted protein                                  549   0.0      
ref|XP_003539910.1|  PREDICTED: lanC-like protein GCL2-like             549   0.0      
ref|XP_010500915.1|  PREDICTED: lanC-like protein GCR2                  548   0.0      
ref|XP_009147647.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    547   0.0      
ref|XP_003618310.1|  LanC-like protein                                  548   0.0      
ref|XP_007043559.1|  GCR2-like 2 isoform 1                              546   0.0      
gb|KFK35758.1|  hypothetical protein AALP_AA4G032600                    545   0.0      
ref|XP_009588409.1|  PREDICTED: lanC-like protein GCL2                  545   0.0      
ref|XP_010241998.1|  PREDICTED: lanC-like protein GCL2 isoform X2       544   0.0      
gb|AGV54697.1|  lanC-like protein 2                                     543   0.0      
ref|XP_010051804.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    543   0.0      
ref|XP_006392852.1|  hypothetical protein EUTSA_v10011533mg             543   0.0      
ref|XP_007149603.1|  hypothetical protein PHAVU_005G083500g             543   0.0      
gb|KEH38770.1|  G protein coupled receptor                              539   0.0      
ref|XP_004141231.1|  PREDICTED: lanC-like protein 2-like                536   0.0      
ref|XP_004248157.1|  PREDICTED: lanC-like protein GCL2 isoform X1       535   0.0      
gb|KFK40450.1|  hypothetical protein AALP_AA3G374700                    534   0.0      
emb|CDP14758.1|  unnamed protein product                                534   0.0      
ref|XP_010241996.1|  PREDICTED: lanC-like protein GCL2 isoform X1       535   0.0      
ref|XP_002517941.1|  catalytic, putative                                533   0.0      Ricinus communis
ref|NP_175700.2|  G-protein coupled receptor 2                          533   0.0      Arabidopsis thaliana [mouse-ear cress]
pdb|3T33|A  Chain A, Crystal Structure Of Arabidopsis Gcr2              533   0.0      
ref|XP_010918434.1|  PREDICTED: lanC-like protein GCL2 isoform X1       532   0.0      
ref|XP_011045509.1|  PREDICTED: lanC-like protein GCL2                  532   0.0      
ref|NP_850003.1|  protein GCR2-LIKE 2                                   532   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884221.1|  hypothetical protein ARALYDRAFT_480913             531   0.0      
ref|XP_008452476.1|  PREDICTED: lanC-like protein GCL2 isoform X2       530   0.0      
ref|XP_006409014.1|  hypothetical protein EUTSA_v10002001mg             528   0.0      
ref|XP_008381258.1|  PREDICTED: lanC-like protein GCL2                  528   0.0      
ref|XP_006299729.1|  hypothetical protein CARUB_v10015922mg             527   0.0      
gb|EYU26156.1|  hypothetical protein MIMGU_mgv1a007017mg                528   1e-180   
ref|XP_009357824.1|  PREDICTED: lanC-like protein GCL2                  526   6e-180   
gb|AAG52264.1|AC019018_1  putative G protein-coupled receptor; 80...    524   1e-179   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452475.1|  PREDICTED: lanC-like protein GCL2 isoform X1       524   3e-179   
gb|ABQ14360.1|  abscisic acid ABA receptor                              523   1e-178   Populus trichocarpa [western balsam poplar]
ref|XP_008809400.1|  PREDICTED: lanC-like protein GCL2                  520   5e-178   
ref|XP_009400289.1|  PREDICTED: lanC-like protein GCL2                  518   5e-177   
ref|XP_009400288.1|  PREDICTED: lanC-like protein GCL2                  518   6e-177   
ref|XP_010555131.1|  PREDICTED: lanC-like protein GCL2                  514   1e-175   
ref|XP_010555129.1|  PREDICTED: lanC-like protein GCL2                  514   2e-175   
ref|XP_006661914.1|  PREDICTED: lanC-like protein GCR2-like             506   3e-172   
ref|XP_004982728.1|  PREDICTED: lanC-like protein 2-like                503   1e-170   
gb|AAD20918.1|  hypothetical protein                                    498   1e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686440.1|  PREDICTED: lanC-like protein GCL2                  499   2e-169   
gb|AGV54199.1|  lanC-like protein                                       499   2e-169   
tpg|DAA49459.1|  TPA: hypothetical protein ZEAMMB73_373795              499   5e-169   
ref|XP_008676974.1|  PREDICTED: LOC100282928 isoform X1                 498   2e-168   
gb|ABB47829.2|  Lanthionine synthetase C-like protein, expressed        495   3e-168   Oryza sativa Japonica Group [Japonica rice]
gb|ACN31611.1|  unknown                                                 494   1e-167   Zea mays [maize]
emb|CDY53809.1|  BnaA06g01740D                                          493   1e-167   
gb|AAL58268.1|AC068923_10  putative lanthionine synthetase              494   3e-167   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001149305.1|  LOC100282928                                       493   4e-167   Zea mays [maize]
gb|ABB47830.2|  Lanthionine synthetase C-like protein, expressed        492   7e-167   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA49457.1|  TPA: LOW QUALITY PROTEIN: lanC-like protein 2          492   8e-167   
ref|NP_001064963.1|  Os10g0497900                                       491   7e-166   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574129.2|  PREDICTED: lanC-like protein GCR2 isoform X2       491   1e-165   
ref|XP_010234867.1|  PREDICTED: lanC-like protein GCR2 isoform X1       490   6e-165   
emb|CDY26028.1|  BnaC06g05960D                                          486   8e-165   
gb|EAZ16566.1|  hypothetical protein OsJ_32039                          485   3e-163   Oryza sativa Japonica Group [Japonica rice]
gb|EMS68258.1|  LanC-like protein 2                                     484   4e-163   
ref|XP_009102106.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    482   5e-163   
ref|XP_002467007.1|  hypothetical protein SORBIDRAFT_01g018190          483   9e-163   Sorghum bicolor [broomcorn]
gb|EMT26581.1|  LanC-like protein 2                                     483   1e-160   
gb|KDO74127.1|  hypothetical protein CISIN_1g015433mg                   460   5e-156   
ref|XP_010918435.1|  PREDICTED: lanC-like protein GCL2 isoform X2       460   6e-155   
ref|NP_001174024.1|  Os04g0529600                                       459   8e-154   
emb|CAJ86377.1|  OSIGBa0155K17.4                                        458   2e-153   Oryza sativa [red rice]
ref|XP_006827807.1|  hypothetical protein AMTR_s00009p00267750          454   1e-152   
ref|XP_004172119.1|  PREDICTED: lanC-like protein 2-like                440   3e-148   
ref|XP_001776967.1|  predicted protein                                  438   9e-146   
ref|XP_002966453.1|  hypothetical protein SELMODRAFT_86123              416   7e-137   
gb|KDO74126.1|  hypothetical protein CISIN_1g015433mg                   411   1e-136   
ref|XP_007043561.1|  GCR2-like 2 isoform 3                              407   2e-135   
ref|XP_001758715.1|  predicted protein                                  400   7e-131   
ref|XP_010327070.1|  PREDICTED: lanC-like protein GCL2 isoform X2       397   2e-130   
gb|KEH24852.1|  G protein coupled receptor                              395   1e-129   
ref|XP_007043560.1|  GCR2-like 2 isoform 2                              389   6e-128   
gb|ABK24484.1|  unknown                                                 392   2e-127   Picea sitchensis
ref|XP_008781994.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    375   4e-123   
gb|KDO74128.1|  hypothetical protein CISIN_1g015433mg                   355   8e-116   
emb|CDP01505.1|  unnamed protein product                                358   1e-114   
ref|XP_009800854.1|  PREDICTED: lanC-like protein GCL1                  358   4e-114   
ref|XP_011031065.1|  PREDICTED: lanC-like protein GCL1                  357   5e-114   
ref|XP_006353211.1|  PREDICTED: lanC-like protein 2-like                356   1e-113   
ref|XP_004250112.1|  PREDICTED: lanC-like protein GCL1                  356   1e-113   
gb|AAF75794.1|AF272710_1  putative 7-transmembrane G-protein-coup...    356   1e-113   Solanum chacoense
ref|XP_002306296.2|  hypothetical protein POPTR_0005s07360g             355   4e-113   Populus trichocarpa [western balsam poplar]
ref|XP_002262692.1|  PREDICTED: lanC-like protein GCL1 isoform X2       354   9e-113   Vitis vinifera
ref|XP_009605819.1|  PREDICTED: lanC-like protein GCL1                  353   2e-112   
ref|XP_002268951.3|  PREDICTED: lanC-like protein GCL1                  353   2e-112   Vitis vinifera
ref|XP_007047870.1|  GCR2-like 1                                        352   5e-112   
emb|CAN83415.1|  hypothetical protein VITISV_029722                     351   9e-112   Vitis vinifera
ref|XP_010652678.1|  PREDICTED: lanC-like protein GCL1 isoform X1       350   2e-111   
ref|XP_006466262.1|  PREDICTED: lanC-like protein GCL1-like             351   2e-111   
ref|XP_002319360.2|  hypothetical protein POPTR_0013s13850g             345   3e-111   Populus trichocarpa [western balsam poplar]
gb|KDO60700.1|  hypothetical protein CISIN_1g013959mg                   349   1e-110   
ref|XP_006426333.1|  hypothetical protein CICLE_v10025657mg             348   2e-110   
ref|XP_010267103.1|  PREDICTED: lanC-like protein GCL1                  348   3e-110   
ref|XP_011022825.1|  PREDICTED: lanC-like protein GCL1                  345   2e-109   
ref|XP_002309963.2|  hypothetical protein POPTR_0007s05070g             345   3e-109   Populus trichocarpa [western balsam poplar]
ref|XP_004502406.1|  PREDICTED: lanC-like protein 2-like                343   8e-109   
gb|KDO60699.1|  hypothetical protein CISIN_1g013959mg                   343   1e-108   
ref|XP_002531667.1|  catalytic, putative                                342   4e-108   Ricinus communis
ref|XP_011100038.1|  PREDICTED: lanC-like protein GCL1                  342   7e-108   
ref|XP_008235076.1|  PREDICTED: lanC-like protein GCL1                  339   4e-107   
emb|CBG76444.1|  OO_Ba0013J05-OO_Ba0033A15.31                           360   7e-107   Oryza officinalis
ref|XP_003601926.1|  G protein-coupled receptor-like protein            338   8e-107   
ref|XP_007163665.1|  hypothetical protein PHAVU_001G253500g             333   1e-104   
gb|KDP29724.1|  hypothetical protein JCGZ_18659                         332   2e-104   
ref|XP_004288166.1|  PREDICTED: lanC-like protein 2-like                332   2e-104   
ref|XP_008387575.1|  PREDICTED: lanC-like protein GCL1                  332   2e-104   
emb|CDY05791.1|  BnaC07g00120D                                          326   6e-104   
ref|XP_010025417.1|  PREDICTED: lanC-like protein GCL1                  331   6e-104   
emb|CBI33140.3|  unnamed protein product                                332   7e-104   
gb|EYU30985.1|  hypothetical protein MIMGU_mgv1a006900mg                330   2e-103   
ref|XP_008453808.1|  PREDICTED: lanC-like protein GCL1                  329   4e-103   
gb|KFK28210.1|  hypothetical protein AALP_AA8G486800                    328   6e-103   
ref|XP_010937380.1|  PREDICTED: lanC-like protein GCL1                  328   6e-103   
ref|XP_009365826.1|  PREDICTED: lanC-like protein GCL1                  328   1e-102   
ref|XP_003552029.2|  PREDICTED: lanC-like protein GCL1-like             328   1e-102   
ref|XP_009339587.1|  PREDICTED: lanC-like protein GCL1                  327   2e-102   
ref|XP_010463250.1|  PREDICTED: lanC-like protein GCL1                  327   2e-102   
gb|KHN44353.1|  LanC-like protein 2                                     326   3e-102   
ref|XP_004146876.1|  PREDICTED: lanC-like protein 2-like                326   4e-102   
ref|XP_008358138.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    325   1e-101   
ref|XP_009150615.1|  PREDICTED: lanC-like protein GCL1                  325   3e-101   
ref|XP_010680997.1|  PREDICTED: lanC-like protein GCL1                  324   6e-101   
ref|XP_003538606.1|  PREDICTED: lanC-like protein 2-like isoform X1     323   9e-101   
ref|XP_010519354.1|  PREDICTED: lanC-like protein GCL1                  323   9e-101   
ref|XP_006591491.1|  PREDICTED: lanC-like protein 2-like isoform X2     321   5e-100   
ref|XP_006280490.1|  hypothetical protein CARUB_v10026430mg             320   1e-99    
ref|XP_010444546.1|  PREDICTED: lanC-like protein GCL1                  320   2e-99    
ref|XP_006394052.1|  hypothetical protein EUTSA_v10004256mg             320   2e-99    
gb|KCW89517.1|  hypothetical protein EUGRSUZ_A01805                     311   3e-99    
gb|ADU04150.1|  hypothetical protein                                    319   4e-99    
ref|XP_010484384.1|  PREDICTED: lanC-like protein GCL1                  319   5e-99    
emb|CDY08803.1|  BnaA06g24210D                                          318   7e-99    
gb|KHG19988.1|  LanC-like protein 2                                     318   1e-98    
ref|XP_002866662.1|  hypothetical protein ARALYDRAFT_358729             316   5e-98    
ref|NP_201331.1|  protein GCR2-like 1                                   316   5e-98    Arabidopsis thaliana [mouse-ear cress]
gb|AAK96841.1|  G protein-coupled receptor-like protein                 316   7e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ADU04157.1|  hypothetical protein                                    314   2e-97    
gb|KHN31391.1|  LanC-like protein 2                                     307   1e-94    
dbj|BAJ96048.1|  predicted protein                                      300   3e-93    
ref|XP_004582540.1|  PREDICTED: lanC-like protein 2                     280   1e-83    
ref|XP_004602091.1|  PREDICTED: lanC-like protein 2                     277   1e-83    
emb|CDY31938.1|  BnaA07g00570D                                          273   5e-82    
ref|XP_008260063.1|  PREDICTED: lanC-like protein 2 isoform X2          271   3e-81    
ref|XP_002982067.1|  hypothetical protein SELMODRAFT_115837             265   4e-81    
ref|XP_008260062.1|  PREDICTED: lanC-like protein 2 isoform X1          273   4e-81    
gb|EHH52121.1|  Testis-specific adriamycin sensitivity protein          270   8e-81    
ref|XP_003275065.1|  PREDICTED: lanC-like protein 2                     271   2e-80    
gb|EHH17302.1|  Testis-specific adriamycin sensitivity protein          269   2e-80    
ref|XP_005549615.1|  PREDICTED: lanC-like protein 2 isoform X2          268   2e-80    
ref|NP_001014209.1|  lanC-like protein 2                                271   2e-80    Rattus norvegicus [brown rat]
ref|XP_007979469.1|  PREDICTED: lanC-like protein 2 isoform X1          271   2e-80    
ref|XP_007094861.1|  PREDICTED: lanC-like protein 2                     269   2e-80    
ref|XP_004438431.1|  PREDICTED: lanC-like protein 2                     271   2e-80    
ref|XP_010623360.1|  PREDICTED: lanC-like protein 2                     270   3e-80    
ref|XP_003815868.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    270   3e-80    
dbj|BAG63209.1|  unnamed protein product                                270   3e-80    Homo sapiens [man]
ref|NP_001248105.1|  lanC-like protein 2                                270   3e-80    
ref|XP_008825772.1|  PREDICTED: lanC-like protein 2                     270   3e-80    
ref|XP_010330054.1|  PREDICTED: lanC-like protein 2 isoform X2          268   4e-80    
ref|XP_003896011.1|  PREDICTED: lanC-like protein 2 isoform X1          270   4e-80    
emb|CAD28471.1|  hypothetical protein                                   270   4e-80    Homo sapiens [man]
dbj|BAE00722.1|  unnamed protein product                                267   4e-80    Macaca fascicularis [crab eating macaque]
ref|NP_598498.1|  lanC-like protein 2                                   270   4e-80    Mus musculus [mouse]
gb|AAH70049.1|  LanC lantibiotic synthetase component C-like 2 (b...    270   5e-80    Homo sapiens [man]
ref|NP_061167.1|  lanC-like protein 2                                   270   5e-80    Homo sapiens [man]
dbj|BAG53147.1|  unnamed protein product                                270   5e-80    Homo sapiens [man]
ref|XP_004045515.1|  PREDICTED: lanC-like protein 2                     270   5e-80    
ref|XP_003318497.1|  PREDICTED: lanC-like protein 2                     270   5e-80    
ref|XP_003733613.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    270   6e-80    
ref|XP_004839897.1|  PREDICTED: lanC-like protein 2 isoform X2          267   6e-80    
ref|XP_005609226.1|  PREDICTED: lanC-like protein 2                     268   6e-80    
gb|KFO33010.1|  LanC-like protein 2                                     266   8e-80    
ref|XP_002833100.1|  PREDICTED: lanC-like protein 2                     269   8e-80    
ref|XP_004794591.1|  PREDICTED: lanC-like protein 1 isoform X1          267   1e-79    
ref|XP_008701796.1|  PREDICTED: lanC-like protein 2                     267   1e-79    
ref|XP_005658651.1|  PREDICTED: lanC-like protein 2-like                268   1e-79    
ref|XP_006074845.1|  PREDICTED: lanC-like protein 2                     266   1e-79    
ref|XP_003982670.1|  PREDICTED: lanC-like protein 2                     268   2e-79    
ref|XP_005360945.1|  PREDICTED: lanC-like protein 2                     268   2e-79    
ref|XP_005904454.1|  PREDICTED: lanC-like protein 2                     268   2e-79    
ref|XP_004018608.1|  PREDICTED: lanC-like protein 2                     266   2e-79    
ref|XP_003943908.1|  PREDICTED: lanC-like protein 2 isoform X1          268   2e-79    
ref|XP_006236642.2|  PREDICTED: lanC-like protein 2 isoform X1          266   3e-79    
ref|XP_006236643.1|  PREDICTED: lanC-like protein 2 isoform X2          265   3e-79    
ref|XP_004877353.1|  PREDICTED: lanC-like protein 2                     267   4e-79    
ref|XP_003766010.1|  PREDICTED: lanC-like protein 1                     266   4e-79    
ref|XP_008576884.1|  PREDICTED: lanC-like protein 2                     267   4e-79    
ref|NP_001095726.1|  lanC-like protein 2                                266   5e-79    Bos taurus [bovine]
ref|XP_004646693.1|  PREDICTED: lanC-like protein 2                     267   5e-79    
ref|XP_006022339.1|  PREDICTED: lanC-like protein 1                     265   6e-79    
gb|KFK43530.1|  hypothetical protein AALP_AA1G138200                    261   8e-79    
ref|XP_004839896.1|  PREDICTED: lanC-like protein 2 isoform X1          266   9e-79    
ref|XP_004417378.1|  PREDICTED: lanC-like protein 2                     266   9e-79    
ref|XP_006276713.1|  PREDICTED: lanC-like protein 1                     265   1e-78    
ref|XP_010661310.1|  PREDICTED: lanC-like protein GCL2                  260   1e-78    
ref|XP_006729895.1|  PREDICTED: lanC-like protein 2                     266   2e-78    
ref|XP_004767073.1|  PREDICTED: lanC-like protein 1 isoform X1          264   2e-78    
ref|XP_010967451.1|  PREDICTED: lanC-like protein 2                     264   2e-78    
ref|XP_007633708.1|  PREDICTED: lanC-like protein 2 isoform X2          263   2e-78    
ref|XP_006757252.1|  PREDICTED: lanC-like protein 2                     263   2e-78    
ref|XP_005695556.1|  PREDICTED: lanC-like protein 2                     266   3e-78    
gb|ERE66398.1|  lanC-like protein 2                                     264   3e-78    
ref|XP_004405425.1|  PREDICTED: lanC-like protein 1                     263   3e-78    
ref|XP_010995335.1|  PREDICTED: lanC-like protein 2                     263   3e-78    
ref|XP_007939437.1|  PREDICTED: lanC-like protein 2                     265   4e-78    
ref|XP_006192458.1|  PREDICTED: lanC-like protein 2-like                265   4e-78    
ref|XP_005975688.1|  PREDICTED: lanC-like protein 2                     264   4e-78    
ref|XP_007233451.1|  PREDICTED: lanC-like protein 2                     264   5e-78    
ref|XP_007500444.1|  PREDICTED: lanC-like protein 2                     265   6e-78    
ref|XP_001364295.2|  PREDICTED: lanC-like protein 1 isoform X1          263   6e-78    Monodelphis domestica
gb|EFB24809.1|  hypothetical protein PANDA_020566                       264   6e-78    Ailuropoda melanoleuca
ref|XP_002930203.1|  PREDICTED: lanC-like protein 2-like                264   7e-78    
ref|XP_008506329.1|  PREDICTED: lanC-like protein 2                     261   1e-77    
ref|XP_006148979.1|  PREDICTED: lanC-like protein 2                     263   1e-77    
ref|XP_004739432.1|  PREDICTED: lanC-like protein 2 isoform X2          263   1e-77    
ref|XP_006912141.1|  PREDICTED: lanC-like protein 2                     261   1e-77    
gb|EHA98285.1|  LanC-like protein 2                                     267   1e-77    
ref|XP_008685682.1|  PREDICTED: lanC-like protein 1 isoform X1          261   2e-77    
ref|XP_009460226.1|  PREDICTED: lanC-like protein 1                     261   2e-77    
ref|XP_003504936.1|  PREDICTED: lanC-like protein 2 isoform X1          263   2e-77    
ref|XP_004694568.1|  PREDICTED: lanC-like protein 2                     263   2e-77    
ref|XP_006898659.1|  PREDICTED: lanC-like protein 2-like                263   2e-77    
ref|XP_010281072.1|  PREDICTED: lanC-like protein 1                     259   2e-77    
ref|XP_006219526.1|  PREDICTED: lanC-like protein 2-like                262   2e-77    
ref|XP_004708222.1|  PREDICTED: lanC-like protein 2                     261   2e-77    
gb|KFP97922.1|  LanC-like 2                                             260   2e-77    
gb|KFQ90951.1|  LanC-like 1                                             261   3e-77    
gb|KFO80625.1|  LanC-like 1                                             261   3e-77    
ref|XP_008919586.1|  PREDICTED: lanC-like protein 2                     261   4e-77    
gb|ELK12680.1|  LanC-like protein 2                                     262   4e-77    
ref|XP_009565204.1|  PREDICTED: lanC-like protein 1                     259   4e-77    
gb|KFZ55043.1|  LanC-like 2                                             260   4e-77    
gb|KFV88367.1|  LanC-like 1                                             259   4e-77    
gb|KFV02516.1|  LanC-like 1                                             260   4e-77    
gb|KFU97310.1|  LanC-like 2                                             259   4e-77    
ref|XP_008068662.1|  PREDICTED: lanC-like protein 2                     259   5e-77    
ref|XP_007501858.1|  PREDICTED: lanC-like protein 1 isoform X2          262   5e-77    
ref|XP_009273304.1|  PREDICTED: lanC-like protein 2                     260   5e-77    
ref|XP_003762577.1|  PREDICTED: lanC-like protein 2                     262   5e-77    
ref|XP_004283055.1|  PREDICTED: lanC-like protein 2                     262   5e-77    
ref|XP_009885874.1|  PREDICTED: lanC-like protein 1 isoform X1          260   6e-77    
ref|XP_004384021.1|  PREDICTED: lanC-like protein 2                     262   6e-77    
ref|XP_009566764.1|  PREDICTED: lanC-like protein 2                     259   6e-77    
ref|XP_010201115.1|  PREDICTED: lanC-like protein 1                     258   6e-77    
gb|KFP32110.1|  LanC-like 1                                             259   6e-77    
ref|XP_010084089.1|  PREDICTED: lanC-like protein 1                     258   6e-77    
ref|XP_005337466.1|  PREDICTED: lanC-like protein 2                     261   6e-77    
ref|XP_009928472.1|  PREDICTED: lanC-like protein 2                     259   7e-77    
ref|XP_004447944.1|  PREDICTED: lanC-like protein 2 isoform 2           262   7e-77    
ref|XP_006992062.1|  PREDICTED: lanC-like protein 2-like                261   7e-77    
ref|XP_005631064.1|  PREDICTED: lanC-like protein 2                     265   7e-77    
gb|KGL95390.1|  LanC-like 1                                             260   7e-77    
ref|XP_005396650.1|  PREDICTED: lanC-like protein 2 isoform X2          259   7e-77    
ref|XP_009885875.1|  PREDICTED: lanC-like protein 1 isoform X2          258   8e-77    
ref|XP_009995128.1|  PREDICTED: lanC-like protein 1                     258   8e-77    
ref|XP_005396649.1|  PREDICTED: lanC-like protein 2 isoform X1          259   9e-77    
ref|XP_009686963.1|  PREDICTED: lanC-like protein 1                     258   9e-77    
ref|XP_007463743.1|  PREDICTED: lanC-like protein 2                     259   9e-77    
ref|XP_008148865.1|  PREDICTED: lanC-like protein 2                     259   1e-76    
ref|XP_009319938.1|  PREDICTED: lanC-like protein 2                     260   1e-76    
ref|XP_010012429.1|  PREDICTED: lanC-like protein 1                     258   1e-76    
gb|KFQ83337.1|  LanC-like 1                                             258   1e-76    
ref|XP_003474247.1|  PREDICTED: lanC-like protein 1                     259   1e-76    
ref|XP_010162821.1|  PREDICTED: lanC-like protein 2                     258   1e-76    
ref|XP_006190570.1|  PREDICTED: lanC-like protein 1                     259   1e-76    
gb|KFO54122.1|  LanC-like 1                                             258   1e-76    
gb|KFM08745.1|  LanC-like 1                                             258   1e-76    
gb|KFW01635.1|  LanC-like 2                                             258   2e-76    
ref|XP_010309333.1|  PREDICTED: lanC-like protein 1                     257   2e-76    
ref|XP_008111107.1|  PREDICTED: lanC-like protein 2                     260   2e-76    
gb|KFV64229.1|  LanC-like 1                                             258   2e-76    
ref|XP_008578632.1|  PREDICTED: lanC-like protein 1                     259   2e-76    
ref|XP_010179314.1|  PREDICTED: lanC-like protein 2                     258   2e-76    
ref|XP_008503139.1|  PREDICTED: lanC-like protein 1                     259   2e-76    
ref|XP_010581555.1|  PREDICTED: lanC-like protein 1                     259   2e-76    
ref|XP_003470156.1|  PREDICTED: lanC-like protein 2                     260   2e-76    
gb|KFO96908.1|  LanC-like 1                                             258   2e-76    
gb|KFR03138.1|  LanC-like 1                                             258   2e-76    
ref|XP_007118424.1|  PREDICTED: lanC-like protein 2                     261   2e-76    
ref|XP_002922402.1|  PREDICTED: lanC-like protein 1-like                258   2e-76    
gb|KFW84735.1|  LanC-like 1                                             258   3e-76    
ref|XP_008143428.1|  PREDICTED: lanC-like protein 1                     258   3e-76    
ref|XP_010406143.1|  PREDICTED: lanC-like protein 1                     258   3e-76    
ref|XP_009946789.1|  PREDICTED: lanC-like protein 2                     257   3e-76    
gb|KFP09242.1|  LanC-like 1                                             257   3e-76    
ref|XP_007187727.1|  PREDICTED: lanC-like protein 2                     257   3e-76    
ref|XP_009810346.1|  PREDICTED: lanC-like protein 1                     256   4e-76    
ref|XP_009942928.1|  PREDICTED: lanC-like protein 1                     256   4e-76    
gb|KFW90395.1|  LanC-like 1                                             257   4e-76    
ref|XP_009279358.1|  PREDICTED: lanC-like protein 1                     258   4e-76    
ref|XP_008926719.1|  PREDICTED: lanC-like protein 1                     258   4e-76    
ref|XP_007524577.1|  PREDICTED: lanC-like protein 1                     258   5e-76    
ref|XP_008934094.1|  PREDICTED: lanC-like protein 2                     257   5e-76    
ref|XP_005506618.1|  PREDICTED: lanC-like protein 2                     259   5e-76    
gb|KFZ53917.1|  LanC-like 1                                             256   5e-76    
gb|KFP61249.1|  LanC-like 1                                             256   5e-76    
ref|XP_010396952.1|  PREDICTED: lanC-like protein 2                     257   5e-76    
ref|XP_009572443.1|  PREDICTED: lanC-like protein 2                     256   5e-76    
gb|KFV14132.1|  LanC-like 1                                             257   5e-76    
gb|KFW04656.1|  LanC-like 1                                             257   5e-76    
ref|XP_008641803.1|  PREDICTED: lanC-like protein 1                     258   5e-76    
gb|EPY76822.1|  lanC-like protein                                       259   6e-76    
gb|KFP85016.1|  LanC-like 2                                             257   6e-76    
gb|KFQ71604.1|  LanC-like 1                                             256   6e-76    
ref|XP_005021837.1|  PREDICTED: lanC-like protein 1                     257   6e-76    
ref|XP_008997665.1|  PREDICTED: lanC-like protein 1 isoform X2          257   6e-76    
ref|XP_010085360.1|  PREDICTED: lanC-like protein 2                     256   6e-76    
ref|NP_067270.1|  lanC-like protein 1                                   257   7e-76    
ref|XP_009643058.1|  PREDICTED: lanC-like protein 2                     256   7e-76    
ref|XP_005519153.1|  PREDICTED: lanC-like protein 2                     259   8e-76    
gb|KFP67740.1|  LanC-like 2                                             256   8e-76    
ref|XP_005487037.1|  PREDICTED: lanC-like protein 2                     259   8e-76    
ref|XP_006205316.1|  PREDICTED: lanC-like protein 1                     257   9e-76    
ref|XP_002749787.2|  PREDICTED: lanC-like protein 1 isoform X1          257   9e-76    
ref|XP_010148638.1|  PREDICTED: lanC-like protein 2                     256   9e-76    
ref|XP_009463056.1|  PREDICTED: lanC-like protein 2                     256   9e-76    
ref|XP_008632157.1|  PREDICTED: lanC-like protein 2                     259   9e-76    
ref|XP_008489494.1|  PREDICTED: lanC-like protein 2                     257   9e-76    
gb|ELR61273.1|  LanC-like protein 1                                     257   9e-76    
ref|XP_009634935.1|  PREDICTED: lanC-like protein 1                     255   1e-75    
ref|XP_005889054.1|  PREDICTED: lanC-like protein 1                     257   1e-75    
ref|XP_009894709.1|  PREDICTED: lanC-like protein 1                     255   1e-75    
ref|XP_009704758.1|  PREDICTED: lanC-like protein 1                     256   1e-75    
ref|XP_006779000.1|  PREDICTED: lanC-like protein 1                     257   1e-75    
ref|XP_005144230.1|  PREDICTED: lanC-like protein 1                     256   1e-75    
ref|XP_009820748.1|  PREDICTED: lanC-like protein 2                     256   1e-75    
ref|XP_005445171.1|  PREDICTED: lanC-like protein 2                     258   1e-75    
gb|EOB04765.1|  LanC-like protein 2                                     257   1e-75    
ref|XP_006082817.1|  PREDICTED: lanC-like protein 1                     256   1e-75    
gb|KGL96810.1|  LanC-like 2                                             256   1e-75    
ref|XP_007638258.1|  PREDICTED: lanC-like protein 1 isoform X1          256   1e-75    
ref|XP_006872805.1|  PREDICTED: lanC-like protein 1                     256   1e-75    
ref|XP_009501831.1|  PREDICTED: lanC-like protein 1                     255   1e-75    
ref|XP_009092160.1|  PREDICTED: lanC-like protein 2                     256   1e-75    
ref|XP_005425762.1|  PREDICTED: lanC-like protein 2                     259   2e-75    
ref|XP_009941337.1|  PREDICTED: lanC-like protein 2                     255   2e-75    
ref|XP_009863709.1|  PREDICTED: lanC-like protein 2                     255   2e-75    
gb|KFU84016.1|  LanC-like 1                                             254   2e-75    
ref|XP_010859418.1|  PREDICTED: lanC-like protein 1                     256   2e-75    
ref|XP_005874242.1|  PREDICTED: lanC-like protein 1                     256   2e-75    
ref|XP_003925633.1|  PREDICTED: lanC-like protein 1                     256   2e-75    
ref|XP_009999832.1|  PREDICTED: lanC-like protein 2                     255   2e-75    
ref|XP_009327921.1|  PREDICTED: lanC-like protein 1                     254   2e-75    
ref|XP_003991153.1|  PREDICTED: lanC-like protein 1 isoform X1          256   2e-75    
ref|XP_009980699.1|  PREDICTED: lanC-like protein 1                     254   2e-75    
ref|XP_005501752.1|  PREDICTED: lanC-like protein 1                     256   2e-75    
gb|KFQ49144.1|  LanC-like 1                                             255   2e-75    
ref|XP_007423495.1|  PREDICTED: lanC-like protein 2                     258   2e-75    
ref|XP_010614350.1|  PREDICTED: lanC-like protein 1 isoform X2          256   2e-75    
gb|KFV53555.1|  LanC-like 1                                             255   2e-75    
ref|XP_007086146.1|  PREDICTED: lanC-like protein 1                     256   2e-75    
ref|XP_004626666.1|  PREDICTED: lanC-like protein 1                     256   2e-75    
gb|KFO15126.1|  LanC-like 1                                             255   2e-75    
ref|XP_009896607.1|  PREDICTED: lanC-like protein 2                     255   2e-75    
ref|XP_006536971.1|  PREDICTED: LanC (bacterial lantibiotic synth...    256   3e-75    
ref|XP_006634360.1|  PREDICTED: lanC-like protein 2-like                257   3e-75    
ref|XP_009987546.1|  PREDICTED: lanC-like protein 2                     255   3e-75    
ref|XP_003791072.1|  PREDICTED: lanC-like protein 2                     259   3e-75    
ref|XP_005235317.1|  PREDICTED: lanC-like protein 2                     258   3e-75    
gb|KFW71076.1|  LanC-like 1                                             254   3e-75    
ref|XP_009703975.1|  PREDICTED: lanC-like protein 2                     254   3e-75    
ref|XP_005014987.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    257   4e-75    
ref|XP_002613417.1|  hypothetical protein BRAFLDRAFT_93787              255   4e-75    
ref|XP_010311253.1|  PREDICTED: lanC-like protein 2                     254   4e-75    
ref|XP_009887721.1|  PREDICTED: lanC-like protein 2                     254   4e-75    
ref|XP_007607018.1|  PREDICTED: lanC-like protein 1 isoform X2          255   4e-75    
ref|NP_001016046.1|  LanC lantibiotic synthetase component C-like 1     255   4e-75    
gb|EDL00246.1|  LanC (bacterial lantibiotic synthetase component ...    256   4e-75    
gb|KFV83634.1|  LanC-like 2                                             254   4e-75    
ref|XP_009491749.1|  PREDICTED: lanC-like protein 1                     254   4e-75    
ref|XP_536055.1|  PREDICTED: lanC-like protein 1                        255   5e-75    
ref|NP_001069695.1|  lanC-like protein 1                                255   5e-75    
ref|XP_005279741.1|  PREDICTED: lanC-like protein 1                     255   5e-75    
ref|NP_001133442.1|  LanC-like protein 2                                256   5e-75    
ref|XP_003907950.1|  PREDICTED: lanC-like protein 1 isoform X2          255   6e-75    
ref|XP_004004942.1|  PREDICTED: lanC-like protein 1                     255   6e-75    
ref|XP_010884003.1|  PREDICTED: lanC-like protein 2                     256   6e-75    
ref|XP_009500817.1|  PREDICTED: lanC-like protein 2                     254   6e-75    
ref|XP_010353221.1|  PREDICTED: lanC-like protein 1                     254   7e-75    
ref|XP_005331925.1|  PREDICTED: lanC-like protein 1                     254   7e-75    
ref|XP_009181236.1|  PREDICTED: lanC-like protein 1 isoform X1          255   7e-75    
ref|XP_003703135.1|  PREDICTED: lanC-like protein 2-like                255   7e-75    
ref|XP_003215180.1|  PREDICTED: lanC-like protein 1                     254   8e-75    
ref|NP_446175.1|  lanC-like protein 1                                   254   8e-75    
ref|XP_005396999.1|  PREDICTED: lanC-like protein 1 isoform X1          254   8e-75    
ref|NP_001245050.1|  lanC-like protein 1                                254   8e-75    
ref|XP_009015183.1|  hypothetical protein HELRODRAFT_188186             256   8e-75    
ref|XP_009575790.1|  PREDICTED: lanC-like protein 1                     253   8e-75    
emb|CAG46576.1|  LANCL1                                                 254   8e-75    
ref|XP_009677694.1|  PREDICTED: lanC-like protein 2                     253   8e-75    
gb|AAX37077.1|  LanC lantibiotic synthetase component C-like 1          254   9e-75    
ref|XP_004033195.1|  PREDICTED: lanC-like protein 1 isoform 1           254   9e-75    
ref|XP_007470076.1|  PREDICTED: lanC-like protein 1                     254   9e-75    
dbj|BAG35299.1|  unnamed protein product                                254   9e-75    
ref|XP_010137609.1|  PREDICTED: lanC-like protein 2                     253   1e-74    
ref|XP_009966730.1|  PREDICTED: lanC-like protein 2                     253   1e-74    
ref|NP_006046.1|  lanC-like protein 1                                   254   1e-74    
ref|XP_009484901.1|  PREDICTED: lanC-like protein 2                     253   1e-74    
pdb|3E6U|A  Chain A, Crystal Structure Of Human Lancl1                  254   1e-74    
gb|KFP49501.1|  LanC-like 1                                             252   1e-74    
ref|XP_009877458.1|  PREDICTED: lanC-like protein 1                     252   1e-74    
ref|XP_008844469.1|  PREDICTED: lanC-like protein 1                     254   1e-74    
ref|XP_003406133.1|  PREDICTED: lanC-like protein 1 isoform X1          254   1e-74    
ref|XP_005574229.1|  PREDICTED: lanC-like protein 1 isoform X2          254   1e-74    
ref|XP_004470258.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    255   1e-74    
ref|XP_005041412.1|  PREDICTED: lanC-like protein 2                     256   1e-74    
ref|XP_005676543.1|  PREDICTED: lanC-like protein 1 isoform X1          254   1e-74    
gb|AAV38168.1|  LanC lantibiotic synthetase component C-like 1 (b...    254   1e-74    
ref|XP_005574228.1|  PREDICTED: lanC-like protein 1 isoform X1          254   1e-74    
ref|XP_005246300.1|  PREDICTED: lanC-like protein 1 isoform X1          254   1e-74    
ref|XP_006861978.1|  PREDICTED: lanC-like protein 2                     255   1e-74    
ref|XP_005969890.1|  PREDICTED: lanC-like protein 1 isoform X1          254   2e-74    
ref|XP_002712500.1|  PREDICTED: lanC-like protein 1                     254   2e-74    
ref|XP_005287377.1|  PREDICTED: lanC-like protein 2 isoform X4          253   2e-74    
ref|XP_005170667.1|  PREDICTED: lanC-like protein 2 isoform X1          254   2e-74    
ref|XP_003254074.1|  PREDICTED: lanC-like protein 1 isoform 1           253   3e-74    
gb|KFP38661.1|  LanC-like 1                                             251   3e-74    
ref|XP_005441569.1|  PREDICTED: lanC-like protein 1                     253   3e-74    
ref|XP_003309499.1|  PREDICTED: lanC-like protein 1 isoform X2          253   3e-74    
ref|XP_007071974.1|  PREDICTED: LOW QUALITY PROTEIN: lanC-like pr...    254   3e-74    
ref|XP_007932698.1|  PREDICTED: lanC-like protein 1                     253   3e-74    
ref|XP_009442472.1|  PREDICTED: lanC-like protein 1 isoform X1          253   3e-74    
ref|XP_009917699.1|  PREDICTED: lanC-like protein 1                     253   3e-74    
ref|XP_004851168.1|  PREDICTED: lanC-like protein 1 isoform X1          253   3e-74    
ref|XP_006124173.1|  PREDICTED: lanC-like protein 2                     253   4e-74    
ref|XP_008167878.1|  PREDICTED: lanC-like protein 2 isoform X3          253   4e-74    
ref|XP_005287375.1|  PREDICTED: lanC-like protein 2 isoform X2          253   4e-74    
ref|XP_004701833.1|  PREDICTED: lanC-like protein 1                     253   4e-74    
ref|XP_006975024.1|  PREDICTED: lanC-like protein 1                     253   4e-74    
ref|XP_003455790.1|  PREDICTED: lanC-like protein 2 isoform X1          254   4e-74    
ref|XP_006022221.1|  PREDICTED: lanC-like protein 2                     253   4e-74    
ref|XP_007059434.1|  PREDICTED: lanC-like protein 2                     253   4e-74    
ref|XP_004896824.1|  PREDICTED: lanC-like protein 1-like                253   4e-74    
ref|XP_010114065.1|  PREDICTED: lanC-like protein 2                     251   5e-74    
ref|NP_001125139.1|  lanC-like protein 1                                253   5e-74    
ref|XP_004427825.1|  PREDICTED: lanC-like protein 1                     253   5e-74    
gb|KGL84870.1|  LanC-like 1                                             252   5e-74    
ref|XP_010127468.1|  PREDICTED: lanC-like protein 1                     251   6e-74    
gb|KGL77828.1|  LanC-like 2                                             251   6e-74    
gb|KFQ04380.1|  LanC-like 1                                             250   8e-74    
ref|XP_006140153.1|  PREDICTED: lanC-like protein 1 isoform X1          252   8e-74    
ref|XP_005941324.1|  PREDICTED: lanC-like protein 2-like isoform X2     250   9e-74    
ref|XP_006050069.1|  PREDICTED: lanC-like protein 1 isoform X1          252   9e-74    
ref|XP_005244494.1|  PREDICTED: lanC-like protein 1                     253   9e-74    
ref|XP_006140154.1|  PREDICTED: lanC-like protein 1 isoform X2          251   1e-73    
ref|XP_010213784.1|  PREDICTED: lanC-like protein 2                     250   1e-73    
gb|KFV99741.1|  LanC-like 1                                             249   1e-73    



>ref|XP_006348233.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=407

 Score =   624 bits (1609),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/413 (73%), Positives = 347/413 (84%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ERYYPNEM          ++E+AP   KDSL+KLLSLP++TIS+RLK DA  LKDEVVRE
Sbjct  3     ERYYPNEMGDL------SIEELAPENAKDSLSKLLSLPYDTISQRLKLDATNLKDEVVRE  56

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW A+GR V DY LYTG LGTA+LL K+YQ+T NNDDL LC  II+ACD AA + SGP T
Sbjct  57    TWAAKGRHVNDYRLYTGTLGTAYLLFKSYQITQNNDDLVLCSDIIQACD-AACNGSGPPT  115

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+ G AGIYALGAVAAK+ GDD+L   ++TKFKEIKLP+DL D+L YGRAGYLWACSFLN
Sbjct  116   FIGGHAGIYALGAVAAKNNGDDQLCQQFLTKFKEIKLPIDLGDDLFYGRAGYLWACSFLN  175

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K+LGKGT+S S MRA+ NE+IKSGRKLSKLEN KSPLMYE +G++YWGAAHGLAG+M  L
Sbjct  176   KHLGKGTISISQMRAVVNELIKSGRKLSKLENFKSPLMYESRGKKYWGAAHGLAGVMNVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             +++ELK DE EDVK TLRYMIKNRF SGNY  +EG DE+D LVHWCHGAPG+ALTL KAA
Sbjct  236   LDMELKQDEIEDVKGTLRYMIKNRFSSGNYRTSEG-DESDVLVHWCHGAPGVALTLAKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F  +EF +AA +AGEVVW+RGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLY+AKAF
Sbjct  295   KVFGDDEFLKAAREAGEVVWRRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYKAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHDRAHT I +GIM +G+HPFSLFEGIGGMA LFLDL +P ++ FPAYEL
Sbjct  355   ACFLHDRAHTFICEGIMHKGNHPFSLFEGIGGMACLFLDLVEPFESRFPAYEL  407



>emb|CDP05888.1| unnamed protein product [Coffea canephora]
Length=409

 Score =   603 bits (1556),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/413 (71%), Positives = 345/413 (84%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R+ PNEM  ++PE++  + E A    K+SL KLL LP  T+ +RLK +AL LK  VV+E
Sbjct  3     DRFLPNEMPDYLPESSVEI-ESASDRAKESLEKLLHLPCKTLFERLKNEALDLKKTVVKE  61

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWGARG+R+TDYTLYTG LGTAFLL KAYQ+T +  DL L  +IIKACD+AAS  SG VT
Sbjct  62    TWGARGKRLTDYTLYTGTLGTAFLLFKAYQITKDKKDLLLSSEIIKACDSAAS-GSGRVT  120

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+YALGAV AKH GDD L  +++TKF+EIKLP +LP+ELLYGRAG+LWA +FLN
Sbjct  121   FICGQAGVYALGAVVAKHSGDDRLSGYFLTKFREIKLPKELPNELLYGRAGFLWASTFLN  180

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             +NLGK TVSS+ MRA+ +EIIKSGRKL+K    + PLMYEW G++YWGAAHGLAGIMY L
Sbjct  181   RNLGKDTVSSTEMRAVVDEIIKSGRKLAKG---RCPLMYEWHGKKYWGAAHGLAGIMYIL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E D LVHWCHGAPGIALTL+KAA
Sbjct  238   MDMELKPDEIEDVKGTLRYMIKNRFPSGNYPSSEGS-ETDRLVHWCHGAPGIALTLSKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F S+EF Q A+DAGEVVW RGLLKRVG+CHGISGN YVFLSLYR+TG+ EYLYRAKAF
Sbjct  297   EVFSSKEFLQGAVDAGEVVWNRGLLKRVGLCHGISGNTYVFLSLYRMTGRVEYLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FLHDRA TLI++GIM  GD P+SLFEGIGGMAYLFLD+A+PS A FPAYEL
Sbjct  357   ASFLHDRAKTLISEGIMHGGDRPYSLFEGIGGMAYLFLDIAEPSAARFPAYEL  409



>ref|XP_004244212.1| PREDICTED: lanC-like protein GCR2 [Solanum lycopersicum]
Length=407

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/413 (70%), Positives = 343/413 (83%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ERYYPNEM          ++E+ P  TKDSL KLLSLP++TI++RLK DA+ LKDEVVRE
Sbjct  3     ERYYPNEMDEL------SIEELVPENTKDSLFKLLSLPYDTITQRLKLDAINLKDEVVRE  56

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW A+GR V DYTLYTG LGTA++L K+YQ+T N DD++LC  II+ACDTA +   GP T
Sbjct  57    TWSAKGRHVKDYTLYTGTLGTAYILFKSYQITRNIDDIALCSDIIQACDTACN-GFGPPT  115

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+ G AGIYALGAVAAK+ GDD+L   ++TKFKE+KLP+DL D+L YGRAGYLWACSFLN
Sbjct  116   FIGGHAGIYALGAVAAKNNGDDQLCQIFLTKFKEMKLPIDLGDDLFYGRAGYLWACSFLN  175

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K+LGKGT+S S MR + NE++KSGRKLSKLEN KSPLMYE +G +YWGAAHG+AG+M  L
Sbjct  176   KHLGKGTISISQMREVVNELVKSGRKLSKLENFKSPLMYESRGEKYWGAAHGIAGVMNVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             +++ELK DE EDVK TLRYMIKNRF SGNY  +EG DE+D  VHWCHGA G+ALTL KAA
Sbjct  236   LDMELKQDEIEDVKGTLRYMIKNRFSSGNYRTSEG-DESDVRVHWCHGAAGVALTLAKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F  +EF +AA +AGEVVW+RGLLKRVGICHGISGNAYVFLSLY+LT +EEYLY+AKAF
Sbjct  295   KVFGDDEFLEAAREAGEVVWRRGLLKRVGICHGISGNAYVFLSLYKLTREEEYLYKAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHDRAHTLI +G+M +GDHPFSLFEGIGGMA LFLDL +P ++ FPAYE+
Sbjct  355   ACFLHDRAHTLICEGVMHKGDHPFSLFEGIGGMACLFLDLVEPFESRFPAYEV  407



>ref|XP_002284781.1| PREDICTED: lanC-like protein GCR2 [Vitis vinifera]
 emb|CBI20338.3| unnamed protein product [Vitis vinifera]
Length=407

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/413 (68%), Positives = 337/413 (82%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM    PET    +E +   + DSL KLLS P+ T+S++ ++ AL +KD VVRE
Sbjct  3     DRFFPNEM----PETAVEAEETSAQNSGDSLIKLLSFPYETLSQQFERAALDVKDAVVRE  58

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY LYTGALGTAFLL KAYQ+T N DDL++C +I+KACD+A S  SG VT
Sbjct  59    TWALAGKRVQDYALYTGALGTAFLLFKAYQITNNRDDLNVCSEIVKACDSA-SATSGRVT  117

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+YA+GAVAAKH GD+ LL  Y+T+FKEIKLP DLP+ELLYGR G+LWACSFLN
Sbjct  118   FICGQAGVYAIGAVAAKHAGDERLLGRYLTQFKEIKLPKDLPNELLYGRGGFLWACSFLN  177

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+SS+ MRA   EIIKSGR+++K E  + PLMYEW G++YWGAAHGLAG+M+ L
Sbjct  178   KHIGKDTISSARMRASVKEIIKSGREMAKRE--RCPLMYEWHGKKYWGAAHGLAGVMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  236   MHMELKPDEVEDVKGTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLLKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG  E+LYRAKAF
Sbjct  295   EVFGDKEFLQAAVDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEFLYRAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRA  LI++G M  GD P+SLFEGIGGM YLFLD+ +PS+A FP YEL
Sbjct  355   ACFLLDRAQRLISEGKMHGGDRPYSLFEGIGGMTYLFLDMIEPSEARFPGYEL  407



>ref|XP_011042485.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
 ref|XP_011013677.1| PREDICTED: lanC-like protein GCR2 [Populus euphratica]
Length=412

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/415 (69%), Positives = 339/415 (82%), Gaps = 7/415 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTT--VVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +RY+PNEM  +IPETTT  V + +     KDSL KLLSLP+N +S+RLK  AL +KD VV
Sbjct  3     DRYFPNEMPDYIPETTTTAVDETVTERNNKDSLTKLLSLPYNILSQRLKASALDVKDTVV  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             RETWG  G+RV DY+LYTGALGTA+LLLKAYQVT N +DL+LC  IIKACD+  S  SG 
Sbjct  63    RETWGMSGKRVKDYSLYTGALGTAYLLLKAYQVTKNQNDLNLCSDIIKACDSV-SRDSGR  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAKH GD  LL HY+ +FKEIKLP DLP ELLYGRAG+LWACSF
Sbjct  122   VTFICGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLPYELLYGRAGFLWACSF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK++GK T+S+S  RA+ +EIIK+GR + K    K PL+YEW G+RYWGAAHGLAGIM 
Sbjct  182   LNKHIGKETISTSRKRAVVDEIIKAGRLIRKG---KCPLLYEWHGKRYWGAAHGLAGIML  238

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++EL PDE EDVK TL YMIKN FPSGNYP++EG+ ++D LVHWCHGAPGIALTL K
Sbjct  239   VLMDLELTPDEVEDVKGTLHYMIKNHFPSGNYPSSEGN-KSDCLVHWCHGAPGIALTLAK  297

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  +EF QAAM+AGEVVW RGLLKRVGICHGISGN YVF+SLYRLTG  EYLYRAK
Sbjct  298   AAEVFGDKEFLQAAMEAGEVVWNRGLLKRVGICHGISGNTYVFVSLYRLTGNVEYLYRAK  357

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFL+DRA  L+++G M  GD P+SLFEG GGMAYLFLD+ +PS+A FPAYEL
Sbjct  358   AFACFLYDRAQKLVSEGKMHGGDRPYSLFEGFGGMAYLFLDILEPSEARFPAYEL  412



>ref|XP_006370294.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
 gb|ERP66863.1| hypothetical protein POPTR_0001s41360g [Populus trichocarpa]
Length=412

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/415 (69%), Positives = 335/415 (81%), Gaps = 7/415 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTT--VVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R +PNEM  +IPETTT  V + +     KDSL  LLSLP+N +S+RLK  AL +KD VV
Sbjct  3     DRSFPNEMPDYIPETTTTAVDETVTERNNKDSLTNLLSLPYNILSQRLKASALDVKDTVV  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             RETWG  G+RV DY+LYTGALGTA+LL KAYQVT N +DL+LC  IIKACD+  S  SG 
Sbjct  63    RETWGMSGKRVKDYSLYTGALGTAYLLFKAYQVTKNQNDLNLCSDIIKACDSV-SRDSGR  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAKH GD  LL HY+ +FKEIKLP DLP ELLYGRAG+LWACSF
Sbjct  122   VTFICGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLPYELLYGRAGFLWACSF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK++GK T+S+S  RA+ +EIIK+GR   K    K PL+YEW G+RYWGAAHGLAGIM 
Sbjct  182   LNKHIGKETISTSRKRAVVDEIIKAGRLTRKG---KCPLLYEWHGKRYWGAAHGLAGIML  238

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++EL PDE EDVK TL YMIKN FPSGNYP++EG+ ++D LVHWCHGAPGIALTL K
Sbjct  239   VLMDLELTPDEVEDVKGTLHYMIKNHFPSGNYPSSEGN-KSDCLVHWCHGAPGIALTLAK  297

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  +EF QAAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG  EYLYRAK
Sbjct  298   AAEVFGDKEFLQAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAK  357

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLHDRA  L+++G M  GD P+SLFEG GGMAYLFLD+ +PS+A FPAYEL
Sbjct  358   AFACFLHDRAQKLVSEGKMHGGDRPYSLFEGFGGMAYLFLDILEPSEARFPAYEL  412



>gb|KDO74125.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=407

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/413 (68%), Positives = 334/413 (81%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM    PET+  V        +DSL KLLSLP+  +S  LK  AL LK  VV E
Sbjct  3     DRFFPNEM----PETSLAVAAHETTTAQDSLTKLLSLPYTAVSDTLKNSALALKQTVVNE  58

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DYTLYTGALGTA+LL KAYQVT N+++L LC  I++ACD+A S  SG VT
Sbjct  59    TWGVSGKRVQDYTLYTGALGTAYLLFKAYQVTKNDNELKLCCDIVEACDSA-SRDSGRVT  117

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL HY+TKFKEIKLP DLP+ELLYGR G+LWACSFLN
Sbjct  118   FICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPSDLPNELLYGRVGFLWACSFLN  177

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S++ MRA+ +EIIK+GR+L+     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  178   KHMGKDTISTAQMRAVVDEIIKAGRRLAN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ LTL KAA
Sbjct  236   MDMELKPDEVEDVKGTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVTLTLAKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVFLSLYRLTG  EYLYRAKAF
Sbjct  295   EVFGEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL+DRA  LI +G M  GD P+SLFEGIGGM +LFLD+ +PS+A FPAYEL
Sbjct  355   ACFLYDRAQKLIAEGKMHGGDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_006464716.1| PREDICTED: lanC-like protein GCR2-like [Citrus sinensis]
Length=407

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/413 (68%), Positives = 334/413 (81%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM    PET+  V        +DSL KLLSLP+  +S  LK  AL LK  VV E
Sbjct  3     DRFFPNEM----PETSLAVAAHETTTAQDSLTKLLSLPYTAVSDTLKNSALALKQTVVNE  58

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DYTLYTGALGTA+LL KAYQVT N+++L LC  I++ACD+A S  SG VT
Sbjct  59    TWGVSGKRVQDYTLYTGALGTAYLLFKAYQVTKNDNELKLCCDIVEACDSA-SRDSGRVT  117

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL HY+TKFKEIKLP DLP+ELLYGR G+LWACSFLN
Sbjct  118   FICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPSDLPNELLYGRVGFLWACSFLN  177

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S++ MRA+ +EIIK+GR+L+     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  178   KHMGKDTISTAQMRAVVDEIIKAGRRLAN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ LTL KAA
Sbjct  236   MDMELKPDEVEDVKGTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVTLTLAKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLK+VGICHGISGN YVFLSLYRLTG  EYLYRAKAF
Sbjct  295   EVFGEKEFLQAAVDAGEVVWKRGLLKQVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL+DRA  LI +G M  GD P+SLFEGIGGM +LFLD+ +PS+A FPAYEL
Sbjct  355   ACFLYDRAQKLIAEGKMHGGDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_009767466.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana sylvestris]
Length=408

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/413 (68%), Positives = 343/413 (83%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN M  F+ ETT  VQ+  P G KD L+KLL LP+ T+ ++LK  A  LK+ +V+E
Sbjct  3     DRYFPNTMLVFVDETT--VQQSFPEGAKDPLSKLLHLPYRTVCQKLKSAAQDLKETIVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW  +G RV+DYTLYTGALGTAFLL KAYQVT +N+DL+LC  IIKACD+A SH SG VT
Sbjct  61    TWVCKGGRVSDYTLYTGALGTAFLLFKAYQVTRDNNDLALCSHIIKACDSA-SHGSGRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+YALGAV AKH GD++L  HY+TKFKEI+LP DLP+ELLYGRAG+LWACSFLN
Sbjct  120   FICGQAGVYALGAVVAKHSGDEQLCDHYLTKFKEIELPKDLPNELLYGRAGFLWACSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             KN+G+ T+S + ++A+  E+IKSGRK+ K    + PLMYEW  ++YWGAAHGLAGIM+ L
Sbjct  180   KNIGRDTISPTQIQAVVVEVIKSGRKMGKG---RCPLMYEWHEKKYWGAAHGLAGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELK DE EDVKATLRYMI+NRFPSGNYP+++G  E+D LVHWCHGAPG+ALTL KAA
Sbjct  237   MDMELKADEAEDVKATLRYMIRNRFPSGNYPSSDGS-ESDRLVHWCHGAPGVALTLIKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F S+EF QAA +A EVVW RGLLKRVGICHG+SGN+YVFLSLYRLTGK EYLY+A+AF
Sbjct  296   EVFSSDEFLQAAAEAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKARAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLH RA TLI++G+M  GD P+SLFEGIGGMAYLFLD+ +P +  FPAYEL
Sbjct  356   ACFLHARAQTLISEGVMHGGDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  408



>ref|XP_011098332.1| PREDICTED: lanC-like protein GCR2 [Sesamum indicum]
Length=403

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/413 (69%), Positives = 337/413 (82%), Gaps = 12/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  +I ET +V  E A     DSL KLL LP+ T+S+ LK+ AL LKD VV+E
Sbjct  3     DRFFPNEMPDYILETPSV--ESAAVAASDSLTKLLHLPYRTLSEGLKKAALDLKDTVVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
                       DYTLYTGALGTAFLL KAYQ+TG+ +DL+LC  II+ACD+A S  SG VT
Sbjct  61    X-----XXXGDYTLYTGALGTAFLLFKAYQITGDKNDLALCSDIIEACDSA-SRGSGRVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+YALGAVAA H GD EL H Y+ +FKEIKL  DLPDELLYGRAG+LWA SFLN
Sbjct  115   FICGRAGVYALGAVAAHHKGDKELCHQYLAQFKEIKLSKDLPDELLYGRAGFLWASSFLN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             KN+GK T+SS+ MRA+ +EIIKSGR+L+K    + PLM+EW G+RYWGAAHGLAGIMY L
Sbjct  175   KNIGKDTISSTRMRAVVDEIIKSGRQLAKG---RCPLMFEWHGKRYWGAAHGLAGIMYVL  231

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+++L PDE E VK TLRYMIKNRFPSGNYP++EG  E D LVHWCHGAPG+ALTL KAA
Sbjct  232   MDMDLTPDEVEHVKGTLRYMIKNRFPSGNYPSSEGS-ETDRLVHWCHGAPGVALTLAKAA  290

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F SEEF QAA+DAGEVVW RGLLKRVG+CHGISGNAY+FLSLY+LTGK+E+LYRAKAF
Sbjct  291   KVFASEEFLQAAIDAGEVVWNRGLLKRVGVCHGISGNAYIFLSLYQLTGKQEFLYRAKAF  350

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHDRA  LI++GI+  GD P+SLFEGIGGMAYLFLD+ +PS+A FPAYEL
Sbjct  351   ACFLHDRAQILISEGIIHGGDRPYSLFEGIGGMAYLFLDMTEPSQARFPAYEL  403



>ref|XP_006451926.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
 gb|ESR65166.1| hypothetical protein CICLE_v10008488mg [Citrus clementina]
Length=407

 Score =   583 bits (1503),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/413 (68%), Positives = 333/413 (81%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM    PET+  V        +DSL KLLSLP+  +S  LK  AL LK  VV E
Sbjct  3     DRFFPNEM----PETSLAVAAHETTTAQDSLTKLLSLPYTAVSDTLKNSALALKQTVVNE  58

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DYTLYTGALGTA+LL KAYQVT N+++L LC  I+KACD+A S  SG VT
Sbjct  59    TWGVSGKRVQDYTLYTGALGTAYLLFKAYQVTKNDNELKLCCDIVKACDSA-SRDSGCVT  117

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL  Y+TKFKEIKLP DLP+ELLYGR G+LWACSFLN
Sbjct  118   FICGRAGVCALGAVLAKHAGDERLLDLYLTKFKEIKLPSDLPNELLYGRVGFLWACSFLN  177

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S++ MRA+ +EIIK+GR+L+     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  178   KHIGKDTISTAQMRAVVDEIIKAGRRLAN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPD+ EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ LTL KAA
Sbjct  236   MDMELKPDQVEDVKGTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVTLTLAKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVFLSLYRLTG  EYLYRAKAF
Sbjct  295   EVFGEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL+DRA  LI +G M  GD P+SLFEGIGGM +LFLD+ +PS+A FPAYEL
Sbjct  355   ACFLYDRAQKLIAEGKMHGGDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  407



>ref|XP_009767465.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana sylvestris]
Length=410

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/415 (68%), Positives = 343/415 (83%), Gaps = 9/415 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN M  F+ ETT  VQ+  P G KD L+KLL LP+ T+ ++LK  A  LK+ +V+E
Sbjct  3     DRYFPNTMLVFVDETT--VQQSFPEGAKDPLSKLLHLPYRTVCQKLKSAAQDLKETIVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASG--P  589
             TW  +G RV+DYTLYTGALGTAFLL KAYQVT +N+DL+LC  IIKACD+A SH SG   
Sbjct  61    TWVCKGGRVSDYTLYTGALGTAFLLFKAYQVTRDNNDLALCSHIIKACDSA-SHGSGCRR  119

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CGQAG+YALGAV AKH GD++L  HY+TKFKEI+LP DLP+ELLYGRAG+LWACSF
Sbjct  120   VTFICGQAGVYALGAVVAKHSGDEQLCDHYLTKFKEIELPKDLPNELLYGRAGFLWACSF  179

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNKN+G+ T+S + ++A+  E+IKSGRK+ K    + PLMYEW  ++YWGAAHGLAGIM+
Sbjct  180   LNKNIGRDTISPTQIQAVVVEVIKSGRKMGKG---RCPLMYEWHEKKYWGAAHGLAGIMH  236

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELK DE EDVKATLRYMI+NRFPSGNYP+++G  E+D LVHWCHGAPG+ALTL K
Sbjct  237   VLMDMELKADEAEDVKATLRYMIRNRFPSGNYPSSDGS-ESDRLVHWCHGAPGVALTLIK  295

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F S+EF QAA +A EVVW RGLLKRVGICHG+SGN+YVFLSLYRLTGK EYLY+A+
Sbjct  296   AAEVFSSDEFLQAAAEAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAR  355

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLH RA TLI++G+M  GD P+SLFEGIGGMAYLFLD+ +P +  FPAYEL
Sbjct  356   AFACFLHARAQTLISEGVMHGGDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  410



>gb|KDP27026.1| hypothetical protein JCGZ_20961 [Jatropha curcas]
Length=408

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/413 (67%), Positives = 337/413 (82%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PNEM  ++PE   +++E     +KDSL KLLSLP+NT+++RLK+ AL +KD VVRE
Sbjct  3     DRYFPNEMPNYVPE---ILEEAVTETSKDSLTKLLSLPYNTVTERLKRSALDIKDTVVRE  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DYT+YTG LGTA+LL KAYQVT N +DL LC  I+ ACD+A S  SG VT
Sbjct  60    TWGLSGKRVQDYTIYTGMLGTAYLLFKAYQVTKNYNDLKLCSDIVMACDSA-SRGSGRVT  118

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL  Y+T+FKEIKLP DLP ELLYGRAG+LW+CSFLN
Sbjct  119   FICGRAGVCALGAVTAKHAGDERLLDLYLTQFKEIKLPSDLPYELLYGRAGFLWSCSFLN  178

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+SSS  RA  +EII++G+KLS     K PLMYEW G++Y GAAHG+AGIM+ L
Sbjct  179   KHIGKETISSSCRRAAVDEIIEAGKKLS--HKGKCPLMYEWHGKKYLGAAHGMAGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELK DE E VK+TLRYMI+ RFPSGNYP++EG+ E+D LVHWCHGAPG+ALTL KAA
Sbjct  237   MDMELKQDEIEAVKSTLRYMIETRFPSGNYPSSEGN-ESDRLVHWCHGAPGVALTLVKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVW RGLL+RVGICHGISGN YVF SLYRLTG+ EYLYRAKAF
Sbjct  296   EVFGDKEFLQAAIDAGEVVWNRGLLRRVGICHGISGNTYVFFSLYRLTGRAEYLYRAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHD+A  LI +G M  GD P+SLFEGIGGMAYLF D+ +PS+A FPAYEL
Sbjct  356   ACFLHDKAQKLILEGKMHGGDRPYSLFEGIGGMAYLFFDMIEPSEARFPAYEL  408



>ref|XP_007021343.1| G protein coupled receptor [Theobroma cacao]
 gb|EOY12868.1| G protein coupled receptor [Theobroma cacao]
Length=406

 Score =   576 bits (1484),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/413 (67%), Positives = 333/413 (81%), Gaps = 9/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  F+ ETT     +    T+DSL KLLSLP+ T S +LK  AL LK+ VVRE
Sbjct  3     DRFFPNEMPEFVAETT-----VTGGTTRDSLTKLLSLPYKTFSDKLKTSALDLKETVVRE  57

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DYTLYTGALGTA+L+  AYQVT N +DL LC  I+KACD+A S  SG VT
Sbjct  58    TWRLSGKRVQDYTLYTGALGTAYLVFNAYQVTKNENDLKLCSDIVKACDSA-SKDSGRVT  116

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ L   Y+ KFKEI+ P DLP+ELLYGRAG+LWACSFLN
Sbjct  117   FICGRAGVCALGAVIAKHSGDERLQDRYLRKFKEIRFPSDLPNELLYGRAGFLWACSFLN  176

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S+  MRA+ +EIIKSG++L+     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  177   KHIGKDTISTIRMRAVVDEIIKSGKQLAG--KGRCPLMYEWHGKKYWGAAHGLAGIMHVL  234

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMIK+R+P+GNYP++EG  E+D LVHWCHGAPG+ LTL KAA
Sbjct  235   MDMELKPDEVEDVKGTLRYMIKSRYPTGNYPSSEGS-ESDRLVHWCHGAPGVTLTLVKAA  293

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK EYLYRAKAF
Sbjct  294   EVFGDKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAF  353

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DRA  LI++  M  GD P+SLFEGIGGMAYLFLD+ +PS+A FPAYE+
Sbjct  354   ASFLSDRAQKLISERKMHGGDRPYSLFEGIGGMAYLFLDMGEPSEARFPAYEI  406



>ref|XP_010099009.1| hypothetical protein L484_025669 [Morus notabilis]
 gb|EXB76311.1| hypothetical protein L484_025669 [Morus notabilis]
Length=409

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/413 (68%), Positives = 334/413 (81%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F+ E    V E +     D L KLLSLP+ T S  L+  AL LKD VVRE
Sbjct  3     DRFFQNVMPNFLAEKP--VGETSSEAAVDPLTKLLSLPYKTFSDSLRSSALELKDTVVRE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DYT+YTGALGTA+L  KAYQVT N +DL LCL+I+KACD+A S  S  VT
Sbjct  61    TWVLSGKRVQDYTVYTGALGTAYLAFKAYQVTKNANDLKLCLEIVKACDSA-SRDSSRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+A + ALGAVAAKH GD+ LL HYIT+FKEIKL  DLP+ELLYGRAG+LWA SF+N
Sbjct  120   FLCGRASVCALGAVAAKHAGDERLLGHYITQFKEIKLSSDLPNELLYGRAGFLWASSFIN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
              ++G GT+S++  R++ +EIIK+GRKL+K    K PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  180   HHIGNGTISNTLRRSVVDEIIKAGRKLAK--KGKCPLMYEWHGKKYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELK DE EDVK TLRYMIKN FPSGNYP++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  238   MDMELKSDEAEDVKGTLRYMIKNCFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++FE ++F QAAMDAG+VVW+RGLLKRVGICHGISGNAYVFL+LYRLTGK EYLY+AKAF
Sbjct  297   EVFEDKQFLQAAMDAGDVVWERGLLKRVGICHGISGNAYVFLALYRLTGKVEYLYKAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHDRA  LI++G M  GDHP+SLFEGIGGMA+LFLD+ +PS+A FPAYEL
Sbjct  357   ACFLHDRARKLISEGRMHGGDHPYSLFEGIGGMAHLFLDMTEPSEARFPAYEL  409



>ref|XP_008226665.1| PREDICTED: lanC-like protein GCR2 [Prunus mume]
Length=409

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/414 (67%), Positives = 333/414 (80%), Gaps = 8/414 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQ-EIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             +R++PNEM  F+ E        I P   KDSL KLLSLP+ T+S  LK  AL LK+ VVR
Sbjct  3     DRFFPNEMLDFVAEAAADEAASIRP---KDSLTKLLSLPYETLSDMLKSSALDLKETVVR  59

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             +TWG  G+RV DYTLYTG LGTAFL  KAYQVT N +DL LC +I+KACD+A S  SG V
Sbjct  60    QTWGLSGKRVEDYTLYTGVLGTAFLAFKAYQVTKNENDLKLCSEIVKACDSA-SRGSGRV  118

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             +F CG+AG+ ALGAV AKH GD  LL  Y+++FKEIKLP DLP+ELLYGRAG+LWACSFL
Sbjct  119   SFTCGRAGVCALGAVVAKHAGDQMLLDRYLSQFKEIKLPSDLPNELLYGRAGFLWACSFL  178

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK++G GT+S++ MR++ +EIIK+GR+L+K    +S LMYEW G++YWGAAHGLAGIM+ 
Sbjct  179   NKHIGNGTISTTRMRSVVDEIIKAGRQLAK--KGRSSLMYEWHGKKYWGAAHGLAGIMHV  236

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM ++LKPDE EDVK TL YMIKNRFPSGN+P++EG  E+D LVHWCHGAPG+ALTL +A
Sbjct  237   LMSMQLKPDEVEDVKGTLHYMIKNRFPSGNFPSSEGT-ESDRLVHWCHGAPGVALTLVRA  295

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             A++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYLYRAKA
Sbjct  296   AEVFGDKEFLQAAIDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKA  355

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFLHDRA  LI++G M  GD P+SLFEG+GGMA+L LD+ +PS+A FPAY L
Sbjct  356   FACFLHDRALNLISEGTMHGGDRPYSLFEGVGGMAHLLLDMTEPSEARFPAYIL  409



>ref|XP_002534246.1| catalytic, putative [Ricinus communis]
 gb|EEF28136.1| catalytic, putative [Ricinus communis]
Length=419

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/421 (65%), Positives = 330/421 (78%), Gaps = 12/421 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIA--------PHGTKDSLAKLLSLPHNTISKRLKQDALT  391
             +RY+PNEM  +IPE T      A            KDS+  LLSLP+NT+   LK+ A  
Sbjct  3     DRYFPNEMQRYIPEPTATTSTTAIDKAAVVEAANNKDSITGLLSLPYNTLCDTLKRSAFE  62

Query  392   LKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA  571
             L+D VV+ETWG  G+RV DYT+YTG LGTA+LL KAYQVT N +DL+L  QI+KACD+A 
Sbjct  63    LRDMVVKETWGLSGKRVQDYTVYTGVLGTAYLLFKAYQVTKNENDLNLSSQIVKACDSA-  121

Query  572   SHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGY  751
             S  SG VTF+CG+AG+YALGAV AKH GD+ LL HY+T+FKEIK P DLP+ELLYGRAG+
Sbjct  122   SIDSGRVTFICGRAGVYALGAVIAKHAGDERLLDHYLTRFKEIKFPSDLPNELLYGRAGF  181

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHG  931
             LWACSFLNK++ K  +S+   RA+ NEI K+GRKL+  E  + PLMYEW G++YWGAAHG
Sbjct  182   LWACSFLNKHIDKEIISAGRQRAVVNEINKAGRKLAHRE--RYPLMYEWHGKKYWGAAHG  239

Query  932   LAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGI  1111
             LAGIM+ LM +EL+PDE EDVK TLRYMI NRF SGNYP++EG+ E+D LVHWCHGAPG+
Sbjct  240   LAGIMHVLMNMELRPDETEDVKRTLRYMINNRFRSGNYPSSEGN-ESDRLVHWCHGAPGV  298

Query  1112  ALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEE  1291
             ALTL KAA++F  +EF QAAM+A EVVW  GLLKRVG+CHGISGN YVFLSLY+LTG  E
Sbjct  299   ALTLVKAAEVFGDQEFLQAAMEAAEVVWNWGLLKRVGLCHGISGNTYVFLSLYQLTGNME  358

Query  1292  YLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             YLYRAKAF CF+HDRA  LI++G M  GD P+SLFEG+GGMAYLF D+ +PS+A FPAYE
Sbjct  359   YLYRAKAFACFIHDRAQKLISEGKMHGGDRPYSLFEGVGGMAYLFFDMIEPSEARFPAYE  418

Query  1472  L  1474
             L
Sbjct  419   L  419



>ref|XP_010245303.1| PREDICTED: lanC-like protein GCL2 [Nelumbo nucifera]
Length=420

 Score =   575 bits (1482),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/417 (66%), Positives = 339/417 (81%), Gaps = 8/417 (2%)
 Frame = +2

Query  224   EMAEERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDE  403
             EMA+ R++PNEM  F+ ETT   +E AP G  DSL KLLSLP+ T++++ K+ AL LK+ 
Sbjct  12    EMAD-RFFPNEMPDFVAETT---EETAPEGVGDSLRKLLSLPYPTVAEKFKRTALDLKET  67

Query  404   VVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHAS  583
             +V  TWG   RR++D+TLYTGALGTAFLL KAYQVT N +DL+LC +I+KACD+A+S  S
Sbjct  68    IVTNTWGFSRRRLSDFTLYTGALGTAFLLFKAYQVTKNKNDLNLCSEIVKACDSASS-GS  126

Query  584   GPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWAC  763
               VTF+CG+AG+ ALGAV AKH GD+ LL +Y+T+FKEIKLP D+P+ELLYGRAG+LWAC
Sbjct  127   KYVTFICGRAGVCALGAVIAKHAGDERLLSYYLTQFKEIKLPNDVPNELLYGRAGFLWAC  186

Query  764   SFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGI  943
             SFLNK++G+GT+ S+    + NEIIK GR+LS   +   PLM+EW G++YWGAAHGLAGI
Sbjct  187   SFLNKHIGEGTIPSTRTGPVVNEIIKDGRRLSNKGS--CPLMFEWHGKKYWGAAHGLAGI  244

Query  944   MYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTL  1123
             M+ LM +ELKPDEQEDVK TLRYMIKNRF SGNYP++EG D  D LVHWCHGAPG+ LTL
Sbjct  245   MHVLMGMELKPDEQEDVKGTLRYMIKNRFSSGNYPSSEGSDN-DRLVHWCHGAPGVTLTL  303

Query  1124  TKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYR  1303
              KAA++F  +EF +AA  AGEV+WKRGLLKRVGICHGISGNAY FLSLYR TG  EYLYR
Sbjct  304   VKAAEVFGGDEFLKAAEAAGEVIWKRGLLKRVGICHGISGNAYTFLSLYRQTGNVEYLYR  363

Query  1304  AKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             A+AF CFL DRA+ LI++G M  GD P+SLFEGIGGMAYLFLD+ +P++A FPAYEL
Sbjct  364   ARAFACFLLDRANRLISEGKMHGGDRPYSLFEGIGGMAYLFLDMIEPAEARFPAYEL  420



>ref|XP_009617549.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana tomentosiformis]
Length=408

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/413 (67%), Positives = 339/413 (82%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN +  F+ ETT  VQ+  P G KD L KLL LP+ T+ ++L++ AL LK+ +V+E
Sbjct  3     DRYFPNTIPVFVDETT--VQQSFPLGAKDPLLKLLHLPYRTVCQKLQRAALDLKETIVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW ++G RV+DYTLYTGALGTAFLL KAYQVT +N+DL+LC  IIKACD+A S  SG VT
Sbjct  61    TWVSKGGRVSDYTLYTGALGTAFLLFKAYQVTSDNNDLALCSHIIKACDSA-SRGSGRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+YALGAV AKH GD++L  +Y+TKFKEI+LP DLP+ELLYGRAG+LWACSFLN
Sbjct  120   FICGQAGVYALGAVVAKHSGDEQLCDYYLTKFKEIELPKDLPNELLYGRAGFLWACSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             KN+G+ T+S + ++A+  E+IKSGRKL K    + PLMYEW  ++YWG AHGLAGIM+ L
Sbjct  180   KNIGRDTISPTQIQAVVAEVIKSGRKLGKG---RCPLMYEWHEKKYWGVAHGLAGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELK DE EDVK TL YMI+N FPSGNYP++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  237   MDMELKADEVEDVKDTLHYMIRNHFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLIKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F  +EF QAA +A EVVW RGLLKRVGICHG+SGN+YVFLSLYRLTGK EYLY+AKAF
Sbjct  296   KVFSIDEFLQAAAEAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLH RA TLI++G+M  GD P+SLFEGIGGMAYLFLD+ +P +  FPAYEL
Sbjct  356   ACFLHARAQTLISEGVMHGGDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  408



>ref|XP_004244211.1| PREDICTED: lanC-like protein GCL2 [Solanum lycopersicum]
Length=408

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/413 (67%), Positives = 338/413 (82%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M +F+ ETT  V+E    G KD L +LL LP+ T+  +LK+ A  LK+ +V+E
Sbjct  3     DRFFPNTMPSFVDETT--VKESFLEGAKDPLLELLYLPYGTVCDKLKRVAFDLKETIVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW  +  RV+DYT+YTGALGTAFLL KAYQVT + +DL+LC  IIKACD+A S  SG VT
Sbjct  61    TWVCKRGRVSDYTIYTGALGTAFLLFKAYQVTLDKNDLALCSDIIKACDSA-SRGSGRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+Y+LGAV AK  GD++L  HY+TKFKEI+LP DLP+ELLYGRAG+LWACSFLN
Sbjct  120   FICGQAGVYSLGAVVAKQSGDEQLCDHYLTKFKEIELPKDLPNELLYGRAGFLWACSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             KN+G+ T+S + +RA+  E+IKSGRK+ K    K PLMYEW G+RYWGAAHGLAGIM+ L
Sbjct  180   KNIGRETISPTQIRAVVAEVIKSGRKMGKG---KCPLMYEWHGKRYWGAAHGLAGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELK DE EDVKATL YMI+NRFPSGNYP++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  237   MDMELKADEVEDVKATLHYMIRNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLIKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F ++EF QAA++A EV+W RGLLKRVGICHG+SGN+YVFLSLYRLTGK EYLY+AKAF
Sbjct  296   KVFSNDEFLQAAIEAAEVIWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLH RA TLI++G+M  GD P+SLFEG+GGMAYLF D+ DP +  FPAYEL
Sbjct  356   ACFLHTRAQTLISEGVMHGGDRPYSLFEGMGGMAYLFFDMIDPIETRFPAYEL  408



>ref|XP_010062888.1| PREDICTED: lanC-like protein GCR2 [Eucalyptus grandis]
 gb|KCW70029.1| hypothetical protein EUGRSUZ_F03336 [Eucalyptus grandis]
Length=409

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/413 (67%), Positives = 331/413 (80%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN M  F+PE +           KD L+KLL LPH  +S++LK+ AL LKD V RE
Sbjct  3     DRYFPNPMPDFVPEASAEDAAAE--RAKDPLSKLLYLPHAALSEKLKKAALDLKDTVARE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+R+ DYTLYTGALGTA+L+ KA+QVT N  DL LC +II+ACD AAS  SG VT
Sbjct  61    TWAVGGKRLQDYTLYTGALGTAYLVFKAFQVTKNESDLRLCSEIIRACD-AASRDSGRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+ ALGAV AKH GD+ LL HY+T+FKEI+LP DLP+ELLYGRAG+LWA SFLN
Sbjct  120   FICGQAGVCALGAVVAKHSGDERLLDHYLTRFKEIQLPRDLPNELLYGRAGFLWAGSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S++ MRA+ +++IK GR+L+K    K PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  180   KHIGKETISAARMRAVVDDVIKYGRRLAK--GGKCPLMYEWHGKKYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ LKPDE EDVK TL YMIKNRFPSGNYP++EG  E D LVHWCHGAPG+ALTL KAA
Sbjct  238   MDMPLKPDEVEDVKGTLHYMIKNRFPSGNYPSSEGS-ETDRLVHWCHGAPGVALTLVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F S+EF QAA+DAGEVVW RGLLKRVGICHGISGNAYVFLSL RLTG  EYLYRAKAF
Sbjct  297   EVFGSKEFLQAAVDAGEVVWSRGLLKRVGICHGISGNAYVFLSLSRLTGNAEYLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRA  LI++G M  GD P+SLFEGIGGMA LF+D  +PS+A FPAYEL
Sbjct  357   ACFLQDRALRLISEGKMHGGDRPYSLFEGIGGMAGLFMDTTEPSEARFPAYEL  409



>ref|XP_009343572.1| PREDICTED: lanC-like protein GCR2 [Pyrus x bretschneideri]
Length=409

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/413 (66%), Positives = 329/413 (80%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  F+ E        A    KDSL  LL LP+ T+S  LK  AL LK+ VVR+
Sbjct  3     DRFFPNEMPDFLAEPPP--DAAASASPKDSLTNLLHLPYRTLSDILKSSALDLKETVVRQ  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             T G  G+RV DY+LYTGALGTAFL  KAYQVT N  DL LC +I+KACD+A++  S  V+
Sbjct  61    TCGLGGKRVEDYSLYTGALGTAFLAFKAYQVTKNESDLKLCSEIVKACDSAST-GSRRVS  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD  LL  YI+KFKEIKL  DLP+ELLYGRAG+LWACSFLN
Sbjct  120   FICGRAGVCALGAVVAKHTGDKMLLDRYISKFKEIKLSSDLPNELLYGRAGFLWACSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G GT+S++ MR++ +EIIK+GR+L+K +  +S LMYEW G++YWGAAHGLAGIMY L
Sbjct  180   KHIGNGTISTTRMRSVVDEIIKAGRQLAKKD--RSSLMYEWHGKKYWGAAHGLAGIMYVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  ELKPDE EDVK TL YMIKNRFPSGN+P++EG  E+D LVHWCHGAPG+ALTL +AA
Sbjct  238   MSTELKPDEVEDVKGTLHYMIKNRFPSGNFPSSEGS-ESDCLVHWCHGAPGVALTLLRAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYLYRAKAF
Sbjct  297   EVFGDQEFLQAAVDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHDRA  LI++G M  GD P+SLFEG+GGM +L LD+ +PS+A FPAYEL
Sbjct  357   ACFLHDRALRLISEGTMHGGDRPYSLFEGVGGMVHLLLDMTEPSEARFPAYEL  409



>ref|XP_009617548.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana tomentosiformis]
Length=410

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/415 (67%), Positives = 339/415 (82%), Gaps = 9/415 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN +  F+ ETT  VQ+  P G KD L KLL LP+ T+ ++L++ AL LK+ +V+E
Sbjct  3     DRYFPNTIPVFVDETT--VQQSFPLGAKDPLLKLLHLPYRTVCQKLQRAALDLKETIVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASG--P  589
             TW ++G RV+DYTLYTGALGTAFLL KAYQVT +N+DL+LC  IIKACD+A S  SG   
Sbjct  61    TWVSKGGRVSDYTLYTGALGTAFLLFKAYQVTSDNNDLALCSHIIKACDSA-SRGSGCRR  119

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CGQAG+YALGAV AKH GD++L  +Y+TKFKEI+LP DLP+ELLYGRAG+LWACSF
Sbjct  120   VTFICGQAGVYALGAVVAKHSGDEQLCDYYLTKFKEIELPKDLPNELLYGRAGFLWACSF  179

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNKN+G+ T+S + ++A+  E+IKSGRKL K    + PLMYEW  ++YWG AHGLAGIM+
Sbjct  180   LNKNIGRDTISPTQIQAVVAEVIKSGRKLGKG---RCPLMYEWHEKKYWGVAHGLAGIMH  236

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELK DE EDVK TL YMI+N FPSGNYP++EG  E+D LVHWCHGAPG+ALTL K
Sbjct  237   VLMDMELKADEVEDVKDTLHYMIRNHFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLIK  295

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AAK+F  +EF QAA +A EVVW RGLLKRVGICHG+SGN+YVFLSLYRLTGK EYLY+AK
Sbjct  296   AAKVFSIDEFLQAAAEAAEVVWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVEYLYKAK  355

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLH RA TLI++G+M  GD P+SLFEGIGGMAYLFLD+ +P +  FPAYEL
Sbjct  356   AFACFLHARAQTLISEGVMHGGDRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL  410



>ref|XP_011085355.1| PREDICTED: lanC-like protein GCL2 [Sesamum indicum]
Length=422

 Score =   565 bits (1457),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/423 (65%), Positives = 328/423 (78%), Gaps = 13/423 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQE----------IAPHGTKDSLAKLLSLPHNTISKRLKQDA  385
             +R +PN M  F+PE+  +  E          I P GT+DSL KLLSLPH+ +S++L++ A
Sbjct  3     DRCFPNVMPDFVPESPKISDEEAKEKHEGDEILPQGTQDSLLKLLSLPHSALSQKLQRAA  62

Query  386   LTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDT  565
             L LK+ +V ETWGA G+RV D+TLYTG LGTAF+L K++QV GN +DLSLCL+I+KACD+
Sbjct  63    LDLKETIVVETWGATGQRVEDFTLYTGTLGTAFILFKSFQVAGNKNDLSLCLEIVKACDS  122

Query  566   AASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRA  745
             + S +S  VTF+CG+AG+ ALGAV AK+ GDD LL HY+ +FKEI+L  D PDELLYGRA
Sbjct  123   S-SASSRDVTFICGRAGVCALGAVVAKYIGDDNLLQHYLAQFKEIRLSKDHPDELLYGRA  181

Query  746   GYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAA  925
             GYLW C FLNK+LGK T+ S+   AI  E+I  GRKL   E   SPLM+EW G RYWGAA
Sbjct  182   GYLWTCLFLNKHLGKETIPSTSTGAIVREVISKGRKLG--EAGGSPLMFEWYGERYWGAA  239

Query  926   HGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAP  1105
             HGLAGI + LME EL  DE+EDVK TLRYM+KNRFPSGNYPA+E D + D LVHWCHGAP
Sbjct  240   HGLAGISHVLMEFELTSDEREDVKGTLRYMMKNRFPSGNYPASEEDKKRDVLVHWCHGAP  299

Query  1106  GIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK  1285
             GIALTL KAA++F  +EF +AAMDA EVVW RGLLKRVGICHGISGNAYVFLSLYRLTG 
Sbjct  300   GIALTLIKAAEVFGDKEFLEAAMDAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGI  359

Query  1286  EEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPA  1465
              EYLYRAKAF CFL DRAH L++ G +  GD+P SLFEGIGGMA+LFLD+  P  A FPA
Sbjct  360   VEYLYRAKAFACFLLDRAHMLMSTGDLHGGDNPSSLFEGIGGMAHLFLDMVQPKNARFPA  419

Query  1466  YEL  1474
             YEL
Sbjct  420   YEL  422



>gb|KHG14999.1| LanC-like protein 2 [Gossypium arboreum]
Length=407

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/413 (66%), Positives = 324/413 (78%), Gaps = 8/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  F+ E+T            DSL   LSLP+ ++S  LK  AL LK+ VVRE
Sbjct  3     DRFFPNEMPTFVAESTVSTGTAG----GDSLTTFLSLPYKSLSDHLKSAALALKETVVRE  58

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DYTLYTGALGTA+L+ KAYQVT N++DL LC  I+KACD+A S  SG VT
Sbjct  59    TWGLSGKRVQDYTLYTGALGTAYLVFKAYQVTKNDNDLKLCSDIVKACDSA-SKDSGRVT  117

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+YALGAV AK  GD  L   Y+ KF EI+ P DLP ELLYGRAG+LWACSFLN
Sbjct  118   FICGRAGVYALGAVIAKQSGDTSLEQRYLAKFNEIRFPSDLPHELLYGRAGFLWACSFLN  177

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S++H+RA+ +EII+SG++L+     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  178   KHIGKDTISTAHIRAVVDEIIESGKRLAG--KGRCPLMYEWHGKKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+ ELKPDE E VK TLR MIKNRFPSGNYP++EG  E+D LVHWCHGAPGI LTL KAA
Sbjct  236   MDTELKPDEVEYVKGTLRCMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGITLTLAKAA  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTG  EYLYRAKAF
Sbjct  295   EVFGDKEFLQAALDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGNVEYLYRAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DRA  LI+ G M  GD P+SLFEGIGGMA+LFLD+   S+A FPAYE+
Sbjct  355   ASFLSDRAEKLISQGKMHGGDRPYSLFEGIGGMAHLFLDMVKASEARFPAYEI  407



>gb|AES74528.2| G protein coupled receptor [Medicago truncatula]
Length=441

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/422 (64%), Positives = 330/422 (78%), Gaps = 8/422 (2%)
 Frame = +2

Query  224   EMAEERYYPNEMAAFIPETTTVVQE-----IAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             E    R++PN M  FIPE+T   Q+     +      DSL  LL++PH  +S+RLK+ AL
Sbjct  23    EAMSNRFFPNPMPEFIPESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPLSQRLKRAAL  82

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LK+ +V ETWG  G+RV D+TLY G LGTAFLLLK+Y VT N +DL+LC QI+K+CD A
Sbjct  83    DLKETIVMETWGLTGQRVGDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSCD-A  141

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAG  748
             AS +S  VTF+CG+AG+ ALGAVAAKH GDDE L +Y+ +F++IKLP DLPDELLYG+ G
Sbjct  142   ASLSSRDVTFICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQIKLPKDLPDELLYGKGG  201

Query  749   YLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAH  928
             +LWAC FLNK+LG+GTV SS+   + +EIIK+GR L   +  K PLM+EW G +YWGAAH
Sbjct  202   FLWACLFLNKHLGQGTVPSSYTATVVDEIIKNGRALG--QKRKCPLMFEWYGEKYWGAAH  259

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPG  1108
             GLAGIM  LM++ELKPDE EDV+ TL+YMI NRFPSGNYPA++ D ++D LVHWCHGAPG
Sbjct  260   GLAGIMNVLMDMELKPDELEDVRGTLKYMIHNRFPSGNYPASDKDKKSDVLVHWCHGAPG  319

Query  1109  IALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKE  1288
             +ALTL KAAK+F  +EF  AAM+AGEVVW RGLLKRVGICHGISGNAYVFLSLY+LTG  
Sbjct  320   MALTLVKAAKVFGDKEFLDAAMEAGEVVWSRGLLKRVGICHGISGNAYVFLSLYQLTGNT  379

Query  1289  EYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             +YLYRAKAF CFL D AH LI+ G M  GD P SLFEG+GGMAYLFLD+ +PS++ FPAY
Sbjct  380   KYLYRAKAFACFLLDGAHNLISGGEMHGGDSPHSLFEGVGGMAYLFLDMVNPSQSKFPAY  439

Query  1469  EL  1474
             EL
Sbjct  440   EL  441



>ref|XP_003540453.1| PREDICTED: lanC-like protein GCR2-like [Glycine max]
Length=405

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/413 (65%), Positives = 329/413 (80%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNE+  F+ ETT   Q  +P    DSL  LLSLP+ T+S + +  A  LK  VVR+
Sbjct  3     DRFFPNELPRFVAETTD--QTPSP----DSLTALLSLPYQTLSTKFQASAFHLKQSVVRD  56

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG+RG+RV DY+LYTGALGTA+LL KAYQVT + ++L+LC +I+KACD+A++  SG VT
Sbjct  57    TWGSRGKRVKDYSLYTGALGTAYLLFKAYQVTKDGNELNLCSEIVKACDSASAD-SGKVT  115

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL +Y+ +FKEI +P + P ELLYGRAGYLWACSFLN
Sbjct  116   FICGRAGVCALGAVIAKHTGDERLLDYYLRQFKEIAIPRESPYELLYGRAGYLWACSFLN  175

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G  T+ ++HMR+I +E+I +GR L +    + PLMYEW G++YWGAAHGLAGIM+AL
Sbjct  176   KHIGNNTIPTTHMRSIVDEVIMAGRHLGR--KGRCPLMYEWHGKKYWGAAHGLAGIMHAL  233

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMI NR PSGNYP++EG  E D LVHWCHGAPG+ LTL KAA
Sbjct  234   MDMELKPDEVEDVKGTLRYMINNRLPSGNYPSSEGS-ENDRLVHWCHGAPGLTLTLVKAA  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVFLSLYR+TG EEYLYRAKAF
Sbjct  293   EVFGDKEFSQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRMTGNEEYLYRAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRA  LI++G M  GD P+SLFEG+GGMAY  LD+ DP  A FP YEL
Sbjct  353   ACFLLDRAQNLISEGKMHGGDRPYSLFEGLGGMAYTCLDMVDPQMAKFPGYEL  405



>gb|EYU26400.1| hypothetical protein MIMGU_mgv1a007259mg [Erythranthe guttata]
Length=413

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/416 (66%), Positives = 331/416 (80%), Gaps = 8/416 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETT--TVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +RY+ NEM  +IP         E A     DSL  LL LP+ T+S+RLK+ AL LKD VV
Sbjct  3     DRYFTNEMPDYIPPENPPAAAVESAAASVSDSLTNLLHLPYKTLSERLKKSALDLKDTVV  62

Query  410   RETWGARGRRVT-DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASG  586
             +ETW  +G+RV  DY+LYTGALGTAFLL K+YQ+TG+ ++LSLC  IIKACD+A S +S 
Sbjct  63    KETWVCKGKRVGGDYSLYTGALGTAFLLFKSYQITGDKNNLSLCSDIIKACDSA-SQSSQ  121

Query  587   PVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACS  766
              VTF+CGQ G+YALGAVAA H GD++L + YIT+FKEIKL  DLPDELLYGRAG+LWA S
Sbjct  122   RVTFVCGQGGVYALGAVAAHHNGDEQLRNRYITRFKEIKLSKDLPDELLYGRAGFLWASS  181

Query  767   FLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIM  946
             F+NKN+G  T+SS  MRA+ +EIIKSGR L+K      PLM+EW G++YWG AHGLAGIM
Sbjct  182   FMNKNIGANTISSIRMRAVVDEIIKSGRNLAKGN---CPLMFEWHGKKYWGGAHGLAGIM  238

Query  947   YALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLT  1126
               LM++EL  DE + VK TL YMIKNRF SGNYP++EG  E D LVHWCHGAPG+ALTL 
Sbjct  239   NVLMDMELNRDEVDYVKGTLHYMIKNRFESGNYPSSEGS-ENDRLVHWCHGAPGVALTLA  297

Query  1127  KAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRA  1306
             KAAK+F SEEF QAA++AGEVVWKRGLLKRVGICHGISGNAYVFLSLY+LTGK E+LY+A
Sbjct  298   KAAKVFGSEEFMQAAIEAGEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGKSEFLYKA  357

Query  1307  KAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             KAF CFL+DRA  L+++G+M  GD P+SLFEGIGGMAYLFLD+ +PS+A FP +EL
Sbjct  358   KAFACFLYDRAQKLVSEGVMHGGDRPYSLFEGIGGMAYLFLDIIEPSQARFPVFEL  413



>ref|XP_008366750.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=409

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/413 (66%), Positives = 331/413 (80%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  F+ E             K+SL  LL LP+ T+S  LK  AL LK+ VVR+
Sbjct  3     DRFFPNEMPDFLAEPPPDAAAPES--PKNSLTGLLHLPYRTLSDILKCSALDLKETVVRQ  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DY+LYTGALGTAFL  KAYQVT N  DL LC +I+KACD+A++  S  V+
Sbjct  61    TWGLGGKRVEDYSLYTGALGTAFLAFKAYQVTKNESDLKLCSEIVKACDSAST-GSRRVS  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL  Y++KFKEIKL  DLP+ELLYGRAG+LWACSFLN
Sbjct  120   FICGRAGVCALGAVVAKHTGDEMLLDLYLSKFKEIKLSSDLPNELLYGRAGFLWACSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G GT+S++ MR++ +EIIK+GR+L+K    +S LMYEW G++YWGAAHGLAGIMY L
Sbjct  180   KHIGNGTISATCMRSVVDEIIKAGRQLAK--KGRSSLMYEWHGKKYWGAAHGLAGIMYVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  ELKP E EDVK TLRYMIKNRFPSGN+P++EG  E+D LVHWCHGAPG+ALTL +AA
Sbjct  238   MSTELKPAEVEDVKGTLRYMIKNRFPSGNFPSSEGS-ESDRLVHWCHGAPGVALTLLRAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVW +GLLKRVGICHGISGNAYVFLSLYRLTGK EYLYRAKAF
Sbjct  297   EVFGDQEFLQAAIDAGEVVWNQGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLHDRA  LI++G+M  GD  +SLFEG+GGMA+L LD+ +PS+A FPAYEL
Sbjct  357   ACFLHDRALRLISEGMMHGGDRSYSLFEGVGGMAHLLLDMTEPSEARFPAYEL  409



>ref|XP_008229171.1| PREDICTED: lanC-like protein GCL2 [Prunus mume]
Length=413

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/413 (66%), Positives = 331/413 (80%), Gaps = 4/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTV-VQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             +R++PN M  F+ ET T+  QE  P     SL KLLS+P+ ++S+R K+ AL LK+ ++ 
Sbjct  3     DRFFPNIMPDFVAETPTLPTQEAEPEIGSSSLMKLLSMPYPSLSERFKRTALDLKETILT  62

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ETWGA G+RV D+TLY+GALGTA LL K+YQVT N +DLSLC QIIKACD+A S  S  V
Sbjct  63    ETWGATGQRVHDFTLYSGALGTALLLFKSYQVTSNTNDLSLCSQIIKACDSA-SLGSRDV  121

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AGI ALGAVAAKH GD   L +Y+ +F+EIKL  +LPDELLYG+ G+LWAC FL
Sbjct  122   TFICGRAGICALGAVAAKHLGDSASLDYYLAQFREIKLSRNLPDELLYGKVGFLWACLFL  181

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK+LG+GT+SS++MRA+ +EIIK+GR L K    + PLM+EW G +YWGAAHGLAGIM  
Sbjct  182   NKHLGEGTISSAYMRAVVDEIIKNGRALGK--RGRCPLMFEWYGEKYWGAAHGLAGIMDV  239

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM++ELKPDE EDVK TL+YMI NRFPSGNYPA+E D   D LVHWCHGAPGIALTL KA
Sbjct  240   LMDMELKPDEVEDVKGTLKYMIDNRFPSGNYPASEEDKNRDVLVHWCHGAPGIALTLAKA  299

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             AK F  +EF +AA+DA E+VWKRGLLKRVGICHGISGNAYVFLSLY+LTG   +LYRAKA
Sbjct  300   AKFFGDKEFMEAAVDAAEMVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNLGFLYRAKA  359

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             F CFL DRA+ LI++G + RGD P+SLFEG+GGMAYL LD+ +PS+A FPAY+
Sbjct  360   FACFLVDRANKLISEGELHRGDSPYSLFEGVGGMAYLLLDMIEPSQAKFPAYK  412



>gb|KHN28043.1| LanC-like protein 2 [Glycine soja]
Length=405

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/413 (64%), Positives = 328/413 (79%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNE+  F+ ETT   Q  +P    DSL   LSLP+ T+S + +  A  LK  VVR+
Sbjct  3     DRFFPNELPRFVAETTD--QTPSP----DSLTAFLSLPYQTLSTKFQASAFHLKQSVVRD  56

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG+RG+RV DY+LYTGALGTA+LL KAYQVT + ++L+LC +I+KACD+A++  SG VT
Sbjct  57    TWGSRGKRVKDYSLYTGALGTAYLLFKAYQVTKDGNELNLCSEIVKACDSASAD-SGKVT  115

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL +Y+ +FKEI +P + P ELLYGRAGYLWACSFLN
Sbjct  116   FICGRAGVCALGAVIAKHTGDERLLDYYLRQFKEIAIPRESPYELLYGRAGYLWACSFLN  175

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G  T+ ++HMR+I +E+I +GR L +    + PLMYEW G++YWGAAHGLAGIM+AL
Sbjct  176   KHIGNNTIPTTHMRSIVDEVIMAGRHLGR--KGRCPLMYEWHGKKYWGAAHGLAGIMHAL  233

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMI NR PSGNYP++EG  E D LVHWCHGAPG+ LTL KAA
Sbjct  234   MDMELKPDEVEDVKGTLRYMINNRLPSGNYPSSEGS-ENDRLVHWCHGAPGLTLTLVKAA  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVFLSLYR+TG EEYLYRAKAF
Sbjct  293   EVFGDKEFSQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRMTGNEEYLYRAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRA  LI++G M  GD P+SLFEG+GGMAY  LD+ DP  A FP YEL
Sbjct  353   ACFLLDRAQNLISEGKMHGGDRPYSLFEGLGGMAYTCLDMVDPQMAKFPGYEL  405



>ref|XP_006348234.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=408

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/413 (65%), Positives = 337/413 (82%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M +F+ ETT  ++E    G K+ L +LL LP+ T+ ++LK+ A  LK+ +V+E
Sbjct  3     DRFFPNTMPSFVDETT--IEESFLEGAKEPLLELLYLPYGTVCEKLKRVAFDLKETIVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW  +  RV+DYT+YTGALGTAFLL KAYQVT + +DL LC  IIKACD+A S  SG VT
Sbjct  61    TWVCKRGRVSDYTVYTGALGTAFLLFKAYQVTLDKNDLVLCSDIIKACDSA-SRGSGHVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CGQAG+Y+LGAV AKH  D++L  HY+TKFKEI+LP DLP+ELLYGRAG+LWACSFLN
Sbjct  120   FICGQAGVYSLGAVVAKHNEDEQLCDHYLTKFKEIELPKDLPNELLYGRAGFLWACSFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             KN+G+ T+S + +RA+  E+IKSGRK+ K    + PLMYEW G+RYWGAAHGLAGIM+ L
Sbjct  180   KNIGRETISLTQIRAVVAEVIKSGRKMGKG---RCPLMYEWHGKRYWGAAHGLAGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELK DE EDVKATL Y+I+NRFPSGNYP++EG  E+D LVHWCHGAPG+ALTLTKAA
Sbjct  237   MDMELKADEVEDVKATLHYIIRNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLTKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F ++E+ QAA++A EV+W RGLLKRVGICHG+SGN+YVFLSLYRLTGK  YLY+AKAF
Sbjct  296   KVFSNDEYLQAAVEAAEVIWNRGLLKRVGICHGVSGNSYVFLSLYRLTGKVGYLYKAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFLH RA  LI++G+M  GD P+SLFEGIGGMAYLF D+ DP +  FPAYEL
Sbjct  356   ACFLHARAQALISEGVMHGGDRPYSLFEGIGGMAYLFFDMIDPMETRFPAYEL  408



>ref|XP_007212308.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
 gb|EMJ13507.1| hypothetical protein PRUPE_ppa006721mg [Prunus persica]
Length=398

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/414 (66%), Positives = 327/414 (79%), Gaps = 19/414 (5%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQ-EIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             +RY+PNEM  F+ E        + P   KD+L KLL           K  AL LK+ VVR
Sbjct  3     DRYFPNEMLDFVAEAAADEAASVRP---KDALTKLL-----------KSSALDLKETVVR  48

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             +TWG  G+RV DYTLYTG LGTAFL  KAYQVT N +DL LC +I+KACD+A S  SG V
Sbjct  49    QTWGLSGKRVEDYTLYTGVLGTAFLAFKAYQVTKNENDLKLCCEIVKACDSA-SRGSGRV  107

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             +F CG+AG+ ALGAV AKH GD  LL  Y+++FKEIKLP DLP+ELLYGRAG+LWACSFL
Sbjct  108   SFTCGRAGVCALGAVVAKHAGDQMLLDRYLSQFKEIKLPSDLPNELLYGRAGFLWACSFL  167

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK++G GT+S+++MR++ +EIIK+GR+L+K    +S LMYEW G++YWGAAHGLAGIM+ 
Sbjct  168   NKHIGNGTISNTYMRSVVDEIIKAGRQLAK--KGRSSLMYEWHGKKYWGAAHGLAGIMHV  225

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM ++LKPDE EDVK TLRYMIKNRFPSGN+P++EG  E+D LVHWCHGAPG+ALTL +A
Sbjct  226   LMSMQLKPDEVEDVKGTLRYMIKNRFPSGNFPSSEGS-ESDRLVHWCHGAPGVALTLVRA  284

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             A++F   EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYLYRAKA
Sbjct  285   AEVFGDLEFLQAAIDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKVEYLYRAKA  344

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFLHDRA  LI++G M  GD P+SLFEG+GGMA+L LD+ +PS+A FPAYEL
Sbjct  345   FACFLHDRALNLISEGAMHGGDRPYSLFEGVGGMAHLLLDMTEPSEARFPAYEL  398



>ref|XP_004514463.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=446

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/422 (64%), Positives = 330/422 (78%), Gaps = 7/422 (2%)
 Frame = +2

Query  221   SEMAEERYYPNEMAAFIPETTTVVQ----EIAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             +E   +R++PN M  F+PE T   Q    E     T DSL KLL++PH  +S+RLK+ AL
Sbjct  28    TEAMSDRFFPNPMPEFVPEATPSTQHELHEAITVTTGDSLHKLLAMPHAPLSERLKRAAL  87

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LK  +V ETWG   +RV D+TLY G LGTAFLL K+Y VT N +DL+LC QIIKACDTA
Sbjct  88    DLKQTIVMETWGFTEQRVGDFTLYCGLLGTAFLLFKSYNVTQNANDLTLCSQIIKACDTA  147

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAG  748
             + + S  V+F+CG+AG+ ALGAVAAKH G+DE L +Y+ +F++IKLP DLPDELLYGR G
Sbjct  148   SLY-SREVSFICGRAGVCALGAVAAKHAGNDESLRYYLAQFQKIKLPKDLPDELLYGRVG  206

Query  749   YLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAH  928
             +LWAC FLNK+LG+GTV SS+   + +EIIK+GR L +    K PLM+EW G +YWGAAH
Sbjct  207   FLWACLFLNKHLGQGTVPSSYTAPVVDEIIKNGRALGR--KGKCPLMFEWYGEKYWGAAH  264

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPG  1108
             GL GIM+ LM++ELKPD+ EDV+ TL+YMI NRFPSGNYPA+EGD + D LVHWCHGAPG
Sbjct  265   GLVGIMHVLMDMELKPDQLEDVRDTLKYMILNRFPSGNYPASEGDKKRDELVHWCHGAPG  324

Query  1109  IALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKE  1288
             +ALTL KA+K+F  EEF  AAM+A +VVW RGLLKRVG+CHGISGNAYVFLSLY+LTG  
Sbjct  325   VALTLVKASKVFGDEEFLDAAMEAADVVWSRGLLKRVGMCHGISGNAYVFLSLYQLTGNA  384

Query  1289  EYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             +YLY+AKAF CFL DRAH LI+ G M  GD P+SLFEG+GGMAYLFLD+ DPS++ FPAY
Sbjct  385   KYLYKAKAFACFLLDRAHKLISRGEMHGGDRPYSLFEGVGGMAYLFLDMVDPSQSKFPAY  444

Query  1469  EL  1474
             EL
Sbjct  445   EL  446



>ref|XP_010462143.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=412

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/413 (64%), Positives = 325/413 (79%), Gaps = 3/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++ NEM  F+PE +   +E      KDSL KLLSLP+ ++SK+L++ AL+LKD VV E
Sbjct  3     ERFFRNEMPDFVPEESAGDEENVAGVDKDSLTKLLSLPYKSLSKKLQRLALSLKDTVVSE  62

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY+LYTG LGTA LL K+YQVT N DDL LCL+I+ AC  A+  +   VT
Sbjct  63    TWERSGKRVRDYSLYTGVLGTAHLLFKSYQVTRNEDDLKLCLEIVDACYVASRDSERVVT  122

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG  G+ ALGAVAAKH GDD+L   Y+ +F EI+LP DLP ELLYGRAGYLW+C FLN
Sbjct  123   FICGHVGVCALGAVAAKHLGDDQLRDRYLARFNEIRLPCDLPYELLYGRAGYLWSCLFLN  182

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ +VSS+ MR++  EI + GR+L K  +   PLMYEW G+RYWGAAHG AGIM  L
Sbjct  183   KHIGQESVSSARMRSVVEEIFRGGRQLGKRGS--CPLMYEWHGKRYWGAAHGSAGIMNVL  240

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+PDE +DVK TL YMI+NRFPSGNYP++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  241   MHMELEPDEVQDVKCTLSYMIQNRFPSGNYPSSEG-SESDRLVHWCHGAPGVALTLVKAA  299

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+++EF +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYL+RAKAF
Sbjct  300   QVFKTKEFVEAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKPEYLFRAKAF  359

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DR+  LI++G M  GD PFSLFEGIGGMAY+FLD+ DP +A+FP YEL
Sbjct  360   ASFLLDRSEKLISEGKMHGGDGPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  412



>ref|XP_009766748.1| PREDICTED: lanC-like protein GCL2 [Nicotiana sylvestris]
Length=420

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/413 (66%), Positives = 322/413 (78%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQE--IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R+YPN M  ++ E   V +E    P GT +SL KLLS P+NT+S++ K+ AL LK+ +V
Sbjct  3     DRFYPNVMPDYVAENPAVEEEKHPIPQGTNESLLKLLSTPYNTLSEKFKRTALDLKETIV  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
              E+WG   ++V D+TLY G LGTAFLL K+YQVT N +DL++C QI+K CD+A S  S  
Sbjct  63    VESWGLTRQQVPDFTLYCGTLGTAFLLFKSYQVTNNTNDLAVCSQIVKDCDSA-SRNSRD  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTFLCG+AG+ ALGAV AK+ GDD+L+ +Y+T+FKEIKL  DLPDELLYGRAG+LWAC F
Sbjct  122   VTFLCGRAGVCALGAVVAKYMGDDQLVLYYVTQFKEIKLTKDLPDELLYGRAGFLWACLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             +NK++GKGTV SS+  A+ NEII++          +SPLMYEW G  YWGAAHGLAGIMY
Sbjct  182   MNKHIGKGTVPSSYTAAVVNEIIEN--GRRLGGRGRSPLMYEWYGEMYWGAAHGLAGIMY  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM+ ELKPDE EDVK TLRYM+KNRFPSGNYPA+E D   D LVHWCHGAPGIALTL K
Sbjct  240   VLMDFELKPDELEDVKETLRYMVKNRFPSGNYPASEEDKRRDVLVHWCHGAPGIALTLVK  299

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F   EF  AA+DA EVVW RGLLKRVG+CHGISGNAYVFLSLY+LTG EEYLYRAK
Sbjct  300   AAEVFGDREFLNAAVDAAEVVWNRGLLKRVGMCHGISGNAYVFLSLYQLTGNEEYLYRAK  359

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             AF CFL DRAH LI  G M  GD P+SLFEGIGGMAYLFLDL +P +A FPAY
Sbjct  360   AFACFLLDRAHKLIAKGEMHGGDSPYSLFEGIGGMAYLFLDLTEPKEARFPAY  412



>ref|XP_007215460.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
 gb|EMJ16659.1| hypothetical protein PRUPE_ppa006408mg [Prunus persica]
Length=413

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/413 (65%), Positives = 330/413 (80%), Gaps = 4/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTV-VQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             +R++PN M  F+ ET T+  QE  P     SL KLLS+ + ++S+R K+ AL LK+ ++ 
Sbjct  3     DRFFPNIMPDFVAETPTLPTQEAEPEIGSGSLMKLLSMAYPSLSERFKRTALDLKETILT  62

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ET GA G+ V D+TLY+GALGTA LL K+YQVT N +DLSLC QIIKACD+A S  S  V
Sbjct  63    ETLGATGQHVHDFTLYSGALGTALLLFKSYQVTSNTNDLSLCSQIIKACDSA-SLGSRDV  121

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ ALGAVAAKH GD   L +Y+T+F+EIKL  +LPDELLYG+ G+LWAC FL
Sbjct  122   TFICGRAGVCALGAVAAKHLGDSASLDYYLTQFREIKLSRNLPDELLYGKVGFLWACLFL  181

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK+LG+GT+SS++MRA+ +EIIK+GR L K    + PLM+EW G +YWGAAHGLAGIM  
Sbjct  182   NKHLGEGTISSAYMRAVVDEIIKNGRALGK--RGRCPLMFEWYGEKYWGAAHGLAGIMDV  239

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM++ELKPDE EDVK TL+YMI NRFPSGNYPA+E D   D LVHWCHGAPGI+LTL KA
Sbjct  240   LMDMELKPDEVEDVKGTLKYMIDNRFPSGNYPASEEDKNRDVLVHWCHGAPGISLTLAKA  299

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             AK+F  +EF +AA+DA EVVWKRGLLKRVGICHGISGNAYVFLSLY+LTG   +LYRAKA
Sbjct  300   AKVFGDKEFMEAAVDAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNLGFLYRAKA  359

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             F CFL DRAH LI++G + RGD P+SLFEG+GGMAYL LD+ +PS+A FPAYE
Sbjct  360   FACFLVDRAHKLISEGELHRGDSPYSLFEGVGGMAYLLLDMIEPSQAKFPAYE  412



>gb|KDP24150.1| hypothetical protein JCGZ_25807 [Jatropha curcas]
Length=414

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/418 (64%), Positives = 330/418 (79%), Gaps = 11/418 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTK-----DSLAKLLSLPHNTISKRLKQDALTLKD  400
             +R++PN M  F+ E +     +AP   K     DSL KLLS+P+ ++S+R ++ AL LK+
Sbjct  3     DRFFPNLMPDFVSEASPF---LAPQSEKEETSGDSLMKLLSMPYPSLSQRFQRAALDLKE  59

Query  401   EVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHA  580
              +V ETWG   + V D+TLY+G+LGTAF LLK YQV+ N +DLSLCLQI+KACD+A S A
Sbjct  60    TIVMETWGVNAQSVQDFTLYSGSLGTAFFLLKTYQVSNNKNDLSLCLQIVKACDSA-SLA  118

Query  581   SGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWA  760
             S  +TF+CG+AG+ A+GAVAAKH  D+ L ++Y+ +F E+KL  D PDELLYGR+GYLWA
Sbjct  119   SRDLTFICGRAGVCAIGAVAAKHANDEALKNYYLNQFGEVKLSRDHPDELLYGRSGYLWA  178

Query  761   CSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAG  940
             C FLNK++G+GT+  + +RA+A+EIIK+GR+L+K  +   PLMYEW G RYWGAAHGLAG
Sbjct  179   CLFLNKHIGEGTIPPTTIRAVASEIIKNGRELAK--DGGPPLMYEWYGERYWGAAHGLAG  236

Query  941   IMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALT  1120
             IM+ LM+VELKPDE EDVK TL YMIKNRFPSGNYP +E D + D LVHWCHGAPG+ALT
Sbjct  237   IMHVLMDVELKPDEVEDVKGTLNYMIKNRFPSGNYPPSEEDRKRDVLVHWCHGAPGVALT  296

Query  1121  LTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLY  1300
             L KAAK+F  +EF QAA+DA EVVW RGLLKRVGICHGISGNAYVFLSLYR+TG  E+LY
Sbjct  297   LVKAAKVFGVDEFLQAAVDAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRMTGNLEFLY  356

Query  1301  RAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             RAKAF  FL DRAH LI+ G M  GD P+SLFEGIGGMAYLFLD  +PS++ FPAYEL
Sbjct  357   RAKAFTSFLLDRAHKLISAGEMNGGDSPYSLFEGIGGMAYLFLDTTEPSESRFPAYEL  414



>ref|XP_002263345.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657174.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 ref|XP_010657175.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
 emb|CBI28768.3| unnamed protein product [Vitis vinifera]
Length=412

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/413 (64%), Positives = 326/413 (79%), Gaps = 3/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M  ++ ET    +E  P G +DSL KLLS+P + +S+RLK+ AL LK+  V E
Sbjct  3     DRFFPNVMPDYVAETPPTQEETPPQGGEDSLIKLLSMPFSALSQRLKRTALDLKETAVIE  62

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LGTA+LL +AY VT N  DL LC +I+KACD+A S  S  VT
Sbjct  63    TWGLTGQHVRDFTLYSGVLGTAYLLFRAYLVTANKTDLGLCSEIVKACDSA-SLGSRDVT  121

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAKH GD+ L+++Y+T+F EIKLP  LPDELLYGR G+LWAC FLN
Sbjct  122   FICGRAGVCALGAVAAKHNGDERLMNYYLTQFNEIKLPRSLPDELLYGRVGFLWACLFLN  181

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GTV  ++  A+ +EIIK+GR+L+     + PLM+EW G +Y GAAHGLAGIM+ L
Sbjct  182   KHIGQGTVPPTYTGAVVSEIIKNGRRLAN--KGRCPLMFEWYGEKYLGAAHGLAGIMHVL  239

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +ELK DE EDVK TLRYMIKNRFP GNYPA+E D   D LVHWCHGAPG+ALTL KAA
Sbjct  240   MHMELKIDEIEDVKGTLRYMIKNRFPRGNYPASEEDRNGDVLVHWCHGAPGVALTLAKAA  299

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF +AA+DA EVVW RGLLKRVG+CHGISGNAYVFLSLYRLTGK E+LYRAKAF
Sbjct  300   EVFGDDEFLEAAIDAAEVVWNRGLLKRVGVCHGISGNAYVFLSLYRLTGKMEFLYRAKAF  359

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRAH LI+DG M  GD P+SLFEG GGMA+LFLD+ +PS+A FPAYEL
Sbjct  360   ACFLLDRAHKLISDGEMHGGDSPYSLFEGSGGMAHLFLDMIEPSEARFPAYEL  412



>ref|XP_010241999.1| PREDICTED: lanC-like protein GCL2 isoform X3 [Nelumbo nucifera]
Length=408

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/413 (64%), Positives = 330/413 (80%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ NEM  F+ ET     E    G +DSL KLLSLP+ T++ +LK+ AL LK+ +V  
Sbjct  3     DRFFINEMPEFVAETN---DETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTN  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  GR V+D+TLYTG+LGTAFLL KAYQ T N +DL+LC +I+KACD+A+S  SG VT
Sbjct  60    TWGFSGRCVSDFTLYTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASS-GSGDVT  118

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ +LGA+AAKH G+++LL+HY+T+FKEIKLP ++P+ELLYGRAG+LWAC F+N
Sbjct  119   FICGRAGVCSLGAIAAKHAGNEQLLNHYLTQFKEIKLPKNVPNELLYGRAGFLWACLFIN  178

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GKGT+ S+    +  EIIK GR+L+    +  PLM+EW G +YWGAAHGLAGIM+ L
Sbjct  179   KHIGKGTIPSTLTGPVVKEIIKDGRRLA--SKVSCPLMFEWYGTKYWGAAHGLAGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE +DV  TL YMIKNRF SGNYP++E DD  D LVHWCHGAPG+ALTL KAA
Sbjct  237   MDMELKPDELQDVNDTLSYMIKNRFSSGNYPSSE-DDGTDCLVHWCHGAPGVALTLVKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F   +F +AA DAGEVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  E+LYRAKAF
Sbjct  296   EVFGGRQFLKAAGDAGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL D A  LI++G M  GD P+SLFEGIGGMAYLFLD+ +PS+A FPAYEL
Sbjct  356   ACFLLDMAPKLISEGKMHGGDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  408



>ref|XP_006303704.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
 gb|EOA36602.1| hypothetical protein CARUB_v10011802mg [Capsella rubella]
Length=410

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/413 (64%), Positives = 326/413 (79%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++ NEM  F+PE +T  +E A  G KDSL KLLSLP+ + SK+L + AL+LKD  V E
Sbjct  3     ERFFRNEMPEFVPEESTGDEE-AVSGGKDSLTKLLSLPYKSFSKKLHRLALSLKDTAVLE  61

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY+LYTG LGTA+L+ K+YQVT N DDL LCL+I++ACD A S  S  VT
Sbjct  62    TWERSGKRVRDYSLYTGVLGTAYLMFKSYQVTRNKDDLKLCLEIVEACDVA-SRDSERVT  120

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG AG+ ALGAVAAKH GDD+L   Y+  F EI+LP DLP ELLYGR+GYLW+C FLN
Sbjct  121   FICGHAGVCALGAVAAKHLGDDQLRDRYLACFSEIRLPSDLPYELLYGRSGYLWSCLFLN  180

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ +V S+ MR++  EI ++GR+L K  +   PLMYEW G++YWGAAHGLAGIM  L
Sbjct  181   KHIGQESVPSTRMRSVGEEIFRAGRQLGKRGS--CPLMYEWHGKKYWGAAHGLAGIMNVL  238

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+PDE +DVK TL YMI+NRF SGNYP++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  239   MHMELEPDEIQDVKGTLTYMIQNRFSSGNYPSSEGS-ESDRLVHWCHGAPGVALTLVKAA  297

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+++EF +AAM+AGEVVW RGLLKR GICHGI+GN YVFLSLYRLTGK EYLYRAKAF
Sbjct  298   QVFKTKEFVEAAMEAGEVVWNRGLLKRAGICHGITGNTYVFLSLYRLTGKPEYLYRAKAF  357

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++   I++G M  GD PFSLFEGIGGMAY+FLD+ DP +A+FP YEL
Sbjct  358   ASFLMDKSEKFISEGKMHGGDRPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  410



>ref|XP_010542278.1| PREDICTED: lanC-like protein GCR2 [Tarenaya hassleriana]
Length=408

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/413 (65%), Positives = 327/413 (79%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ NE+  F+PE     +EI   GTKDSL KLL LP+ + S RL++ AL LKD V R+
Sbjct  3     DRFFANELPEFVPEAGG--EEIEA-GTKDSLEKLLCLPYRSFSDRLRRYALDLKDTVARQ  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW    +RV DYTLYTG+LGTAFLL KAYQ T N +DL LC  IIKACD+A S  SGPVT
Sbjct  60    TWILSEKRVQDYTLYTGSLGTAFLLFKAYQATKNENDLRLCSDIIKACDSA-SRNSGPVT  118

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GDD LL HY+T+F EI+LP DLP ELLYGRAG LWAC FLN
Sbjct  119   FICGRAGVCALGAVVAKHIGDDRLLDHYLTRFDEIRLPSDLPCELLYGRAGCLWACLFLN  178

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+  VS + MR++  EI  SGR+L +    +SPLMYEW G++YWGAAHGL+GIM+ L
Sbjct  179   KHIGEERVSPARMRSVVEEIFSSGRQLGRTG--RSPLMYEWHGKKYWGAAHGLSGIMHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+PDE +DVK TL Y++KNRFPSGNY ++EG+ E+D LVHWCHGAPG+ALTL KAA
Sbjct  237   MHMELRPDEIKDVKGTLHYIMKNRFPSGNYRSSEGN-ESDRLVHWCHGAPGVALTLVKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F +EEF +AA++AGEVVW RGLLKRVGICHGISGNA+VFLSLYR+TGK EYLYRAKAF
Sbjct  296   EVFGTEEFLEAAVEAGEVVWNRGLLKRVGICHGISGNAFVFLSLYRVTGKAEYLYRAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DR+  LI++G M  GD PFS+FEGIGGMAYLF D+ DPS A FP ++L
Sbjct  356   AAFLLDRSEKLISEGNMHGGDRPFSIFEGIGGMAYLFFDMNDPSGARFPGFQL  408



>emb|CAN64758.1| hypothetical protein VITISV_008093 [Vitis vinifera]
Length=412

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/413 (64%), Positives = 325/413 (79%), Gaps = 3/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M  ++ ET    +E  P G +DSL KLLS+P + +S+RLK+ AL LK+  V E
Sbjct  3     DRFFPNVMPDYVAETPPTQEETPPQGGEDSLIKLLSMPFSALSQRLKRTALDLKETAVIE  62

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LGTA+LL +AY VT N  DL LC +I+KACD+A S  S  VT
Sbjct  63    TWGLTGQHVRDFTLYSGVLGTAYLLFRAYLVTANKTDLGLCSEIVKACDSA-SLGSRDVT  121

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAKH GD+ L+++Y+T+F EIKLP  LPDELLYGR G+LWAC FLN
Sbjct  122   FICGRAGVCALGAVAAKHNGDERLMNYYLTQFNEIKLPRSLPDELLYGRVGFLWACLFLN  181

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GTV  ++   + +EIIK+GR+L+     + PLM+EW G +Y GAAHGLAGIM+ L
Sbjct  182   KHIGQGTVPPTYTGXVVSEIIKNGRRLAN--KGRCPLMFEWYGEKYLGAAHGLAGIMHVL  239

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +ELK DE EDVK TLRYMIKNRFP GNYPA+E D   D LVHWCHGAPG+ALTL KAA
Sbjct  240   MHMELKIDEIEDVKGTLRYMIKNRFPRGNYPASEEDRNGDVLVHWCHGAPGVALTLAKAA  299

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF +AA+DA EVVW RGLLKRVG+CHGISGNAYVFLSLYRLTGK E+LYRAKAF
Sbjct  300   EVFGDDEFLEAAIDAAEVVWNRGLLKRVGVCHGISGNAYVFLSLYRLTGKMEFLYRAKAF  359

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRAH LI+DG M  GD P+SLFEG GGMA+LFLD+ +PS+A FPAYEL
Sbjct  360   ACFLLDRAHKLISDGEMHGGDSPYSLFEGSGGMAHLFLDMIEPSEARFPAYEL  412



>ref|XP_004291663.1| PREDICTED: lanC-like protein 2-like [Fragaria vesca subsp. vesca]
Length=403

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/413 (66%), Positives = 324/413 (78%), Gaps = 12/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY  N+M  F+ E     +         SLA+LLSLP+ T+S  LK  AL LK  VV +
Sbjct  3     DRYLENDMPDFVEEEAPAEEAEV-----GSLARLLSLPYATLSDMLKSSALDLKQTVVMQ  57

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG   +RV DY+LYTGALGTA L  KAYQVT N  DL LC  I+KACD A S  SG V+
Sbjct  58    TWG---KRVGDYSLYTGALGTACLAFKAYQVTKNLSDLKLCCDIVKACDIA-SRDSGHVS  113

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ A GAVAAKH GD  LL HY+++FKEIKL  DLP+ELLYGRAGYLWACSFLN
Sbjct  114   FICGRAGVCAFGAVAAKHAGDGMLLDHYLSQFKEIKLYSDLPNELLYGRAGYLWACSFLN  173

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             KN+G GTVS++ +R++ +EIIKSGR+L+K    +S LMYEW G++YWGAAHGLAGIMY L
Sbjct  174   KNIGNGTVSTTRIRSVVDEIIKSGRQLAK--KGRSSLMYEWHGKKYWGAAHGLAGIMYVL  231

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M V+LKP+E EDVK TLRYMIKN FPSGNY ++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  232   MTVQLKPEEVEDVKGTLRYMIKNCFPSGNYLSSEGS-ESDRLVHWCHGAPGVALTLVKAA  290

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  EEF QAA+DAGEVVW+RGLLKRVG+CHGISGN YVFLSLYR TGK EYLYRAKAF
Sbjct  291   EVFGDEEFVQAAIDAGEVVWRRGLLKRVGLCHGISGNTYVFLSLYRFTGKVEYLYRAKAF  350

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL+DRA  LI++G M  GD P+SLFEG+GGMA+LFLD+ DPS+A FP YEL
Sbjct  351   ACFLYDRAPRLISEGRMHGGDRPYSLFEGVGGMAHLFLDMTDPSEARFPGYEL  403



>ref|XP_004487685.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=416

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/418 (64%), Positives = 321/418 (77%), Gaps = 9/418 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETT-----TVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKD  400
             +R++PN++  F+ ETT        ++ A H    SL  LLSLP+ T+S  L+Q AL  K 
Sbjct  3     DRFFPNDLPPFVAETTLDEEEEEEEKEATHSQPHSLTSLLSLPYQTLSTNLQQAALHFKQ  62

Query  401   EVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHA  580
              VV ETWG+ G RV DYTLYTGALGTA+LL KAYQVT N DDL+LC +I+KACD+A+ ++
Sbjct  63    SVVSETWGSSGNRVKDYTLYTGALGTAYLLFKAYQVTKNVDDLNLCSKIVKACDSASKNS  122

Query  581   SGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWA  760
             S  VTF+CG+AG+ ALGAV AKH GD  LL +Y+ +FKEI+LP DLP E+LYG+AGYLWA
Sbjct  123   S-RVTFICGRAGVCALGAVIAKHAGDGRLLDYYLRQFKEIELPHDLPYEVLYGKAGYLWA  181

Query  761   CSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAG  940
             CSFLNK++GK T+ ++ MR I  E+I +GRKL+     + PLMYEW G++YWGAAHGLAG
Sbjct  182   CSFLNKHIGKDTIPTADMRPIVEEVITAGRKLA--HKGRCPLMYEWHGKKYWGAAHGLAG  239

Query  941   IMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALT  1120
             IM  LM +ELKPDE EDVK TLRYMIKNRF SGNYP++EG  E+D LVHWCHGAPG+ LT
Sbjct  240   IMNVLMGMELKPDEVEDVKGTLRYMIKNRFSSGNYPSSEGS-ESDRLVHWCHGAPGVTLT  298

Query  1121  LTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLY  1300
             L KA + FE +EF QAA+DAGEVVW RGLLKRVG+CHG+SGN YVFLSLYRLTG +EYLY
Sbjct  299   LVKAVEAFEDKEFLQAAVDAGEVVWNRGLLKRVGLCHGVSGNTYVFLSLYRLTGNKEYLY  358

Query  1301  RAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             RAK F CFL DRA  LI  G M  GD P+SLFEG+GGMA  FLD+ DP  A FP YEL
Sbjct  359   RAKGFSCFLLDRAQKLIVKGKMHGGDRPYSLFEGLGGMANTFLDMVDPQVARFPGYEL  416



>ref|XP_007132705.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
 gb|ESW04699.1| hypothetical protein PHAVU_011G117700g [Phaseolus vulgaris]
Length=414

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/414 (65%), Positives = 327/414 (79%), Gaps = 5/414 (1%)
 Frame = +2

Query  239   RYYPNEMAAFIPETT--TVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             R++ N M  F+PE T  T  ++       DSL KLL++PH  +S+RLK+ AL LK+ +V 
Sbjct  4     RFFQNPMPEFVPEATPSTPQEQEEALTVGDSLPKLLAMPHAPLSERLKRAALDLKETIVI  63

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ETWG   R+  D++LY G LGTAFLLLK+Y+VT N +DLSLC QI+KACD AAS  S  V
Sbjct  64    ETWGVSWRKDGDFSLYCGVLGTAFLLLKSYEVTRNGNDLSLCSQIVKACD-AASVRSRDV  122

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ +LGAVAAKH GDDE L +Y+ +F++IKL  DLPDELLYGR G+LWAC FL
Sbjct  123   TFICGRAGVCSLGAVAAKHAGDDESLRYYMAQFEKIKLSKDLPDELLYGRVGFLWACLFL  182

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK+LG+GTV SS+   + +E+IKSGR+L +    + PLM+EW G +YWGAAHGLAGIM+ 
Sbjct  183   NKHLGQGTVPSSYTAMVVDEVIKSGRRLGR--KGRCPLMFEWYGEKYWGAAHGLAGIMHV  240

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LME+ELKPDE EDVK TL+YMI NRF SGNYPA+E D ++D LVHWCHGAPGIALTL KA
Sbjct  241   LMEMELKPDELEDVKGTLKYMISNRFSSGNYPASEDDRKSDVLVHWCHGAPGIALTLVKA  300

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             AK+F  +EF  AAM+AGEVVW RGLLK+VGICHGISGNAYVFLSLY+LTG  ++LYRAKA
Sbjct  301   AKVFGDKEFLDAAMEAGEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGNVKHLYRAKA  360

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL DRAH LI+ G M  GD P+SLFEG+GGMAYLFLD+ DPS + FPAYEL
Sbjct  361   FACFLLDRAHKLISGGEMHGGDRPYSLFEGLGGMAYLFLDMIDPSLSKFPAYEL  414



>ref|XP_010675629.1| PREDICTED: lanC-like protein GCR2 [Beta vulgaris subsp. vulgaris]
Length=408

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 324/413 (78%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  +IPE++ +       G  DSL KLL LP+ ++ + LK  AL LKD VV+E
Sbjct  3     DRFFPNEMPDYIPESSIITSSTLETG--DSLKKLLHLPYKSVCEILKNSALQLKDAVVKE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY+LYTGALGTAFLL KAYQVT N  DL+L  QII+ACD+A S  S  +T
Sbjct  61    TWAKSGKRVQDYSLYTGALGTAFLLFKAYQVTNNKGDLALSSQIIQACDSA-SRGSKNIT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG++G+ ALGAV AKH GD+ LL+HY+T+FK+IKLP DLP ELLYG+ G+LW+CSFL 
Sbjct  120   FICGRSGVCALGAVVAKHAGDENLLNHYVTEFKQIKLPADLPYELLYGKTGFLWSCSFLK  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ T+S S MR I ++I+K+G+KL K    + PLMYEW G++YWGAAHGLAGI++ L
Sbjct  180   KHIGEDTISYSTMREIVSDIMKAGKKLGKG---RCPLMYEWHGKKYWGAAHGLAGILHVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL  DEQED+K+ LRYMI+ RFP GNYP++EG  E+D LVHWCHGAPG+ALTL KA 
Sbjct  237   MSMELTLDEQEDIKSVLRYMIRGRFPGGNYPSSEGS-ESDRLVHWCHGAPGLALTLAKAY  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +E  QAA+DA EVVW RGLLKRVGICHG SGN YVFL+LYRLTG  EYLYRAKAF
Sbjct  296   EVFGDKELLQAAVDAAEVVWNRGLLKRVGICHGTSGNTYVFLALYRLTGNAEYLYRAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FLHDRA  LI +G M  GD P+SLFEG+GGMAYLFLD+ +P++A FPAYEL
Sbjct  356   ASFLHDRARRLIAEGFMHGGDRPYSLFEGLGGMAYLFLDMNEPAEARFPAYEL  408



>gb|KHG20582.1| LanC-like protein 2 [Gossypium arboreum]
Length=409

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/414 (64%), Positives = 331/414 (80%), Gaps = 8/414 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTT-VVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             +R++PN +  F+PETT    QEI      D+L KLLS+P++++S+  K+ AL LK+ V  
Sbjct  3     DRFFPNVLPDFVPETTQHEQQEIG-----DTLIKLLSMPYSSLSQHFKRTALDLKETVTL  57

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ETWG   ++V+D+TLY G LGTAFLL K+Y +T N +DLSLCL I+ AC++A S +S   
Sbjct  58    ETWGITSQKVSDFTLYCGTLGTAFLLFKSYLLTNNTNDLSLCLAIVDACNSA-SLSSRDA  116

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TFLCG+AG+ ALGAVAAK+ G+ E L+HY+T F+EIKL  DLPDELLYGRAG+LWAC FL
Sbjct  117   TFLCGRAGVCALGAVAAKYAGNQESLNHYLTPFREIKLSRDLPDELLYGRAGFLWACLFL  176

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK+LG+GT++S+  RA+ +EIIK+GR L K +   SPLM+EW G +YWGAAHGLAGI+Y 
Sbjct  177   NKHLGEGTITSTTTRAVVDEIIKNGRALGK-KGGGSPLMFEWYGEKYWGAAHGLAGIIYV  235

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM+ ELKPDE EDVK+TLRYMI+NRFP GNYPA+E D ++D LVHWCHGAPGIALTL KA
Sbjct  236   LMDTELKPDEAEDVKSTLRYMIRNRFPGGNYPASEQDRKSDVLVHWCHGAPGIALTLVKA  295

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             A++F  +EF +AA+DA EVVW RGLLKRVGICHGISGNAYVFLSLYR TG  ++L+RAKA
Sbjct  296   AEVFGDDEFLEAAVDAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRKTGNVKFLHRAKA  355

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL D+AH LI++G M  GD P+SLFEGIGGMAYLFLD+ +P  + FPAYEL
Sbjct  356   FACFLLDQAHKLISNGEMHGGDRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL  409



>ref|XP_002894411.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70670.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/413 (65%), Positives = 324/413 (78%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER+  NE+  F+PE +    E    G KDSL KLLSLP+ + S++L+  AL+LKD+VV E
Sbjct  3     ERFSRNELPEFVPEESAGEDETVTAG-KDSLTKLLSLPYKSFSEKLQSYALSLKDKVVWE  61

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY LYTG LGTA+LL K+YQVT N DDL LCL+I++ACD A S  S  VT
Sbjct  62    TWERSGKRVRDYKLYTGVLGTAYLLFKSYQVTRNEDDLKLCLEIVEACDVA-SRDSERVT  120

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG AG+ ALGAVAAKH GD++LL  Y+ +F+ I+LP  LP ELLYGRAGYLWAC FLN
Sbjct  121   FICGHAGVCALGAVAAKHLGDNQLLDRYLARFRGIRLPSYLPYELLYGRAGYLWACLFLN  180

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK +VSS  MR++  EI ++GR+L        PLMYEW G+RYWGAAHGLAGIM  L
Sbjct  181   KHIGKDSVSSERMRSVVEEIFRAGRQLGNRGT--CPLMYEWHGKRYWGAAHGLAGIMNVL  238

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+ DE +DVK TL YMI+NRFPSGNY ++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  239   MHMELEQDEIKDVKGTLSYMIQNRFPSGNYLSSEGS-ESDRLVHWCHGAPGVALTLVKAA  297

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+++EF +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYLYRAKAF
Sbjct  298   QVFKTKEFVEAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKAEYLYRAKAF  357

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G M  GD PFSLFEGIGGMAY+FLD+ DP++ALFP YEL
Sbjct  358   ASFLLDKSEKLISEGKMHGGDRPFSLFEGIGGMAYMFLDMNDPTQALFPGYEL  410



>ref|XP_003539910.1| PREDICTED: lanC-like protein GCL2-like [Glycine max]
 gb|KHN31966.1| LanC-like protein 2 [Glycine soja]
Length=414

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/415 (64%), Positives = 328/415 (79%), Gaps = 5/415 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETT--TVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R++PN M  F+PETT  T  +E       DSL KLL++PH  + +RLK+ AL LK+ +V
Sbjct  3     DRFFPNPMPEFVPETTPSTPQEEEEALTVGDSLPKLLAMPHAPLLERLKRAALDLKETIV  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
              ETWG  G++V D+TLY G LGTAFLL K+Y+VTGN +DLSLC +I+KACD AAS  S  
Sbjct  63    IETWGLSGQQVRDFTLYCGVLGTAFLLFKSYRVTGNGNDLSLCSEIVKACD-AASARSRD  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ +LGAVAAKH GDDE L +Y+ +FK+IKL  DLPDELLYGR G+LWAC F
Sbjct  122   VTFICGRAGVCSLGAVAAKHAGDDESLKYYLAQFKKIKLSKDLPDELLYGRVGFLWACLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK+LG GTV S++   + +E+IK+GR L +    + PLM+EW G +YWGAAHGLAGIM+
Sbjct  182   LNKHLGLGTVPSNYTAVVVDEVIKNGRALGR--KGRCPLMFEWYGEKYWGAAHGLAGIMH  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELKPDE EDV+ TL+YMI NRF SGNYP +E D ++D LVHWCHGAPG+ALTL K
Sbjct  240   VLMDMELKPDELEDVRGTLKYMISNRFRSGNYPVSEDDRKSDALVHWCHGAPGMALTLVK  299

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AAK+F  +EF  AA++A EVVW RGLLK+VGICHGISGNAYVFLSLY+LTG  +YLYRAK
Sbjct  300   AAKVFGDKEFLDAAIEAAEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGDVKYLYRAK  359

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFL DRAH LI+ G M  GD P+S+FEG+GGMAYLFLD++DPS + FPAYEL
Sbjct  360   AFACFLLDRAHKLISRGEMHGGDRPYSMFEGLGGMAYLFLDMSDPSLSKFPAYEL  414



>ref|XP_010500915.1| PREDICTED: lanC-like protein GCR2 [Camelina sativa]
Length=411

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/413 (63%), Positives = 326/413 (79%), Gaps = 4/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++ NE+  F+PE +   +E    G KDSL +LLSLP+ + SK+L++ AL+LKD VV E
Sbjct  3     ERFFQNELPEFVPEESAGDEETVA-GGKDSLTRLLSLPYKSFSKKLQRLALSLKDTVVLE  61

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY+LYTG LGTA LL K+YQVT N DDL LCL+I++AC  A+  +   VT
Sbjct  62    TWERSGKRVRDYSLYTGVLGTAHLLFKSYQVTKNEDDLKLCLEIVEACYVASIDSKRVVT  121

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG AG+ ALGAVAAKH GD++L   Y+ +F EI++P DLP ELLYGRAGYLW+C F+N
Sbjct  122   FICGHAGVCALGAVAAKHLGDEQLCDRYLARFSEIRIPSDLPYELLYGRAGYLWSCLFMN  181

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+  VSS+ MR++  EI ++GR+L K  +   PLMYEW G+RYWGAAHGLAGIM  L
Sbjct  182   KHIGQECVSSAKMRSVVEEIFRAGRQLGKRGS--CPLMYEWHGKRYWGAAHGLAGIMNVL  239

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+PDE +DVK TL YMI+NRFPSGNYP++EG  E+D L HWCHGAPG+ALTL KAA
Sbjct  240   MHMELEPDEIQDVKGTLSYMIQNRFPSGNYPSSEG-SESDRLFHWCHGAPGVALTLVKAA  298

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+++EF +AAM+AGEVVW RGLLKR+GICHGISGN YVFLSLYRLT K EYLYRAKAF
Sbjct  299   QVFKTKEFIEAAMEAGEVVWNRGLLKRLGICHGISGNTYVFLSLYRLTEKPEYLYRAKAF  358

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL +++  LI++G M  GD PFSLFEGIGGMAY+FLD+ DP +A+FP YEL
Sbjct  359   ASFLLEKSEKLISEGKMHGGDRPFSLFEGIGGMAYMFLDMNDPRQAVFPGYEL  411



>ref|XP_009147647.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCR2 [Brassica 
rapa]
Length=409

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/413 (63%), Positives = 327/413 (79%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++PNE+  F+PE     + ++ H  KDSL KLLSLP+ + SK+L++ AL+LKD +V E
Sbjct  3     ERFFPNEIPEFLPEDAGEEETVSTH--KDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV D+ LYTG LGTA+LL ++YQV  N +DL LCL+I++AC TA S  S  VT
Sbjct  61    TWDRSGKRVRDFNLYTGVLGTAYLLFQSYQVARNENDLKLCLEIVEACYTA-SKDSDRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAK  GD +L   Y+ +F EI+LP DLP ELLYGRAGYLWAC FLN
Sbjct  120   FICGRAGVCALGAVAAKLTGDSQLQDRYLARFHEIRLPGDLPYELLYGRAGYLWACLFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK +VSS+ MR++  EI ++GR+L   E +K PLM+EW G++YWGAAHGLAGIM+ L
Sbjct  180   KHIGKDSVSSARMRSVVEEIFRAGRQLG--ERVKCPLMFEWHGKKYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M VEL+PDE EDVK TL YMI++RFPSGNY ++EG  E+D LVHWCHGAPG+AL L KAA
Sbjct  238   MHVELEPDEMEDVKGTLSYMIQHRFPSGNYLSSEGS-ESDRLVHWCHGAPGVALALVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF +AAM+AGEV+W RGLLK VGICHGISGN YVFLSLYRLTGK EYLYRAKAF
Sbjct  297   QVFRKDEFVEAAMEAGEVLWNRGLLKXVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G M  GD PFSLFEGIGGMAY+FLD+ +P++ALFP YEL
Sbjct  357   ASFLLDKSEKLISEGKMHGGDRPFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  409



>ref|XP_003618310.1| LanC-like protein [Medicago truncatula]
Length=469

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/450 (60%), Positives = 330/450 (73%), Gaps = 36/450 (8%)
 Frame = +2

Query  224   EMAEERYYPNEMAAFIPETTTVVQE-----IAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             E    R++PN M  FIPE+T   Q+     +      DSL  LL++PH  +S+RLK+ AL
Sbjct  23    EAMSNRFFPNPMPEFIPESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPLSQRLKRAAL  82

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LK+ +V ETWG  G+RV D+TLY G LGTAFLLLK+Y VT N +DL+LC QI+K+CD A
Sbjct  83    DLKETIVMETWGLTGQRVGDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSCD-A  141

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKE-----------------  697
             AS +S  VTF+CG+AG+ ALGAVAAKH GDDE L +Y+ +F++                 
Sbjct  142   ASLSSRDVTFICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQDWAFMQTTCSNRLNAAM  201

Query  698   -----------IKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKS  844
                        IKLP DLPDELLYG+ G+LWAC FLNK+LG+GTV SS+   + +EIIK+
Sbjct  202   QSVIYVRFRSDIKLPKDLPDELLYGKGGFLWACLFLNKHLGQGTVPSSYTATVVDEIIKN  261

Query  845   GRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKN  1024
             GR L   +  K PLM+EW G +YWGAAHGLAGIM  LM++ELKPDE EDV+ TL+YMI N
Sbjct  262   GRALG--QKRKCPLMFEWYGEKYWGAAHGLAGIMNVLMDMELKPDELEDVRGTLKYMIHN  319

Query  1025  RFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRG  1204
             RFPSGNYPA++ D ++D LVHWCHGAPG+ALTL KAAK+F  +EF  AAM+AGEVVW RG
Sbjct  320   RFPSGNYPASDKDKKSDVLVHWCHGAPGMALTLVKAAKVFGDKEFLDAAMEAGEVVWSRG  379

Query  1205  LLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHP  1384
             LLKRVGICHGISGNAYVFLSLY+LTG  +YLYRAKAF CFL D AH LI+ G M  GD P
Sbjct  380   LLKRVGICHGISGNAYVFLSLYQLTGNTKYLYRAKAFACFLLDGAHNLISGGEMHGGDSP  439

Query  1385  FSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              SLFEG+GGMAYLFLD+ +PS++ FPAYEL
Sbjct  440   HSLFEGVGGMAYLFLDMVNPSQSKFPAYEL  469



>ref|XP_007043559.1| GCR2-like 2 isoform 1 [Theobroma cacao]
 gb|EOX99390.1| GCR2-like 2 isoform 1 [Theobroma cacao]
Length=408

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/413 (63%), Positives = 331/413 (80%), Gaps = 7/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN +  F+ ETT   +E+      D+L KLLS+P++++S+  K+ AL LK+ V  +
Sbjct  3     DRFFPNVLPDFVSETTEQKEEVG-----DTLMKLLSMPYSSLSQHFKRAALDLKETVTLD  57

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G++V+D+TLY G LGTAFLL K+YQ+  N +DLSLCL I+ AC++A S +S  VT
Sbjct  58    TWGLTGQKVSDFTLYCGTLGTAFLLFKSYQLANNTNDLSLCLAIVDACNSA-SFSSRDVT  116

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+AG+ ALGAVAAKH G+ ELL +Y+++FKEIKL  +LPDELLYGRAG+LWAC FLN
Sbjct  117   FLCGRAGVCALGAVAAKHAGNQELLDYYLSQFKEIKLSSNLPDELLYGRAGFLWACVFLN  176

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K+LG+GT+ S+  RA+ +E+IK+GR+L+K +   SPLM+E+ G +YWGAAHGLAGIM+ L
Sbjct  177   KHLGEGTIPSTTTRAVVDEVIKNGRQLAK-KGGGSPLMFEFYGEKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++EL+PDE  DVK TL+YMI+NRFPSGNYPA+E D + D LVHWCHGAPGIALTL KAA
Sbjct  236   MDMELEPDEIMDVKGTLKYMIRNRFPSGNYPASEQDRKRDVLVHWCHGAPGIALTLVKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF +AA+DA EVV+ RGLLKRVGICHGISGNAYVFLSLYR TG  E+LYRAKAF
Sbjct  296   EVFGDDEFLEAAVDAAEVVFNRGLLKRVGICHGISGNAYVFLSLYRKTGNVEFLYRAKAF  355

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRAH LI+ G M  GD P+SLFEGIGGMAYLFLD+ +P  A FPAYE 
Sbjct  356   ACFLLDRAHKLISKGEMHGGDRPYSLFEGIGGMAYLFLDMIEPLGARFPAYEF  408



>gb|KFK35758.1| hypothetical protein AALP_AA4G032600 [Arabis alpina]
Length=403

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/413 (63%), Positives = 321/413 (78%), Gaps = 12/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++  E+   +PE          +  +DS+ KLLSLP+ + S++L++ AL+LKD VV E
Sbjct  3     ERFFRYELPESVPEK---------YAGEDSMTKLLSLPYKSFSEKLQKYALSLKDTVVLE  53

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY +YTG LGTA+LL K+Y VT N DDL LCL+I++ACD  AS  S  VT
Sbjct  54    TWERCGKRVRDYNMYTGVLGTAYLLFKSYLVTSNEDDLKLCLEIVQACDVVASRDSERVT  113

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG AG+ +LGAV AK  GDD+L   Y+T+F+EI+LP DLP ELLYGR GYLWAC FLN
Sbjct  114   FLCGYAGVCSLGAVVAKCIGDDQLQDRYLTRFREIRLPSDLPYELLYGRVGYLWACLFLN  173

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K +GK +VSS+ MR +  EI + GR+L K    + PLMYEW G++YWGAAHGLAGIMY L
Sbjct  174   KYIGKDSVSSARMRFLVEEIFRGGRQLGK--RGECPLMYEWHGKKYWGAAHGLAGIMYVL  231

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+ DE EDVK TLRYMI+NRFPSGNYP++EG +E+D LVHWCHGAPG+ALTL KAA
Sbjct  232   MHMELELDEIEDVKGTLRYMIQNRFPSGNYPSSEG-NESDRLVHWCHGAPGVALTLIKAA  290

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F ++EF +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYLYRAKAF
Sbjct  291   QVFGTQEFVEAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAF  350

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI +G M  GD PFSLFEGIGGM+Y+FLD+ DP++ALFP YEL
Sbjct  351   ASFLLDKSEKLIAEGKMHGGDRPFSLFEGIGGMSYMFLDMIDPTQALFPGYEL  403



>ref|XP_009588409.1| PREDICTED: lanC-like protein GCL2 [Nicotiana tomentosiformis]
Length=423

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/413 (64%), Positives = 317/413 (77%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQE--IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R+YPN M  F+ E   V +E    P GT +SL KLLS P+NT+S++ K+ AL LK+ ++
Sbjct  3     DRFYPNVMPDFVAENPAVEEEKHPIPQGTNESLLKLLSTPYNTLSEKFKRAALDLKETIL  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
              ETWG   ++V D+TLY G LGTAFL+ K+YQVT N +DL++C QI+K CD A S  S  
Sbjct  63    VETWGLTRQQVPDFTLYNGTLGTAFLMFKSYQVTNNTNDLAVCSQIVKDCDFA-SRNSRD  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTFLCG+AG+ ALGAV AK+ GDD+L+ +Y+T+FKEIKL  DLPDELLYGRAG+LWA  F
Sbjct  122   VTFLCGRAGVCALGAVVAKYMGDDQLVLYYVTQFKEIKLTKDLPDELLYGRAGFLWASLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             +NK++GKGT+ S++  A+ NEII++          +SPLMYEW G  YWGAAHGLAGIMY
Sbjct  182   MNKHIGKGTIPSTYTAAVVNEIIEN--GRRLGGRGRSPLMYEWYGEMYWGAAHGLAGIMY  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM+ ELKPDE EDVK TLRYM+KNRFPSGNYP +E D   D LVHWCHGAPGIALTL K
Sbjct  240   VLMDFELKPDELEDVKETLRYMVKNRFPSGNYPTSEEDKRRDVLVHWCHGAPGIALTLVK  299

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F   EF  AA+DA EVVW RGLLKRVG+CHGISGNAYVFLSLY+LTG  EYLYRAK
Sbjct  300   AAEVFGDREFLNAAVDAAEVVWNRGLLKRVGMCHGISGNAYVFLSLYQLTGNVEYLYRAK  359

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             A  CFL DRAH LI  G M  GD P+SLFEGIGGMAYLFLD+ +P +A FPAY
Sbjct  360   ALACFLLDRAHKLIAKGEMHGGDSPYSLFEGIGGMAYLFLDMTEPKEARFPAY  412



>ref|XP_010241998.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nelumbo nucifera]
Length=409

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/413 (63%), Positives = 329/413 (80%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ NEM  F+ ET     E    G +DSL KLLSLP+ T++ +LK+ AL LK+ +V  
Sbjct  3     DRFFINEMPEFVAETN---DETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTN  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  GR V+D+TLYTG+LGTAFLL KAYQ T N +DL+LC +I+KACD+A+S +   VT
Sbjct  60    TWGFSGRCVSDFTLYTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGSGSDVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ +LGA+AAKH G+++LL+HY+T+FKEIKLP ++P+ELLYGRAG+LWAC F+N
Sbjct  120   FICGRAGVCSLGAIAAKHAGNEQLLNHYLTQFKEIKLPKNVPNELLYGRAGFLWACLFIN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GKGT+ S+    +  EIIK GR+L+    +  PLM+EW G +YWGAAHGLAGIM+ L
Sbjct  180   KHIGKGTIPSTLTGPVVKEIIKDGRRLA--SKVSCPLMFEWYGTKYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE +DV  TL YMIKNRF SGNYP++E DD  D LVHWCHGAPG+ALTL KAA
Sbjct  238   MDMELKPDELQDVNDTLSYMIKNRFSSGNYPSSE-DDGTDCLVHWCHGAPGVALTLVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F   +F +AA DAGEVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  E+LYRAKAF
Sbjct  297   EVFGGRQFLKAAGDAGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNLEFLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL D A  LI++G M  GD P+SLFEGIGGMAYLFLD+ +PS+A FPAYEL
Sbjct  357   ACFLLDMAPKLISEGKMHGGDSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL  409



>gb|AGV54697.1| lanC-like protein 2 [Phaseolus vulgaris]
Length=405

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 316/413 (77%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM  F+ ETT ++         DSL  LLSLP+  +S++ +  A  LK  VVRE
Sbjct  3     DRFFPNEMPRFVAETTDLIP------LTDSLTALLSLPYQILSEKFQASAFHLKQSVVRE  56

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG+RG+RV DYTLYTGALGTA+LL KAYQVT + +DL+LC +I++AC +A++  SG VT
Sbjct  57    TWGSRGKRVKDYTLYTGALGTAYLLFKAYQVTKDGNDLNLCSEIVEACHSASAD-SGRVT  115

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+AG+ ALGAV AKH GDD LL +Y+ +FKEI +P D P ELLYGR GYLWACSFLN
Sbjct  116   FLCGRAGVCALGAVVAKHTGDDRLLDYYLRQFKEIVIPRDSPYELLYGRTGYLWACSFLN  175

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G  T+ ++HMR++ +E+I +GR+L      + P MYEW G++YWGAAHGLAGIM+ L
Sbjct  176   KHIGHNTIPTTHMRSVVDEVISAGRQLG--HKGRCPXMYEWHGKKYWGAAHGLAGIMHVL  233

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE E+VK TLRYMI  RFPSGNYP++EG  E D  VHWCHGAPGI  TL KA 
Sbjct  234   MDMELKPDEVEEVKGTLRYMINYRFPSGNYPSSEGS-ENDRFVHWCHGAPGIIFTLVKAG  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVF  LYRLTG EEYLY AKAF
Sbjct  293   EVFGGKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNPYVFFFLYRLTGNEEYLYMAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             GCFL DRA  LI+ G M  GD P+SLFEG GGMAY  LD+ DP  A FP YE 
Sbjct  353   GCFLLDRAQKLISGGKMHGGDCPYSLFEGFGGMAYTCLDMVDPKMAKFPGYEF  405



>ref|XP_010051804.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Eucalyptus 
grandis]
Length=419

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/421 (63%), Positives = 323/421 (77%), Gaps = 12/421 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEI--------APHGTKDSLAKLLSLPHNTISKRLKQDALT  391
             +R++PN M  F+PE                AP  +  SLAKLL+ P+  +S+  K+ AL 
Sbjct  3     DRFFPNTMPVFVPEAAAAAASDDDDGGAVSAPGDS--SLAKLLAKPYPVLSESFKRAALD  60

Query  392   LKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA  571
             LK+ +V +TWGA  +RV D+TLY G+LGTAFLL ++YQ+T N++DL+LC QII+ACD+A+
Sbjct  61    LKETIVVQTWGATRQRVRDFTLYCGSLGTAFLLFRSYQITSNSNDLALCSQIIRACDSAS  120

Query  572   SHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGY  751
             +  S  VTF+CG+AG+ ALGAV AK+ GD   L HY+  FKEIKL   +PDELLYGRAG+
Sbjct  121   AK-SRDVTFICGRAGVCALGAVVAKYAGDTHSLTHYLNHFKEIKLSKSIPDELLYGRAGF  179

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHG  931
             LWAC FLNK++G+GT   S MRA+A+EI K+GR L+K    KSPLM+EW G +YWGAAHG
Sbjct  180   LWACLFLNKHIGEGTAPXSTMRAVADEIFKNGRALAK-RGGKSPLMFEWYGEKYWGAAHG  238

Query  932   LAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGI  1111
             LAGIM+ LM +ELKPDE EDVK TL+YMI+NRFPSGNYP++E D   D LVHWCHGAPGI
Sbjct  239   LAGIMHVLMHMELKPDEMEDVKGTLKYMIRNRFPSGNYPSSEEDRNRDVLVHWCHGAPGI  298

Query  1112  ALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEE  1291
             ALTL KAA++F  EEF +AA+DA EVVW RGLLKRVGICHGISGN YVFLSLYR+TG  E
Sbjct  299   ALTLVKAAEVFRDEEFLRAAVDAAEVVWNRGLLKRVGICHGISGNVYVFLSLYRVTGNAE  358

Query  1292  YLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             +LYRAKAF CFL DRA  LI+ G M  GD+P+SLFEGIGG AYLFLD+ +PS A FPAYE
Sbjct  359   FLYRAKAFACFLLDRALKLISTGEMHGGDNPYSLFEGIGGTAYLFLDMVEPSAARFPAYE  418

Query  1472  L  1474
             L
Sbjct  419   L  419



>ref|XP_006392852.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
 gb|ESQ30138.1| hypothetical protein EUTSA_v10011533mg [Eutrema salsugineum]
Length=409

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/413 (64%), Positives = 324/413 (78%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++ NE+  F+PE     +EI   G KDS+ KLLSLP+ + S++L++ AL+LKD VVRE
Sbjct  3     ERFFRNEIPEFVPEEVGE-EEIVSAG-KDSMTKLLSLPYRSFSEKLQRYALSLKDTVVRE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY+LYTG LGTA+LL K+YQ+T N DDL LCL+I++ACD A S  S  +T
Sbjct  61    TWERSGKRVGDYSLYTGVLGTAYLLFKSYQITRNEDDLKLCLEIVEACDVA-SRDSERLT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GDD+L   Y+  F+EI+LP  LP ELLYGRAGYLWAC FLN
Sbjct  120   FICGRAGVCALGAVVAKHLGDDQLQDRYLADFREIRLPSGLPHELLYGRAGYLWACLFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK TVSS+ MR++  EI + GR+L K  +   PLMYEW G+RYWGAAHGLAGIM+ L
Sbjct  180   KHIGKDTVSSARMRSVVEEIFREGRQLGKRGS--CPLMYEWHGKRYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M +EL+ DE +DVK TL YM  +RFPSGNY ++EG+ E+D LVHWCHGA G+ALTL KAA
Sbjct  238   MHMELEQDEMQDVKVTLAYMFLHRFPSGNYLSSEGN-ESDCLVHWCHGATGVALTLVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++  + E  +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLTGK EYLYRAKAF
Sbjct  297   QVLRTVELVEAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGKPEYLYRAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G M  GD PFSLFEGIGGMAY+F D+ DP++ALFPAYEL
Sbjct  357   ASFLLDKSEKLISEGEMHGGDRPFSLFEGIGGMAYMFFDMNDPTRALFPAYEL  409



>ref|XP_007149603.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
 gb|ESW21597.1| hypothetical protein PHAVU_005G083500g [Phaseolus vulgaris]
Length=427

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/435 (61%), Positives = 324/435 (74%), Gaps = 32/435 (7%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKD-----  400
             +R++PNEM  F+ ETT ++         DSL  LLSLP+  +S++ +  A  LK      
Sbjct  3     DRFFPNEMPRFVAETTDLIP------LTDSLTALLSLPYQILSEKFQASAFHLKQSVPKN  56

Query  401   -----------------EVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDL  529
                              +VVRETWG+RG+RV DYTLYTGALGTA+LL KAYQVT + +DL
Sbjct  57    FILNLWVSFNWLSSILVQVVRETWGSRGKRVKDYTLYTGALGTAYLLFKAYQVTKDGNDL  116

Query  530   SLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLP  709
             +LC +I++AC +A++  SG VTFLCG+AG+ ALGAV AKH GDD LL +Y+ +FKEI +P
Sbjct  117   NLCSEIVEACHSASAD-SGRVTFLCGRAGVCALGAVVAKHTGDDRLLDYYLRQFKEIVIP  175

Query  710   VDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLM  889
              D P ELLYGR GYLWACSFLNK++G  T+ ++HMR++ +E+I +GR+L      + PLM
Sbjct  176   RDSPYELLYGRTGYLWACSFLNKHIGHNTIPTTHMRSVVDEVISAGRQLG--HKGRCPLM  233

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDE  1069
             YEW G++YWGAAHGLAGIM+ LM++ELKPDE E+VK TLRYMI  RFPSGNYP++EG  E
Sbjct  234   YEWHGKKYWGAAHGLAGIMHVLMDMELKPDEVEEVKGTLRYMINYRFPSGNYPSSEGS-E  292

Query  1070  ADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNA  1249
              D LVHWCHGAPGI LTL KAA++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN 
Sbjct  293   NDRLVHWCHGAPGIILTLVKAAEVFGEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNT  352

Query  1250  YVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFL  1429
             YVFLSLYRLTG EEYLY AKAFGCFL DRA  LI+ G M  GD P+SLFEG+GGMAY  L
Sbjct  353   YVFLSLYRLTGNEEYLYMAKAFGCFLLDRAQKLISGGKMHGGDRPYSLFEGLGGMAYTCL  412

Query  1430  DLADPSKALFPAYEL  1474
             D+ DP  A FP YE 
Sbjct  413   DMVDPKMAKFPGYEF  427



>gb|KEH38770.1| G protein coupled receptor [Medicago truncatula]
Length=417

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/420 (62%), Positives = 319/420 (76%), Gaps = 10/420 (2%)
 Frame = +2

Query  233   EERYYPNEMAAFIP------ETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTL  394
              +R++PN +  F        E        +   T+ SL  LLSLP+ T++ +L+  AL  
Sbjct  2     SDRFFPNNLPPFTAGAETTLEDEEEEATSSQTPTQHSLTSLLSLPYQTLTSKLQATALHF  61

Query  395   KDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAAS  574
             K  VV ETWG+   RV DYTLYTG LGTA+L+ K+YQV+ N DDL+LCL+I+KACD+A++
Sbjct  62    KQSVVSETWGSGVNRVKDYTLYTGVLGTAYLVFKSYQVSKNVDDLNLCLKIVKACDSASA  121

Query  575   HASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYL  754
             ++S  VTF+CG+AG+ ALGAV AKH GD+ LL +Y+ +FKEI+LP DLP ELLYGR GYL
Sbjct  122   NSS-RVTFICGRAGVCALGAVIAKHAGDERLLDYYLRQFKEIELPCDLPYELLYGRTGYL  180

Query  755   WACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGL  934
             WACSFLNK++GK T+ +++MR I +E+I +GRKL+     + PLMYEW G++YWGAAHGL
Sbjct  181   WACSFLNKHVGKDTIPTTYMRPIVDEVITTGRKLA--HKGRCPLMYEWHGKKYWGAAHGL  238

Query  935   AGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIA  1114
             AGIM  LM++ELKPDE ED+K TLRYMIKNRF SGNYP++EG  E+D LVHWCHGAPG+ 
Sbjct  239   AGIMNVLMDMELKPDEVEDIKGTLRYMIKNRFSSGNYPSSEGS-ESDRLVHWCHGAPGVT  297

Query  1115  LTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEY  1294
             LTL KAA++F   EF QAA DAGEVVWKRGLLKRVGICHGISGN YVFLSLYRLTG +EY
Sbjct  298   LTLVKAAEVFGDREFLQAAEDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNKEY  357

Query  1295  LYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             LYRAK F CFL DRA  LI  G M  GD P+SLFEG+GGM Y F+D+ DP  A FP YEL
Sbjct  358   LYRAKGFSCFLLDRAQELIGQGKMHGGDRPYSLFEGLGGMTYTFVDMIDPQVARFPGYEL  417



>ref|XP_004141231.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 gb|KGN55144.1| hypothetical protein Csa_4G638330 [Cucumis sativus]
Length=412

 Score =   536 bits (1382),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/415 (63%), Positives = 321/415 (77%), Gaps = 7/415 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSL--AKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R++PN+M  F P      +  + H    +L   +LLSLP   +S RL+Q AL LK+ VV
Sbjct  3     DRFFPNQMPRF-PAEAPPDELASSHSYSATLIPTELLSLPDAALSDRLRQAALNLKETVV  61

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             RETW   GR   D TLYTGALGTAFL LK++ V+ N +DL LC +I+ AC++  S  S  
Sbjct  62    RETWTLSGRHPQDNTLYTGALGTAFLALKSFFVSKNENDLKLCSEIVTACESL-SKTSRH  120

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAK   D  L+ HY+ KFK+IKLP DLP+ELLYGRAG+LWAC F
Sbjct  121   VTFICGRAGVCALGAVAAKFANDGRLVDHYLAKFKDIKLPSDLPNELLYGRAGFLWACLF  180

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK++G+ T+S++ MR++ +E+I++GR L   E  KSPLMYEW G++YWGAAHGLAGIM+
Sbjct  181   LNKHIGQNTISNNFMRSVVDEVIEAGRTLG--EKSKSPLMYEWHGKKYWGAAHGLAGIMH  238

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ALTL K
Sbjct  239   VLMDMELKPDEVEDVKNTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLGK  297

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG   YL+RAK
Sbjct  298   AAEVFGDDEFLQAAIDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLMYLHRAK  357

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLH  A  LI++G M  GD P+SLFEGIGGMAYLF D+ +P+ A FP+YEL
Sbjct  358   AFACFLHQNAEKLISEGKMHSGDRPYSLFEGIGGMAYLFFDMVEPNAAKFPSYEL  412



>ref|XP_004248157.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Solanum lycopersicum]
Length=413

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/414 (64%), Positives = 320/414 (77%), Gaps = 5/414 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQE--IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R+YPN M  F+ E   + +E    P GT +SL KLLS P++ +SK+ K+ AL LK+ +V
Sbjct  3     DRFYPNVMPDFVAENPAIEEEQHPNPQGTNESLLKLLSTPYHILSKKFKRAALDLKETIV  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
              ETWG   ++V D+TLY G LGTAFLL KAYQVT N +DL++C QI+K CD+A+ H S  
Sbjct  63    AETWGLTRQQVPDFTLYCGTLGTAFLLFKAYQVTKNTNDLAVCSQIVKDCDSASRH-SRD  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTFLCG+AG+ ALGAV AK+ GDD+L+ +Y+++FKEIKL  DLPDELLYGRAGYLWA  F
Sbjct  122   VTFLCGRAGVCALGAVVAKYMGDDQLVFYYVSQFKEIKLTKDLPDELLYGRAGYLWAFLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             +NK++G+GT+ S++  A+ +EIIK+GRKL      +SPLM+EW G  YWGAAHGLAGIM+
Sbjct  182   INKHIGQGTIPSTYTAAVIDEIIKNGRKLGG--KGRSPLMHEWYGEMYWGAAHGLAGIMH  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM+ ELKPD+ EDVK TL+YM+KNRFPSGNYPA+E D   D LVHWCHGAPGI LTL K
Sbjct  240   VLMDFELKPDDLEDVKGTLKYMVKNRFPSGNYPASENDRRRDLLVHWCHGAPGIVLTLVK  299

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  EEF  AA+ A EVVW RGLLKRVGICHGISGNAY  LSLYRLTG  EYLYRAK
Sbjct  300   AAEVFGDEEFINAAVAAAEVVWNRGLLKRVGICHGISGNAYALLSLYRLTGNAEYLYRAK  359

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             AF CFL DRAH LI  G M  GD P+SLFEGI GMAYLFLD+ DP  A FPAYE
Sbjct  360   AFACFLLDRAHKLIAKGEMHGGDTPYSLFEGIAGMAYLFLDMPDPKNARFPAYE  413



>gb|KFK40450.1| hypothetical protein AALP_AA3G374700 [Arabis alpina]
Length=407

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/413 (62%), Positives = 321/413 (78%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F+ ET T           DSL  LL++P++++S +LK+ AL LK+ VV E
Sbjct  5     DRFFHNVMPDFVRETET-------EAGGDSLMHLLAMPYSSLSHQLKRSALDLKETVVIE  57

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LG AFLL +++QVT N +DLSLCLQI+KACD AAS +S  VT
Sbjct  58    TWGFTGQLVQDFTLYSGTLGVAFLLFRSFQVTKNANDLSLCLQIVKACD-AASASSRDVT  116

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ +LGA AAK  G+++LL++Y+ +F++I+L  DLP+ELLYGR GYLWAC F+N
Sbjct  117   FICGRAGVCSLGAAAAKLSGEEDLLNYYLAQFRQIRLASDLPNELLYGRVGYLWACLFIN  176

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K +   T+SS+++R +  EIIK GR ++K  N  SPLM+EW G++YWGAAHGLAGIM+ L
Sbjct  177   KYVAAETLSSTNIRQVTQEIIKEGRSMAK--NGSSPLMFEWYGKKYWGAAHGLAGIMHVL  234

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+V+LKPDE EDVK TL+YMIKNRFPSGNYPA E D   D LVHWCHGAPGIALTL KA+
Sbjct  235   MDVQLKPDEAEDVKGTLKYMIKNRFPSGNYPANEEDRRRDTLVHWCHGAPGIALTLVKAS  294

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F   EF +A + A EVVWKRGL+KRVGICHGISGNAYVFL+LYR TG+ EYLYRAKAF
Sbjct  295   EVFGEREFLEAGVAAAEVVWKRGLIKRVGICHGISGNAYVFLALYRATGRSEYLYRAKAF  354

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DR H L++ G M  GD P+SLFEGIGGMAYLFLD+ DP++A FP YEL
Sbjct  355   ASFLLDRGHKLLSKGEMHGGDSPYSLFEGIGGMAYLFLDMVDPTQARFPGYEL  407



>emb|CDP14758.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   534 bits (1376),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/422 (62%), Positives = 325/422 (77%), Gaps = 12/422 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAP-------HGTKDSLAKLLSLPHNTISKRLKQDALTL  394
             +RY+PN M  F+ E  T+ QEI          GT++SL +LL+ P+ T+S++LK+ AL L
Sbjct  3     DRYFPNLMPDFVQEDPTLEQEIQQSGHRIPEQGTEESLFRLLATPYTTLSEKLKRAALDL  62

Query  395   KDE--VVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
             K+   VV +TWG  G++V D+TLY+GALGTA LL K++ VT N +DL LC QI+ ACD+A
Sbjct  63    KETIVVVVDTWGLTGQKVDDFTLYSGALGTALLLFKSFLVTRNGNDLILCSQIVNACDSA  122

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAG  748
             + H++  VTF+CG+AG+ ALGAV AK+ G D+LLH+Y+  FKEI+L  DLPDELLYGRAG
Sbjct  123   SLHST-DVTFICGRAGVCALGAVVAKYLGYDQLLHYYLNHFKEIRLTRDLPDELLYGRAG  181

Query  749   YLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAH  928
             YLWAC F+N+++G+GT+  + M A   EI +SGRKL      +SPLM+EW G +YWGAAH
Sbjct  182   YLWACLFINEHIGRGTILPTEMGAAVKEIFRSGRKLGG--RGRSPLMFEWYGEKYWGAAH  239

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPG  1108
             GLAGIM+ L+  ELK DE+E+VK TL YMIKNRFPSGNYPA+E D   D LVHWCHGAPG
Sbjct  240   GLAGIMHILLHFELKADEREEVKETLNYMIKNRFPSGNYPASEEDKRRDVLVHWCHGAPG  299

Query  1109  IALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKE  1288
             IALTL KAA++F  + F QAA+DA EVVW RGLLKRVGICHG+SGN YVFL+LYRLTG  
Sbjct  300   IALTLVKAAEVFGDKRFLQAAIDAAEVVWNRGLLKRVGICHGVSGNTYVFLALYRLTGNV  359

Query  1289  EYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             E+LYRAKAF CFL DRA+ LI+ G M  GD P+SLFEGIGGMAYLFLD+ +P+ A FPAY
Sbjct  360   EFLYRAKAFSCFLLDRAYKLISKGEMHGGDSPYSLFEGIGGMAYLFLDMVEPTNARFPAY  419

Query  1469  EL  1474
             EL
Sbjct  420   EL  421



>ref|XP_010241996.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nelumbo nucifera]
Length=436

 Score =   535 bits (1377),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/440 (60%), Positives = 330/440 (75%), Gaps = 33/440 (8%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ NEM  F+ ET     E    G +DSL KLLSLP+ T++ +LK+ AL LK+ +V  
Sbjct  3     DRFFINEMPEFVAETN---DETGAEGIEDSLLKLLSLPYPTLAAKLKRTALDLKETIVTN  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHA-----  580
             TWG  GR V+D+TLYTG+LGTAFLL KAYQ T N +DL+LC +I+KACD+A+S +     
Sbjct  60    TWGFSGRCVSDFTLYTGSLGTAFLLFKAYQATKNKNDLNLCAEIVKACDSASSGSGFSLS  119

Query  581   ----------------------SGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFK  694
                                   S  VTF+CG+AG+ +LGA+AAKH G+++LL+HY+T+FK
Sbjct  120   LSLSLHSFSLTVLIYGFMRLLYSSDVTFICGRAGVCSLGAIAAKHAGNEQLLNHYLTQFK  179

Query  695   EIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
             EIKLP ++P+ELLYGRAG+LWAC F+NK++GKGT+ S+    +  EIIK GR+L+    +
Sbjct  180   EIKLPKNVPNELLYGRAGFLWACLFINKHIGKGTIPSTLTGPVVKEIIKDGRRLA--SKV  237

Query  875   KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAA  1054
               PLM+EW G +YWGAAHGLAGIM+ LM++ELKPDE +DV  TL YMIKNRF SGNYP++
Sbjct  238   SCPLMFEWYGTKYWGAAHGLAGIMHVLMDMELKPDELQDVNDTLSYMIKNRFSSGNYPSS  297

Query  1055  EGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHG  1234
             E DD  D LVHWCHGAPG+ALTL KAA++F   +F +AA DAGEVVW RGLLKRVGICHG
Sbjct  298   E-DDGTDCLVHWCHGAPGVALTLVKAAEVFGGRQFLKAAGDAGEVVWNRGLLKRVGICHG  356

Query  1235  ISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGM  1414
             +SGNAYVFLSLYRLTG  E+LYRAKAF CFL D A  LI++G M  GD P+SLFEGIGGM
Sbjct  357   VSGNAYVFLSLYRLTGNLEFLYRAKAFACFLLDMAPKLISEGKMHGGDSPYSLFEGIGGM  416

Query  1415  AYLFLDLADPSKALFPAYEL  1474
             AYLFLD+ +PS+A FPAYEL
Sbjct  417   AYLFLDMIEPSEARFPAYEL  436



>ref|XP_002517941.1| catalytic, putative [Ricinus communis]
 gb|EEF44459.1| catalytic, putative [Ricinus communis]
Length=410

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 319/413 (77%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M  F+  T           T DSL KLLS+P+ ++S+R ++  L LK+ +V E
Sbjct  3     DRFFPNIMPDFV--TEAAAAATEDSSTGDSLMKLLSMPYPSLSQRFQRAGLDLKETIVME  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LG+AFL+ K+YQVT N +DL LCLQI+KACD+A S AS  VT
Sbjct  61    TWGLSGQSVQDFTLYSGTLGSAFLIFKSYQVTNNKNDLFLCLQIVKACDSA-SPASRDVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+AG+ ALGAVAAK+  D +L ++Y+ +F E+KL  + PDELLYGR+GYLWAC F+N
Sbjct  120   FLCGRAGVCALGAVAAKYANDQDLQNYYLNQFGEVKLSKNHPDELLYGRSGYLWACLFIN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GT+  + +RA+  EIIK+GR L+K      PLMYEW G RYWGAAHGLAGIM+ L
Sbjct  180   KHIGEGTIPHTTIRAVTVEIIKNGRALAKKGG--CPLMYEWYGERYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+ ELK DE EDVK TL+YMI NRFPSGNYPA+E D + D LVHWCHGAPGIALTL KA 
Sbjct  238   MDAELKLDEVEDVKGTLKYMINNRFPSGNYPASEEDWKRDVLVHWCHGAPGIALTLVKAV  297

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF QAA+DA E+VW RGLLKRVGICHGISGN YVFL+LYR+TG  E+LYRAKAF
Sbjct  298   QVFGDKEFLQAAVDAAEIVWNRGLLKRVGICHGISGNTYVFLALYRMTGSIEFLYRAKAF  357

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DRAH LI+ G M  GD P+SLFEGIGGMAYLFLD+ DPSKA FPAYEL
Sbjct  358   ASFLLDRAHKLISAGEMHGGDSPYSLFEGIGGMAYLFLDMIDPSKARFPAYEL  410



>ref|NP_175700.2| G-protein coupled receptor 2 [Arabidopsis thaliana]
 sp|F4IEM5.1|GCR2_ARATH RecName: Full=LanC-like protein GCR2; AltName: Full=G-protein 
coupled receptor 2 [Arabidopsis thaliana]
 gb|AEE32868.1| G-protein coupled receptor 2 [Arabidopsis thaliana]
Length=410

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/413 (62%), Positives = 319/413 (77%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++ NEM  F+PE  +  +E      KDSL KLLSLP+ + S++L + AL++KD+VV E
Sbjct  3     ERFFRNEMPEFVPEDLSGEEETVTE-CKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWE  61

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY LYTG LGTA+LL K+YQVT N DDL LCL+ ++ACD A S  S  VT
Sbjct  62    TWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVA-SRDSERVT  120

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG AG+ ALGAVAAK  GDD+L   Y+ +F+ I+LP DLP ELLYGRAGYLWAC FLN
Sbjct  121   FICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLN  180

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ ++SS  MR++  EI ++GR+L        PLMYEW G+RYWGAAHGLAGIM  L
Sbjct  181   KHIGQESISSERMRSVVEEIFRAGRQLGN--KGTCPLMYEWHGKRYWGAAHGLAGIMNVL  238

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  EL+PDE +DVK TL YMI+NRFPSGNY ++EG  ++D LVHWCHGAPG+ALTL KAA
Sbjct  239   MHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGS-KSDRLVHWCHGAPGVALTLVKAA  297

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             +++ ++EF +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLT   +YLYRAKAF
Sbjct  298   QVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAF  357

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G M  GD PFSLFEGIGGMAY+ LD+ DP++ALFP YEL
Sbjct  358   ASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  410



>pdb|3T33|A Chain A, Crystal Structure Of Arabidopsis Gcr2
Length=415

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/413 (62%), Positives = 319/413 (77%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++ NEM  F+PE  +  +E      KDSL KLLSLP+ + S++L + AL++KD+VV E
Sbjct  8     ERFFRNEMPEFVPEDLSGEEETVTE-CKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWE  66

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV DY LYTG LGTA+LL K+YQVT N DDL LCL+ ++ACD A S  S  VT
Sbjct  67    TWERSGKRVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVA-SRDSERVT  125

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG AG+ ALGAVAAK  GDD+L   Y+ +F+ I+LP DLP ELLYGRAGYLWAC FLN
Sbjct  126   FICGYAGVCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLN  185

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ ++SS  MR++  EI ++GR+L        PLMYEW G+RYWGAAHGLAGIM  L
Sbjct  186   KHIGQESISSERMRSVVEEIFRAGRQLGN--KGTCPLMYEWHGKRYWGAAHGLAGIMNVL  243

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  EL+PDE +DVK TL YMI+NRFPSGNY ++EG  ++D LVHWCHGAPG+ALTL KAA
Sbjct  244   MHTELEPDEIKDVKGTLSYMIQNRFPSGNYLSSEGS-KSDRLVHWCHGAPGVALTLVKAA  302

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             +++ ++EF +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLT   +YLYRAKAF
Sbjct  303   QVYNTKEFVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAF  362

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G M  GD PFSLFEGIGGMAY+ LD+ DP++ALFP YEL
Sbjct  363   ASFLLDKSEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  415



>ref|XP_010918434.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Elaeis guineensis]
Length=404

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 256/413 (62%), Positives = 323/413 (78%), Gaps = 11/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM AF+ E   V   +AP      L  LL LP+   + +L + AL LK++VV+E
Sbjct  3     DRFFPNEMPAFVEENEGV---LAP----SPLHSLLYLPYPKTADKLLRAALDLKEKVVKE  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW     R  D+TLYTGALGTAFLL KAYQVT N  DLSLC +II+ACD A S     VT
Sbjct  56    TWVRLRGRAKDFTLYTGALGTAFLLFKAYQVTNNRGDLSLCSEIIRACDVA-SQGDPHVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL+HY++ F+ I++   +P+ELLYGR GYLWAC FLN
Sbjct  115   FICGRAGVCALGAVVAKHAGDEALLNHYLSSFRGIRMRGKVPNELLYGRVGYLWACCFLN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GT+ ++HM A+A EII  G++LS     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  175   KHIGEGTIPTTHMGALAKEIITDGKRLSN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+++LKPDE+ED+K TL+YMI+NRFPSGNYP++EG +  D LVHWCHGAPG++LTLTKA+
Sbjct  233   MDMDLKPDEKEDIKGTLQYMIRNRFPSGNYPSSEGSNN-DRLVHWCHGAPGVSLTLTKAS  291

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+ E+F Q A++A EVVW RGLLKRVGICHGISGNAYVFLSLYRLTGK EYLYRAKAF
Sbjct  292   QVFQEEQFLQVAVEAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAF  351

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL D+A+ LI DG+M  GD P+SLFEG  GMA+LFLD+  PS++ FPAYEL
Sbjct  352   ACFLLDKANKLIADGLMHGGDRPYSLFEGQAGMAHLFLDMVRPSESRFPAYEL  404



>ref|XP_011045509.1| PREDICTED: lanC-like protein GCL2 [Populus euphratica]
Length=409

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/413 (63%), Positives = 322/413 (78%), Gaps = 6/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M +F+ E    +QE      ++SL KLLS+P+ ++SK+ ++  L LK+ +V E
Sbjct  3     DRFFPNAMPSFVTED---IQEEDKVTDENSLMKLLSMPYTSLSKQFQRSGLDLKETIVME  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LGTA LL K+YQVT N +DL LCL+I+KACD+A S AS  VT
Sbjct  60    TWGLGGQVVHDFTLYSGNLGTALLLYKSYQVTSNENDLFLCLEIVKACDSA-SRASRDVT  118

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAKH  D+ L  +Y+++  EIKL  + PDELLYGR+G+LWAC FLN
Sbjct  119   FICGRAGVCALGAVAAKHANDEALQSYYLSQLGEIKLLRNHPDELLYGRSGFLWACLFLN  178

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GTV  + +RA+ANEIIK+GR L+K     SPLMYEW G RYWGAAHGLAGIM  L
Sbjct  179   KHMGQGTVPDTTIRAVANEIIKNGRALAKKGG--SPLMYEWYGERYWGAAHGLAGIMNVL  236

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             ++V+LKPD+ EDVK TL+YMI N FPSGNY  +E D + D LVHWCHGAPGIALTL KA 
Sbjct  237   LDVDLKPDDFEDVKGTLKYMINNCFPSGNYSTSEEDRKRDVLVHWCHGAPGIALTLVKAV  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F  +EF +AA++A EVVW RGLLKRVGICH ISGNAYVFLSLY+LTG  E+LY+AKAF
Sbjct  297   KVFGDKEFLEAAINAAEVVWNRGLLKRVGICHDISGNAYVFLSLYQLTGNIEFLYKAKAF  356

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRAH LI+ G M  GD P+S+FEG GGMAYLFLD+ DPSKA FPAYEL
Sbjct  357   TCFLLDRAHKLISAGEMHGGDSPYSMFEGTGGMAYLFLDMIDPSKARFPAYEL  409



>ref|NP_850003.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
 sp|Q8VZQ6.1|GCL2_ARATH RecName: Full=LanC-like protein GCL2; AltName: Full=G protein-coupled 
receptor 2-like protein 2; Short=Protein GCR2-like 
2 [Arabidopsis thaliana]
 gb|AAL36290.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20120.1| unknown protein [Arabidopsis thaliana]
 gb|AEC07068.1| protein GCR2-LIKE 2 [Arabidopsis thaliana]
Length=405

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/412 (63%), Positives = 321/412 (78%), Gaps = 10/412 (2%)
 Frame = +2

Query  239   RYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRET  418
             R++ N M  F+ E  +V          D+L  LL++P++++S++LK+ AL LK+ VV ET
Sbjct  4     RFFDNVMPDFVKEKESV-------SGGDTLRNLLAMPYSSLSQQLKRSALDLKETVVIET  56

Query  419   WGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTF  598
             WG  G+ V D+TLY+G LG AFLL +AYQVTGN +DLSLCL+I+KACDTA S +SG VTF
Sbjct  57    WGFSGQTVEDFTLYSGTLGAAFLLFRAYQVTGNANDLSLCLEIVKACDTA-SASSGDVTF  115

Query  599   LCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLNK  778
             LCG+AG+  LGAVAAK  G+++LL++Y+ +F+ I+L  DLP+ELLYGR GYLWAC F+NK
Sbjct  116   LCGRAGVCGLGAVAAKLSGEEDLLNYYLGQFRLIRLSSDLPNELLYGRVGYLWACLFINK  175

Query  779   NLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALM  958
              +GK T+SS  +R +A EIIK GR ++K     SPLM+EW G+RYWGAAHGLAGIM+ LM
Sbjct  176   YIGKETLSSDTIREVAQEIIKEGRSMAK--KGSSPLMFEWYGKRYWGAAHGLAGIMHVLM  233

Query  959   EVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAK  1138
             +V+LKPDE EDVK TL+YMIKNRFPSGNYPA+E D + D LVHWCHGAPGIALTL KAA+
Sbjct  234   DVQLKPDEAEDVKGTLKYMIKNRFPSGNYPASEEDKKKDILVHWCHGAPGIALTLGKAAE  293

Query  1139  IFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG  1318
             +F   EF +A+  A EVVW RGLLKRVGICHGISGNAYVFL+LYR TG+ EYLYRAKAF 
Sbjct  294   VFGEREFLEASAAAAEVVWNRGLLKRVGICHGISGNAYVFLALYRATGRSEYLYRAKAFA  353

Query  1319  CFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              FL DR   L++ G M  GD P+SLFEG+ GMAYLFLD+ DPS+A FP YEL
Sbjct  354   SFLLDRGPKLLSKGEMHGGDSPYSLFEGVAGMAYLFLDMVDPSEARFPGYEL  405



>ref|XP_002884221.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60480.1| hypothetical protein ARALYDRAFT_480913 [Arabidopsis lyrata subsp. 
lyrata]
Length=405

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/413 (63%), Positives = 317/413 (77%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F+ E  +           DSL  LL++P++++S++LK+ AL LK+ VV E
Sbjct  3     DRFFDNVMPDFVKEKES-------ESGGDSLRNLLAMPYSSLSQQLKRSALDLKETVVME  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LG AFLL +AYQVTGN +DLSLCL+I+KACD AAS +SG VT
Sbjct  56    TWGFSGQTVEDFTLYSGTLGAAFLLFRAYQVTGNVNDLSLCLEIVKACD-AASASSGDVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+AG+  LGA AAK  G++ELL++Y+ +F+ I+L  DLP+ELLYGR GYLWAC F+N
Sbjct  115   FLCGRAGVCGLGAAAAKLSGEEELLNYYLAQFRLIRLSSDLPNELLYGRVGYLWACLFIN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K +GK T+SS  +R +A EIIK GR ++K     SPLM+EW G+RYWGAAHGLAGIM+ L
Sbjct  175   KYIGKETLSSDTIREVAQEIIKDGRSMAK--KGSSPLMFEWYGKRYWGAAHGLAGIMHVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+V+LKPDE EDVK TL+YMIKNRFPSGNYPA+E D   D LVHWCHGAPGIALTL KAA
Sbjct  233   MDVQLKPDEAEDVKGTLKYMIKNRFPSGNYPASEEDRRKDVLVHWCHGAPGIALTLVKAA  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F   EF +A   A EVVW RGLLKRVGICHGISGNAYVFLSLYR TG  EYLYRAKAF
Sbjct  293   EVFGEREFLEAGAAAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATGMSEYLYRAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DR   L++ G M  GD P+SLFEG+ GMAYL+LD+ DPS+A FP YEL
Sbjct  353   ASFLLDRGPKLLSKGEMHGGDSPYSLFEGVAGMAYLYLDMVDPSQARFPGYEL  405



>ref|XP_008452476.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Cucumis melo]
Length=412

 Score =   530 bits (1364),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/415 (62%), Positives = 320/415 (77%), Gaps = 7/415 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSL--AKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R++PN M  F P      + ++ H    +L   +LLSLP   +  RL+Q AL LK+ VV
Sbjct  3     DRFFPNPMPRF-PAEAPSDELVSSHSYSATLIPTELLSLPDAALFDRLRQTALNLKETVV  61

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             RETW   GR   DYTLYTGALGTAFL LK++ V  N +DL LC +I+ AC++  S  S  
Sbjct  62    RETWTLSGRHPQDYTLYTGALGTAFLALKSFLVFKNENDLKLCSEIVAACESL-SKKSRH  120

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAK   D  L+ HY+ KFK+IKLP DLP+ELLYGRAG+LWAC F
Sbjct  121   VTFICGRAGVCALGAVAAKFANDGMLVDHYLEKFKDIKLPSDLPNELLYGRAGFLWACLF  180

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK++G+ T+S++ MR++ +E+I++GR+L   +  KSPLMYEW G++YWGAAHGLAGIM+
Sbjct  181   LNKHIGRNTISNTFMRSVVDEVIEAGRRLG--QKSKSPLMYEWHGKKYWGAAHGLAGIMH  238

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELKPDE EDVK TLRYMIKNRF SGNYP++E + E+D LVHWCHGAPG+ALTL K
Sbjct  239   VLMDMELKPDEVEDVKNTLRYMIKNRFLSGNYPSSE-ESESDRLVHWCHGAPGVALTLGK  297

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG   YL+RAK
Sbjct  298   AAEVFGDDEFLQAAIDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLTYLHRAK  357

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLH  A  LI++G M  GD P+SLFEGIGGMAYLFLD+ +P  A FP+YEL
Sbjct  358   AFACFLHQNAEKLISEGKMHSGDCPYSLFEGIGGMAYLFLDMVEPYAAKFPSYEL  412



>ref|XP_006409014.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
 gb|ESQ50467.1| hypothetical protein EUTSA_v10002001mg [Eutrema salsugineum]
Length=405

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/413 (62%), Positives = 318/413 (77%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F+ ET +           DSL  LL++P++++S+ LK+ AL LK+ VV E
Sbjct  3     DRFFDNVMPDFVRETES-------EAGGDSLTNLLAMPYSSLSQLLKRSALDLKETVVME  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+GALG AFLL +AYQVTGN +DLSLCLQI+KACD AAS +SG VT
Sbjct  56    TWGFSGQLVQDFTLYSGALGAAFLLFRAYQVTGNANDLSLCLQIVKACD-AASASSGDVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+ G++ LGA AAK  GD ELL++Y+ +F++I+L  ++P+ELLYGR GYLWAC F+N
Sbjct  115   FICGRTGVFGLGAAAAKRSGDQELLNYYLAQFRQIRLSSEIPNELLYGRVGYLWACLFVN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K +G  T+ S+ +R +A EII+ GR ++K  N  SPLM+EW G RY GAAHGLAGIM+ L
Sbjct  175   KYVGAETLPSATIRQVAQEIIQQGRSMAK--NGSSPLMFEWYGERYLGAAHGLAGIMHVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M V+LKPDE EDVK TL+YMIK+RFPSGNY A+E D   D LVHWCHGAPGIALTL KAA
Sbjct  233   MHVQLKPDEAEDVKGTLKYMIKSRFPSGNYAASEEDRRRDLLVHWCHGAPGIALTLVKAA  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+  EF +AA  A EVVW RGLLKRVGICHGISGNAYVFLSLYR TG+ EYLYRAKAF
Sbjct  293   EVFKEREFLEAAAAAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATGRSEYLYRAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DRAH L++ G M  GD P+SLFEG+GGMA LFLD+ DP +A FP YEL
Sbjct  353   ASFLLDRAHKLLSKGDMHGGDSPYSLFEGVGGMACLFLDMVDPFQARFPGYEL  405



>ref|XP_008381258.1| PREDICTED: lanC-like protein GCL2 [Malus domestica]
Length=414

 Score =   528 bits (1361),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/414 (63%), Positives = 318/414 (77%), Gaps = 5/414 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M   + E  T     A HG  DSL  LLS P  ++S  LK  A  LK  ++ E
Sbjct  3     DRFFPNIMPDMVAEAPTPSPPQAEHGN-DSLMNLLSTPCPSLSHLLKXAASDLKQTILTE  61

Query  416   TWG--ARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             TW   A  + + D+TLY+GALGTAFLL K+YQVTG+ +D++L  QI+KACD+A+  +   
Sbjct  62    TWAGAAAAQSLHDFTLYSGALGTAFLLFKSYQVTGDANDITLXAQIVKACDSASLGSRDV  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAKHCGD   L +Y+ +F+EIKL   LPDELLYG+ G+LWAC F
Sbjct  122   VTFMCGRAGVCALGAVAAKHCGDSASLSYYLAQFREIKLSRSLPDELLYGKVGFLWACLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK+LG GT+SS++MRA+ +EIIK+GR L K    + PLM+EW G +YWGAAHGLAGIM+
Sbjct  182   LNKHLGDGTISSAYMRAVVDEIIKNGRALGK--GGRCPLMFEWYGEKYWGAAHGLAGIMH  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELKPDE EDVK TL+YMI NRFPSGNYPA+E D   D LVHWCHGAPGIALTL K
Sbjct  240   VLMDMELKPDEVEDVKGTLKYMINNRFPSGNYPASEEDRHRDVLVHWCHGAPGIALTLAK  299

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AAK+F  +EF +AA DA EVVWKRGLLKRVGICHGISGNAYVFLSLY+LTG   +LYRAK
Sbjct  300   AAKVFGDKEFLEAAADAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNVVFLYRAK  359

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             AF CFL DR+H LI  G M RGD P+SLFEG+GGMAYL LD+ +PS+A FPAYE
Sbjct  360   AFACFLLDRSHKLIXQGEMHRGDSPYSLFEGVGGMAYLLLDMLEPSQAKFPAYE  413



>ref|XP_006299729.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
 gb|EOA32627.1| hypothetical protein CARUB_v10015922mg [Capsella rubella]
Length=403

 Score =   527 bits (1358),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 257/413 (62%), Positives = 314/413 (76%), Gaps = 12/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F+ E+             DSL+ LL +P++++S+ LK+ AL LK+ VV  
Sbjct  3     DRFFDNVMPDFVKES---------EAGGDSLSNLLVMPYSSLSQHLKRSALDLKETVVMN  53

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LG AFLL +AYQVT N +DLSLCL+I+KACD AAS +SG VT
Sbjct  54    TWGFSGQTVEDFTLYSGTLGAAFLLFRAYQVTRNANDLSLCLEIVKACD-AASASSGDVT  112

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+AG+  LGA AAK  G++ELL++Y+ +F+ I+L  DLP+ELLYGR GYLWAC F+N
Sbjct  113   FLCGRAGVCGLGAAAAKLSGEEELLNYYLAQFRLIRLSSDLPNELLYGRIGYLWACLFIN  172

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K +GK T+SS  +R +A EIIK GR ++K  N  SPLM+EW GR+YWGAAHGLAGIM+ L
Sbjct  173   KYVGKETLSSDTIRQVAQEIIKEGRSMAK--NGSSPLMFEWYGRKYWGAAHGLAGIMHVL  230

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+V+LKPDE EDVK TLRYMIKNRFPSGNYPA+E D   D LVHWCHGAPGIALTL KAA
Sbjct  231   MDVQLKPDEAEDVKGTLRYMIKNRFPSGNYPASEEDRRKDVLVHWCHGAPGIALTLVKAA  290

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F   EF +A   A EVVW RGLLKRVGICHGISGN YVFL+LYR TG+ EYLYRAKAF
Sbjct  291   EVFGEREFLEAGAAAAEVVWNRGLLKRVGICHGISGNTYVFLALYRATGRSEYLYRAKAF  350

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL DR   L++ G M  GD P+SLFEG+ GMAYLF D+ DPS+A FP YEL
Sbjct  351   ASFLLDRGPKLLSQGEMHGGDSPYSLFEGVAGMAYLFFDMVDPSQARFPCYEL  403



>gb|EYU26156.1| hypothetical protein MIMGU_mgv1a007017mg [Erythranthe guttata]
Length=422

 Score =   528 bits (1359),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 257/423 (61%), Positives = 314/423 (74%), Gaps = 13/423 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFI---PETTTVVQ------EIAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             +R++ NEM  F+   P+   V++      E+ P  T+DSL +LLS P+ TIS + ++ AL
Sbjct  3     DRFFENEMPDFVQENPDEEEVIRSRNGRVEVNPQATQDSLVRLLSQPYTTISLKFQRAAL  62

Query  389   TLKDEVVRETWGA-RGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDT  565
              LK  +V +TWG   G+ V D+TLY+G LGTAFLL K YQVT N +DL+L  +I+KACD+
Sbjct  63    DLKQTIVVKTWGGFTGQHVEDFTLYSGTLGTAFLLFKFYQVTHNKNDLTLSSEIVKACDS  122

Query  566   AASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRA  745
             A+ H S  V+F+CG+AG+ ++GAV AKH GDD+L+H+Y+ +FK+I+L  D PDELLYGRA
Sbjct  123   ASVH-SRDVSFMCGRAGVCSIGAVVAKHMGDDKLVHYYLNQFKKIRLSEDHPDELLYGRA  181

Query  746   GYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAA  925
             GYLWAC FLNK+ G  T+ S+ M A+  EIIK GRK  K E   SPLMYEW G RYWGAA
Sbjct  182   GYLWACLFLNKHFGNETIPSTSMSAVVKEIIKKGRKQGKKEG--SPLMYEWHGERYWGAA  239

Query  926   HGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAP  1105
             HGLAGIM+ LME  L  DE EDVK TL+YMIKN+FPSGNYP +E D   D LVHWCHGAP
Sbjct  240   HGLAGIMHVLMECRLTSDEIEDVKGTLKYMIKNQFPSGNYPVSEEDKTRDALVHWCHGAP  299

Query  1106  GIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK  1285
             GIALTLTKAA +F  +EF + AM A EVVW RGLLKR+G+CHGISGNAYVFLSLYRLTG 
Sbjct  300   GIALTLTKAAMVFGDKEFLEGAMGAAEVVWNRGLLKRIGMCHGISGNAYVFLSLYRLTGV  359

Query  1286  EEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPA  1465
              EYLYRAKAF  FL D  H LI+ G +  GD+PFSLFEG+GGM +LFLD+  P  A FPA
Sbjct  360   VEYLYRAKAFASFLLDGTHMLISTGELHSGDNPFSLFEGMGGMTHLFLDMVQPKNARFPA  419

Query  1466  YEL  1474
             YE 
Sbjct  420   YEF  422



>ref|XP_009357824.1| PREDICTED: lanC-like protein GCL2 [Pyrus x bretschneideri]
Length=414

 Score =   526 bits (1354),  Expect = 6e-180, Method: Compositional matrix adjust.
 Identities = 259/414 (63%), Positives = 319/414 (77%), Gaps = 5/414 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M   + E  T     A HG  DSL  LLS P  ++S  LK+ A  L   ++ E
Sbjct  3     DRFFPNIMPDMVAEAPTPSPPQAEHGN-DSLMNLLSTPCPSLSHLLKRAASDLIQIILTE  61

Query  416   TWGAR--GRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             TW      + + D+TLY+GALGTAFLL K+YQVTG+ +D+++C QI+KACD+A+  +   
Sbjct  62    TWAGATAAQSLHDFTLYSGALGTAFLLFKSYQVTGDANDVTICAQIVKACDSASLGSRDV  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAKHCGD   + +Y+ +F+EIKL  +LPDELLYG+ G+LWAC F
Sbjct  122   VTFMCGRAGVCALGAVAAKHCGDSASVSYYLAQFREIKLSRNLPDELLYGKVGFLWACLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK+L  GT+SS++MRA+ +EIIK+GR L K    + PLM+EW G +YWGAAHGLAGIM+
Sbjct  182   LNKHLEGGTISSAYMRAVVDEIIKNGRALGK--GGRCPLMFEWYGEKYWGAAHGLAGIMH  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELKPDE EDVK TL+YMI NRFPSGNYPA+E D   D LVHWCHGAPGIALTL K
Sbjct  240   VLMDMELKPDEVEDVKGTLKYMINNRFPSGNYPASEEDRHRDVLVHWCHGAPGIALTLAK  299

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AAK+F  +EF +AA DA EVVWKRGLLKRVGICHGISGNAYVFLSLY+LTG   +LYRAK
Sbjct  300   AAKVFGDKEFLEAAADAAEVVWKRGLLKRVGICHGISGNAYVFLSLYQLTGNVVFLYRAK  359

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             AF CFL DRAH LI+ G M RGD P+SLFEG+GGMAYL LD+ +PS+A FPAYE
Sbjct  360   AFACFLLDRAHKLISQGEMHRGDSPYSLFEGVGGMAYLLLDMVEPSQAKFPAYE  413



>gb|AAG52264.1|AC019018_1 putative G protein-coupled receptor; 80093-78432 [Arabidopsis 
thaliana]
Length=401

 Score =   524 bits (1350),  Expect = 1e-179, Method: Compositional matrix adjust.
 Identities = 254/406 (63%), Positives = 313/406 (77%), Gaps = 5/406 (1%)
 Frame = +2

Query  257   MAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGR  436
             M  F+PE  +  +E      KDSL KLLSLP+ + S++L + AL++KD+VV ETW   G+
Sbjct  1     MPEFVPEDLSGEEETVTE-CKDSLTKLLSLPYKSFSEKLHRYALSIKDKVVWETWERSGK  59

Query  437   RVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAG  616
             RV DY LYTG LGTA+LL K+YQVT N DDL LCL+ ++ACD A S  S  VTF+CG AG
Sbjct  60    RVRDYNLYTGVLGTAYLLFKSYQVTRNEDDLKLCLENVEACDVA-SRDSERVTFICGYAG  118

Query  617   IYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGT  796
             + ALGAVAAK  GDD+L   Y+ +F+ I+LP DLP ELLYGRAGYLWAC FLNK++G+ +
Sbjct  119   VCALGAVAAKCLGDDQLYDRYLARFRGIRLPSDLPYELLYGRAGYLWACLFLNKHIGQES  178

Query  797   VSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKP  976
             +SS  MR++  EI ++GR+L        PLMYEW G+RYWGAAHGLAGIM  LM  EL+P
Sbjct  179   ISSERMRSVVEEIFRAGRQLGN--KGTCPLMYEWHGKRYWGAAHGLAGIMNVLMHTELEP  236

Query  977   DEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEE  1156
             DE +DVK TL YMI+NRFPSGNY ++EG  ++D LVHWCHGAPG+ALTL KAA+++ ++E
Sbjct  237   DEIKDVKGTLSYMIQNRFPSGNYLSSEGS-KSDRLVHWCHGAPGVALTLVKAAQVYNTKE  295

Query  1157  FEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR  1336
             F +AAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLT   +YLYRAKAF  FL D+
Sbjct  296   FVEAAMEAGEVVWSRGLLKRVGICHGISGNTYVFLSLYRLTRNPKYLYRAKAFASFLLDK  355

Query  1337  AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +  LI++G M  GD PFSLFEGIGGMAY+ LD+ DP++ALFP YEL
Sbjct  356   SEKLISEGQMHGGDRPFSLFEGIGGMAYMLLDMNDPTQALFPGYEL  401



>ref|XP_008452475.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Cucumis melo]
Length=415

 Score =   524 bits (1349),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 259/418 (62%), Positives = 320/418 (77%), Gaps = 10/418 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSL--AKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R++PN M  F P      + ++ H    +L   +LLSLP   +  RL+Q AL LK+ VV
Sbjct  3     DRFFPNPMPRF-PAEAPSDELVSSHSYSATLIPTELLSLPDAALFDRLRQTALNLKETVV  61

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
             RETW   GR   DYTLYTGALGTAFL LK++ V  N +DL LC +I+ AC++  S  S  
Sbjct  62    RETWTLSGRHPQDYTLYTGALGTAFLALKSFLVFKNENDLKLCSEIVAACESL-SKKSRH  120

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAK   D  L+ HY+ KFK+IKLP DLP+ELLYGRAG+LWAC F
Sbjct  121   VTFICGRAGVCALGAVAAKFANDGMLVDHYLEKFKDIKLPSDLPNELLYGRAGFLWACLF  180

Query  770   LNKNLGKGTVSSSHM---RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAG  940
             LNK++G+ T+S++ M   R++ +E+I++GR+L   +  KSPLMYEW G++YWGAAHGLAG
Sbjct  181   LNKHIGRNTISNTFMVFHRSVVDEVIEAGRRLG--QKSKSPLMYEWHGKKYWGAAHGLAG  238

Query  941   IMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALT  1120
             IM+ LM++ELKPDE EDVK TLRYMIKNRF SGNYP++E + E+D LVHWCHGAPG+ALT
Sbjct  239   IMHVLMDMELKPDEVEDVKNTLRYMIKNRFLSGNYPSSE-ESESDRLVHWCHGAPGVALT  297

Query  1121  LTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLY  1300
             L KAA++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG   YL+
Sbjct  298   LGKAAEVFGDDEFLQAAIDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLTYLH  357

Query  1301  RAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             RAKAF CFLH  A  LI++G M  GD P+SLFEGIGGMAYLFLD+ +P  A FP+YEL
Sbjct  358   RAKAFACFLHQNAEKLISEGKMHSGDCPYSLFEGIGGMAYLFLDMVEPYAAKFPSYEL  415



>gb|ABQ14360.1| abscisic acid ABA receptor [Populus trichocarpa]
Length=443

 Score =   523 bits (1348),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 270/415 (65%), Positives = 314/415 (76%), Gaps = 12/415 (3%)
 Frame = +2

Query  248   PNEMAAFIPETTTVVQEIAP-HGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWG  424
             P E A   P   T  QE+    G +      L   H  ++  L    + L  EVVRETWG
Sbjct  35    PAEPAGGGPVVKTWDQEVCSLCGLRFEPCGYLYDGHWRLTWSLTSGPMGLV-EVVRETWG  93

Query  425   ARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLC  604
               G+RV DY+LYTGALGTA+LL KAYQVT N +DL+LC  IIKACD+  S  SG VTF+C
Sbjct  94    MSGKRVKDYSLYTGALGTAYLLFKAYQVTKNQNDLNLCSDIIKACDSV-SRDSGRVTFIC  152

Query  605   G-----QAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             G     +AG+ ALGAVAAKH GD  LL HY+ +FKEIKLP DLP ELLYGRAG+LWACSF
Sbjct  153   GLTGCGRAGVCALGAVAAKHAGDGRLLDHYLAQFKEIKLPSDLPYELLYGRAGFLWACSF  212

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK++GK T+S+S  RA+ +EIIK+GR   K    K PL+YEW G+RYWGAAHGLAGIM 
Sbjct  213   LNKHIGKETISTSRKRAVVDEIIKAGRLARKG---KCPLLYEWHGKRYWGAAHGLAGIML  269

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++EL PDE EDVK TL YMIKN FPSGNYP++EG+ ++D LVHWCHGAPGIALTL K
Sbjct  270   VLMDLELTPDEVEDVKGTLHYMIKNHFPSGNYPSSEGN-KSDCLVHWCHGAPGIALTLAK  328

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  +EF QAAM+AGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG  EYLYRAK
Sbjct  329   AAEVFGDKEFLQAAMEAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAK  388

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLHDRA  L+++G M  GD P+SLFEG GGMAYLFLD+ +PS+A FPAYEL
Sbjct  389   AFACFLHDRAQKLVSEGKMHGGDRPYSLFEGFGGMAYLFLDILEPSEARFPAYEL  443



>ref|XP_008809400.1| PREDICTED: lanC-like protein GCL2 [Phoenix dactylifera]
Length=404

 Score =   520 bits (1340),  Expect = 5e-178, Method: Compositional matrix adjust.
 Identities = 251/413 (61%), Positives = 316/413 (77%), Gaps = 11/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ NEM AF+ E   +   +AP      L           + +L + AL LK++VV+E
Sbjct  3     DRFFHNEMPAFVEEKEGI---LAPSSLHSLLYLSYP----KTADKLLRAALDLKEKVVKE  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   GRR  D+TLYTGALGTAFLL KAYQVT N  DLSLC +II+ACD   S     VT
Sbjct  56    TWVRFGRRAKDFTLYTGALGTAFLLFKAYQVTNNRGDLSLCSEIIRACDVG-SQGDPHVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL+HY++ F+EI++P  +P+ELLYGR GYLWAC+FLN
Sbjct  115   FICGRAGVCALGAVVAKHAGDEALLNHYLSSFREIRMPGKVPNELLYGRVGYLWACAFLN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GT+ S+HM A+A +II  G++LS   +   PLMYEW  ++YWGAAHGLAGIM+ L
Sbjct  175   KHIGEGTIPSTHMGALAKKIIMDGKRLSNRGS--CPLMYEWHDKKYWGAAHGLAGIMHVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+++LKPDE+ED+K TLRYMI+NRF SGNYP++EG +  D LVHWCHGAPG++LTLTKAA
Sbjct  233   MDMDLKPDEKEDIKGTLRYMIQNRFSSGNYPSSEGSNN-DRLVHWCHGAPGVSLTLTKAA  291

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+ E+F QA  +A EVVW RGLLKRVGICHGISGN YVFLSLYRLTG  EYLYRAKAF
Sbjct  292   QVFQEEQFLQATAEAAEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGNMEYLYRAKAF  351

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL D+A+ LI DG+M  GD P+SLFEG  GMA+LFLD+  PS++ FPAYEL
Sbjct  352   ACFLLDKANKLIADGLMHSGDRPYSLFEGQAGMAHLFLDMVRPSESRFPAYEL  404



>ref|XP_009400289.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=404

 Score =   518 bits (1333),  Expect = 5e-177, Method: Compositional matrix adjust.
 Identities = 250/412 (61%), Positives = 314/412 (76%), Gaps = 11/412 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
              R++PN++  F+ E   VV        + +L  LL LP+  ++ +L + AL LKD+VV+E
Sbjct  3     NRFFPNDLPEFVEEKEGVV-------AQSTLHNLLYLPYPKLADKLLKAALDLKDKVVKE  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   GRR  DYTLYTGA GTAFLL K+YQVT N  DL LC +I++ACD A S  S  VT
Sbjct  56    TWVRSGRRAKDYTLYTGAFGTAFLLFKSYQVTSNRSDLGLCNEIVRACDQA-SQGSPFVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AK  GD++LL HY+  F+EIK+P D+P+ELLYGRAGYLWACSFLN
Sbjct  115   FICGRAGVCALGAVVAKEAGDEDLLRHYLRSFREIKMPGDVPNELLYGRAGYLWACSFLN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+GT+ S+ M +I  +II  G++L+   +   PLMYEW G +YWGAAHGLAGIM+ L
Sbjct  175   KHIGEGTIPSTDMSSIGEDIILDGKRLAIKGS--CPLMYEWYGEKYWGAAHGLAGIMHVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+V LKP++ E VK TL YMI+N FPSGNYP++EG D  D LVHWCHGAPG+ALTLTKAA
Sbjct  233   MDVNLKPEDLEYVKGTLHYMIQNHFPSGNYPSSEGFD-TDRLVHWCHGAPGVALTLTKAA  291

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+ + F +AA +A +VVW RGLLKRVGICHG+SGNAYVFLSLYRLTG   YLY+AKAF
Sbjct  292   QVFQDKLFLKAAAEAADVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVSYLYQAKAF  351

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
              CFL DRA+ LI +G M  GDHP+SLFEG  GMAYLFLD+  PS++ FPAY+
Sbjct  352   TCFLLDRANKLIAEGKMHSGDHPYSLFEGQAGMAYLFLDMTTPSQSRFPAYK  403



>ref|XP_009400288.1| PREDICTED: lanC-like protein GCL2 [Musa acuminata subsp. malaccensis]
Length=403

 Score =   518 bits (1333),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 248/413 (60%), Positives = 319/413 (77%), Gaps = 12/413 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PNEM  F+ E    V        + +L  LL LP+  ++ +  + AL LK++VV+E
Sbjct  3     DRYFPNEMPDFVEEQEGAV-------AQSTLHSLLCLPYTKLADKFLRAALDLKEKVVKE  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   GRRV D+TLYTGALGTAFLL KAYQVT N  DLSLC +II+ACD+ ++  S  VT
Sbjct  56    TWLRNGRRVKDFTLYTGALGTAFLLFKAYQVTNNLSDLSLCGEIIRACDSVSA-GSRHVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AK  GD+ LL+HY++ F+EIK+  D+P+ELLYG+ GYLWACSFLN
Sbjct  115   FICGRAGVCALGAVVAKQAGDNVLLNHYLSSFREIKMR-DVPNELLYGKVGYLWACSFLN  173

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ T+ S+HM  +A EII  G++LS   +   PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  174   KHIGESTIPSTHMSPVAKEIILDGKRLSNKGS--CPLMYEWHGKKYWGAAHGLAGIMHVL  231

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKP+++E +K TL YMI +RFPSGNYP+++G + +D LVHWCHGAPG+ALTL KA+
Sbjct  232   MDMELKPEDKECIKGTLSYMINHRFPSGNYPSSQGSN-SDRLVHWCHGAPGVALTLIKAS  290

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+ E+   AA +A +VVW RGLLKRVGICHGISGN YVFLSLYRLTG+ EYLYRAKAF
Sbjct  291   QVFQDEQILGAAEEAAKVVWSRGLLKRVGICHGISGNTYVFLSLYRLTGRVEYLYRAKAF  350

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRA+ LI DG M  GD P+S+FEG  GMA+LFLD+  PS++ FPAYEL
Sbjct  351   ACFLLDRANQLIADGRMHSGDRPYSMFEGQAGMAHLFLDMIRPSESRFPAYEL  403



>ref|XP_010555131.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score =   514 bits (1324),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 318/413 (77%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F  ET T  Q        DSL KLL++P++++S++ K+ AL LK+ +V E
Sbjct  3     DRFFDNVMPDFTRETDTETQ-------GDSLTKLLAMPYSSLSQQFKRSALDLKETIVME  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LG A LL K +Q++ N +DL+LCLQI+KACD AAS +S  VT
Sbjct  56    TWGFSGQNVKDFTLYSGTLGAALLLFKVHQMSKNANDLALCLQIVKACD-AASRSSRDVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGA AAK  G+ ELL +Y+T+F++I+LP DLPDELLYGRAGYLWAC FLN
Sbjct  115   FICGRAGVCALGAAAAKVAGEAELLSYYLTQFRQIELPRDLPDELLYGRAGYLWACLFLN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ TV S+ +  +  E+IK GR ++K     SPLMYEW G +YWGAAHGLAGIM  L
Sbjct  175   KHIGEETVPSATISEVVGEVIKGGRTMAK--KGSSPLMYEWYGDKYWGAAHGLAGIMNVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+V LKPDE EDVK TL+Y+IKNRFP GNY A+E D   D LVHWCHGAPGIALTLTKAA
Sbjct  233   MDVPLKPDEAEDVKGTLKYLIKNRFPCGNYAASEEDRRRDVLVHWCHGAPGIALTLTKAA  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F   +F +AA DA EVVW RGLLKRVGICHGISGNAYVFLSLYR T   EYLYRAKAF
Sbjct  293   KVFGDGDFLKAAADAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATSNTEYLYRAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRAH L+++G M  GD P+SLFEGIGGMAYLFLD+ +PS+A FP YEL
Sbjct  353   ACFLLDRAHELLSEGEMHGGDSPYSLFEGIGGMAYLFLDMVEPSQARFPGYEL  405



>ref|XP_010555129.1| PREDICTED: lanC-like protein GCL2 [Tarenaya hassleriana]
Length=405

 Score =   514 bits (1323),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 318/413 (77%), Gaps = 10/413 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M  F  ET T  Q        DSL KLL++P++++S++ K+ AL LK+ +V E
Sbjct  3     DRFFDNVMPDFTRETDTETQ-------GDSLTKLLAMPYSSLSQQFKRSALDLKETIVME  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY+G LG A LL K +Q++ N +DL+LCLQI+KACD AAS +S  VT
Sbjct  56    TWGFSGQNVKDFTLYSGTLGAALLLFKVHQMSKNANDLALCLQIVKACD-AASRSSRNVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGA AAK  G+ ELL +Y+T+F++I+LP DLPDELLYGRAGYLWAC FLN
Sbjct  115   FICGRAGVCALGAAAAKVAGEAELLSYYLTQFRQIELPRDLPDELLYGRAGYLWACLFLN  174

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++G+ TV S+ +  +  E+IK GR ++K     SPLMYEW G +YWGAAHGLAGIM  L
Sbjct  175   KHIGEETVPSATISEVVGEVIKGGRTMAK--KGSSPLMYEWYGDKYWGAAHGLAGIMNVL  232

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+V LKPDE EDVK TL+Y+IKNRFP GNY A+E D   D LVHWCHGAPGIALTLTKAA
Sbjct  233   MDVPLKPDEAEDVKGTLKYLIKNRFPCGNYAASEEDRRRDVLVHWCHGAPGIALTLTKAA  292

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             K+F   +F +AA DA EVVW RGLLKRVGICHGISGNAYVFLSLYR T   EYLYRAKAF
Sbjct  293   KVFGDGDFLKAAADAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRATSNTEYLYRAKAF  352

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL DRAH L+++G M  GD P+SLFEGIGGMAYLFLD+ +PS+A FP YEL
Sbjct  353   ACFLLDRAHELLSEGEMHGGDSPYSLFEGIGGMAYLFLDMVEPSQARFPGYEL  405



>ref|XP_006661914.1| PREDICTED: lanC-like protein GCR2-like [Oryza brachyantha]
Length=399

 Score =   506 bits (1302),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 249/413 (60%), Positives = 307/413 (74%), Gaps = 16/413 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN+   F+  +        P G       LLSLP+  ++ RL+  AL +KDEVV E
Sbjct  3     DRYFPNDFPDFVAAS--------PXGGPG----LLSLPYRVVADRLRAAALRIKDEVVEE  50

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW    R+VTDYTLYTGALGTA LL K++QVTG+  DLSL   I+K CD AAS     +T
Sbjct  51    TWTRARRQVTDYTLYTGALGTALLLFKSFQVTGDRADLSLAGDIVKECD-AASRGLPFLT  109

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGA+ AKH  D  L+ HY++KF EI +  ++P+ELLYGRAGYLWAC FLN
Sbjct  110   FICGRAGVCALGAMIAKHSDDQLLVTHYLSKFDEILVTENVPNELLYGRAGYLWACLFLN  169

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
              +LG+ T+   H+ ++A +II+ GRKLS    +  PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  170   THLGEKTIPIGHITSVAKDIIEEGRKLSN--RVSCPLMYEWHGKKYWGAAHGLAGIMHVL  227

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  EL+PDE++DVK TL YMI+NR+PSGNYP++EG  E+D LVHWCHGAPG+ALTL KA 
Sbjct  228   MHTELEPDEKDDVKNTLLYMIRNRYPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLAKAY  286

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  E F+Q+A +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAKAF
Sbjct  287   QVFHDEHFKQSAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAF  346

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL + A  LI DG M  GDHPFSLFEG  GMAYL LD+  PS++ FPAYEL
Sbjct  347   ACFLLESADRLIADGTMHGGDHPFSLFEGKAGMAYLLLDMISPSESKFPAYEL  399



>ref|XP_004982728.1| PREDICTED: lanC-like protein 2-like [Setaria italica]
Length=446

 Score =   503 bits (1295),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 253/436 (58%), Positives = 312/436 (72%), Gaps = 15/436 (3%)
 Frame = +2

Query  179   PNYREHSS*LDMQGSEMAEERYYPNEMAAFIPETTTVVQEIAPHGTKD----SLAKLLSL  346
             P+  E      + G  MA+ R++PN+   F+ E        AP G  D     +  LLSL
Sbjct  22    PSSHESKRRRSLPGGAMAD-RFFPNDFPDFVAEAE------APGGDGDRRPAGVRGLLSL  74

Query  347   PHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDD  526
             P+  +S R  + A  LKD+VV ETW   GR+VTDYTLYTGALGTA LL K+++VTG+  D
Sbjct  75    PYARLSDRFLRAARRLKDKVVEETWVKAGRQVTDYTLYTGALGTALLLFKSFRVTGDRGD  134

Query  527   LSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKL  706
             L+L   I+ ACD A S     +TF+CG+AG+ ALGAV AKHC D   +  Y++ F EI +
Sbjct  135   LALAADIVHACDDA-SRGLPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITI  193

Query  707   PVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPL  886
                +P+ELLYGRAGYLWAC FLNK+L + T+   H+ ++A +II+ GRKLS   +  SPL
Sbjct  194   TEKVPNELLYGRAGYLWACLFLNKHLSEKTIPLEHINSVAKDIIREGRKLSSKGS--SPL  251

Query  887   MYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDD  1066
             MYEW G++YWGAAHGLAGIM+ LM  ELK DEQ+DVK TLRYMIKNRFPSGNYP++EG+ 
Sbjct  252   MYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEQDDVKNTLRYMIKNRFPSGNYPSSEGN-  310

Query  1067  EADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGN  1246
             E+D LVHWCHGAPG+ALTL KA ++F  + F+Q+A  A EVVW RGLLKRVGICHG+SGN
Sbjct  311   ESDRLVHWCHGAPGVALTLAKAYEVFHDDHFKQSAAGAAEVVWNRGLLKRVGICHGVSGN  370

Query  1247  AYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLF  1426
             AY FLSLYRLTG  EYLYRAKAF CFL ++A   I +G M  GD PFSLFEG  GMAYL 
Sbjct  371   AYTFLSLYRLTGNVEYLYRAKAFACFLLEKADEFIAEGAMHGGDRPFSLFEGKAGMAYLL  430

Query  1427  LDLADPSKALFPAYEL  1474
             LD+ DPS++ FPAYEL
Sbjct  431   LDMVDPSESRFPAYEL  446



>gb|AAD20918.1| hypothetical protein [Arabidopsis thaliana]
Length=371

 Score =   498 bits (1281),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 240/361 (66%), Positives = 291/361 (81%), Gaps = 3/361 (1%)
 Frame = +2

Query  392   LKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA  571
             +K++ + ETWG  G+ V D+TLY+G LG AFLL +AYQVTGN +DLSLCL+I+KACDTA 
Sbjct  14    VKEKEMIETWGFSGQTVEDFTLYSGTLGAAFLLFRAYQVTGNANDLSLCLEIVKACDTA-  72

Query  572   SHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGY  751
             S +SG VTFLCG+AG+  LGAVAAK  G+++LL++Y+ +F+ I+L  DLP+ELLYGR GY
Sbjct  73    SASSGDVTFLCGRAGVCGLGAVAAKLSGEEDLLNYYLGQFRLIRLSSDLPNELLYGRVGY  132

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHG  931
             LWAC F+NK +GK T+SS  +R +A EIIK GR ++K     SPLM+EW G+RYWGAAHG
Sbjct  133   LWACLFINKYIGKETLSSDTIREVAQEIIKEGRSMAK--KGSSPLMFEWYGKRYWGAAHG  190

Query  932   LAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGI  1111
             LAGIM+ LM+V+LKPDE EDVK TL+YMIKNRFPSGNYPA+E D + D LVHWCHGAPGI
Sbjct  191   LAGIMHVLMDVQLKPDEAEDVKGTLKYMIKNRFPSGNYPASEEDKKKDILVHWCHGAPGI  250

Query  1112  ALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEE  1291
             ALTL KAA++F   EF +A+  A EVVW RGLLKRVGICHGISGNAYVFL+LYR TG+ E
Sbjct  251   ALTLGKAAEVFGEREFLEASAAAAEVVWNRGLLKRVGICHGISGNAYVFLALYRATGRSE  310

Query  1292  YLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             YLYRAKAF  FL DR   L++ G M  GD P+SLFEG+ GMAYLFLD+ DPS+A FP YE
Sbjct  311   YLYRAKAFASFLLDRGPKLLSKGEMHGGDSPYSLFEGVAGMAYLFLDMVDPSEARFPGYE  370

Query  1472  L  1474
             L
Sbjct  371   L  371



>ref|XP_010686440.1| PREDICTED: lanC-like protein GCL2 [Beta vulgaris subsp. vulgaris]
Length=410

 Score =   499 bits (1285),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/413 (61%), Positives = 316/413 (77%), Gaps = 5/413 (1%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ERY+ NEM  +IPET+T +       T ++L KLLS+ +N ++  +++ AL +K+ VV E
Sbjct  3     ERYFKNEMPDYIPETSTTLTTAT--TTGNTLLKLLSMDYNALASLMERQALDIKETVVVE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+TLY G LGTAFLL K+Y+VT N  DL+LC +I+KACD A+SH S  VT
Sbjct  61    TWGRSGQNVVDFTLYVGDLGTAFLLFKSYKVTNNIHDLTLCHEIVKACDHASSH-SRDVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH G+++LL++Y+T+FK+I LP DLPDELLYGRAG+LWAC F+N
Sbjct  120   FICGRAGVCALGAVVAKHMGNEQLLNYYLTQFKQINLPKDLPDELLYGRAGFLWACLFVN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K+LG GT+    MR++  +II+ GR++      K PLM+EW G +YWGAAHGLAGIM+ L
Sbjct  180   KHLGDGTIPPMIMRSVITDIIEDGRRMPN--KGKWPLMFEWYGEKYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             ME +LKPDE+EDVK TL  MI+NRFPSGNYPA+  D   D LVHWCHGAPG+ALTL KA 
Sbjct  238   METDLKPDEREDVKNTLLSMIQNRFPSGNYPASGEDSRRDLLVHWCHGAPGVALTLIKAY  297

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++   + F +AA +A EVVW+RGLLKRVGICHGISGN YVFLSLYR+T    YLYRAKAF
Sbjct  298   EVLGDKVFLEAAAEAAEVVWRRGLLKRVGICHGISGNTYVFLSLYRVTRNPSYLYRAKAF  357

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D AH LI  G M  GD+P+SLFEGIGGMAYLFLD+ +P+ A FPAYEL
Sbjct  358   ASFLLDNAHKLIAAGEMHGGDNPYSLFEGIGGMAYLFLDMKEPTSARFPAYEL  410



>gb|AGV54199.1| lanC-like protein [Phaseolus vulgaris]
Length=414

 Score =   499 bits (1284),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/414 (61%), Positives = 311/414 (75%), Gaps = 5/414 (1%)
 Frame = +2

Query  239   RYYPNEMAAFIPETT--TVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             R++ N M  F+PE T  T  ++       DSL KLL++PH  +S+RLK+ AL LK+ +V 
Sbjct  4     RFFQNPMPEFVPEATPSTPQEQEEALTVGDSLPKLLAMPHAPLSERLKRAALDLKETIVI  63

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ETWG   R+  D++LY G LGTAFLLLK+Y+VT N +DLSLC QI+KACD AAS  S  V
Sbjct  64    ETWGVSWRKDGDFSLYCGVLGTAFLLLKSYEVTRNGNDLSLCSQIVKACD-AASVRSRDV  122

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ +LGAVAAKH GDDE L +Y+ +F++IKL  DLPDELLYG++ +L      
Sbjct  123   TFICGRAGVCSLGAVAAKHAGDDESLRYYMAQFEKIKLSKDLPDELLYGKSWFLVGLFVP  182

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
              ++LG+G  S S+   +  +  K  R    +   + P+M+EW G +YWGAAHGLAGIM+ 
Sbjct  183   KQHLGQGNGSFSYTLWVLMKSFKMERGW--VGRGRCPVMFEWYGEKYWGAAHGLAGIMHV  240

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LME+ELKPDE EDVK TL+YMI NRF SGNYPA+E D ++D LVHWCHGAPGIALTL KA
Sbjct  241   LMEMELKPDELEDVKGTLKYMISNRFRSGNYPASEDDRKSDVLVHWCHGAPGIALTLVKA  300

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
              K+F  +EF  AAM+AGEVVW RGLLK+VGICHGISGNAYVFLSLY+LTG  ++LYRAKA
Sbjct  301   GKVFGDKEFLDAAMEAGEVVWNRGLLKKVGICHGISGNAYVFLSLYQLTGNVKHLYRAKA  360

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL DRAH LI+ G M  GD P+SLFEG+GGMAYLFLD+ DPS + FPAYEL
Sbjct  361   FACFLLDRAHKLISGGEMHGGDRPYSLFEGLGGMAYLFLDMIDPSLSKFPAYEL  414



>tpg|DAA49459.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=449

 Score =   499 bits (1285),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 247/422 (59%), Positives = 308/422 (73%), Gaps = 10/422 (2%)
 Frame = +2

Query  212   MQGSEMAEERYYPNEMAAFIPETTTVVQE-IAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             ++G  MA+ R+ PN+   F+ E      E   P G +     LLSLP+  +S    + A 
Sbjct  37    LRGESMAD-RFIPNDFPDFVAEAEASDGEGHRPAGHRG----LLSLPYTRLSDHFVRAAR  91

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LKD+VV ETW   GR+VTDYTLYTG+LGTA LL K++QVTG+  DL+L   I++ACD A
Sbjct  92    RLKDKVVEETWVKAGRKVTDYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDDA  151

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAG  748
              S     +TF+CG+AG+ ALGAV AKHC D   +  Y++ F EI +   +P+ELLYGRAG
Sbjct  152   -SRGLPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITEKVPNELLYGRAG  210

Query  749   YLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAH  928
             YLWAC FLNK+L + T+   H+ ++A +II  GR  +      SPLMYEW G++YWGAAH
Sbjct  211   YLWACLFLNKHLSEKTIPLDHINSVAKDIINEGRGFAS--KGSSPLMYEWHGKKYWGAAH  268

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPG  1108
             GLAGIM+ LM  ELKPDEQ+DVK TLRYMIKN+FPSGNYP++EG+ E+D+LVHWCHGAPG
Sbjct  269   GLAGIMHVLMHTELKPDEQDDVKNTLRYMIKNKFPSGNYPSSEGN-ESDHLVHWCHGAPG  327

Query  1109  IALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKE  1288
             +ALTL KA ++F  + FEQ+A +A EVVW RGLLKRVGICHG+SGNAY FLSLYRLTG  
Sbjct  328   VALTLAKAYEVFHDDYFEQSAAEAAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNV  387

Query  1289  EYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             EYLYRAKAF CFL ++A  LI +G M  GD PFSLFEG  GM+YL LD+ DPS++ FPAY
Sbjct  388   EYLYRAKAFACFLLEKADQLIAEGAMHGGDRPFSLFEGKAGMSYLLLDMVDPSESRFPAY  447

Query  1469  EL  1474
             EL
Sbjct  448   EL  449



>ref|XP_008676974.1| PREDICTED: LOC100282928 isoform X1 [Zea mays]
 tpg|DAA49460.1| TPA: hypothetical protein ZEAMMB73_373795 [Zea mays]
Length=451

 Score =   498 bits (1282),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 246/423 (58%), Positives = 309/423 (73%), Gaps = 10/423 (2%)
 Frame = +2

Query  212   MQGSEMAEERYYPNEMAAFIPETTTVVQE-IAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             ++G  MA+ R+ PN+   F+ E      E   P G +     LLSLP+  +S    + A 
Sbjct  37    LRGESMAD-RFIPNDFPDFVAEAEASDGEGHRPAGHRG----LLSLPYTRLSDHFVRAAR  91

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LKD+VV ETW   GR+VTDYTLYTG+LGTA LL K++QVTG+  DL+L   I++ACD A
Sbjct  92    RLKDKVVEETWVKAGRKVTDYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDDA  151

Query  569   ASHASGP-VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRA  745
             +       +TF+CG+AG+ ALGAV AKHC D   +  Y++ F EI +   +P+ELLYGRA
Sbjct  152   SRGLPRRFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITEKVPNELLYGRA  211

Query  746   GYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAA  925
             GYLWAC FLNK+L + T+   H+ ++A +II  GR  +   +  SPLMYEW G++YWGAA
Sbjct  212   GYLWACLFLNKHLSEKTIPLDHINSVAKDIINEGRGFASKGS--SPLMYEWHGKKYWGAA  269

Query  926   HGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAP  1105
             HGLAGIM+ LM  ELKPDEQ+DVK TLRYMIKN+FPSGNYP++EG+ E+D+LVHWCHGAP
Sbjct  270   HGLAGIMHVLMHTELKPDEQDDVKNTLRYMIKNKFPSGNYPSSEGN-ESDHLVHWCHGAP  328

Query  1106  GIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK  1285
             G+ALTL KA ++F  + FEQ+A +A EVVW RGLLKRVGICHG+SGNAY FLSLYRLTG 
Sbjct  329   GVALTLAKAYEVFHDDYFEQSAAEAAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGN  388

Query  1286  EEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPA  1465
              EYLYRAKAF CFL ++A  LI +G M  GD PFSLFEG  GM+YL LD+ DPS++ FPA
Sbjct  389   VEYLYRAKAFACFLLEKADQLIAEGAMHGGDRPFSLFEGKAGMSYLLLDMVDPSESRFPA  448

Query  1466  YEL  1474
             YEL
Sbjct  449   YEL  451



>gb|ABB47829.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
Length=399

 Score =   495 bits (1275),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/413 (60%), Positives = 307/413 (74%), Gaps = 16/413 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN++  F+ E        AP G +  L+   S    ++S+RL + AL +KD+V+ E
Sbjct  3     DRYFPNDLPDFVAE--------APDGGRGLLSLPYS----SLSERLLRAALRIKDKVMEE  50

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW    R+VTDYTLYTGALGTA LL K++QVTGN  DL+L   I+K CD AAS     +T
Sbjct  51    TWTRARRQVTDYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKECD-AASRGLPFLT  109

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKHC D  LL HY++ F EI +   +P+ELLYGRAGYLWAC FLN
Sbjct  110   FICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVPNELLYGRAGYLWACLFLN  169

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
              +LG+ T+   H+ ++A +II  GRKL+K  N   PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  170   THLGEKTIPHEHITSVAKDIIDEGRKLAKKGN--CPLMYEWHGKKYWGAAHGLAGIMHVL  227

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  ELK DE++DVK TL YMI+NR+P+GNYP++EG  E+D LVHWCHGAPG+ALTL KA 
Sbjct  228   MHTELKLDEKDDVKNTLLYMIRNRYPTGNYPSSEGS-ESDRLVHWCHGAPGVALTLAKAY  286

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  E F+Q A +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAKAF
Sbjct  287   QVFHDEHFKQTAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAF  346

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL ++A  LI DG M  GDHPFSLFEG  GMAYL LD+  PS++ FPAYEL
Sbjct  347   ACFLLEKADQLIADGAMHGGDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  399



>gb|ACN31611.1| unknown [Zea mays]
Length=408

 Score =   494 bits (1272),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 243/414 (59%), Positives = 304/414 (73%), Gaps = 9/414 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQE-IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             +R+ PN+   F+ E      E   P G +     LLSLP+  +S    + A  LKD+VV 
Sbjct  3     DRFIPNDFPDFVAEAEASDGEGHRPAGHRG----LLSLPYTRLSDHFVRAARRLKDKVVE  58

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ETW   GR+VTDYTLYTG+LGTA LL K++QVTG+  DL+L   I++ACD A S     +
Sbjct  59    ETWVKAGRKVTDYTLYTGSLGTALLLFKSFQVTGDRGDLTLAADIVRACDDA-SRGLPFL  117

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ ALGAV AKHC D   +  Y++ F EI +   +P+ELLYGRAGYLWAC FL
Sbjct  118   TFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITITEKVPNELLYGRAGYLWACLFL  177

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             NK+L + T+   H+ ++A +II  GR L+      SPLMYEW G++YWGAAHGLAGIM+ 
Sbjct  178   NKHLSEKTIPLEHINSVAKDIINEGRGLAS--KGSSPLMYEWHGKKYWGAAHGLAGIMHV  235

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM  ELKPDEQ+DVK TLRYMIKN+FPSGNYP++EG+ E+D+LVHWCHGAPG+ALTL KA
Sbjct  236   LMHTELKPDEQDDVKNTLRYMIKNKFPSGNYPSSEGN-ESDHLVHWCHGAPGVALTLAKA  294

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
              ++F  + F+Q+A +A EVVW RGLLKRVGICHG+SGNAY FLSLYRLTG  E+LYRAKA
Sbjct  295   YEVFHDDYFKQSAAEAAEVVWNRGLLKRVGICHGVSGNAYAFLSLYRLTGNVEHLYRAKA  354

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL ++A  LI +G M  GD PFSLFEG  GM+YL LD+ DPS++ FPAYEL
Sbjct  355   FACFLLEKADQLIAEGAMHGGDRPFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  408



>emb|CDY53809.1| BnaA06g01740D [Brassica napus]
Length=386

 Score =   493 bits (1269),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 242/413 (59%), Positives = 307/413 (74%), Gaps = 29/413 (7%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++PNE+  F+PE     +  + H  KDSL KLLSLP+ + SK+L++ AL+LKD +V E
Sbjct  3     ERFFPNEIPEFLPEDAGEEETFSTH--KDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV D+ LYTG LGTA+LL ++YQV  N +DL LCL+I++AC TA S  S  VT
Sbjct  61    TWDRSGKRVRDFNLYTGVLGTAYLLFQSYQVARNENDLKLCLEIVEACYTA-SKDSDRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAK  GD +L   Y+ +F EI+LP DLP ELLYGRAGYLWAC FLN
Sbjct  120   FICGRAGVCALGAVAAKLTGDSQLQDRYLARFHEIRLPGDLPYELLYGRAGYLWACLFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK +VSS+ MR++  EI ++GR+L   E +K PLM+EW G++YWGAAHGLAGIM+ L
Sbjct  180   KHIGKDSVSSARMRSVVEEIFRAGRQLG--ERVKCPLMFEWHGKKYWGAAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M VEL+PDE EDVK TL YMI++RFPSGNY ++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  238   MHVELEPDEMEDVKGTLSYMIQHRFPSGNYLSSEG-SESDRLVHWCHGAPGVALTLVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F ++EF +AAM+AGEVVW RGLLKR                        EYLYRAKAF
Sbjct  297   QVFRTDEFVEAAMEAGEVVWNRGLLKR-----------------------PEYLYRAKAF  333

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G M  GD PFSLFEGIGGMAY+FLD+ +P++ALFP YEL
Sbjct  334   ASFLLDKSEKLISEGKMHGGDRPFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  386



>gb|AAL58268.1|AC068923_10 putative lanthionine synthetase [Oryza sativa Japonica Group]
Length=446

 Score =   494 bits (1273),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 249/413 (60%), Positives = 307/413 (74%), Gaps = 16/413 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN++  F+ E        AP G +  L+   S    ++S+RL + AL +KD+V+ E
Sbjct  50    DRYFPNDLPDFVAE--------APDGGRGLLSLPYS----SLSERLLRAALRIKDKVMEE  97

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW    R+VTDYTLYTGALGTA LL K++QVTGN  DL+L   I+K CD AAS     +T
Sbjct  98    TWTRARRQVTDYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKECD-AASRGLPFLT  156

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKHC D  LL HY++ F EI +   +P+ELLYGRAGYLWAC FLN
Sbjct  157   FICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVPNELLYGRAGYLWACLFLN  216

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
              +LG+ T+   H+ ++A +II  GRKL+K  N   PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  217   THLGEKTIPHEHITSVAKDIIDEGRKLAKKGN--CPLMYEWHGKKYWGAAHGLAGIMHVL  274

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M  ELK DE++DVK TL YMI+NR+P+GNYP++EG  E+D LVHWCHGAPG+ALTL KA 
Sbjct  275   MHTELKLDEKDDVKNTLLYMIRNRYPTGNYPSSEGS-ESDRLVHWCHGAPGVALTLAKAY  333

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  E F+Q A +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAKAF
Sbjct  334   QVFHDEHFKQTAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKAF  393

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL ++A  LI DG M  GDHPFSLFEG  GMAYL LD+  PS++ FPAYEL
Sbjct  394   ACFLLEKADQLIADGAMHGGDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  446



>ref|NP_001149305.1| LOC100282928 [Zea mays]
 gb|ACG34942.1| lanC-like protein 2 [Zea mays]
Length=401

 Score =   493 bits (1268),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 239/391 (61%), Positives = 294/391 (75%), Gaps = 8/391 (2%)
 Frame = +2

Query  302   APHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTA  481
             AP G +     LLSLP+  +S    + A  LKD+VV ETW   GR+VTDYTLYTG+LGTA
Sbjct  19    APQGIRG----LLSLPYTRLSDHFVRAARRLKDKVVEETWVKAGRKVTDYTLYTGSLGTA  74

Query  482   FLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDD  661
              LL K++QVTG+  DL+L   I++ACD A S     +TF+CG+AG+ ALGAV AKHC D 
Sbjct  75    LLLFKSFQVTGDRGDLALAADIVRACDDA-SRGLPFLTFICGRAGVCALGAVIAKHCDDQ  133

Query  662   ELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIK  841
               +  Y++ F EI +   +P+ELLYGRAGYLWAC FLNK+L + T+   H+ ++A +II 
Sbjct  134   LRVTQYLSSFDEITITEKVPNELLYGRAGYLWACLFLNKHLSEKTIPLDHINSVAKDIIN  193

Query  842   SGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIK  1021
              GR  +      SPLMYEW G++YWGAAHGLAGIM+ LM  ELKPDEQ+DVK TLRYMIK
Sbjct  194   EGRGFA--SKGSSPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKPDEQDDVKNTLRYMIK  251

Query  1022  NRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKR  1201
             N+FPSGNYP++EG+ E+D+LVHWCHGAPG+ALTL KA ++F  + FEQ+A +A EVVW R
Sbjct  252   NKFPSGNYPSSEGN-ESDHLVHWCHGAPGVALTLAKAYEVFHDDYFEQSAAEAAEVVWNR  310

Query  1202  GLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDH  1381
             GLLKRVGICHG+SGNAY FLSLYRLTG  EYLYRAKAF CFL ++A  LI +G M  GD 
Sbjct  311   GLLKRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAEGAMHGGDR  370

Query  1382  PFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             PFSLFEG  GM+YL LD+ DPS++ FPAYEL
Sbjct  371   PFSLFEGKAGMSYLLLDMVDPSESRFPAYEL  401



>gb|ABB47830.2| Lanthionine synthetase C-like protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG93541.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   492 bits (1266),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 247/414 (60%), Positives = 306/414 (74%), Gaps = 16/414 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN++  F+ E        AP G +  L+   S    ++S+RL + AL +KD+V+ E
Sbjct  3     DRYFPNDLPDFVAE--------APDGGRGLLSLPYS----SLSERLLRAALRIKDKVMEE  50

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP-V  592
             TW    R+VTDYTLYTGALGTA LL K++QVTGN  DL+L   I+K CD A+       +
Sbjct  51    TWTRARRQVTDYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKECDAASRGLPRRFL  110

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ ALGAV AKHC D  LL HY++ F EI +   +P+ELLYGRAGYLWAC FL
Sbjct  111   TFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVPNELLYGRAGYLWACLFL  170

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             N +LG+ T+   H+ ++A +II  GRKL+K  N   PLMYEW G++YWGAAHGLAGIM+ 
Sbjct  171   NTHLGEKTIPHEHITSVAKDIIDEGRKLAKKGN--CPLMYEWHGKKYWGAAHGLAGIMHV  228

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM  ELK DE++DVK TL YMI+NR+P+GNYP++EG  E+D LVHWCHGAPG+ALTL KA
Sbjct  229   LMHTELKLDEKDDVKNTLLYMIRNRYPTGNYPSSEGS-ESDRLVHWCHGAPGVALTLAKA  287

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
              ++F  E F+Q A +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAKA
Sbjct  288   YQVFHDEHFKQTAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKA  347

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL ++A  LI DG M  GDHPFSLFEG  GMAYL LD+  PS++ FPAYEL
Sbjct  348   FACFLLEKADQLIADGAMHGGDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  401



>tpg|DAA49457.1| TPA: LOW QUALITY PROTEIN: lanC-like protein 2 [Zea mays]
Length=400

 Score =   492 bits (1266),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 238/388 (61%), Positives = 293/388 (76%), Gaps = 4/388 (1%)
 Frame = +2

Query  311   GTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLL  490
             GT      LLSLP+  +S    + A  LKD+VV ETW   GR+VTDYTLYTG+LGTA LL
Sbjct  17    GTAPQGRGLLSLPYTRLSDHFVRAARRLKDKVVEETWVKAGRKVTDYTLYTGSLGTALLL  76

Query  491   LKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELL  670
              K++QVTG+  DL+L   I++ACD A S     +TF+CG+AG+ ALGAV AKHC D   +
Sbjct  77    FKSFQVTGDRGDLALAADIVRACDDA-SRGLPFLTFICGRAGVCALGAVIAKHCDDQLRV  135

Query  671   HHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGR  850
               Y++ F EI +   +P+ELLYGRAGYLWAC FLNK+L + T+   H+ ++A +II  GR
Sbjct  136   TQYLSSFDEITITEKVPNELLYGRAGYLWACLFLNKHLSEKTIPLDHINSVAKDIINEGR  195

Query  851   KLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRF  1030
               +   +  SPLMYEW G++YWGAAHGLAGIM+ LM  ELKPDEQ+DVK TLRYMIKN+F
Sbjct  196   GFASKGS--SPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKPDEQDDVKNTLRYMIKNKF  253

Query  1031  PSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLL  1210
             PSGNYP++EG+ E+D+LVHWCHGAPG+ALTL KA ++F  + FEQ+A +A EVVW RGLL
Sbjct  254   PSGNYPSSEGN-ESDHLVHWCHGAPGVALTLAKAYEVFHDDYFEQSAAEAAEVVWNRGLL  312

Query  1211  KRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFS  1390
             KRVGICHG+SGNAY FLSLYRLTG  EYLYRAKAF CFL ++A  LI +G M  GD PFS
Sbjct  313   KRVGICHGVSGNAYAFLSLYRLTGNVEYLYRAKAFACFLLEKADQLIAEGAMHGGDRPFS  372

Query  1391  LFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             LFEG  GM+YL LD+ DPS++ FPAYEL
Sbjct  373   LFEGKAGMSYLLLDMVDPSESRFPAYEL  400



>ref|NP_001064963.1| Os10g0497900 [Oryza sativa Japonica Group]
 dbj|BAF26877.1| Os10g0497900, partial [Oryza sativa Japonica Group]
Length=447

 Score =   491 bits (1264),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 247/414 (60%), Positives = 306/414 (74%), Gaps = 16/414 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +RY+PN++  F+ E        AP G +  L+   S    ++S+RL + AL +KD+V+ E
Sbjct  49    DRYFPNDLPDFVAE--------APDGGRGLLSLPYS----SLSERLLRAALRIKDKVMEE  96

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP-V  592
             TW    R+VTDYTLYTGALGTA LL K++QVTGN  DL+L   I+K CD A+       +
Sbjct  97    TWTRARRQVTDYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKECDAASRGLPRRFL  156

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ ALGAV AKHC D  LL HY++ F EI +   +P+ELLYGRAGYLWAC FL
Sbjct  157   TFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVPNELLYGRAGYLWACLFL  216

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             N +LG+ T+   H+ ++A +II  GRKL+K  N   PLMYEW G++YWGAAHGLAGIM+ 
Sbjct  217   NTHLGEKTIPHEHITSVAKDIIDEGRKLAKKGN--CPLMYEWHGKKYWGAAHGLAGIMHV  274

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM  ELK DE++DVK TL YMI+NR+P+GNYP++EG  E+D LVHWCHGAPG+ALTL KA
Sbjct  275   LMHTELKLDEKDDVKNTLLYMIRNRYPTGNYPSSEGS-ESDRLVHWCHGAPGVALTLAKA  333

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
              ++F  E F+Q A +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAKA
Sbjct  334   YQVFHDEHFKQTAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKA  393

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL ++A  LI DG M  GDHPFSLFEG  GMAYL LD+  PS++ FPAYEL
Sbjct  394   FACFLLEKADQLIADGAMHGGDHPFSLFEGRAGMAYLLLDMVSPSESKFPAYEL  447



>ref|XP_003574129.2| PREDICTED: lanC-like protein GCR2 isoform X2 [Brachypodium distachyon]
Length=475

 Score =   491 bits (1265),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 243/414 (59%), Positives = 305/414 (74%), Gaps = 6/414 (1%)
 Frame = +2

Query  233   EERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             ++R++PNE+  F+ E T    +         L  LLSLP+  +S RL + AL LKD+VV 
Sbjct  68    DDRFFPNELPDFVAEATDADGDPP----AAGLLGLLSLPYPKLSDRLLRAALRLKDKVVE  123

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPV  592
             ETW   G  VTDYTLYTGALGTA LL K++QV G+  DL+L  +I++ACD A S+    +
Sbjct  124   ETWTKAGGHVTDYTLYTGALGTALLLFKSFQVNGDRRDLTLAGEIVQACDLA-SNGLPFL  182

Query  593   TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFL  772
             TF+CG+AG+ ALGAV AKHC D  ++ HY++ F EI +   +P+ELLYGRAGYLWAC FL
Sbjct  183   TFICGRAGVCALGAVIAKHCNDQLMVTHYLSSFDEITVTDKVPNELLYGRAGYLWACLFL  242

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYA  952
             N++L + T+ + H+ ++A +IIK GRKLS  +    PLMYEW G++YWGAAHGL GIM+ 
Sbjct  243   NEHLSEKTIPAEHISSVAKDIIKEGRKLSNKDKGSCPLMYEWHGKKYWGAAHGLTGIMHV  302

Query  953   LMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKA  1132
             LM  ELK DEQ+DVK TLRYMI  R+PSGNYP++EG   +D LVHWCHGAPG+ALTL KA
Sbjct  303   LMHTELKLDEQDDVKNTLRYMISKRYPSGNYPSSEGSG-SDRLVHWCHGAPGVALTLCKA  361

Query  1133  AKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
              ++F  + F+Q+A +AGEVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAKA
Sbjct  362   YQVFHDDHFKQSAAEAGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAKA  421

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F CFL + A  LI +  M  GDHPFSLFEG  GMAY  LD+ +P ++ FPAYEL
Sbjct  422   FACFLLEDADRLIAEEAMHGGDHPFSLFEGKAGMAYFLLDMVNPYESRFPAYEL  475



>ref|XP_010234867.1| PREDICTED: lanC-like protein GCR2 isoform X1 [Brachypodium distachyon]
Length=477

 Score =   490 bits (1261),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 242/415 (58%), Positives = 305/415 (73%), Gaps = 6/415 (1%)
 Frame = +2

Query  233   EERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVR  412
             ++R++PNE+  F+ E T    +         L  LLSLP+  +S RL + AL LKD+VV 
Sbjct  68    DDRFFPNELPDFVAEATDADGDPP----AAGLLGLLSLPYPKLSDRLLRAALRLKDKVVE  123

Query  413   ETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP-  589
             ETW   G  VTDYTLYTGALGTA LL K++QV G+  DL+L  +I++ACD A++      
Sbjct  124   ETWTKAGGHVTDYTLYTGALGTALLLFKSFQVNGDRRDLTLAGEIVQACDLASNGLPRRF  183

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             +TF+CG+AG+ ALGAV AKHC D  ++ HY++ F EI +   +P+ELLYGRAGYLWAC F
Sbjct  184   LTFICGRAGVCALGAVIAKHCNDQLMVTHYLSSFDEITVTDKVPNELLYGRAGYLWACLF  243

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LN++L + T+ + H+ ++A +IIK GRKLS  +    PLMYEW G++YWGAAHGL GIM+
Sbjct  244   LNEHLSEKTIPAEHISSVAKDIIKEGRKLSNKDKGSCPLMYEWHGKKYWGAAHGLTGIMH  303

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM  ELK DEQ+DVK TLRYMI  R+PSGNYP++EG   +D LVHWCHGAPG+ALTL K
Sbjct  304   VLMHTELKLDEQDDVKNTLRYMISKRYPSGNYPSSEGSG-SDRLVHWCHGAPGVALTLCK  362

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             A ++F  + F+Q+A +AGEVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG  EYLYRAK
Sbjct  363   AYQVFHDDHFKQSAAEAGEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTGNVEYLYRAK  422

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFL + A  LI +  M  GDHPFSLFEG  GMAY  LD+ +P ++ FPAYEL
Sbjct  423   AFACFLLEDADRLIAEEAMHGGDHPFSLFEGKAGMAYFLLDMVNPYESRFPAYEL  477



>emb|CDY26028.1| BnaC06g05960D [Brassica napus]
Length=386

 Score =   486 bits (1251),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 240/413 (58%), Positives = 304/413 (74%), Gaps = 29/413 (7%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             ER++PNE+  F+PE     + ++ H  KDSL KLLSLP+ + SK+L++ AL+LKD +V E
Sbjct  3     ERFFPNEIPEFLPEDAGEEETVSTH--KDSLTKLLSLPYRSFSKKLQRYALSLKDTIVFE  60

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW   G+RV D+ LYTG LGTA+LL K+ QVT N +DL LCL+I++AC TA S  S  VT
Sbjct  61    TWERSGKRVRDFNLYTGVLGTAYLLFKSCQVTRNKNDLKLCLEIVEACYTA-SKDSDRVT  119

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAK  GD +L   Y+ +F EI+LP DLP ELLYGRAGYLWAC FLN
Sbjct  120   FICGRAGVCALGAVAAKLTGDSQLQDRYLARFHEIRLPSDLPYELLYGRAGYLWACLFLN  179

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++ K +VSS+ MR++  EI ++GR+L     +K PLM+EW G++YWG AHGLAGIM+ L
Sbjct  180   KHIEKDSVSSARMRSVVEEIFRAGRQLGG--RVKCPLMFEWHGKKYWGTAHGLAGIMHVL  237

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M VEL+PDE EDVK TL YMI++RFPSGNY ++EG  E+D LVHWCHGAPG+ALTL KAA
Sbjct  238   MHVELEPDEMEDVKGTLSYMIQHRFPSGNYLSSEG-SESDRLVHWCHGAPGVALTLVKAA  296

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F  +EF +AAM+AGEVVW RGLLKR                        EYLYRAKAF
Sbjct  297   QVFRKDEFVEAAMEAGEVVWNRGLLKR-----------------------PEYLYRAKAF  333

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FL D++  LI++G MQ GD  FSLFEGIGGMAY+FLD+ +P++ALFP YEL
Sbjct  334   ASFLLDKSEKLISEGKMQGGDRRFSLFEGIGGMAYMFLDMNEPTQALFPGYEL  386



>gb|EAZ16566.1| hypothetical protein OsJ_32039 [Oryza sativa Japonica Group]
Length=461

 Score =   485 bits (1248),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 245/424 (58%), Positives = 301/424 (71%), Gaps = 23/424 (5%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKD-SLAKLLSLPHNTISKR----------LKQD  382
             +RY+PN++  F+ E        AP G +  ++  LL       S+R          +  D
Sbjct  50    DRYFPNDLPDFVAE--------APDGGRGLAVVSLLQPLRKGSSRRAPDQGQGVRLISPD  101

Query  383   ALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACD  562
                   +V+ ETW    R+VTDYTLYTGALGTA LL K++QVTGN  DL+L   I+K CD
Sbjct  102   RSLPPPQVMEETWTRARRQVTDYTLYTGALGTALLLFKSFQVTGNRADLALAGDIVKECD  161

Query  563   TAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGR  742
              AAS     +TF+CG+AG+ ALGAV AKHC D  LL HY++ F EI +   +P+ELLYGR
Sbjct  162   -AASRGLPFLTFICGRAGVCALGAVIAKHCNDQLLLTHYLSSFDEIIVTEKVPNELLYGR  220

Query  743   AGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGA  922
             AGYLWAC FLN +LG+ T+   H+ ++A +II  GRKL+K  N   PLMYEW G++YWGA
Sbjct  221   AGYLWACLFLNTHLGEKTIPHEHITSVAKDIIDEGRKLAKKGN--CPLMYEWHGKKYWGA  278

Query  923   AHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGA  1102
             AHGLAGIM+ LM  ELK DE++DVK TL YMI+NR+P+GNYP++EG  E+D LVHWCHGA
Sbjct  279   AHGLAGIMHVLMHTELKLDEKDDVKNTLLYMIRNRYPTGNYPSSEGS-ESDRLVHWCHGA  337

Query  1103  PGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTG  1282
             PG+ALTL KA ++F  E F+Q A +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRLTG
Sbjct  338   PGVALTLAKAYQVFHDEHFKQTAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLTG  397

Query  1283  KEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFP  1462
               EYLYRAKAF CFL ++A  LI DG M  GDHPFSLFEG  GMAYL LD+  PS++ FP
Sbjct  398   NVEYLYRAKAFACFLLEKADQLIADGAMHGGDHPFSLFEGRAGMAYLLLDMVSPSESKFP  457

Query  1463  AYEL  1474
             AYEL
Sbjct  458   AYEL  461



>gb|EMS68258.1| LanC-like protein 2 [Triticum urartu]
Length=436

 Score =   484 bits (1245),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 248/446 (56%), Positives = 308/446 (69%), Gaps = 45/446 (10%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKD---SLAKLLSLPHNTISKRLKQDALTLKD--  400
             +R++PN++  F+ E        AP G       L  LLSLP+  +S RL + AL LKD  
Sbjct  3     DRFFPNDLPDFVAE--------APDGGDPPAAGLRGLLSLPYPRLSDRLLRAALRLKDKA  54

Query  401   ----------------------------EVVRETWGARGRRVTDYTLYTGALGTAFLLLK  496
                                         +VV+ETW   G +VTDYTLYTGALGTA LL K
Sbjct  55    RRLCFISCVVVSFRGARARGARLIDRVLQVVQETWTRTGGQVTDYTLYTGALGTALLLFK  114

Query  497   AYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHH  676
             ++QVTG+  DL+L   I++ACD AAS     +TF+CG+AG+ ALGAV AKHC D  +  +
Sbjct  115   SFQVTGDRRDLNLASDIVQACD-AASLGLPFLTFICGRAGVCALGAVIAKHCNDQLMETN  173

Query  677   YITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKL  856
             +++ F EI +   +P+ELLYGRAGYLWAC FLN++L   T+ + H+ ++A +II+ GRKL
Sbjct  174   FLSSFDEIIITEKVPNELLYGRAGYLWACLFLNEHLSDKTIPAEHISSVAKDIIREGRKL  233

Query  857   SKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPS  1036
             S       PLMYEW G++YWGAAHGLAGIM+ LM  ELK DEQ+DVK TLRYMI NRFPS
Sbjct  234   SN--KGSCPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEQDDVKNTLRYMISNRFPS  291

Query  1037  GNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR  1216
             GNYP++E D E+D LVHWCHGAPG+ALTL KA ++F+ + F+Q+A +A EVVW RGLLKR
Sbjct  292   GNYPSSE-DSESDRLVHWCHGAPGVALTLAKAYQVFQDDHFKQSAAEAAEVVWNRGLLKR  350

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLF  1396
             VGICHGISGNAYVFLSLYRLTG  EYLYRAKAF CFL + A  LI +  M  GD PFSLF
Sbjct  351   VGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFACFLLENADRLIAEEAMHGGDRPFSLF  410

Query  1397  EGIGGMAYLFLDLADPSKALFPAYEL  1474
             EG  GMAYL LD+ +PS++ FPAYEL
Sbjct  411   EGKAGMAYLLLDMVNPSESRFPAYEL  436



>ref|XP_009102106.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Brassica 
rapa]
Length=408

 Score =   482 bits (1241),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 244/418 (58%), Positives = 305/418 (73%), Gaps = 17/418 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M    P+ +   Q +A  G  DSL  LL++P++ +S+ L++ AL LK+ VV E
Sbjct  3     DRFFDNLM----PDLS---QSVAEEG--DSLMNLLAMPYSFLSQNLQRSALGLKETVVME  53

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+ V D+ LY+G LG AFLL +AYQVT N +DLSL LQI+KAC  AAS +S  +T
Sbjct  54    TWGFTGQLVQDFPLYSGTLGAAFLLFRAYQVTANPNDLSLFLQILKACCDAASASSRDIT  113

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEI----KLPVDLPDELLYGRAGYLWAC  763
             F+CG+AG+ ALG  AAK  GD ELL++Y+++F++      L   + +ELLYG  GYLWAC
Sbjct  114   FICGRAGVCALGTAAAKRSGDQELLNYYLSQFRQFCFSTLLSSYIANELLYGIVGYLWAC  173

Query  764   SFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGI  943
              F+NK +G  T+SS+ +  +  EIIK  R ++K  N KSPLM+EW G+RYWG AHGLAGI
Sbjct  174   LFVNKYVGAETLSSTTIHQVTEEIIKESRSMTK--NEKSPLMFEWYGQRYWGTAHGLAGI  231

Query  944   MYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTL  1123
             M+ LM+V+LKPDE EDVK TL+Y+I NRFPS NYPA+E D   D LVHWCHGAPGIALTL
Sbjct  232   MHVLMDVQLKPDEAEDVKGTLKYLINNRFPSXNYPASEEDRRRDLLVHWCHGAPGIALTL  291

Query  1124  TKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYR  1303
              KAA+ F   EF +A   A EVVW RGLLKRVGICHGISGNAYVFLS YR TG+ EYL+R
Sbjct  292   VKAAE-FLGREFLEAGEAAAEVVWNRGLLKRVGICHGISGNAYVFLSFYRATGRNEYLHR  350

Query  1304  AKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEG-IGGMAYLFLDLADPSKALFPAYEL  1474
             AKAF  FL DR H L++ G M  GD P+SLFEG +G MAYLFLD+ DPS+A FP YEL
Sbjct  351   AKAFASFLLDRGHKLLSKGEMHGGDSPYSLFEGVVGKMAYLFLDMVDPSQARFPGYEL  408



>ref|XP_002467007.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
 gb|EER94005.1| hypothetical protein SORBIDRAFT_01g018190 [Sorghum bicolor]
Length=451

 Score =   483 bits (1244),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 245/421 (58%), Positives = 306/421 (73%), Gaps = 6/421 (1%)
 Frame = +2

Query  212   MQGSEMAEERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALT  391
             ++G  MA+ R++PN+   F+ E      +   H     L  LL LP+  +  RL + A  
Sbjct  37    LRGESMAD-RFFPNDFPDFVAEAEASDGDGEGH-RPAGLRGLLELPYTRLCDRLLRAARR  94

Query  392   LKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA  571
             LKD+VV ETW   GR+VTDYTLYTG+LGTA LL K++QVTG+  DL+L   I++ACD A 
Sbjct  95    LKDKVVEETWLKAGRKVTDYTLYTGSLGTALLLFKSFQVTGDRGDLALAADIVRACDEA-  153

Query  572   SHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGY  751
             S     +TF+CG+AG+ ALGAV AKHC D   +  Y++ F EI +   +P+ELLYGR GY
Sbjct  154   SRGLPFLTFICGRAGVCALGAVIAKHCDDQLRVTQYLSSFDEITVTEKVPNELLYGRVGY  213

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHG  931
             LWAC FLNK+L + T+   H+ ++A +II  GR L+      SPLMYEW G++YWGAAHG
Sbjct  214   LWACLFLNKHLSEKTIPVEHINSVAKDIIIEGRNLAS--KGSSPLMYEWHGKKYWGAAHG  271

Query  932   LAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGI  1111
             LAGIM+ LM  ELKPDEQ+DVK TLRYMI+NRFPSGNYP++EG+ E+D LVHWCHGAPG+
Sbjct  272   LAGIMHVLMHTELKPDEQDDVKNTLRYMIENRFPSGNYPSSEGN-ESDRLVHWCHGAPGV  330

Query  1112  ALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEE  1291
             ALTL KA ++F  + F+QAA +A EVVW RGLLKRVGICHG+SGNAYVFLSLYRL+G  E
Sbjct  331   ALTLAKAYEVFHDDYFKQAAAEAAEVVWNRGLLKRVGICHGVSGNAYVFLSLYRLSGNVE  390

Query  1292  YLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             YLYRAKAF CFL ++A  LI +G M  GD  FSLFE   GMAYL LD+ DPS++ FPAYE
Sbjct  391   YLYRAKAFACFLLEKADQLIAEGAMHGGDRSFSLFEEKAGMAYLLLDMVDPSESRFPAYE  450

Query  1472  L  1474
             L
Sbjct  451   L  451



>gb|EMT26581.1| LanC-like protein 2 [Aegilops tauschii]
Length=579

 Score =   483 bits (1242),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 248/446 (56%), Positives = 307/446 (69%), Gaps = 45/446 (10%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKD---SLAKLLSLPHNTISKRLKQDALTLKD--  400
             +R++PN++  F+ E        AP G       L  LLSLP+  +S RL + AL LKD  
Sbjct  146   DRFFPNDLPDFVAE--------APDGGDPPAAGLRGLLSLPYPRLSDRLLRAALRLKDKA  197

Query  401   ----------------------------EVVRETWGARGRRVTDYTLYTGALGTAFLLLK  496
                                         +VV+ETW   G  VTDYTLYTGALGTA LL K
Sbjct  198   RRLCFTACVVVSFRGARARGARLIDCALQVVQETWTRTGGHVTDYTLYTGALGTALLLFK  257

Query  497   AYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHH  676
             ++QVTG+  DL+L  +I++ACD AAS     +TF+CG+AG+ ALGAV AKHC D  +  +
Sbjct  258   SFQVTGDRRDLNLASEIVQACD-AASLGLPFLTFICGRAGVCALGAVIAKHCNDQLMETN  316

Query  677   YITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKL  856
             +++ F EI +   +P+ELLYGRAGYLWAC FLN++L   T+ + H+ ++A +II  GRKL
Sbjct  317   FLSSFDEIIITEKVPNELLYGRAGYLWACLFLNEHLSDKTIPAEHISSVAKDIIMEGRKL  376

Query  857   SKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPS  1036
             S       PLMYEW G++YWGAAHGLAGIM+ LM  ELK DEQ+DVK TLRYMI NRFPS
Sbjct  377   SN--KGSCPLMYEWHGKKYWGAAHGLAGIMHVLMHTELKLDEQDDVKNTLRYMISNRFPS  434

Query  1037  GNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR  1216
             GNYP++E D E+D LVHWCHGAPG+ALTL KA ++F+ + F+Q+A +A EVVW RGLLKR
Sbjct  435   GNYPSSE-DSESDRLVHWCHGAPGVALTLAKAYQVFQDDHFKQSAAEAAEVVWNRGLLKR  493

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLF  1396
             VGICHGISGNAYVFLSLYRLTG  EYLYRAKAF CFL + A  LI +  M  GD PFSLF
Sbjct  494   VGICHGISGNAYVFLSLYRLTGNVEYLYRAKAFACFLLENADRLIAEEAMHGGDRPFSLF  553

Query  1397  EGIGGMAYLFLDLADPSKALFPAYEL  1474
             EG  GMAYL LD+ +PS++ FPAYEL
Sbjct  554   EGKAGMAYLLLDMVNPSESRFPAYEL  579



>gb|KDO74127.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=298

 Score =   460 bits (1184),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 216/300 (72%), Positives = 254/300 (85%), Gaps = 3/300 (1%)
 Frame = +2

Query  575   HASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYL  754
             H    VTF+CG+AG+ ALGAV AKH GD+ LL HY+TKFKEIKLP DLP+ELLYGR G+L
Sbjct  2     HGCRRVTFICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPSDLPNELLYGRVGFL  61

Query  755   WACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGL  934
             WACSFLNK++GK T+S++ MRA+ +EIIK+GR+L+     + PLMYEW G++YWGAAHGL
Sbjct  62    WACSFLNKHMGKDTISTAQMRAVVDEIIKAGRRLAN--RGRCPLMYEWHGKKYWGAAHGL  119

Query  935   AGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIA  1114
             AGIM+ LM++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ 
Sbjct  120   AGIMHVLMDMELKPDEVEDVKGTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVT  178

Query  1115  LTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEY  1294
             LTL KAA++F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVFLSLYRLTG  EY
Sbjct  179   LTLAKAAEVFGEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEY  238

Query  1295  LYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             LYRAKAF CFL+DRA  LI +G M  GD P+SLFEGIGGM +LFLD+ +PS+A FPAYEL
Sbjct  239   LYRAKAFACFLYDRAQKLIAEGKMHGGDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  298



>ref|XP_010918435.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Elaeis guineensis]
Length=365

 Score =   460 bits (1183),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 235/413 (57%), Positives = 291/413 (70%), Gaps = 50/413 (12%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM AF+ E   V   +AP      L  LL LP+   + +L + AL LK++VV+E
Sbjct  3     DRFFPNEMPAFVEENEGV---LAP----SPLHSLLYLPYPKTADKLLRAALDLKEKVVKE  55

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TW     R  D+TLYTGALGTAFLL KAYQVT N  DLSLC +II+ACD A S     VT
Sbjct  56    TWVRLRGRAKDFTLYTGALGTAFLLFKAYQVTNNRGDLSLCSEIIRACDVA-SQGDPHVT  114

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL+HY++ F                R G         
Sbjct  115   FICGRAGVCALGAVVAKHAGDEALLNHYLSSF----------------RGG---------  149

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
                           A+A EII  G++LS     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  150   --------------ALAKEIITDGKRLSN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVL  193

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M+++LKPDE+ED+K TL+YMI+NRFPSGNYP++EG +  D LVHWCHGAPG++LTLTKA+
Sbjct  194   MDMDLKPDEKEDIKGTLQYMIRNRFPSGNYPSSEGSNN-DRLVHWCHGAPGVSLTLTKAS  252

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF  1315
             ++F+ E+F Q A++A EVVW RGLLKRVGICHGISGNAYVFLSLYRLTGK EYLYRAKAF
Sbjct  253   QVFQEEQFLQVAVEAAEVVWNRGLLKRVGICHGISGNAYVFLSLYRLTGKVEYLYRAKAF  312

Query  1316  GCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              CFL D+A+ LI DG+M  GD P+SLFEG  GMA+LFLD+  PS++ FPAYEL
Sbjct  313   ACFLLDKANKLIADGLMHGGDRPYSLFEGQAGMAHLFLDMVRPSESRFPAYEL  365



>ref|NP_001174024.1| Os04g0529600 [Oryza sativa Japonica Group]
 emb|CAD41202.1| OSJNBa0074L08.13 [Oryza sativa Japonica Group]
 emb|CAE03855.1| OSJNBa0081C01.1 [Oryza sativa Japonica Group]
 gb|EAY94933.1| hypothetical protein OsI_16739 [Oryza sativa Indica Group]
 gb|EAZ31418.1| hypothetical protein OsJ_15552 [Oryza sativa Japonica Group]
 dbj|BAH92752.1| Os04g0529600 [Oryza sativa Japonica Group]
Length=422

 Score =   459 bits (1182),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 237/425 (56%), Positives = 294/425 (69%), Gaps = 17/425 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPE-----TTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKD  400
             +R++PN M  +  E              P     SL  LLSLP+  ++ R    AL LK 
Sbjct  3     DRFFPNNMPGYADEGAPPPPAAAAAAAIPSTYSSSLHHLLSLPYPDLADRFLHAALHLKQ  62

Query  401   EVVRETWG-------ARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKAC  559
             +VV ETW        A G  V D+TLYTGALGTA LL +AY VTG+  DL+ C +I+ AC
Sbjct  63    KVVHETWDKRRRAAAAAGEAVGDFTLYTGALGTALLLFRAYLVTGDRADLATCAEIVAAC  122

Query  560   DTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYG  739
             D AAS  +   TF+CG+AG+ ALGAV AKH GD+  + HY++ FKEIK+    PDELLYG
Sbjct  123   D-AASMGAEIATFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFKEIKIHSKSPDELLYG  181

Query  740   RAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWG  919
             RAGYLWAC+FLNK+LG  T+  +    +  +II+ GR LS    +  PLMYEW G +YWG
Sbjct  182   RAGYLWACTFLNKHLGDNTIPPTTTDTVMRDIIRDGRTLS---TIGCPLMYEWYGEKYWG  238

Query  920   AAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHG  1099
             AAHGL+GIM+ L++++L  D+ E VK TLRYMI+NRFPSGNYP  E +D+ D  VHWCHG
Sbjct  239   AAHGLSGIMHVLLDMDLTKDDTECVKGTLRYMIQNRFPSGNYPVTE-EDKHDRFVHWCHG  297

Query  1100  APGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLT  1279
             APGI+LTL KA+++F  E F +A  +A EVVW RGLLKRVGICHG+SGNAY FL+L+RLT
Sbjct  298   APGISLTLAKASQVFPEERFLEAIAEAAEVVWNRGLLKRVGICHGVSGNAYTFLALFRLT  357

Query  1280  GKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALF  1459
              K+E+LYRAKAF CFL DRA  LI DGIM  GD P+SLFEG  GMAYLFLD+ +P  + F
Sbjct  358   KKKEHLYRAKAFACFLLDRAKQLIADGIMHSGDEPYSLFEGQVGMAYLFLDMINPLDSRF  417

Query  1460  PAYEL  1474
             P YEL
Sbjct  418   PGYEL  422



>emb|CAJ86377.1| OSIGBa0155K17.4 [Oryza sativa Indica Group]
Length=422

 Score =   458 bits (1178),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 236/426 (55%), Positives = 295/426 (69%), Gaps = 17/426 (4%)
 Frame = +2

Query  233   EERYYPNEMAAFIPE-----TTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLK  397
             ++R++PN +  +  E              P     SL  LLSLP+  ++ R    AL LK
Sbjct  2     DDRFFPNNIPGYADEGAPPPPAAAAAAAIPSTYSSSLHHLLSLPYPDLADRFLHAALHLK  61

Query  398   DEVVRETWG-------ARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKA  556
              +VV ETW        A G  V D+TLYTGALGTA LL +AY VTG+  DL+ C +I+ A
Sbjct  62    QKVVHETWDKRRRAAAAAGEAVGDFTLYTGALGTALLLFRAYLVTGDRADLATCAEIVAA  121

Query  557   CDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLY  736
             CD AAS  +   TF+CG+AG+ ALGAV AKH GD+  + HY++ FKEIK+    PDELLY
Sbjct  122   CD-AASMGAEIATFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFKEIKIHSKSPDELLY  180

Query  737   GRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYW  916
             GRAGYLWAC+FLNK+LG  T+  +    +  +II+ GR LS    +  PLMYEW G +YW
Sbjct  181   GRAGYLWACTFLNKHLGDNTIPPTTTDTVMRDIIRDGRTLS---TIGCPLMYEWYGEKYW  237

Query  917   GAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCH  1096
             GAAHGL+GIM+ L++++L  D+ E VK TLRYMI+NRFPSGNYP  E +D+ D  VHWCH
Sbjct  238   GAAHGLSGIMHVLLDMDLTKDDTECVKGTLRYMIQNRFPSGNYPVTE-EDKHDRFVHWCH  296

Query  1097  GAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRL  1276
             GAPGI+LTL KA+++F  E F +A  +A EVVW RGLLKRVGICHG+SGNAY FL+L+RL
Sbjct  297   GAPGISLTLAKASQVFPEERFLEAIAEAAEVVWNRGLLKRVGICHGVSGNAYTFLALFRL  356

Query  1277  TGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKAL  1456
             T K+E+LYRAKAF CFL DRA  LI DGIM  GD P+SLFEG  GMAYLFLD+ +P  + 
Sbjct  357   TKKKEHLYRAKAFACFLLDRAKQLIADGIMHSGDEPYSLFEGQVGMAYLFLDMINPLDSR  416

Query  1457  FPAYEL  1474
             FP YEL
Sbjct  417   FPGYEL  422



>ref|XP_006827807.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
 gb|ERM95223.1| hypothetical protein AMTR_s00009p00267750 [Amborella trichopoda]
Length=374

 Score =   454 bits (1169),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 222/363 (61%), Positives = 272/363 (75%), Gaps = 7/363 (2%)
 Frame = +2

Query  395   KDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAAS  574
             + E+V+ETW   G RV D TLYTGALGTA+LL KAYQVT N DDLSLC +II +CD ++ 
Sbjct  15    EKEIVKETWVNCGGRVKDTTLYTGALGTAYLLFKAYQVTNNKDDLSLCTEIIASCDVSSR  74

Query  575   HASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV---DLPDELLYGRA  745
                  VTF+CGQAGIYALGAVAAK  GD  LL  Y++ F++I   +   D+P ELLYGR+
Sbjct  75    GMREDVTFICGQAGIYALGAVAAKCIGDQSLLDRYLSLFRKIPKRIESYDIPYELLYGRS  134

Query  746   GYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAA  925
             G+LWAC+FLN+++G GT+SS     I  +I K GR+LS   +   PL+Y W G++YWGAA
Sbjct  135   GFLWACAFLNQHIGPGTISSDVTAPIVKDIFKEGRRLS---HGGCPLVYVWHGKKYWGAA  191

Query  926   HGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAP  1105
             HGLAGIM+ LM  EL   E+EDVK TLRYM++NRFPSGNYP++EG    D LVHWCHGAP
Sbjct  192   HGLAGIMHVLMHFELSAREEEDVKGTLRYMMQNRFPSGNYPSSEGS-TTDRLVHWCHGAP  250

Query  1106  GIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK  1285
             G+ALT+ +A + F  +EF  AA+DA +VVWKRGLL+RVGICHG+SGNAYVFL+LYRL GK
Sbjct  251   GVALTMCRAVQAFGDKEFMDAAVDATDVVWKRGLLRRVGICHGVSGNAYVFLALYRLLGK  310

Query  1286  EEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPA  1465
             EEYLY+AKAF CFL D    LI+ G M  GD   SLFEG+ G A+LFLD+  PS + FPA
Sbjct  311   EEYLYKAKAFACFLLDCGGRLISSGEMHGGDRSLSLFEGMAGTAHLFLDMTKPSDSRFPA  370

Query  1466  YEL  1474
             YEL
Sbjct  371   YEL  373



>ref|XP_004172119.1| PREDICTED: lanC-like protein 2-like, partial [Cucumis sativus]
Length=293

 Score =   440 bits (1131),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 206/295 (70%), Positives = 247/295 (84%), Gaps = 3/295 (1%)
 Frame = +2

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAVAAK   D  L+ HY+ KFK+IKLP DLP+ELLYGRAG+LWAC F
Sbjct  2     VTFICGRAGVCALGAVAAKFANDGRLVDHYLAKFKDIKLPSDLPNELLYGRAGFLWACLF  61

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK++G+ T+S++ MR++ +E+I++GR L   E  KSPLMYEW G++YWGAAHGLAGIM+
Sbjct  62    LNKHIGQNTISNNFMRSVVDEVIEAGRTLG--EKSKSPLMYEWHGKKYWGAAHGLAGIMH  119

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ALTL K
Sbjct  120   VLMDMELKPDEVEDVKNTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVALTLGK  178

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             AA++F  +EF QAA+DAGEVVW RGLLKRVGICHGISGN YVFLSLYRLTG   YL+RAK
Sbjct  179   AAEVFGDDEFLQAAIDAGEVVWNRGLLKRVGICHGISGNTYVFLSLYRLTGDLMYLHRAK  238

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             AF CFLH  A  LI++G M  GD P+SLFEGIGGMAYLF D+ +P+ A FP+YEL
Sbjct  239   AFACFLHQNAEKLISEGKMHSGDRPYSLFEGIGGMAYLFFDMVEPNAAKFPSYEL  293



>ref|XP_001776967.1| predicted protein [Physcomitrella patens]
 gb|EDQ58216.1| predicted protein [Physcomitrella patens]
Length=395

 Score =   438 bits (1126),  Expect = 9e-146, Method: Compositional matrix adjust.
 Identities = 213/369 (58%), Positives = 269/369 (73%), Gaps = 6/369 (2%)
 Frame = +2

Query  371   LKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
             L + A+++KDEV++ TW  +GRRV+D  LYTG LGTAFL  KAYQ+TG+ +DL+LC +I+
Sbjct  32    LLEVAMSIKDEVIQATWIRKGRRVSDPILYTGVLGTAFLCFKAYQITGSKEDLTLCSEIV  91

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDEL  730
              +C  AA      VTFLCGQ GIYALGA AAK  GD++ LH Y+  F   K  + +P EL
Sbjct  92    DSCTVAAKSLHKYVTFLCGQPGIYALGAAAAKSSGDEQSLHRYLQLFH--KGGMGMPYEL  149

Query  731   LYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRR  910
             LYGRAG+LWA  F+NK++G+GT+ SS    I + I+  GR  +     +SPLMY+W G R
Sbjct  150   LYGRAGFLWAALFVNKHVGEGTIPSSTTGPIVDAILAGGR--AGASQTQSPLMYQWHGSR  207

Query  911   YWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHW  1090
             YWG AHGLAGIM+ LM   L   ++EDVK TLRYMI  RFPSGNYP++EG+   D LVHW
Sbjct  208   YWGGAHGLAGIMHTLMHFPLNKKDEEDVKGTLRYMIARRFPSGNYPSSEGN-ATDRLVHW  266

Query  1091  CHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSL  1267
             CHGAPGIA+TL KA+K+F  E EF+ AA++AG+VVW RGLL+++G+CHGISGN YVFLSL
Sbjct  267   CHGAPGIAMTLCKASKVFPDEMEFQHAAVEAGDVVWSRGLLRKLGLCHGISGNTYVFLSL  326

Query  1268  YRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPS  1447
             Y+ TG +++L+RA+ F  FLH  A TLI  G M  GDHP+SLFEG+ G A LF DL  P 
Sbjct  327   YQSTGGKQHLFRAQQFATFLHKNARTLIESGEMHGGDHPYSLFEGLAGTACLFFDLTKPE  386

Query  1448  KALFPAYEL  1474
              A FPAYEL
Sbjct  387   MARFPAYEL  395



>ref|XP_002966453.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
 gb|EFJ32480.1| hypothetical protein SELMODRAFT_86123 [Selaginella moellendorffii]
Length=421

 Score =   416 bits (1069),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 209/422 (50%), Positives = 276/422 (65%), Gaps = 12/422 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEI---------APHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             +R++ N +A +  +    VQEI            G   +LA     PH    ++L + AL
Sbjct  3     DRFFLNNLADYSEKEEANVQEILESGKEIPRTAEGYSVNLAAPFRHPHLASPEKLLKSAL  62

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LKDE+V+ TWG  G RV D   YTG LGTA+L LK+++VT   +DL+LC +II  C  A
Sbjct  63    ALKDEIVQVTWGRGGTRVKDPIFYTGVLGTAYLCLKSFEVTQKKEDLALCSEIIDHCAAA  122

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAG  748
             A      VTF+CGQ GIYALG VAAK  GD + +  Y+  F+E+   + +P ELLYGRAG
Sbjct  123   AQSMKQYVTFICGQPGIYALGMVAAKSRGDQQRVDFYLNLFEEVYGGLGMPYELLYGRAG  182

Query  749   YLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAH  928
             +LWA  F+N ++G  T+  +    I + I+ +GR  +       PLMY+W G RYWGAAH
Sbjct  183   FLWASLFVNMHIGNETIPWTTTGPIVDAILAAGR--AGASQSSCPLMYQWHGTRYWGAAH  240

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPG  1108
             GLAGIMY LM   L   +  DVK TL YMI NRF SGNYP+++G+ + D L+HWCHGAPG
Sbjct  241   GLAGIMYVLMHFALSARDAADVKETLLYMIANRFQSGNYPSSDGN-QRDKLIHWCHGAPG  299

Query  1109  IALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKE  1288
             I LTL KAAK+F    F +AA+ AGE++WK+GLL+RVG+CHG+SGN Y FL+LYRLTG  
Sbjct  300   ICLTLCKAAKVFPEPVFREAAVAAGELIWKKGLLRRVGLCHGVSGNTYPFLALYRLTGDR  359

Query  1289  EYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             ++L+RA++F  FL ++   LI  G M  GDHP+SLFEG+ G A+L+LDL  P +A FP Y
Sbjct  360   KHLFRARSFATFLCNQGRELIDSGDMHGGDHPYSLFEGLAGTAFLWLDLQRPEEARFPGY  419

Query  1469  EL  1474
             EL
Sbjct  420   EL  421



>gb|KDO74126.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=320

 Score =   411 bits (1057),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 197/306 (64%), Positives = 241/306 (79%), Gaps = 8/306 (3%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PNEM    PET+  V        +DSL KLLSLP+  +S  LK  AL LK  VV E
Sbjct  3     DRFFPNEM----PETSLAVAAHETTTAQDSLTKLLSLPYTAVSDTLKNSALALKQTVVNE  58

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G+RV DYTLYTGALGTA+LL KAYQVT N+++L LC  I++ACD+A S  SG VT
Sbjct  59    TWGVSGKRVQDYTLYTGALGTAYLLFKAYQVTKNDNELKLCCDIVEACDSA-SRDSGRVT  117

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAV AKH GD+ LL HY+TKFKEIKLP DLP+ELLYGR G+LWACSFLN
Sbjct  118   FICGRAGVCALGAVLAKHAGDERLLDHYLTKFKEIKLPSDLPNELLYGRVGFLWACSFLN  177

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K++GK T+S++ MRA+ +EIIK+GR+L+     + PLMYEW G++YWGAAHGLAGIM+ L
Sbjct  178   KHMGKDTISTAQMRAVVDEIIKAGRRLAN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ LTL KAA
Sbjct  236   MDMELKPDEVEDVKGTLRYMIKNRFPSGNYPSSEG-SESDRLVHWCHGAPGVTLTLAKAA  294

Query  1136  KIFESE  1153
             ++   E
Sbjct  295   EVILDE  300



>ref|XP_007043561.1| GCR2-like 2 isoform 3 [Theobroma cacao]
 gb|EOX99392.1| GCR2-like 2 isoform 3 [Theobroma cacao]
Length=288

 Score =   407 bits (1046),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 193/280 (69%), Positives = 234/280 (84%), Gaps = 1/280 (0%)
 Frame = +2

Query  635   VAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
             +AAKH G+ ELL +Y+++FKEIKL  +LPDELLYGRAG+LWAC FLNK+LG+GT+ S+  
Sbjct  10    LAAKHAGNQELLDYYLSQFKEIKLSSNLPDELLYGRAGFLWACVFLNKHLGEGTIPSTTT  69

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
             RA+ +E+IK+GR+L+K +   SPLM+E+ G +YWGAAHGLAGIM+ LM++EL+PDE  DV
Sbjct  70    RAVVDEVIKNGRQLAK-KGGGSPLMFEFYGEKYWGAAHGLAGIMHVLMDMELEPDEIMDV  128

Query  995   KATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAM  1174
             K TL+YMI+NRFPSGNYPA+E D + D LVHWCHGAPGIALTL KAA++F  +EF +AA+
Sbjct  129   KGTLKYMIRNRFPSGNYPASEQDRKRDVLVHWCHGAPGIALTLVKAAEVFGDDEFLEAAV  188

Query  1175  DAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLIT  1354
             DA EVV+ RGLLKRVGICHGISGNAYVFLSLYR TG  E+LYRAKAF CFL DRAH LI+
Sbjct  189   DAAEVVFNRGLLKRVGICHGISGNAYVFLSLYRKTGNVEFLYRAKAFACFLLDRAHKLIS  248

Query  1355  DGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              G M  GD P+SLFEGIGGMAYLFLD+ +P  A FPAYE 
Sbjct  249   KGEMHGGDRPYSLFEGIGGMAYLFLDMIEPLGARFPAYEF  288



>ref|XP_001758715.1| predicted protein [Physcomitrella patens]
 gb|EDQ76693.1| predicted protein [Physcomitrella patens]
Length=407

 Score =   400 bits (1028),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 207/417 (50%), Positives = 280/417 (67%), Gaps = 14/417 (3%)
 Frame = +2

Query  233   EERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKR--LKQDALTLKDEV  406
             E+RY+PN ++ +      V   +  +G   S  +    P  + S+   + + A+ L+DEV
Sbjct  2     EDRYFPNTLSDY------VAPLLGGNGNPHSQCEPGRTPEGSFSEPSVVLKAAIALRDEV  55

Query  407   VRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASG  586
             +  TW   G RV+D T+Y G LGTAFL  K +Q TG+ +DL +C  I+ +C  AA     
Sbjct  56    LEATWIRHGPRVSDPTMYVGMLGTAFLCFKVHQTTGSIEDLDICCNIVDSCAVAAESMKQ  115

Query  587   PVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACS  766
              VTFLCGQ+GIYALGA AAK  GD + L  Y++ F    L   +P EL+YGRAG+LWA  
Sbjct  116   YVTFLCGQSGIYALGAAAAKCKGDQKRLDWYLSLFNAGGL--GMPYELMYGRAGFLWAAL  173

Query  767   FLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIM  946
             F+NK +G+ T+  S    + + ++ +GR  +   + + PLMY+WQG RYWGAAHGLAGIM
Sbjct  174   FVNKYVGEETIPWSVTGPVVDAVMAAGR--AGASHTQCPLMYQWQGTRYWGAAHGLAGIM  231

Query  947   YALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLT  1126
             + LM   L  ++ +DVK TLRYMIK RF SGNYP++EG    D LVHWC+GAPG+ALTL 
Sbjct  232   HVLMHFPLNHEDMKDVKGTLRYMIKGRFSSGNYPSSEGSTR-DRLVHWCYGAPGMALTLC  290

Query  1127  KAAKIF-ESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYR  1303
             KAA+++ E ++F+ AA++AGEVVWKRGLL+R+G+CHGISGNAYVFL+LYRL G++++L+R
Sbjct  291   KAAQVYPECKDFKLAAIEAGEVVWKRGLLRRLGLCHGISGNAYVFLALYRLCGEKKHLFR  350

Query  1304  AKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             A  FG FLH  A  LI +G M  GDH +SL+EG  G A L+LDLA    + FP YE 
Sbjct  351   AHQFGKFLHKNAKQLIRNGEMHGGDHGYSLYEGWAGTACLWLDLAGADASRFPGYEF  407



>ref|XP_010327070.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Solanum lycopersicum]
Length=340

 Score =   397 bits (1019),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 192/319 (60%), Positives = 244/319 (76%), Gaps = 5/319 (2%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQE--IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVV  409
             +R+YPN M  F+ E   + +E    P GT +SL KLLS P++ +SK+ K+ AL LK+ +V
Sbjct  3     DRFYPNVMPDFVAENPAIEEEQHPNPQGTNESLLKLLSTPYHILSKKFKRAALDLKETIV  62

Query  410   RETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGP  589
              ETWG   ++V D+TLY G LGTAFLL KAYQVT N +DL++C QI+K CD+A+ H S  
Sbjct  63    AETWGLTRQQVPDFTLYCGTLGTAFLLFKAYQVTKNTNDLAVCSQIVKDCDSASRH-SRD  121

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTFLCG+AG+ ALGAV AK+ GDD+L+ +Y+++FKEIKL  DLPDELLYGRAGYLWA  F
Sbjct  122   VTFLCGRAGVCALGAVVAKYMGDDQLVFYYVSQFKEIKLTKDLPDELLYGRAGYLWAFLF  181

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             +NK++G+GT+ S++  A+ +EIIK+GRKL      +SPLM+EW G  YWGAAHGLAGIM+
Sbjct  182   INKHIGQGTIPSTYTAAVIDEIIKNGRKLGG--KGRSPLMHEWYGEMYWGAAHGLAGIMH  239

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              LM+ ELKPD+ EDVK TL+YM+KNRFPSGNYPA+E D   D LVHWCHGAPGI LTL K
Sbjct  240   VLMDFELKPDDLEDVKGTLKYMVKNRFPSGNYPASENDRRRDLLVHWCHGAPGIVLTLVK  299

Query  1130  AAKIFESEEFEQAAMDAGE  1186
             AA++F  EEF  AA+ A E
Sbjct  300   AAEVFGDEEFINAAVAAAE  318



>gb|KEH24852.1| G protein coupled receptor [Medicago truncatula]
Length=343

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 189/312 (61%), Positives = 238/312 (76%), Gaps = 8/312 (3%)
 Frame = +2

Query  224   EMAEERYYPNEMAAFIPETTTVVQE-----IAPHGTKDSLAKLLSLPHNTISKRLKQDAL  388
             E    R++PN M  FIPE+T   Q+     +      DSL  LL++PH  +S+RLK+ AL
Sbjct  23    EAMSNRFFPNPMPEFIPESTPSTQQELQEAVTVTTGGDSLLNLLAMPHAPLSQRLKRAAL  82

Query  389   TLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTA  568
              LK+ +V ETWG  G+RV D+TLY G LGTAFLLLK+Y VT N +DL+LC QI+K+CD A
Sbjct  83    DLKETIVMETWGLTGQRVGDFTLYCGLLGTAFLLLKSYHVTCNTNDLALCSQIVKSCD-A  141

Query  569   ASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAG  748
             AS +S  VTF+CG+AG+ ALGAVAAKH GDDE L +Y+ +F++IKLP DLPDELLYG+ G
Sbjct  142   ASLSSRDVTFICGRAGVCALGAVAAKHAGDDESLRYYLAQFQQIKLPKDLPDELLYGKGG  201

Query  749   YLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAH  928
             +LWAC FLNK+LG+GTV SS+   + +EIIK+GR L   +  K PLM+EW G +YWGAAH
Sbjct  202   FLWACLFLNKHLGQGTVPSSYTATVVDEIIKNGRALG--QKRKCPLMFEWYGEKYWGAAH  259

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPG  1108
             GLAGIM  LM++ELKPDE EDV+ TL+YMI NRFPSGNYPA++ D ++D LVHWCHGAPG
Sbjct  260   GLAGIMNVLMDMELKPDELEDVRGTLKYMIHNRFPSGNYPASDKDKKSDVLVHWCHGAPG  319

Query  1109  IALTLTKAAKIF  1144
             +ALTL KAAK+ 
Sbjct  320   MALTLVKAAKVI  331



>ref|XP_007043560.1| GCR2-like 2 isoform 2, partial [Theobroma cacao]
 gb|EOX99391.1| GCR2-like 2 isoform 2, partial [Theobroma cacao]
Length=308

 Score =   389 bits (999),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 187/320 (58%), Positives = 251/320 (78%), Gaps = 14/320 (4%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN +  F+ ETT   +E+      D+L KLLS+P++++S+  K+ AL LK+ V  +
Sbjct  3     DRFFPNVLPDFVSETTEQKEEVG-----DTLMKLLSMPYSSLSQHFKRAALDLKETVTLD  57

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG  G++V+D+TLY G LGTAFLL K+YQ+  N +DLSLCL I+ AC++A S +S  VT
Sbjct  58    TWGLTGQKVSDFTLYCGTLGTAFLLFKSYQLANNTNDLSLCLAIVDACNSA-SFSSRDVT  116

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             FLCG+AG+ ALGAVAAKH G+ ELL +Y+++FKEIKL  +LPDELLYGRAG+LWAC FLN
Sbjct  117   FLCGRAGVCALGAVAAKHAGNQELLDYYLSQFKEIKLSSNLPDELLYGRAGFLWACVFLN  176

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K+LG+GT+ S+  RA+ +E+IK+GR+L+K +   SPLM+E+ G +YWGAAHGLAGIM+ L
Sbjct  177   KHLGEGTIPSTTTRAVVDEVIKNGRQLAK-KGGGSPLMFEFYGEKYWGAAHGLAGIMHVL  235

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             M++EL+PDE  DVK TL+YMI+NRFPSGNYPA+E D + D LVHWCHGAPGIALTL KAA
Sbjct  236   MDMELEPDEIMDVKGTLKYMIRNRFPSGNYPASEQDRKRDVLVHWCHGAPGIALTLVKAA  295

Query  1136  KIFESEEFEQAAMDAGEVVW  1195
             ++       +AA+DA EVV+
Sbjct  296   EL-------EAAVDAAEVVF  308



>gb|ABK24484.1| unknown [Picea sitchensis]
 gb|ACN40165.1| unknown [Picea sitchensis]
Length=427

 Score =   392 bits (1007),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 197/379 (52%), Positives = 259/379 (68%), Gaps = 16/379 (4%)
 Frame = +2

Query  377   QDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKA  556
             + AL LKDEVV+ TW  RG R  D T+Y G  GTAF+  +++Q+TGNN+DL+LC +II +
Sbjct  52    KTALNLKDEVVQSTWTQRGFRCRDPTVYKGLSGTAFMCFRSHQITGNNEDLALCSEIIDS  111

Query  557   CDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKL-------PVD  715
             C   A      VTFLCG+AGIYALGAV AK+ GD++    ++  F E+         P D
Sbjct  112   CAAVARSLRHHVTFLCGEAGIYALGAVVAKYKGDNQRKDFFLNLFCEVAQERALSVGPED  171

Query  716   ----LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSP  883
                 +P EL+YGRAG+LWA  F+NK+LG  T+    +  I + ++  GR  +   +   P
Sbjct  172   GGFGMPYELMYGRAGFLWAALFVNKHLGGETIPWRVLSPIVDAVLAGGR--TGASHTLCP  229

Query  884   LMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEG  1060
             LMY+W G RYWGAAHGLAGIM+ L+   L  ++ +DVK TL YMI+NRFP SGNYP++EG
Sbjct  230   LMYQWNGTRYWGAAHGLAGIMHVLLHFPLNKEDADDVKGTLHYMIRNRFPESGNYPSSEG  289

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEE-FEQAAMDAGEVVWKRGLLKRVGICHGI  1237
             +   D LV WCHGAPG+A++L KAA++   E  F QAA++AGE+VWK+GLL++VG+CHGI
Sbjct  290   NKR-DKLVQWCHGAPGVAMSLCKAAQVLPGEPVFRQAAVEAGELVWKKGLLRKVGLCHGI  348

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMA  1417
             SGNAY FL+LYRLT +E YL RAKAF  FL++    LI  G M  GDHP+SLFEG+ G A
Sbjct  349   SGNAYTFLALYRLTKEELYLNRAKAFTGFLYNNGRRLIASGQMHGGDHPYSLFEGLAGTA  408

Query  1418  YLFLDLADPSKALFPAYEL  1474
              L+ D+  P  A FP +EL
Sbjct  409   CLYFDMVKPEHARFPGFEL  427



>ref|XP_008781994.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL2 [Phoenix 
dactylifera]
Length=276

 Score =   375 bits (963),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 213/262 (81%), Gaps = 6/262 (2%)
 Frame = +2

Query  698   IKLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLK  877
             IK+P  +P+ELLYGR GYLWAC FLNK++G+GT+ S+H  AIA EII  G++LS   +  
Sbjct  18    IKMPGKVPNELLYGRVGYLWACFFLNKHIGEGTIPSTHTGAIAKEIIMDGQRLSNRGS--  75

Query  878   SPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAE  1057
              PLMYEW G +YWGAAHGLAGIM+ LM+VELKPDE+ED+K TL YMI+NRFPSGNYP++E
Sbjct  76    CPLMYEWYGEKYWGAAHGLAGIMHILMDVELKPDEKEDIKGTLHYMIQNRFPSGNYPSSE  135

Query  1058  GDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGI  1237
             G  + D L+HWCHGAPG+ALTLTKAA++F+ E+F Q A +A EVVW RGLLKRVGICHGI
Sbjct  136   GSYD-DRLMHWCHGAPGVALTLTKAAQVFQEEQFLQVAAEAAEVVWSRGLLKRVGICHGI  194

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFL---HDRAHTLITDGIMQRGDHPFSLFEGIG  1408
             SGN YVFL+LYRLTG   YLYRAKAF CFL    D+A+ LI DG+M  GDHP+SLFEG  
Sbjct  195   SGNXYVFLALYRLTGNVVYLYRAKAFACFLLDKLDKANKLIADGLMHSGDHPYSLFEGQA  254

Query  1409  GMAYLFLDLADPSKALFPAYEL  1474
             GMAYLFLD+  PS++ FPAYEL
Sbjct  255   GMAYLFLDMVRPSESRFPAYEL  276



>gb|KDO74128.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
 gb|KDO74129.1| hypothetical protein CISIN_1g015433mg [Citrus sinensis]
Length=228

 Score =   355 bits (910),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 196/231 (85%), Gaps = 3/231 (1%)
 Frame = +2

Query  782   LGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALME  961
             +GK T+S++ MRA+ +EIIK+GR+L+     + PLMYEW G++YWGAAHGLAGIM+ LM+
Sbjct  1     MGKDTISTAQMRAVVDEIIKAGRRLAN--RGRCPLMYEWHGKKYWGAAHGLAGIMHVLMD  58

Query  962   VELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKI  1141
             +ELKPDE EDVK TLRYMIKNRFPSGNYP++EG  E+D LVHWCHGAPG+ LTL KAA++
Sbjct  59    MELKPDEVEDVKGTLRYMIKNRFPSGNYPSSEGS-ESDRLVHWCHGAPGVTLTLAKAAEV  117

Query  1142  FESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGC  1321
             F  +EF QAA+DAGEVVWKRGLLKRVGICHGISGN YVFLSLYRLTG  EYLYRAKAF C
Sbjct  118   FGEKEFLQAAVDAGEVVWKRGLLKRVGICHGISGNTYVFLSLYRLTGNVEYLYRAKAFAC  177

Query  1322  FLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             FL+DRA  LI +G M  GD P+SLFEGIGGM +LFLD+ +PS+A FPAYEL
Sbjct  178   FLYDRAQKLIAEGKMHGGDRPYSLFEGIGGMTHLFLDMIEPSEARFPAYEL  228



>emb|CDP01505.1| unnamed protein product [Coffea canephora]
Length=425

 Score =   358 bits (920),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 202/410 (49%), Positives = 265/410 (65%), Gaps = 31/410 (8%)
 Frame = +2

Query  305   PHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGR----RVTDYTLYTGAL  472
             PHG+ D  A  LSLP  T    L Q A++LKD+VV+ TW  RG+      TD T+YTG L
Sbjct  27    PHGS-DLTAPNLSLPAET----LLQAAISLKDKVVQVTW--RGQWNDYGNTDPTVYTGLL  79

Query  473   GTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHC  652
             GTAF  L+AY+ TG+  DLSLC +I+  C + A  ++  +TFLCG+ G+YALGAVAA +C
Sbjct  80    GTAFTCLRAYEATGSLQDLSLCTEIVDTCASIARSSTRHLTFLCGRGGVYALGAVAANYC  139

Query  653   GDDELLHHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGT  796
             GD +    Y+ +F E+     LPV  P+E        LLYGRAG+LW   F+NK+LG   
Sbjct  140   GDQQKRDLYMDRFFEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWTALFINKHLGAEA  198

Query  797   VSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVE-LK  973
             V S  +  +   ++  GR  +  +N   PLMY W G RYWGAAHGLAGI++ L+  + L 
Sbjct  199   VPSDLLMPVVEAVLAGGRAGAS-DNTACPLMYRWHGTRYWGAAHGLAGILHVLLHFQALS  257

Query  974   PDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFES  1150
              D+ EDVK TLRYM+ NRFP SGNYP +EG+   D LV WCHGA GI +TL KA+++  +
Sbjct  258   ADDIEDVKGTLRYMMSNRFPRSGNYPVSEGNPR-DKLVQWCHGATGIGITLCKASEVLPT  316

Query  1151  E-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG-CF  1324
             + EF  AA++AGEVVWK GL+K+VG+  G +GNAY FLSLYRLTG+  Y  RAKAF  C 
Sbjct  317   DREFRNAAIEAGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEDRAKAFANCL  376

Query  1325  LHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              HD+ +   T       DH +SLF+G+ G+A L+ DL  P K+ FP YE+
Sbjct  377   YHDQRNA-TTSSPSTGADHAYSLFQGLAGVACLWFDLLAPEKSKFPGYEI  425



>ref|XP_009800854.1| PREDICTED: lanC-like protein GCL1 [Nicotiana sylvestris]
Length=432

 Score =   358 bits (918),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 190/398 (48%), Positives = 254/398 (64%), Gaps = 22/398 (6%)
 Frame = +2

Query  329   AKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRR---VTDYTLYTGALGTAFLLLKA  499
             A  +SLP    S+   Q A++LKD+VV  TW   GR    VTD T+YTG LGTAF  L++
Sbjct  41    AHNVSLP----SETFLQAAISLKDQVVEMTWKGNGRSAGGVTDPTVYTGLLGTAFTCLRS  96

Query  500   YQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DEL  667
             Y+ TG+  DL LC +I+ AC   A   +  VTFLCG+ G+YALGAVAA +CGD    D  
Sbjct  97    YEATGDPKDLELCSEIVDACAELARTVTRHVTFLCGRGGVYALGAVAANYCGDLYKRDLY  156

Query  668   LHHYITKFKEIKLPVDLPD-------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIA  826
             L+H++   +E  LPV   D       +LLYGRAG+LWA  F+ K LG+ TV   ++  + 
Sbjct  157   LNHFLEVAQERALPVGPEDGGFGMSYDLLYGRAGFLWAALFIRKYLGEETVPDEYLMPVV  216

Query  827   NEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATL  1006
               I++ GR     +N   PLMY W G RYWGAAHGLAGI++ L+   +  ++ EDVK TL
Sbjct  217   EAILEGGRA-GATDNPACPLMYRWHGTRYWGAAHGLAGILHVLLHFPVSQEDIEDVKETL  275

Query  1007  RYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDA  1180
             RYM+ NRFP SGNYP +EG+   D LV W HGA GI +T+ KA+++  ++ EF  AA++ 
Sbjct  276   RYMMSNRFPHSGNYPVSEGNPR-DKLVQWSHGATGITITMCKASEVLSNDREFRDAAIEG  334

Query  1181  GEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDG  1360
             GEVVWK GL+K+VG+  G SGNAY FLSL+RLTG+  Y  RA++F   L+  A T++ + 
Sbjct  335   GEVVWKNGLVKKVGLADGASGNAYAFLSLFRLTGESIYEERARSFASCLYHNARTIMNER  394

Query  1361  IMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                  DH +SLF+G+GG+A    DL  P  + FP YEL
Sbjct  395   HHNEADHSYSLFQGLGGVACFLFDLLTPENSRFPGYEL  432



>ref|XP_011031065.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=421

 Score =   357 bits (916),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 193/404 (48%), Positives = 262/404 (65%), Gaps = 22/404 (5%)
 Frame = +2

Query  308   HGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT--DYTLYTGALGTA  481
             H T  +   +L LPH T    L + A++LK++VV  TW   G+  T  D T+YTG LGTA
Sbjct  25    HRTDPTSTDML-LPHET----LLRAAISLKNQVVEMTWERDGKTGTGIDPTVYTGLLGTA  79

Query  482   FLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDD  661
             F  L++Y+VTGN  DL LC +I+  C  +A  +S  +TFLCG+ G+YALGAVAA + GD 
Sbjct  80    FTCLRSYEVTGNEQDLLLCSEIVDTCSVSARTSSRHITFLCGRGGLYALGAVAASYKGDR  139

Query  662   ELLHHYITKFKEIK----LPVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSS  808
                  ++  F E+     LPV        +  EL+YGRAG+LWA  F+NK+LG+GT+   
Sbjct  140   RRRDFFVNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLPCD  199

Query  809   HMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQE  988
              +R + + ++  GR  +  +N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ E
Sbjct  200   LLRPVVDAVLAGGRAGAS-DNAACPLMYRWHGTRYWGAANGLAGILQVLLHFPLSIEDVE  258

Query  989   DVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFE  1162
             DVKATLRYM+ NRFP SGNYP++EG+   D LV W HGA  +A+TL KA+++F ++ EF 
Sbjct  259   DVKATLRYMMSNRFPHSGNYPSSEGNPR-DKLVQWSHGATSMAITLCKASEMFPNDREFR  317

Query  1163  QAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAH  1342
              AA++AGEVVWK GL+K+VG+  G +GNAY FLSLYRLTG+  Y  RA AF  FL+  A 
Sbjct  318   NAAIEAGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEERANAFASFLYHNAS  377

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              L+T G  +  +H +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  378   ELVTIGDARGANHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  421



>ref|XP_006353211.1| PREDICTED: lanC-like protein 2-like [Solanum tuberosum]
Length=424

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 190/393 (48%), Positives = 248/393 (63%), Gaps = 20/393 (5%)
 Frame = +2

Query  350   HNT--ISKRLKQDALTLKDEVVRETWGARGRR---VTDYTLYTGALGTAFLLLKAYQVTG  514
             HN    S+   Q A++LKD+VV  TW   GR    VTD T+YTG LGTAF  L++Y+ TG
Sbjct  34    HNVSHTSETFLQAAISLKDQVVEMTWKENGRSAGSVTDPTMYTGLLGTAFTCLRSYEATG  93

Query  515   NNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DELLHHYI  682
             +  DL LC +I+ AC   A   +  VTFLCG+ G+YALGAVAA +CGD    D  L+H++
Sbjct  94    DRKDLELCSEIVDACADLARTVTRHVTFLCGRGGVYALGAVAANYCGDQHKRDLYLNHFL  153

Query  683   TKFKEIKLPVDLPD-------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIK  841
                +E  LPV   D       +LLYGRAG+LWA  F+ K LG  +V   ++  +   I+ 
Sbjct  154   EVAQERALPVGPEDGGFGMSYDLLYGRAGFLWAALFIRKYLGVESVPDDYLMPVVEAILA  213

Query  842   SGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIK  1021
              GR  +  +N   PLMY W G RYWGAAHGLAGI++ L+   L  ++ EDVK TLRYM+ 
Sbjct  214   GGRAGAS-DNPACPLMYRWHGTRYWGAAHGLAGILHVLLHFPLSQEDIEDVKETLRYMMS  272

Query  1022  NRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIF-ESEEFEQAAMDAGEVVW  1195
             NRFP SGNYP +EG+   D LV W HGA GI +T+ K +++  +  EF  AA++ GEVVW
Sbjct  273   NRFPHSGNYPVSEGNPR-DKLVQWSHGATGITITMCKVSEVLSDDREFRGAAIEGGEVVW  331

Query  1196  KRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRG  1375
             K GL++RVG+  G SGNAY FLSLYRLTG+  Y  RAKAF   L+  A T++ +      
Sbjct  332   KSGLVERVGLADGASGNAYAFLSLYRLTGESIYEERAKAFASCLYQNARTIMNERHHNEA  391

Query  1376  DHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             DH +SLF+G+GG+A    DL  P  + FP YEL
Sbjct  392   DHSYSLFQGLGGVACFLFDLLAPKNSRFPGYEL  424



>ref|XP_004250112.1| PREDICTED: lanC-like protein GCL1 [Solanum lycopersicum]
Length=424

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 189/394 (48%), Positives = 249/394 (63%), Gaps = 20/394 (5%)
 Frame = +2

Query  341   SLPHNTISKRLKQDALTLKDEVVRETWGARGRR---VTDYTLYTGALGTAFLLLKAYQVT  511
             S+PH   S+   Q A++LKD+VV  TW   GR    VTD T+YTG LGTAF  L++Y+ T
Sbjct  35    SVPHT--SETFLQAAISLKDQVVEMTWKENGRSASSVTDPTMYTGLLGTAFTCLRSYEST  92

Query  512   GNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DELLHHY  679
             G+  DL LC +I+ +C   A   +  VTFLCG+ G+YALGAVAA +CGD    D  L+H+
Sbjct  93    GDRKDLELCSEIVDSCADLARTFTRHVTFLCGRGGVYALGAVAASYCGDQHKRDLYLNHF  152

Query  680   ITKFKEIKLPVDLPD-------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEII  838
             +   +E  LPV   D       +LLYGRAG+LWA  F+ K LG  +V    +  +   I+
Sbjct  153   LEVAQERALPVGPEDGGFGMSYDLLYGRAGFLWAALFIRKYLGVESVPDDSLMPVVEAIL  212

Query  839   KSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMI  1018
               GR  +  +N   PLMY W G RYWGAAHGLAGI++ L+   L  ++ EDVK TLRYM+
Sbjct  213   AGGRAGAS-DNSACPLMYRWHGTRYWGAAHGLAGILHVLLHFPLSQEDIEDVKETLRYMM  271

Query  1019  KNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIF-ESEEFEQAAMDAGEVV  1192
              NRFP SGNYP +EG+   D LV W HGA GI +T+ K +K+  +  EF  AA++ GEVV
Sbjct  272   SNRFPHSGNYPVSEGNPR-DKLVQWSHGATGITITMCKVSKVLSDDREFRDAAIEGGEVV  330

Query  1193  WKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQR  1372
             WK GL+++VG+  G SGNAY FLSLYRLTG+  Y  RAKAF   L+  A T++ +     
Sbjct  331   WKSGLVEKVGLADGASGNAYAFLSLYRLTGESIYEERAKAFASCLYQNARTIMNEREHNE  390

Query  1373  GDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              DH +SLF+G+GG+A    DL  P  + FP +EL
Sbjct  391   ADHSYSLFQGLGGVACFLFDLLAPKNSRFPGFEL  424



>gb|AAF75794.1|AF272710_1 putative 7-transmembrane G-protein-coupled receptor [Solanum 
chacoense]
Length=424

 Score =   356 bits (914),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 188/387 (49%), Positives = 246/387 (64%), Gaps = 18/387 (5%)
 Frame = +2

Query  362   SKRLKQDALTLKDEVVRETWGARGRR---VTDYTLYTGALGTAFLLLKAYQVTGNNDDLS  532
             S+   Q A++LKD+VV  TW   GR    VTD T+YTG LGTAF  L++Y+ TG+  DL 
Sbjct  40    SETFLQAAISLKDQVVEMTWKENGRSAGSVTDPTMYTGLLGTAFTCLRSYEATGDRKDLE  99

Query  533   LCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DELLHHYITKFKEI  700
             LC +I+ AC   A   +  VTFLCG+ G+YALGAVAA +CGD    D  L+H++   +E 
Sbjct  100   LCSEIVDACADLARTVTRHVTFLCGRGGVYALGAVAANYCGDQHKRDLYLNHFLEVAQER  159

Query  701   KLPVDLPD-------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLS  859
              LPV   D       +LLYGRAG+LWA  F+ K LG  +V   ++  +   I+  GR  +
Sbjct  160   ALPVGPEDGGFGMSYDLLYGRAGFLWAALFIRKYLGVESVPDDYLMPVVEAILAGGRAGA  219

Query  860   KLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-S  1036
               +N   PLMY W G RYWGAAHGLAGI++ L+   L  ++ EDVK TLRYM+ NRFP S
Sbjct  220   S-DNPACPLMYRWHGTRYWGAAHGLAGILHVLLHFPLSQEDIEDVKETLRYMMSNRFPHS  278

Query  1037  GNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIF-ESEEFEQAAMDAGEVVWKRGLLK  1213
             GNYP +EG+   D LV W HGA GI +T+ K +++  +  EF  AA++ GEVVWK GL++
Sbjct  279   GNYPVSEGNPR-DKLVQWSHGATGITITMCKVSEVLSDDREFRGAAIEGGEVVWKSGLVE  337

Query  1214  RVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSL  1393
             RVG+  G SGNAY FLSLYRLTG+  Y  RAKAF   L+  A T++ +      DH +SL
Sbjct  338   RVGLADGASGNAYAFLSLYRLTGESIYEERAKAFASCLYQNARTIMNERHHNEADHSYSL  397

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F+G+GG+A    DL  P  + FP YEL
Sbjct  398   FQGLGGVACFLFDLLAPKNSRFPGYEL  424



>ref|XP_002306296.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
 gb|EEE93292.2| hypothetical protein POPTR_0005s07360g [Populus trichocarpa]
Length=421

 Score =   355 bits (910),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 190/400 (48%), Positives = 259/400 (65%), Gaps = 21/400 (5%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT--DYTLYTGALGTAFLLL  493
             D  +  + LPH T    L + A++LK++VV  TW   G+  T  D T+YTG LGTAF  L
Sbjct  28    DPTSTDMLLPHET----LLRAAISLKNQVVEVTWERDGKTGTGIDPTVYTGLLGTAFTCL  83

Query  494   KAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLH  673
             ++Y+VTGN  DL LC +I+  C  +A  +S  +TFLCG+ G+YALGAVAA + GD     
Sbjct  84    RSYEVTGNEQDLLLCSEIVDTCSVSARTSSRHITFLCGRGGLYALGAVAASYKGDRRRRD  143

Query  674   HYITKFKEIK----LPVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRA  820
              ++  F E+     LPV        +  EL+YGRAG+LWA  F+NK+LG+GT+    +  
Sbjct  144   FFVNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLPCDLLMP  203

Query  821   IANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKA  1000
             + + ++  GR  +  +N   PLMY W G RYWGA +GLAGI+  L+   L  ++ EDVKA
Sbjct  204   VVDAVLAGGRAGAS-DNAACPLMYRWHGTRYWGAPNGLAGILQVLLHFPLSIEDVEDVKA  262

Query  1001  TLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAM  1174
             TLRYM+ NRFP SGNYP++EG+   D LV W HGA G+A+TL KA+++F ++ EF  AA+
Sbjct  263   TLRYMMSNRFPHSGNYPSSEGNPR-DKLVQWSHGATGMAITLCKASEMFPNDREFRNAAI  321

Query  1175  DAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLIT  1354
             +AGEVVWK GL+K+VG+  G +GNAY FLSLYRLTG+  Y  RA AF  FL+  A  L+T
Sbjct  322   EAGEVVWKSGLVKKVGLADGAAGNAYAFLSLYRLTGESIYEERANAFASFLYHNASELVT  381

Query  1355  DGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              G  +  +H +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  382   IGDARGANHAYSLFQGLAGTACLWFDLLKPESSRFPGYEL  421



>ref|XP_002262692.1| PREDICTED: lanC-like protein GCL1 isoform X2 [Vitis vinifera]
Length=421

 Score =   354 bits (908),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 253/402 (63%), Gaps = 24/402 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW--GARG-RRVTDYTLYTGALGTAFLL  490
             D  A  LSLP  T  K     A++LKD+VV  TW  G  G R+  D T++TG LGTAF  
Sbjct  27    DPTAANLSLPTETFLKA----AMSLKDQVVEATWKRGGEGWRKGIDPTVHTGLLGTAFAC  82

Query  491   LKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELL  670
             L++Y+ TG   DL LC +I+ +C   +   +  VTFLCG  G+YALGAV A H GD +  
Sbjct  83    LRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHVTFLCGSGGVYALGAVVANHIGDYQRR  142

Query  671   HHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
               Y+  F E+     LPV  P+E        LLYGRAG+LWA  F+NK+LG+ T+ +  +
Sbjct  143   DMYLDLFLEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQTLPNDLI  201

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
               + N ++  GR  +  +N   PLMY W G RYWGAAHGLAGI+  L+   L  ++ EDV
Sbjct  202   MPVVNAVLAGGRAGAS-DNTTCPLMYRWHGTRYWGAAHGLAGILQVLLHFPLSEEDSEDV  260

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TLRYM  NRFP SGNYP+ EG+   D LV W HGA G+A+TL KA+++F  + EF  A
Sbjct  261   KGTLRYMRSNRFPHSGNYPSFEGNPR-DKLVQWSHGATGVAITLCKASQVFSRDREFRDA  319

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L
Sbjct  320   AIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKL  379

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +T G     +H +SLF+G+ G A L  DL  P  + FP YEL
Sbjct  380   VTVGHAGTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_009605819.1| PREDICTED: lanC-like protein GCL1 [Nicotiana tomentosiformis]
Length=430

 Score =   353 bits (907),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 190/398 (48%), Positives = 249/398 (63%), Gaps = 22/398 (6%)
 Frame = +2

Query  329   AKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRR---VTDYTLYTGALGTAFLLLKA  499
             A  +SLP    S+   Q A++LKD+VV  TW   GR    VTD T+YTG LGTAF  L++
Sbjct  39    AHNISLP----SETFLQAAISLKDQVVDMTWKGNGRSAGGVTDPTVYTGLLGTAFTCLRS  94

Query  500   YQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDE----L  667
             Y+ TG+  DL LC +I+ AC   A   +  VTFLCG+ G+YALGAVAA +CGD       
Sbjct  95    YEATGDRKDLELCSEIVDACAELARTVTRHVTFLCGRGGVYALGAVAANYCGDQHKRVLY  154

Query  668   LHHYITKFKEIKLPVDLPD-------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIA  826
             L+H+    +E  LPV   D       +LLYGRAG+LWA  F+ K LG  TV   ++  + 
Sbjct  155   LNHFFEVAQERALPVGPEDGGFGMSYDLLYGRAGFLWAALFIRKYLGAETVPDEYLMPVV  214

Query  827   NEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATL  1006
               I+  GR     +N   PLMY W G RYWGAAHGLAGI++ L+   L  ++ EDVK TL
Sbjct  215   EAILAGGRA-GATDNPACPLMYRWHGTRYWGAAHGLAGILHVLLHFPLSQEDIEDVKETL  273

Query  1007  RYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDA  1180
             RYM+ NRFP SGNYP +EG+   D LV W HGA GI +T+ KA+++  ++ EF  AA++ 
Sbjct  274   RYMMSNRFPHSGNYPVSEGNPR-DKLVQWSHGATGITITMCKASEVLSNDREFRDAAIEG  332

Query  1181  GEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDG  1360
             GEVVWK GL+K+VG+  G SG AY FLSL+RLTG+  Y  RA+AF   L+  A T++ + 
Sbjct  333   GEVVWKNGLVKKVGLADGASGIAYAFLSLFRLTGESIYEERARAFASCLYHNARTIMNER  392

Query  1361  IMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                  DH +SLF+G+GG+A    DL  P  + FP YEL
Sbjct  393   HHNEADHSYSLFQGLGGVACFLFDLLTPENSRFPGYEL  430



>ref|XP_002268951.3| PREDICTED: lanC-like protein GCL1 [Vitis vinifera]
Length=421

 Score =   353 bits (906),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 195/402 (49%), Positives = 253/402 (63%), Gaps = 24/402 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW--GARG-RRVTDYTLYTGALGTAFLL  490
             D  A  LSLP  T  K     A++LKD+VV  TW  G  G R+  D T++TG LGTAF  
Sbjct  27    DPTAANLSLPTETFLKA----AMSLKDQVVEATWKRGGEGWRKGIDPTVHTGLLGTAFAC  82

Query  491   LKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELL  670
             L++Y+ TG   DL LC +I+ +C   +   +  VTFLCG  G+YALGAV A H GD +  
Sbjct  83    LRSYESTGRQQDLLLCAEIVDSCAMTSREFTRHVTFLCGSGGVYALGAVVANHIGDYQRR  142

Query  671   HHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
               Y+  F E+     LPV  P+E        LLYGRAG+LWA  F+NK+LG+ T+ +  +
Sbjct  143   DMYLDLFLEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQTLPNDLV  201

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
               + N ++  GR  +  +N   PLMY W G RYWGAAHGLAGI+  L+   L  ++ EDV
Sbjct  202   MPVVNAVLAGGRAGAS-DNTTCPLMYRWHGTRYWGAAHGLAGILQVLLHFPLSEEDSEDV  260

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TLRYM  NRFP SGNYP+ EG+   D LV W HGA G+A+TL KA+++F  + EF  A
Sbjct  261   KGTLRYMRSNRFPHSGNYPSFEGNPR-DKLVQWSHGATGVAITLCKASQVFSRDREFRDA  319

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L
Sbjct  320   AIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKL  379

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +T G     +H +SLF+G+ G A L  DL  P  + FP YEL
Sbjct  380   VTVGHAGTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_007047870.1| GCR2-like 1 [Theobroma cacao]
 gb|EOX92027.1| GCR2-like 1 [Theobroma cacao]
Length=424

 Score =   352 bits (903),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 193/402 (48%), Positives = 260/402 (65%), Gaps = 25/402 (6%)
 Frame = +2

Query  323   SLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT----DYTLYTGALGTAFLL  490
             ++A  LSL  +T+ K     A+ LKD+VV  TW   G        D T+ TG LGTAF  
Sbjct  30    TVANNLSLSADTLLKA----AIALKDQVVEVTWKEGGGSCAGSGMDPTVNTGLLGTAFTC  85

Query  491   LKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELL  670
             L++Y+VTGN  DL L  +I+  C + A  ++  VTFLCG+ G+Y+LGAV A + GD + L
Sbjct  86    LRSYEVTGNQQDLLLSAKIVDTCASVARASTRHVTFLCGRGGVYSLGAVVANYMGDPQRL  145

Query  671   HHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
             + ++ +F E+     LPV  P+E        LLYGRAG+LWA  FLNK+LGK TV S  +
Sbjct  146   NFFLNQFLEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFLNKHLGKETVPSDVL  204

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
               I + I+  GR  +  ++   PLMY W G RYWGAA+GLAGI++ L+   L  ++ EDV
Sbjct  205   MPIIDAILAGGRTGAS-DHPACPLMYRWHGTRYWGAANGLAGILHVLLHFPLSENDAEDV  263

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TLRYM+ NRFP SGNYP++EG+   D LV W HGA  +A+TL KA++++ SE EF  A
Sbjct  264   KGTLRYMMSNRFPHSGNYPSSEGNPR-DKLVQWSHGATSMAITLAKASQVYPSEREFRDA  322

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L
Sbjct  323   AIEAGEVVWKNGLVKKVGLADGVAGNAYAFLSLYRLTGETIYEERAKAFASFLYHNARKL  382

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +  G     DH +SLF+G+ G A L+ DL +P  + FP +EL
Sbjct  383   VNVGHACGADHAYSLFQGLAGTACLWFDLLEPQNSKFPGFEL  424



>emb|CAN83415.1| hypothetical protein VITISV_029722 [Vitis vinifera]
Length=421

 Score =   351 bits (901),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 194/402 (48%), Positives = 252/402 (63%), Gaps = 24/402 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW--GARG-RRVTDYTLYTGALGTAFLL  490
             D  A  LSLP  T  K     A++LKD+VV  TW  G  G R+  D T++TG LGTAF  
Sbjct  27    DPTAANLSLPTETFLKA----AMSLKDQVVEATWKRGGEGWRKGIDPTVHTGLLGTAFAC  82

Query  491   LKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELL  670
             L++Y+ TG   DL LC +I+ +C   +   +  VTFLCG  G+YALGAV A H  D +  
Sbjct  83    LRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHVTFLCGSGGVYALGAVVANHIXDYQRR  142

Query  671   HHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
               Y+  F E+     LPV  P+E        LLYGRAG+LWA  F+NK+LG+ T+ +  +
Sbjct  143   DMYLDLFLEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQTLPNDLI  201

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
               + N ++  GR  +  +N   PLMY W G RYWGAAHGLAGI+  L+   L  ++ EDV
Sbjct  202   MPVVNAVLAGGRAGAS-DNTTCPLMYRWHGTRYWGAAHGLAGILQVLLHFPLSEEDSEDV  260

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TLRYM  NRFP SGNYP+ EG+   D LV W HGA G+A+TL KA+++F  + EF  A
Sbjct  261   KGTLRYMRSNRFPHSGNYPSFEGNPR-DKLVQWSHGATGVAITLCKASQVFSRDREFRDA  319

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L
Sbjct  320   AIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKL  379

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +T G     +H +SLF+G+ G A L  DL  P  + FP YEL
Sbjct  380   VTVGHAGTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_010652678.1| PREDICTED: lanC-like protein GCL1 isoform X1 [Vitis vinifera]
Length=421

 Score =   350 bits (899),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 194/402 (48%), Positives = 252/402 (63%), Gaps = 24/402 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW--GARG-RRVTDYTLYTGALGTAFLL  490
             D  A  LSLP  T  K     A++LKD+VV  TW  G  G R+  D T++TG LGTAF  
Sbjct  27    DPTAANLSLPTETFLKA----AMSLKDQVVEATWKRGGEGWRKGIDPTVHTGLLGTAFAC  82

Query  491   LKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELL  670
             L++Y+ TG   DL LC +I+ +C   +   +  VTFLCG  G+YALGAV A H  D +  
Sbjct  83    LRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHVTFLCGSGGVYALGAVVANHIRDYQRR  142

Query  671   HHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
               Y+  F E+     LPV  P+E        LLYGRAG+LWA  F+NK+LG+ T+ +  +
Sbjct  143   DMYLDLFLEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQTLPNDLI  201

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
               + N ++  GR  +  +N   PLMY W G RYWGAAHGLAGI+  L+   L  ++ EDV
Sbjct  202   MPVVNAVLAGGRAGAS-DNTTCPLMYRWHGTRYWGAAHGLAGILQVLLHFPLSEEDSEDV  260

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TLRYM  NRFP SGNYP+ EG+   D LV W HGA G+A+TL KA+++F  + EF  A
Sbjct  261   KGTLRYMRSNRFPHSGNYPSFEGNPR-DKLVQWSHGATGVAITLCKASQVFSRDREFRDA  319

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L
Sbjct  320   AIEAGEVVWKNGLVKKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKL  379

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +T G     +H +SLF+G+ G A L  DL  P  + FP YEL
Sbjct  380   VTVGHAGTTEHAYSLFQGLAGTACLLFDLLSPENSRFPGYEL  421



>ref|XP_006466262.1| PREDICTED: lanC-like protein GCL1-like [Citrus sinensis]
Length=431

 Score =   351 bits (900),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 190/402 (47%), Positives = 250/402 (62%), Gaps = 33/402 (8%)
 Frame = +2

Query  338   LSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT----------DYTLYTGALGTAFL  487
             +SLP  T  K     A++LKD+VV  TW    RR++          D TLYTG LGTAF+
Sbjct  40    MSLPCETFLKA----AVSLKDQVVEVTW----RRLSGGGGEPGRGMDPTLYTGLLGTAFI  91

Query  488   LLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDEL  667
              L++Y++TGN  +L L  +II  C +    ++  VTFLCG+ GIYA+GAV A   GD   
Sbjct  92    CLRSYELTGNQQELLLSAEIIDTCASVVRDSTRHVTFLCGRGGIYAIGAVVANRMGDRSR  151

Query  668   LHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKGTVSSSHM  814
                ++  F EI     LP            +LLYGRAG+LWA  F+NK+LG GT+ +  +
Sbjct  152   RDFFLNLFLEIAQERALPAGPEEGGFGMSYDLLYGRAGFLWAALFVNKHLGAGTLPNELL  211

Query  815   RAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
               I + ++  GR      N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ EDV
Sbjct  212   MPIVDAVLAGGRA-GATANTACPLMYRWHGTRYWGAANGLAGILQVLLHFPLSEEDAEDV  270

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F S+ EF  A
Sbjct  271   KGTLRYMMSNRFPQSGNYPVSEGNPR-DKLVQWSHGATGVAITLCKASQVFPSDREFRDA  329

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G +GNAY FLSLYRLTG+  Y+ RA AF  FL+  A  L
Sbjct  330   AIEAGEVVWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNL  389

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +T G     DH +SLF+G+ G A ++ DL +P  A FP YEL
Sbjct  390   VTSGHAHGADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  431



>ref|XP_002319360.2| hypothetical protein POPTR_0013s13850g [Populus trichocarpa]
 gb|EEE95283.2| hypothetical protein POPTR_0013s13850g [Populus trichocarpa]
Length=286

 Score =   345 bits (885),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 175/303 (58%), Positives = 219/303 (72%), Gaps = 19/303 (6%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++PN M  F+ E    +QE      +DSL KLLS+P+ ++SK+ ++  L LK+ +V E
Sbjct  3     DRFFPNVMPRFVTED---IQEEDKVIDEDSLMKLLSMPYTSLSKQFQRSGLDLKETIVME  59

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
             TWG             G LGTA LL K+YQVTGN +DL LCL+I+KACD+A S AS  VT
Sbjct  60    TWG-------------GNLGTALLLYKSYQVTGNENDLFLCLEIVKACDSA-SRASRDVT  105

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLN  775
             F+CG+AG+ ALGAVAAKH  D+ L  +Y+++  EIKL  + PDELLYGR+G+LWAC FLN
Sbjct  106   FICGRAGVCALGAVAAKHVNDEALQSYYLSQLGEIKLLRNHPDELLYGRSGFLWACLFLN  165

Query  776   KNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYAL  955
             K+LG+GTV  + +RA+ANEIIK+GR L+K     SPLMYEW G RYWGA HGLAGIM  L
Sbjct  166   KHLGQGTVPDTTIRAVANEIIKNGRALAKKGG--SPLMYEWYGERYWGADHGLAGIMNVL  223

Query  956   MEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             ++VEL+PDE EDVK TL+YMI N FPSGNY  +E D + D LVHWCHG PGIALTL KA 
Sbjct  224   LDVELRPDEFEDVKGTLKYMINNCFPSGNYSTSEEDRKRDVLVHWCHGPPGIALTLVKAV  283

Query  1136  KIF  1144
             KI 
Sbjct  284   KIM  286



>gb|KDO60700.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=431

 Score =   349 bits (895),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 187/398 (47%), Positives = 247/398 (62%), Gaps = 25/398 (6%)
 Frame = +2

Query  338   LSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT------DYTLYTGALGTAFLLLKA  499
             +SLP  T  K     A++LKD+VV  TW              D TLYTG LGTAF+ L++
Sbjct  40    MSLPCETFLKA----AVSLKDQVVEVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRS  95

Query  500   YQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHY  679
             Y++TGN  +L L  +II  C +    ++  VTFLCG+ GIYA+GAV A   GD      +
Sbjct  96    YELTGNQQELLLSAEIIDTCASVVRDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFF  155

Query  680   ITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIA  826
             +  F EI     LP            +LLYGRAG+LWA  F+NK+LG GT+ +  +  I 
Sbjct  156   LNLFLEIAQERALPAGPEEGGFGMSYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIV  215

Query  827   NEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATL  1006
             + ++  GR      N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ EDVK TL
Sbjct  216   DAVLAGGRA-GATANTACPLMYRWHGTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTL  274

Query  1007  RYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDA  1180
             RYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F S+ EF  AA++A
Sbjct  275   RYMMSNRFPQSGNYPVSEGNPR-DKLVQWSHGATGVAITLCKASQVFPSDREFRDAAIEA  333

Query  1181  GEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDG  1360
             GEV+WK GL+K+VG+  G +GNAY FLSLYRLTG+  Y+ RA AF  FL+  A  L+T G
Sbjct  334   GEVLWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLVTSG  393

Query  1361  IMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               +  DH +SLF+G+ G A ++ DL +P  A FP YEL
Sbjct  394   HTRGADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  431



>ref|XP_006426333.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
 gb|ESR39573.1| hypothetical protein CICLE_v10025657mg [Citrus clementina]
Length=431

 Score =   348 bits (894),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 187/398 (47%), Positives = 247/398 (62%), Gaps = 25/398 (6%)
 Frame = +2

Query  338   LSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT------DYTLYTGALGTAFLLLKA  499
             +SLP  T  K     A++LKD+VV  TW              D TLYTG LGTAF+ L++
Sbjct  40    MSLPCETFLKA----AVSLKDQVVEVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRS  95

Query  500   YQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHY  679
             Y++TGN  +L L  +II  C +    ++  VTFLCG+ GIYA+GAV A   GD      +
Sbjct  96    YELTGNQQELLLSAEIIDTCASVVRDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFF  155

Query  680   ITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIA  826
             +  F EI     LP            +LLYGRAG+LWA  F+NK+LG GT+ +  +  I 
Sbjct  156   LNLFLEIAQERALPAGPEEGGFGMSYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIV  215

Query  827   NEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATL  1006
             + ++  GR      N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ EDVK TL
Sbjct  216   DAVLAGGRA-GATANTACPLMYRWHGTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTL  274

Query  1007  RYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDA  1180
             RYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F S+ EF  AA++A
Sbjct  275   RYMMSNRFPQSGNYPVSEGNPR-DKLVQWSHGATGVAITLCKASQVFPSDREFRDAAIEA  333

Query  1181  GEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDG  1360
             GEV+WK GL+K+VG+  G +GNAY FLSLYRLTG+  Y+ RA AF  FL+  A  L+T G
Sbjct  334   GEVLWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLVTSG  393

Query  1361  IMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               +  DH +SLF+G+ G A ++ DL +P  A FP YEL
Sbjct  394   HTRGADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  431



>ref|XP_010267103.1| PREDICTED: lanC-like protein GCL1 [Nelumbo nucifera]
Length=421

 Score =   348 bits (892),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 183/382 (48%), Positives = 244/382 (64%), Gaps = 19/382 (5%)
 Frame = +2

Query  377   QDALTLKDEVVRETWGARG---RRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQI  547
             Q A++LKD V+  TW  RG    +  D T+YTG LGTAF  L++YQ TG   DL LC +I
Sbjct  43    QAAISLKDRVIEATWKERGGLQLQSMDPTVYTGLLGTAFTCLRSYQATGCQSDLQLCAEI  102

Query  548   IKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIK----LP--  709
             +  C   A  +   +TFLCG  G+YALGAV A +  D +    Y+  F E+     LP  
Sbjct  103   VDTCAAVARSSKRHLTFLCGSGGVYALGAVVANYKDDCQRRDLYLDLFLEVAQDRALPSG  162

Query  710   -----VDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
                    +P EL YGRAG+LWA  F+N++LG+  V  + +  +   ++  GR  +  +N 
Sbjct  163   PEEGGFGMPYELHYGRAGFLWAALFINRHLGE-VVPKNLLMPVVEAVLAGGRAGAS-DNT  220

Query  875   KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPA  1051
               PLMY W G  YWGAAHGLAGI++ ++   L   + EDVK T RYM+KNRFP SGNYP+
Sbjct  221   ACPLMYRWHGTGYWGAAHGLAGILHVVLHFPLSRQDAEDVKDTFRYMMKNRFPRSGNYPS  280

Query  1052  AEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGIC  1228
             +EG+   DNLV W HGA G+A+TL  AA++F  + EF  AA++AGEVVWK GL+++VG+ 
Sbjct  281   SEGNPR-DNLVQWSHGATGMAITLCNAAQVFSCDREFRDAAIEAGEVVWKNGLVRKVGLS  339

Query  1229  HGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIG  1408
              G+SGNAY FLSLYRLTGK  Y  RA+AF  FL+  A  L+T G ++R DH +SLF+G+ 
Sbjct  340   DGVSGNAYAFLSLYRLTGKTIYQKRAEAFASFLYHNAGRLVTAGHVRRNDHAYSLFQGLA  399

Query  1409  GMAYLFLDLADPSKALFPAYEL  1474
             G+A L+ DL  P  + FP YEL
Sbjct  400   GVACLWFDLVSPENSRFPGYEL  421



>ref|XP_011022825.1| PREDICTED: lanC-like protein GCL1 [Populus euphratica]
Length=423

 Score =   345 bits (886),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/386 (49%), Positives = 255/386 (66%), Gaps = 21/386 (5%)
 Frame = +2

Query  371   LKQDALTLKDEVVRETWGARGRRV---TDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCL  541
             L + A++LKD+VV  TW  R   +    D T+YTG LGTAF  L++Y+V GN  DL LC 
Sbjct  41    LLKAAISLKDQVVAATW-KRDSNMGAGIDPTVYTGLLGTAFTCLRSYEVAGNEQDLLLCS  99

Query  542   QIIKACDTAASHASG--PVTFLCGQAGIYALGAVAAKHCGD----DELLHHYITKFKEIK  703
              I++ C  +A  +S    +TFLCG+ G+YALGAVAA + GD    D  L+ ++   +E  
Sbjct  100   NIVETCSVSALASSRQLTLTFLCGRGGLYALGAVAANYKGDQQGRDFFLNLFLELAQERA  159

Query  704   LPVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSK  862
             LPV        +  EL+YGRAG+LWA  F+NK+LG+GT+ S  +  + + ++  GR  + 
Sbjct  160   LPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLPSDLLLPVVDAVLAGGRAGAS  219

Query  863   LENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRF-PSG  1039
              +N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ EDVKATLRYM+ NRF  SG
Sbjct  220   -DNAACPLMYRWHGTRYWGAANGLAGILQVLLNFPLSKEDAEDVKATLRYMMSNRFCHSG  278

Query  1040  NYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKR  1216
             NYP++EG+   D LV W HGA G+A+TL KA+++F ++ EF  AA++AGEVVWK GL+K+
Sbjct  279   NYPSSEGNPR-DKLVQWSHGATGMAITLCKASEMFPNDREFRDAAIEAGEVVWKSGLVKK  337

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLF  1396
             VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L+T G  +  DH +SLF
Sbjct  338   VGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNASGLVTIGHARGADHAYSLF  397

Query  1397  EGIGGMAYLFLDLADPSKALFPAYEL  1474
             +G+ G A L+ DL  P  + FP YEL
Sbjct  398   QGLAGTACLWFDLLKPENSRFPGYEL  423



>ref|XP_002309963.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
 gb|EEE90413.2| hypothetical protein POPTR_0007s05070g [Populus trichocarpa]
Length=423

 Score =   345 bits (884),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 188/387 (49%), Positives = 254/387 (66%), Gaps = 23/387 (6%)
 Frame = +2

Query  371   LKQDALTLKDEVVRETWGARGRRV---TDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCL  541
             L + A++LKD+VV  TW  R   +    D T+YTG LGTAF  L++++VTGN  DL LC 
Sbjct  41    LLKAAISLKDQVVEATW-KRDSNMGAGIDPTVYTGLLGTAFTCLRSFEVTGNEQDLLLCS  99

Query  542   QIIKACDTAASHASG---PVTFLCGQAGIYALGAVAAKHCGD----DELLHHYITKFKEI  700
              I+  C  +A HAS     +TFLCG+ G+YALGAVAA + GD    D  L+ ++   +E 
Sbjct  100   NIVDTCSVSA-HASSRQMTLTFLCGKGGLYALGAVAANYKGDHQGRDFFLNLFLEVAQER  158

Query  701   KLPVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLS  859
              LPV        +  EL+YGRAG+LWA  F+NK+LG+GT+ S  +  + + ++  GR  +
Sbjct  159   ALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLPSDLLLPVVDAVLAGGRAGA  218

Query  860   KLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-S  1036
               +N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ EDVKATLRYM+ NRF  S
Sbjct  219   S-DNAACPLMYRWHGTRYWGAANGLAGILQVLLNFPLSKEDAEDVKATLRYMMSNRFRHS  277

Query  1037  GNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLK  1213
             GNYP++EG+   D LV W HGA G+ +TL KA+++F ++ EF  AA++AGEVVWK GL+K
Sbjct  278   GNYPSSEGNPR-DKLVQWSHGATGMVITLCKASEMFPNDREFRDAAIEAGEVVWKSGLVK  336

Query  1214  RVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSL  1393
             + G+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L+T G  +  DH +SL
Sbjct  337   KAGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNASGLVTIGHARGADHAYSL  396

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F+G+ G A L+ DL  P  + FP YEL
Sbjct  397   FQGLAGTACLWFDLLKPESSRFPGYEL  423



>ref|XP_004502406.1| PREDICTED: lanC-like protein 2-like [Cicer arietinum]
Length=412

 Score =   343 bits (881),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 191/394 (48%), Positives = 256/394 (65%), Gaps = 25/394 (6%)
 Frame = +2

Query  338   LSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGN  517
             LS+P  T  K     A++LKDEVV  +W  R   V D T+YTG LGTAF  L++Y+VTG 
Sbjct  29    LSVPSETFLKA----AISLKDEVVEVSWNRR--EVVDPTVYTGLLGTAFTCLRSYEVTGC  82

Query  518   NDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DELLHHYIT  685
             + DL LC +I+  C T A  +   VTFLCG+ G+YALGAV A + GD    D  L  ++ 
Sbjct  83    HKDLLLCSEIVDTCATLARASLRHVTFLCGRGGVYALGAVVANYMGDLNKRDLFLGLFVE  142

Query  686   KFKEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIK  841
               KE  LP+  P+E        LLYGRAG+LWA  F+NK+LG+ TV    + +I + ++ 
Sbjct  143   VAKERALPIG-PEEGGFGMSYDLLYGRAGFLWAALFVNKHLGEDTVPKDILMSIIDAVLA  201

Query  842   SGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMI  1018
              GR  +   ++K  PLMY W G RY GAA+G+AGI++ L+   L  ++ EDVK TLRY+I
Sbjct  202   GGR--AGASDIKDCPLMYRWHGTRYLGAANGVAGILHVLLHFPLPSEDAEDVKGTLRYLI  259

Query  1019  KNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVV  1192
               RFP SGNYP++EG+   D LV W HGA G+A+TL+KAA++F S+ E   AA++AGEVV
Sbjct  260   SKRFPHSGNYPSSEGNPR-DKLVQWGHGATGMAITLSKAAQVFPSDRELRDAAIEAGEVV  318

Query  1193  WKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQR  1372
             WK GL+K+VG+  G+SGNAY FLSLY+LT    Y+ RAK+F CFL+D A  L  +G    
Sbjct  319   WKNGLVKKVGLADGVSGNAYAFLSLYKLTKDAIYVERAKSFSCFLYDNARVLAAEGQDVM  378

Query  1373  GDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             G + +SLF G+ G A L+ DL  P+ + FP YEL
Sbjct  379   GANGYSLFHGLAGTACLWFDLLAPANSRFPGYEL  412



>gb|KDO60699.1| hypothetical protein CISIN_1g013959mg [Citrus sinensis]
Length=433

 Score =   343 bits (881),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 187/400 (47%), Positives = 247/400 (62%), Gaps = 27/400 (7%)
 Frame = +2

Query  338   LSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT------DYTLYTGALGTAFLLLKA  499
             +SLP  T  K     A++LKD+VV  TW              D TLYTG LGTAF+ L++
Sbjct  40    MSLPCETFLKA----AVSLKDQVVEVTWRRGSGGGGEPGRGMDPTLYTGLLGTAFICLRS  95

Query  500   YQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHY  679
             Y++TGN  +L L  +II  C +    ++  VTFLCG+ GIYA+GAV A   GD      +
Sbjct  96    YELTGNQQELLLSAEIIDTCASVVRDSTRHVTFLCGRGGIYAIGAVVANRMGDRSRRDFF  155

Query  680   ITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIA  826
             +  F EI     LP            +LLYGRAG+LWA  F+NK+LG GT+ +  +  I 
Sbjct  156   LNLFLEIAQERALPAGPEEGGFGMSYDLLYGRAGFLWAALFVNKHLGAGTLPNELLMPIV  215

Query  827   NEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATL  1006
             + ++  GR      N   PLMY W G RYWGAA+GLAGI+  L+   L  ++ EDVK TL
Sbjct  216   DAVLAGGRA-GATANTACPLMYRWHGTRYWGAANGLAGILQVLLHFPLSEEDAEDVKGTL  274

Query  1007  RYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKI--FESE-EFEQAAM  1174
             RYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++  F S+ EF  AA+
Sbjct  275   RYMMSNRFPQSGNYPVSEGNPR-DKLVQWSHGATGVAITLCKASQVSVFPSDREFRDAAI  333

Query  1175  DAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLIT  1354
             +AGEV+WK GL+K+VG+  G +GNAY FLSLYRLTG+  Y+ RA AF  FL+  A  L+T
Sbjct  334   EAGEVLWKNGLVKKVGLADGAAGNAYAFLSLYRLTGETIYVERANAFSSFLYHNAQNLVT  393

Query  1355  DGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              G  +  DH +SLF+G+ G A ++ DL +P  A FP YEL
Sbjct  394   SGHTRGADHGYSLFQGLAGTACIWFDLLEPVNARFPGYEL  433



>ref|XP_002531667.1| catalytic, putative [Ricinus communis]
 gb|EEF30711.1| catalytic, putative [Ricinus communis]
Length=432

 Score =   342 bits (878),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 193/403 (48%), Positives = 264/403 (66%), Gaps = 26/403 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGA-----RGRRVTDYTLYTGALGTAF  484
             D   K LSLP+ T        A++LKD+VV  TW        G  V D T+Y+G+LGTAF
Sbjct  38    DPTVKTLSLPNETFLGA----AISLKDQVVEMTWKVCGSTDTGITVVDPTVYSGSLGTAF  93

Query  485   LLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD--  658
             + L++Y+VTG++ D+ LC +I+ +C +AA  +S  VTFLCG+ G+YALGAV A   GD  
Sbjct  94    VCLRSYEVTGDDQDILLCSKIVDSCASAARASSRHVTFLCGRGGVYALGAVVANCQGDQR  153

Query  659   --DELLHHYITKFKEIKLPVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSSH  811
               D  L+ ++   +E  LPV        +  EL+YGRAG+LWA  F+NK+LG+GT+SS  
Sbjct  154   RRDFFLNLFLEVAQERALPVGPEEGGFGMSYELMYGRAGFLWAALFINKHLGEGTLSSDV  213

Query  812   MRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQED  991
             +  I + ++  GR  +   N   PLMY W G RYWGAA+GLAGI++ L+   L  ++ ED
Sbjct  214   LMPIVDAVLAGGRAGAS-NNPACPLMYRWHGTRYWGAANGLAGILHVLLHFPLSEEDSED  272

Query  992   VKATLRYMIKNRF-PSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQ  1165
             VK TLRYM+ NRF  SGNYP++EG+   D LV W HGA G+A+TL+KA+++F ++ EF  
Sbjct  273   VKGTLRYMMSNRFLHSGNYPSSEGNPR-DKLVQWSHGATGMAITLSKASEVFPNDREFRD  331

Query  1166  AAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHT  1345
             AA++AGEVVWK GL+K+VG+  G++GNAY FLSL+RLTG   Y  RAKAF  FL+  A  
Sbjct  332   AAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLFRLTGDIIYEERAKAFASFLYHNASE  391

Query  1346  LITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +I   +   GD  +SLF+G+ G A L+ DL  P K+ FP YEL
Sbjct  392   IINGHV--PGDDAYSLFKGLAGAACLWFDLLAPEKSRFPGYEL  432



>ref|XP_011100038.1| PREDICTED: lanC-like protein GCL1 [Sesamum indicum]
Length=427

 Score =   342 bits (876),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 181/378 (48%), Positives = 244/378 (65%), Gaps = 17/378 (4%)
 Frame = +2

Query  383   ALTLKDEVVRETWGARGRRVT-DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKAC  559
             A++LKD+VV  TWG RG + + D T+YTG +GTAF  L++Y+VTGN+ DL LC +I+ AC
Sbjct  53    AVSLKDKVVEVTWGRRGNKGSLDPTVYTGLMGTAFTCLRSYEVTGNHRDLQLCAEIVDAC  112

Query  560   DTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPD-----  724
               AA+H +  VTFLCG+ G+YALGA+ A +CGD +    ++ +F E+     LP      
Sbjct  113   -AAAAHTNRHVTFLCGRGGVYALGAITANYCGDQKKRDFFVDRFLEMAQERALPAGPEEG  171

Query  725   ------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPL  886
                   +LLYGRAG+LWA   +NK LG  T+++  +  +   ++  GR  +  +    PL
Sbjct  172   GFGMSYDLLYGRAGFLWAALLVNKYLGGETIANDLLMPVVQAVLAGGRAGAS-DVTACPL  230

Query  887   MYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGD  1063
             MY W G RYWGAAHGLAGI++ L+   L  D+ EDVK+TLRYM+ NRFP SGNYP +EG+
Sbjct  231   MYRWHGTRYWGAAHGLAGILHVLLHFPLSGDDIEDVKSTLRYMMSNRFPHSGNYPVSEGN  290

Query  1064  DEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGIS  1240
                D LV W HGA GIA+TL KA+++  S+ EF  AA++AGEVVWK GL+K+VG+  G +
Sbjct  291   PR-DRLVQWSHGASGIAVTLCKASEVLPSDREFRDAAIEAGEVVWKSGLVKKVGLADGTA  349

Query  1241  GNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAY  1420
             GNAY FLSL RLTG+  Y  RA AF  +L+  A   IT+      +H  SLF G+ G A 
Sbjct  350   GNAYAFLSLLRLTGESIYKERATAFASYLYHSATKTITENGSVGAEHACSLFHGLAGAAC  409

Query  1421  LFLDLADPSKALFPAYEL  1474
             L+ DL       FP YE+
Sbjct  410   LWFDLHRQEDTRFPGYEI  427



>ref|XP_008235076.1| PREDICTED: lanC-like protein GCL1 [Prunus mume]
Length=425

 Score =   339 bits (870),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 189/406 (47%), Positives = 249/406 (61%), Gaps = 27/406 (7%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW--------GARGRRVTDYTLYTGALG  475
             D  A   SLP  T  +     A++LKD+VV+ TW        G R   V D T+YTG LG
Sbjct  26    DPTAPNWSLPSETFLRA----AVSLKDQVVQGTWEGGGDSGSGPRTGMVLDPTVYTGLLG  81

Query  476   TAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCG  655
             TAF  L++Y+ TGN  DL L  +++  C T    ++  VTFLCG+ G+YA+GAV A   G
Sbjct  82    TAFTCLRSYEATGNRQDLVLSSEVVDKCVTVERASTRHVTFLCGRGGVYAIGAVVANLIG  141

Query  656   DDELLHHYITKFKEIKLPVDL---PDE--------LLYGRAGYLWACSFLNKNLGKGTVS  802
             D +    Y+  F E+     L   P+E        LL+GRAG+LWA  F+NK LG+  V 
Sbjct  142   DHQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSYDLLHGRAGFLWAALFINKYLGQEKVP  201

Query  803   SSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDE  982
             S  +  + + ++  GR  +  +N   PLMY W G RY GAA+GLAGI+  L+   L  ++
Sbjct  202   SDLLMPVVDAVLAGGRAGAS-DNPSCPLMYRWHGTRYLGAANGLAGILQVLLHFPLSKED  260

Query  983   QEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-E  1156
              EDVKATLRYM+ NRFP SGNYP++EG+   D  VHW HGA G+A+TL KA+++F  + E
Sbjct  261   AEDVKATLRYMMANRFPHSGNYPSSEGNPR-DKFVHWSHGAAGMAITLCKASQVFPGDRE  319

Query  1157  FEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR  1336
             F  AA++AGEVVWK GLLK+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  
Sbjct  320   FRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGETIYEGRAKAFASFLYHN  379

Query  1337  AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                L+T G     +H +SLF+G+ G A L  DL  P  A FP YEL
Sbjct  380   GRELVTVGDTHGAEHAYSLFQGLAGTACLLFDLHMPENARFPGYEL  425



>emb|CBG76444.1| OO_Ba0013J05-OO_Ba0033A15.31 [Oryza officinalis]
Length=1333

 Score =   360 bits (924),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 180/295 (61%), Positives = 221/295 (75%), Gaps = 15/295 (5%)
 Frame = +2

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSF  769
             VTF+CG+AG+ ALGAV AKH GD+  + HY++ FKEIK+   LPDELLYGRAGYLWAC+F
Sbjct  1054  VTFICGRAGVCALGAVVAKHAGDEAGVAHYLSAFKEIKIQSKLPDELLYGRAGYLWACTF  1113

Query  770   LNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMY  949
             LNK+LG+ TV  +    +  +II+ GR LS    +  PLMYEW G +YWGAAHGL+GIM+
Sbjct  1114  LNKHLGESTVPPTTTDTVMRDIIRDGRTLS---TIGCPLMYEWYGEKYWGAAHGLSGIMH  1170

Query  950   ALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTK  1129
              L++++L  D+ E VK TLRYMI+NRFPSGNYP  E +D  D LVHWCHGAPGI+LTLTK
Sbjct  1171  VLLDMDLTRDDIESVKGTLRYMIENRFPSGNYPTIE-EDNYDRLVHWCHGAPGISLTLTK  1229

Query  1130  AAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAK  1309
             A+++F  E F +A  +A EVVW RGLLKRVGICHG+SGNAY FL+L+RLT K+E+LYRAK
Sbjct  1230  ASQVFPEERFLEAVAEAAEVVWNRGLLKRVGICHGVSGNAYTFLALFRLTKKKEHLYRAK  1289

Query  1310  AFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                         LI DGIM  GD P+SLFEG  GMAYLFLD+ +P  + FP YEL
Sbjct  1290  -----------QLIADGIMHSGDKPYSLFEGQAGMAYLFLDMINPLDSRFPGYEL  1333



>ref|XP_003601926.1| G protein-coupled receptor-like protein [Medicago truncatula]
 gb|AES72177.1| G protein coupled receptor [Medicago truncatula]
Length=415

 Score =   338 bits (867),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 193/394 (49%), Positives = 251/394 (64%), Gaps = 25/394 (6%)
 Frame = +2

Query  338   LSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGN  517
             LSLP+ T  K     A++LKDEVV   W  R   V D T+YTG LGTAF  L++Y+VTG 
Sbjct  32    LSLPNETFLKA----AISLKDEVVEVNWNRR--EVIDPTVYTGLLGTAFTCLRSYEVTGC  85

Query  518   NDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DELLHHYIT  685
             + DL L  +II  C T A  +   VTFLCG+ G+YALGAV A + GD    D  L  ++ 
Sbjct  86    HKDLVLSSEIIDTCATVARDSLRHVTFLCGRGGLYALGAVVANYMGDLQKRDLFLGLFME  145

Query  686   KFKEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIK  841
                E  LPV  P+E        LLYGRAG+LWA  FLNK+LG+ TVS   +  I + ++ 
Sbjct  146   VANERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFLNKHLGEDTVSKDILMPIIDAVLA  204

Query  842   SGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMI  1018
              GR  +   ++K  PLMY W G RY GAA+GLAGI++ L+   L  +  EDVK TLRY+I
Sbjct  205   GGR--AGASDIKDCPLMYRWHGTRYLGAANGLAGILHVLIHFPLPSEYAEDVKGTLRYLI  262

Query  1019  KNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVV  1192
               RFP SGNYP++EG+   D LV W HGA G+A+TL+KAA++F ++ E   AA++AGEVV
Sbjct  263   SKRFPHSGNYPSSEGNPR-DKLVQWSHGATGMAITLSKAAQVFPNDRELRDAAIEAGEVV  321

Query  1193  WKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQR  1372
             WK GL+K+VG+  G+SGNAY FLSLY+LT    Y  RAK+F CFL+D A  L  +G +  
Sbjct  322   WKNGLVKKVGLADGVSGNAYAFLSLYKLTKDSIYEERAKSFSCFLYDNARALAVEGQVVA  381

Query  1373  GDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               + +SLF G+ G A L+ DL  P  + FP YEL
Sbjct  382   DGNGYSLFHGLAGTACLWFDLIAPDNSRFPGYEL  415



>ref|XP_007163665.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
 gb|ESW35659.1| hypothetical protein PHAVU_001G253500g [Phaseolus vulgaris]
Length=409

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 194/420 (46%), Positives = 264/420 (63%), Gaps = 33/420 (8%)
 Frame = +2

Query  278   TTTVVQ---EIAPHGTKDSLAKLLSLPHNTIS---KRLKQDALTLKDEVVRETWGARGRR  439
             T++VV+   E       D +A+ ++L    +S   +   + A +LKD+VV ETW  R  +
Sbjct  2     TSSVVEGGSEKPKRQPSDFIAETMNLTAENLSLTTETFFRAASSLKDKVVEETWNRR-DQ  60

Query  440   VTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGI  619
             V D T+Y+G LGTAF  L++YQVTG  +DL LC  I+  C TAA  +   VTFLCG  G+
Sbjct  61    VVDPTVYSGLLGTAFTCLRSYQVTGCRNDLLLCRDIVDTCVTAARASLRHVTFLCGSGGV  120

Query  620   YALGAVAAKHCGD----DELLHHYITKFKEIKLPVDLPDE--------LLYGRAGYLWAC  763
             Y+LGAV A + GD    D  L  +I   KE  LPV  P+E        LLYGRAG+LW  
Sbjct  121   YSLGAVVANYMGDLGKRDLFLALFIEVAKEKALPVG-PEEGGFGMSYDLLYGRAGFLWGA  179

Query  764   SFLNKNLGKGTVSSSHMRAIANEIIKSGRK-LSKLENLKSPLMYEWQGRRYWGAAHGLAG  940
              FLNK+LG+ +V    +  I + ++  GR   S ++N   PLMY W G RY GAA+GLAG
Sbjct  180   LFLNKHLGEESVPKDILIPIIDAVLAGGRAGASDIKN--CPLMYRWHGTRYLGAANGLAG  237

Query  941   IMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIAL  1117
             I++ L+   L  ++ EDVK TLRY++  RFP SGNYP++EG+   D LV W HGA G+A+
Sbjct  238   ILHVLLHFPLPTEDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPR-DKLVQWGHGATGMAI  296

Query  1118  TLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEY  1294
             TL+KAA++F ++ E   AA++AGEVVWK GL+K+VG+  G+SGNAY FLSLY+LT +  Y
Sbjct  297   TLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYQLTKESIY  356

Query  1295  LYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             L RAK+F  FL+D A +L          + +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  357   LERAKSFASFLYDNAKSLAP-------SNGYSLFQGLAGTACLWFDLHAPQNSRFPGYEL  409



>gb|KDP29724.1| hypothetical protein JCGZ_18659 [Jatropha curcas]
Length=422

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 186/399 (47%), Positives = 251/399 (63%), Gaps = 28/399 (7%)
 Frame = +2

Query  329   AKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRR----VTDYTLYTGALGTAFLLLK  496
             A  L LP  T  +     A++LK++VV  TW          V D T+Y+G LGTAF  L+
Sbjct  35    ASNLWLPKETFLRA----AISLKNKVVEMTWNGSCSTDRSAVVDSTVYSGLLGTAFTCLR  90

Query  497   AYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHH  676
             +Y+ TGN  DL  C +I+  C  AA  +S  VTFLCG+ GIYALGAV A + GD      
Sbjct  91    SYEFTGNQQDLLSCSEIVDTCAAAARASSRHVTFLCGRGGIYALGAVVANYKGDQHGRDS  150

Query  677   YITKFKEIK----LPVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             Y+  F E+     LP+        +  EL+YGRAG+LWA  F+NK LG+ T+ S  +  I
Sbjct  151   YLDLFLEVAHERALPIGPEEGGFGMSYELMYGRAGFLWAALFINKYLGEQTLPSEILLPI  210

Query  824   ANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKAT  1003
              + ++  GR  +  +N + PLMY W G RYWGAA+GLAGI+  L+  +L  ++ EDVKAT
Sbjct  211   VDAVLAGGRAGAS-DNPECPLMYRWHGTRYWGAANGLAGILQVLLHFQLSNEDAEDVKAT  269

Query  1004  LRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMD  1177
             LRYM+  RFP SGNYP++EG+   D LV W HGA  +A++L KA+++F ++ EF  AA++
Sbjct  270   LRYMMSKRFPRSGNYPSSEGNPR-DKLVQWSHGATAMAISLCKASQVFSNDREFRSAAIE  328

Query  1178  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITD  1357
             AGEVVWK GL+K+VG+  GI+GNAY FLSLYRLTG+  Y  RAKAF  FL+  A    T 
Sbjct  329   AGEVVWKSGLVKKVGLFDGIAGNAYAFLSLYRLTGESIYEERAKAFASFLYHNASKFSTG  388

Query  1358  GIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                   DH +SLF+G+ G+A L+ D+  P ++ FP YEL
Sbjct  389   -----ADHVYSLFQGLAGVACLWFDILAPERSRFPGYEL  422



>ref|XP_004288166.1| PREDICTED: lanC-like protein 2-like [Fragaria vesca subsp. vesca]
Length=427

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 253/424 (60%), Gaps = 36/424 (8%)
 Frame = +2

Query  251   NEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGAR  430
             NE   F+  TTT         T D     LSLP  T        A++LKD+VV+ TW   
Sbjct  24    NERLDFVRPTTT---------TPD-----LSLPGET----FLHAAVSLKDQVVKATWEGE  65

Query  431   GRRVT--DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLC  604
                    D  +YTG +GTAF  L++Y+ TGN  DL LC +I   C   A  ++  VTFLC
Sbjct  66    WSSGMGLDPNVYTGLMGTAFTCLRSYEATGNRQDLLLCAEIADKCAAVARVSARHVTFLC  125

Query  605   GQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDL---PDE--------LLYGRAGY  751
             G+ G+YALGAV A   GD +    Y+  F E+     L   P+E        LLYGRAG+
Sbjct  126   GRGGVYALGAVVANLVGDQQRRDLYLNLFLEVAQEKALSVGPEEGGFGMSYDLLYGRAGF  185

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHG  931
             LWA  F+NK+ G+  V S  +  I + ++  GR  +  +N   PLMY W G RY GAA+G
Sbjct  186   LWAALFINKHFGEDIVPSELLMPIVDAVLAGGRAGAS-DNPSCPLMYRWHGTRYLGAANG  244

Query  932   LAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPG  1108
             +AGI+  L+   L  ++ EDVK TLRYM+ NRFP SGNYP++EG+   D  V W HGA G
Sbjct  245   VAGILQVLLHFSLSDEDAEDVKGTLRYMMANRFPHSGNYPSSEGNPR-DKFVQWSHGAAG  303

Query  1109  IALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK  1285
             +A+TL KA+++F  + +F  AA++AGEVVWK GLLK+VG+  G++GNAY FLSLYRLTG+
Sbjct  304   MAITLCKASQVFSGDRDFRDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGE  363

Query  1286  EEYLYRAKAFGCFLHDRAHTLITDGIMQRG-DHPFSLFEGIGGMAYLFLDLADPSKALFP  1462
               Y  RAKAF  FL+  A  L+T G    G +H +SLF+G+ G A L+ D+  P  + FP
Sbjct  364   SIYEERAKAFASFLYHNARQLVTAGQTTHGAEHAYSLFQGLAGTACLWFDVHVPENSRFP  423

Query  1463  AYEL  1474
              YEL
Sbjct  424   GYEL  427



>ref|XP_008387575.1| PREDICTED: lanC-like protein GCL1 [Malus domestica]
Length=423

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 180/383 (47%), Positives = 242/383 (63%), Gaps = 21/383 (5%)
 Frame = +2

Query  383   ALTLKDEVVRETWGARGRR------VTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQ  544
             A+TLKD+VV+ TW  R         V D T+YTG LGTAF  L++Y+  GN  DL LC +
Sbjct  43    AVTLKDQVVQATWEGRQDSGTPTGMVLDPTVYTGLLGTAFTCLRSYEAAGNRQDLVLCAE  102

Query  545   IIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDL--  718
             I+  C   AS ++  VTFLCG+ G+YALGAV A   GD E  + Y+  F E+     L  
Sbjct  103   IVDKCRAVASASTRHVTFLCGRGGVYALGAVVANLIGDHERRNLYLNLFLEVAQEKALSV  162

Query  719   -PDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLEN  871
              P+E        LLYGRAG+LWA  F+NK LG+  + ++ +  + + ++  GR  S   N
Sbjct  163   GPEEGGFGMSYDLLYGRAGFLWAALFINKYLGQEKLPNNJLMPVVDAVLAGGRAGSS-HN  221

Query  872   LKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYP  1048
                PLM+ W G RY GAA+G+AGI+  L+   L  ++ +DVKATLRYM+ NRFP SGNYP
Sbjct  222   PSCPLMFRWHGTRYLGAANGVAGILQVLLHFPLCKEDADDVKATLRYMMANRFPHSGNYP  281

Query  1049  AAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGI  1225
             ++EG+   D  V W HGA G+A+TL KA+++F  + EF  AA++AGEVVWK GLLK+VG+
Sbjct  282   SSEGNPR-DKFVQWSHGAAGMAITLCKASQVFPGDREFRDAAIEAGEVVWKNGLLKKVGL  340

Query  1226  CHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGI  1405
               G++GNAY FLSLYRLTG+  Y  RA+AF  FL+  A    T G     ++ +SLF+G+
Sbjct  341   ADGVAGNAYAFLSLYRLTGESIYEERARAFASFLYHNAGEFATAGHTHGAEYAYSLFQGL  400

Query  1406  GGMAYLFLDLADPSKALFPAYEL  1474
              G A L+ DL  P  + FP YEL
Sbjct  401   AGTACLWFDLYIPENSRFPGYEL  423



>emb|CDY05791.1| BnaC07g00120D [Brassica napus]
Length=269

 Score =   326 bits (835),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 189/246 (77%), Gaps = 6/246 (2%)
 Frame = +2

Query  737   GRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYW  916
             GR GYLWAC F+NK +G  T+ S  +R +  EIIK GR ++K  N  SPLM++W G+RYW
Sbjct  30    GRVGYLWACLFVNKCVGAETLISV-LRQVTEEIIKEGRSMAK--NGNSPLMFQWYGQRYW  86

Query  917   GAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCH  1096
             GAAHGLAGIM+ LM+V+LKPD  EDV+ TL+Y+I NRFP+GNYPA+E D   D LVHWCH
Sbjct  87    GAAHGLAGIMHVLMDVQLKPDVAEDVRGTLKYIINNRFPNGNYPASEEDRRRDFLVHWCH  146

Query  1097  GAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRL  1276
             GAPG   TL KAA++F   EF +A   A EVVW RGLLK+VGICHGISGNAYV LSLYR 
Sbjct  147   GAPG---TLVKAAEVFGEREFLEAGEAAAEVVWNRGLLKQVGICHGISGNAYVSLSLYRA  203

Query  1277  TGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKAL  1456
             TG+ EYL++AKAF  FL D+ H L++ G M  GD P+SLFEG+GGMAYLFLD+ DPS+A 
Sbjct  204   TGRNEYLHQAKAFASFLLDKGHKLLSKGEMHGGDSPYSLFEGVGGMAYLFLDMVDPSQAR  263

Query  1457  FPAYEL  1474
             FP YEL
Sbjct  264   FPGYEL  269



>ref|XP_010025417.1| PREDICTED: lanC-like protein GCL1 [Eucalyptus grandis]
Length=430

 Score =   331 bits (849),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 190/399 (48%), Positives = 253/399 (63%), Gaps = 23/399 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKA  499
             D  A  LSLP  T  +     AL+LKD+VV+ TW   G    D T YTG LGTAFL L++
Sbjct  41    DPGAPDLSLPRETFLRA----ALSLKDQVVQATWREGG--AADPTAYTGLLGTAFLCLRS  94

Query  500   YQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DEL  667
             Y  TG+  DL L  +I+ AC +AA  ++  VTFLCG+ G++A+GAV A   GD    D  
Sbjct  95    YAATGDRGDLLLSAEIVDACASAARASTRHVTFLCGKGGVFAVGAVVANLLGDHHKRDFF  154

Query  668   LHHYITKFKEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             L+ ++   +E  LPV  P+E        LLYGRAG+LWA  FLNKNLG+ TV ++ +  I
Sbjct  155   LNLFLEVAQERALPVG-PEEGGFGMSYDLLYGRAGFLWAALFLNKNLGEETVPNNVLMPI  213

Query  824   ANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKAT  1003
              + ++  GR  +  +    PLMY W G RY GAA+GLAGI+  L+   L  +  EDVK T
Sbjct  214   VDAVLAGGRAGAS-DIATCPLMYRWHGTRYLGAANGLAGILQVLLHFPLCEEYLEDVKGT  272

Query  1004  LRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMD  1177
             LRY++  RFP SGNYP++EG+   D LV W HGA G+A+TL KA+++F  + +F  AA++
Sbjct  273   LRYIMSKRFPHSGNYPSSEGNPR-DKLVQWSHGATGMAITLCKASQVFPHDRDFRDAAIE  331

Query  1178  AGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITD  1357
             AGEVVWK GL+K+VG+  GISGNAY FLSLYRLTG+  Y  RA+AF  FL+  A+  +  
Sbjct  332   AGEVVWKNGLVKKVGLADGISGNAYAFLSLYRLTGERIYEDRARAFASFLYHDANKPVGT  391

Query  1358  GIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             G     D+ FSL++G+ G A L+ DL D   + FP YEL
Sbjct  392   GHGHVADYAFSLYQGLAGAACLWFDLVDAENSRFPGYEL  430



>emb|CBI33140.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   332 bits (852),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 197/448 (44%), Positives = 255/448 (57%), Gaps = 70/448 (16%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW--GARG-RRVTDYTLYTGALGTAFLL  490
             D  A  LSLP  T  K     A++LKD+VV  TW  G  G R+  D T++TG LGTAF  
Sbjct  27    DPTAANLSLPTETFLKA----AMSLKDQVVEATWKRGGEGWRKGIDPTVHTGLLGTAFAC  82

Query  491   LKAYQVTGNNDDLSLCLQIIKAC---------------DTAASHASGPV-----------  592
             L++Y+ TG   DL LC +I+ +C                +   +A G V           
Sbjct  83    LRSYESTGRQQDLLLCAEIVDSCAVTSREFTRHVTFLCGSGGVYALGAVVANHIRDYQRR  142

Query  593   --------------------TFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIK---  703
                                 TFLCG  G+YALGAV A H GD +    Y+  F E+    
Sbjct  143   DMYLDLFLEGCPYPFGITHVTFLCGSGGVYALGAVVANHIGDYQRRDMYLDLFLEVAQER  202

Query  704   -LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKL  856
              LPV  P+E        LLYGRAG+LWA  F+NK+LG+ T+ +  +  + N ++  GR  
Sbjct  203   ALPVG-PEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQTLPNDLIMPVVNAVLAGGRAG  261

Query  857   SKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-  1033
             +  +N   PLMY W G RYWGAAHGLAGI+  L+   L  ++ EDVK TLRYM  NRFP 
Sbjct  262   AS-DNTTCPLMYRWHGTRYWGAAHGLAGILQVLLHFPLSEEDSEDVKGTLRYMRSNRFPH  320

Query  1034  SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLL  1210
             SGNYP+ EG+   D LV W HGA G+A+TL KA+++F  + EF  AA++AGEVVWK GL+
Sbjct  321   SGNYPSFEGNPR-DKLVQWSHGATGVAITLCKASQVFSRDREFRDAAIEAGEVVWKNGLV  379

Query  1211  KRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFS  1390
             K+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A  L+T G     +H +S
Sbjct  380   KKVGLSDGVAGNAYAFLSLYRLTGEPVYEERAKAFASFLYHNAGKLVTVGHAGTTEHAYS  439

Query  1391  LFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             LF+G+ G A L  DL  P  + FP YEL
Sbjct  440   LFQGLAGTACLLFDLLSPENSRFPGYEL  467



>gb|EYU30985.1| hypothetical protein MIMGU_mgv1a006900mg [Erythranthe guttata]
Length=427

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/403 (46%), Positives = 252/403 (63%), Gaps = 25/403 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT-DYTLYTGALGTAFLLLK  496
             D  A  LSLP +   +     A++LKD+VV  TW  RG + + D T+YTG +GTAF  L+
Sbjct  32    DPTATNLSLPADAFLRA----AISLKDQVVEMTWRRRGGKGSLDPTVYTGLMGTAFTCLR  87

Query  497   AYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHH  676
             +Y+ TG++ DL LC +I+ AC  A   ++  VTFLCG+ G+YALGA+ A +CGD      
Sbjct  88    SYEATGDHRDLRLCAEIVDACAAATHISNRHVTFLCGRGGVYALGAITANYCGDQTKRDF  147

Query  677   YITKF----KEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLG-KGTVSSSHMR  817
             Y+ +F    +E  LPV  P+E        LLYGRAG+LWA SFLNK+ G +  + +  + 
Sbjct  148   YLDRFLEMAREKALPVG-PEEGGFGMSYDLLYGRAGFLWAASFLNKHFGGQEIIPNDVIT  206

Query  818   AIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVK  997
              + + ++  GR  + + N   PLMY W G  YWGAAHGLAGI++ L+   L+ D  EDVK
Sbjct  207   PVVDAVLAGGRAGASV-NTACPLMYRWHGTPYWGAAHGLAGILHVLLHFPLRGDHVEDVK  265

Query  998   ATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAA  1171
             ATLRYM+  R P SGNYP +EG    D LV W HGA G+A+TL KA+++F ++ EF  AA
Sbjct  266   ATLRYMMSKRDPQSGNYPVSEGHTR-DELVQWSHGAGGLAITLCKASQVFPNDREFRDAA  324

Query  1172  MDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLI  1351
             ++AGEVVWK GL+K+VG+  G +GNAY  LSL RLTG+  Y  RA++F  +L+  A  ++
Sbjct  325   IEAGEVVWKSGLVKKVGLADGTAGNAYALLSLLRLTGERVYEERAESFASYLYHSARKIM  384

Query  1352  TDGIMQRG--DHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               G       D  +SLF+G  G A LF DL  P  + FP YE+
Sbjct  385   AGGEYSGASEDLDYSLFQGFAGSACLFFDLLKPENSRFPGYEI  427



>ref|XP_008453808.1| PREDICTED: lanC-like protein GCL1 [Cucumis melo]
Length=419

 Score =   329 bits (843),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 178/392 (45%), Positives = 244/392 (62%), Gaps = 20/392 (5%)
 Frame = +2

Query  353   NTI---SKRLKQDALTLKDEVVRETWGARGRRV--TDYTLYTGALGTAFLLLKAYQVTGN  517
             NTI   S+     A++LK++VV  TW  RG      D T+Y G LGTA   L++Y+VTGN
Sbjct  30    NTILLPSQTFLSAAVSLKNQVVELTWKKRGNADIGVDPTVYNGLLGTAVTCLRSYEVTGN  89

Query  518   NDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKE  697
             + DL LC  I+  C  AA  +   +TFLCG+ G+YALGAV + +  D + L  +   F +
Sbjct  90    HQDLVLCSDIVDKCTVAARASHRHLTFLCGRGGVYALGAVVSHYMRDPQKLDFFFNLFLQ  149

Query  698   IKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKS  844
                   LP            +LLYGRAG+LWA  F+NK+LG+  +    + ++ + ++  
Sbjct  150   AAEEKALPSGPEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQRLPHDLLMSVIDAVLAG  209

Query  845   GRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKN  1024
             GR  +  +N   PLM+ W G RY+GAA+GLAGI+  L+   L  ++ +DVK TLRY++  
Sbjct  210   GRAGAS-DNPDCPLMFRWHGTRYYGAANGLAGILQVLLHFPLSKEDADDVKGTLRYLMSK  268

Query  1025  RFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIF-ESEEFEQAAMDAGEVVWK  1198
             RFP SGNYP++EG+   D LV W HGA GI +TL KA+++F E  EF  AA++AGEVVWK
Sbjct  269   RFPHSGNYPSSEGNPR-DKLVQWSHGATGIGITLCKASQVFHEDREFRDAAIEAGEVVWK  327

Query  1199  RGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGD  1378
              GL+K VG+  G+SGNAY FLSLYRLTG+  Y  RA+AFG +L+  A  L+ +     GD
Sbjct  328   NGLVKEVGLADGVSGNAYAFLSLYRLTGESVYEERARAFGTYLYHNASKLVANQNQVGGD  387

Query  1379  HPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
               FSLF G+ G A L+ DL +P K+ FP YEL
Sbjct  388   RLFSLFHGLAGTACLWFDLLEPEKSRFPGYEL  419



>gb|KFK28210.1| hypothetical protein AALP_AA8G486800 [Arabis alpina]
Length=425

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 184/409 (45%), Positives = 250/409 (61%), Gaps = 23/409 (6%)
 Frame = +2

Query  296   EIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGAR---GRRVTDYTLYTG  466
             E   +GT+ S   + SL   T  K     A  LKD+VV  TW AR      V D T+YTG
Sbjct  24    ETVVNGTEPSAPTISSLTTETFLKA----ATLLKDQVVEATWKARVPDSGLVLDPTVYTG  79

Query  467   ALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAK  646
              LGTAF  LK+Y++T N+ DL  C +II  C   A   +  VTFLCG+ G+YALGA+ A 
Sbjct  80    LLGTAFTCLKSYEITKNHQDLLTCAEIIDTCANVARATTRHVTFLCGRGGVYALGAIVAN  139

Query  647   HCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKG  793
             +  D   L  ++  F E+    +LP            +LLYGRAG+LWA  FLN+ LG+G
Sbjct  140   YTRDQPKLDFFLGLFLELAEERELPAGAEEGGFGMSYDLLYGRAGFLWAALFLNRYLGEG  199

Query  794   TVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELK  973
             TV    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI++ L+  +L 
Sbjct  200   TVPDHLLSPIVAAILSGGR-VGAADHAACPLLYRFHGTRFWGAANGLAGILHVLLHFKLS  258

Query  974   PDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFES  1150
              ++ +DV+ TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F  
Sbjct  259   EEDVKDVQGTLRYMMSNRFPKSGNYPCSEGNPR-DKLVQWAHGATGMAITLAKASQVFPK  317

Query  1151  E-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFL  1327
             E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  RAKAF  +L
Sbjct  318   ERDFREAAIEAGEVVWKNGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFAGYL  377

Query  1328  HDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                A  L+    ++ G H +SLF G+ G   L+ DL  P  + FP YE+
Sbjct  378   CRDARDLVNATRVEAG-HDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  425



>ref|XP_010937380.1| PREDICTED: lanC-like protein GCL1 [Elaeis guineensis]
Length=414

 Score =   328 bits (841),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 175/385 (45%), Positives = 248/385 (64%), Gaps = 16/385 (4%)
 Frame = +2

Query  362   SKRLKQDALTLKDEVVRETW-GARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLC  538
             S+   + A++LKD+V+  TW G+ G R  D T Y G LGTA   L+AY+VTG+  DL L 
Sbjct  32    SEAFLKAAISLKDQVLEATWKGSGGGRCIDPTAYVGLLGTAITCLRAYEVTGSPADLRLA  91

Query  539   LQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIK----L  706
              +I+  C  AA      VTFLCG+AG+Y LGAVAA +  D +    ++  F E+     L
Sbjct  92    AEIVDTCTAAARSYRRRVTFLCGRAGVYVLGAVAANYGEDTQRRKLFLDLFLEVAQERAL  151

Query  707   PVD-------LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKL  865
             P+        +P ELL+GRAG+L+A  F+NK+LG G++ +  +  +   ++  GR  +  
Sbjct  152   PIGPEEGGLGMPYELLHGRAGFLYAALFINKHLGPGSIPAELLDPVVEAVLAGGRAGAS-  210

Query  866   ENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGN  1042
             +N   PLMY W G R+WGAAHGLAGI++ L+   L   ++EDV+ T+RYM++NRF  SGN
Sbjct  211   DNPDCPLMYRWHGTRFWGAAHGLAGILHVLLHFRLNGSDREDVRKTVRYMVQNRFGHSGN  270

Query  1043  YPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRV  1219
             YP++EG+   D LV W HGA G+A+ L KAA++F  E EF  AA++AGEVVWKRG  ++V
Sbjct  271   YPSSEGNPR-DKLVQWSHGAGGVAIMLCKAAQVFPDEREFRDAAIEAGEVVWKRGSNQKV  329

Query  1220  GICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFE  1399
             G+  GI+GNAY FLSLY+LT ++ YL RA+AF   L+  A  L+    +  G++ +SLF+
Sbjct  330   GLADGIAGNAYAFLSLYQLTKEKVYLERAEAFAGSLYHNAFKLVARDQVNGGENTYSLFQ  389

Query  1400  GIGGMAYLFLDLADPSKALFPAYEL  1474
             G+ G+A L+ DL  P  A FP +EL
Sbjct  390   GLAGVACLWFDLMTPESASFPGFEL  414



>ref|XP_009365826.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 190/405 (47%), Positives = 246/405 (61%), Gaps = 27/405 (7%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW------GARGRRVTDYTLYTGALGTA  481
             D  A  LSLP  T        A+ LKD+VV+ TW      G     V D T+YTG LGTA
Sbjct  26    DPTAPNLSLPSGT----FLIAAVALKDQVVQATWEGGHGSGTPTGMVLDPTVYTGLLGTA  81

Query  482   FLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDD  661
             F  L++Y+ TGN  DL LC  I+  C   A  +S  VTFLCG+ G+YALGAV A   GD 
Sbjct  82    FTCLRSYEATGNRQDLLLCADIVHKCGAVAPASSRHVTFLCGRGGVYALGAVVASLIGDH  141

Query  662   ELLHHYITKFKEIKLPVDL---PDE--------LLYGRAGYLWACSFLNKNLGKGTVSSS  808
             E    Y+  F E+     L   P+E        LLYGRAG+LWA  F+NK LG   + S 
Sbjct  142   ERCGLYLNLFLEMAQEKALSVGPEEGGFGMSYDLLYGRAGFLWAALFINKYLGHDKLPSD  201

Query  809   HMRAIANEIIKSGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ  985
              +  +   ++  GR  +   ++ S PLMY W G RY GAA+G+AGI+  L+   L  ++ 
Sbjct  202   LLMPVVVAVLAGGR--AGASHIPSCPLMYRWHGTRYLGAANGMAGILQVLLHFPLCNEDA  259

Query  986   EDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EF  1159
             EDVKATLRYM+ NRFP SGNYP++EG+   D  V W HGA G+A+TL KA+++F  + EF
Sbjct  260   EDVKATLRYMMANRFPRSGNYPSSEGNPR-DKFVQWSHGAAGMAITLCKASQVFPGDREF  318

Query  1160  EQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRA  1339
               AA++AGEVVWK GLLK+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+ +A
Sbjct  319   RDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHKA  378

Query  1340  HTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                 T G     ++ +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  379   GEFSTAGRTHGVEYGYSLFQGLAGTACLWFDLHVPENSRFPGYEL  423



>ref|XP_003552029.2| PREDICTED: lanC-like protein GCL1-like [Glycine max]
Length=452

 Score =   328 bits (842),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 192/402 (48%), Positives = 254/402 (63%), Gaps = 29/402 (7%)
 Frame = +2

Query  314   TKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLL  493
             T +  A  LSLP  T  +     A++LKD+VV ETW  R  +V D T+YTG LGTAF  L
Sbjct  65    TMNLTAPNLSLPSET--ETFLSAAISLKDKVVEETWNRR-DQVVDPTVYTGLLGTAFTCL  121

Query  494   KAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----D  661
             ++YQVTG  +DL L  +II  C TAA  +   VTFLCG+ G+YALGAV A + GD    D
Sbjct  122   RSYQVTGCRNDLILSSEIIDTCVTAARASLRHVTFLCGRGGVYALGAVVANYMGDLQKRD  181

Query  662   ELLHHYITKFKEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMR  817
               L  +I   KE  LPV  P+E        LLYGRAG+LW   F+NK+LG+  V    + 
Sbjct  182   LFLGLFIEVAKERALPVG-PEEGGFGMSYDLLYGRAGFLWGALFVNKHLGEDAVPKDILM  240

Query  818   AIANEIIKSGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDV  994
              I + ++  GR  +   ++K  PLMY W G RY GAA+GLAGI++ L+   L  ++ EDV
Sbjct  241   LIIDAVLAGGR--AGASDIKDCPLMYRWHGTRYLGAANGLAGILHVLLHFPLPSEDAEDV  298

Query  995   KATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQA  1168
             K TL Y++  RFP SGNYP++EG+   D LV W HGA G+A+TL+KAA++F ++ E   A
Sbjct  299   KGTLWYLMSKRFPHSGNYPSSEGNPR-DKLVQWGHGATGMAITLSKAAEVFPNDRELRDA  357

Query  1169  AMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTL  1348
             A++AGEVVWK GL+K+VG+  G+SGNAY FLSLYRLT +  Y  RAK+F  FL+D A +L
Sbjct  358   AIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASFLYDNAKSL  417

Query  1349  ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                       + +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  418   AA-------ANGYSLFQGLAGTACLWFDLLAPDNSRFPGYEL  452



>ref|XP_009339587.1| PREDICTED: lanC-like protein GCL1 [Pyrus x bretschneideri]
Length=423

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 190/405 (47%), Positives = 246/405 (61%), Gaps = 27/405 (7%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW------GARGRRVTDYTLYTGALGTA  481
             D  A  LSLP  T        A+ LKD+VV+ TW      G     V D T+YTG LGTA
Sbjct  26    DPTAPNLSLPSGT----FLIAAVALKDQVVQATWEGGHGSGTPTGMVLDPTVYTGLLGTA  81

Query  482   FLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDD  661
             F  L++Y+ TGN  DL LC  I+  C   A  +S  VTFLCG+ G+YALGAV A   GD 
Sbjct  82    FTCLRSYEATGNRQDLLLCADIVHKCGAVAPASSRHVTFLCGRGGVYALGAVVASLIGDH  141

Query  662   ELLHHYITKFKEIKLPVDL---PDE--------LLYGRAGYLWACSFLNKNLGKGTVSSS  808
             E    Y+  F E+     L   P+E        LLYGRAG+LWA  F+NK LG   + S 
Sbjct  142   ERCGLYLNLFLEMAQEKALSVGPEEGGFGMSYDLLYGRAGFLWAALFINKYLGHDKLPSD  201

Query  809   HMRAIANEIIKSGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ  985
              +  +   ++  GR  +   ++ S PLMY W G RY GAA+G+AGI+  L+   L  ++ 
Sbjct  202   LLMPVVVAVLAGGR--AGASHIPSCPLMYRWHGTRYLGAANGMAGILQVLLHFPLCNEDA  259

Query  986   EDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EF  1159
             EDVKATLRYM+ NRFP SGNYP++EG+   D  V W HGA G+A+TL KA+++F  + EF
Sbjct  260   EDVKATLRYMMANRFPHSGNYPSSEGNPR-DKFVQWSHGAAGMAITLCKASQVFPGDREF  318

Query  1160  EQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRA  1339
               AA++AGEVVWK GLLK+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+ +A
Sbjct  319   RDAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYKERAKAFASFLYHKA  378

Query  1340  HTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                 T G     ++ +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  379   GEFSTAGRTHGVEYGYSLFQGLAGTACLWFDLHVPENSRFPGYEL  423



>ref|XP_010463250.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=435

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/412 (45%), Positives = 248/412 (60%), Gaps = 29/412 (7%)
 Frame = +2

Query  317   KDSLAKLLSLPHN-TIS---KRLKQDALTLKDEVVRETW---------GARGRRVTDYTL  457
             KD L   LS P   TIS   +   + A  LK++VV  TW         G  G  V D T+
Sbjct  27    KDELGHFLSEPSAPTISIPTESFLRAATLLKNQVVEATWKGGVEALAPGGSGP-VLDPTV  85

Query  458   YTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAV  637
             YTG LGTAF  LK+Y+VT N+ DL  C +II  C   A   +  VTFLCG+ G+YALGA+
Sbjct  86    YTGLLGTAFTCLKSYEVTRNHQDLLTCAEIIDRCANVARATTRHVTFLCGRGGVYALGAI  145

Query  638   AAKHCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNL  784
              A + GD     HY+  F E+    +LP            +LLYGRAG+LW   FLN+ L
Sbjct  146   VANYRGDQSKRDHYLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWGALFLNRYL  205

Query  785   GKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             G+GTV    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI+Y L+  
Sbjct  206   GEGTVPDHLLSPIVAAILAGGR-VGAADHEACPLLYRFHGTRFWGAANGLAGILYVLLHF  264

Query  965   ELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKI  1141
              L  ++ +DV+ TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++
Sbjct  265   PLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPR-DKLVQWAHGATGMAITLAKASQV  323

Query  1142  FESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG  1318
             F  E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  RAKAF 
Sbjct  324   FPRERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFA  383

Query  1319  CFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              +L   A  L+     +  +H +SLF G+ G   L+ DL  P  + FP YE+
Sbjct  384   SYLCHDARDLLDMSRQEEAEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  435



>gb|KHN44353.1| LanC-like protein 2 [Glycine soja]
Length=411

 Score =   326 bits (836),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 191/422 (45%), Positives = 260/422 (62%), Gaps = 35/422 (8%)
 Frame = +2

Query  278   TTTVVQ---EIAPHGTKDSLAKLLSLPHNTIS-----KRLKQDALTLKDEVVRETWGARG  433
             T++VV+   +   H   D + + ++LP   +S     +     A++LKD+VV ETW  R 
Sbjct  2     TSSVVEGGRDEGKHEPSDFITETMNLPSPNLSLPSETETFLSAAISLKDKVVEETWNRR-  60

Query  434   RRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQA  613
              +V D T+YTG LGTAF  L++YQVTG  +DL LC  II  C TAA  +   VTFLCG+ 
Sbjct  61    DQVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARASLRHVTFLCGRG  120

Query  614   GIYALGAVAAKHCGD----DELLHHYITKFKEIKLPVDLPDE--------LLYGRAGYLW  757
             G+YALGAV A +  D    D  L  +    KE  LPV  P+E        LLYGRAG+LW
Sbjct  121   GVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVG-PEEGGFGMSYDLLYGRAGFLW  179

Query  758   ACSFLNKNLGKGTVSSSHMRAIANEIIKSGRK-LSKLENLKSPLMYEWQGRRYWGAAHGL  934
                F+NK+LG   V    +  I + ++  GR   S +E+   PLMY W G RY GAA+GL
Sbjct  180   GALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVED--CPLMYRWHGTRYLGAANGL  237

Query  935   AGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGI  1111
             AGI++ L+   L  ++ EDVK TLRY++  RFP SGNYP++EG+   D LV W HGA G+
Sbjct  238   AGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPR-DKLVQWGHGATGM  296

Query  1112  ALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKE  1288
             A+TL+KAA++F ++ E   AA++AGEVVWK GL+K+VG+  G+SGNAY FLSLYRLT + 
Sbjct  297   AITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKES  356

Query  1289  EYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
              Y  RAK+F  F++D A +L +        + +SL +G+ G   L+ DL  P  + FP Y
Sbjct  357   IYEERAKSFASFMYDNAKSLAS-------ANGYSLSQGLAGTVCLWFDLLAPDSSRFPGY  409

Query  1469  EL  1474
             EL
Sbjct  410   EL  411



>ref|XP_004146876.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 ref|XP_004168242.1| PREDICTED: lanC-like protein 2-like [Cucumis sativus]
 gb|KGN53211.1| hypothetical protein Csa_4G026880 [Cucumis sativus]
Length=419

 Score =   326 bits (836),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 178/395 (45%), Positives = 244/395 (62%), Gaps = 22/395 (6%)
 Frame = +2

Query  347   PHNTI---SKRLKQDALTLKDEVVRETWGARGRRV--TDYTLYTGALGTAFLLLKAYQVT  511
             P NTI   S+     A++ K++VV  TW  RG      D T+Y G LGTA   L++Y+ T
Sbjct  28    PPNTILLPSQTFLSAAVSFKNQVVELTWKQRGNADIGVDPTVYNGLLGTAVTCLRSYEAT  87

Query  512   GNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKF  691
             GN+ DL LC  I+  C   A  +   +TFLCG+ G+YALGAV + +  D + L  +   F
Sbjct  88    GNHQDLVLCSDIVDKCTVLARASHRHLTFLCGRGGVYALGAVVSHYMRDPQKLDFFFNLF  147

Query  692   ----KEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEI  835
                 +E  LP+  P+E        LLYGRAG+LWA  F+NK+LG+  +    + ++ + +
Sbjct  148   LKAAEEKALPIG-PEEGGFGMSYDLLYGRAGFLWAALFINKHLGEQRIPHDLLMSVVDAV  206

Query  836   IKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYM  1015
             +  GR  +  +N   PLM+ W G RY+GAA+GLAGI+  L+   L  ++ +DVK TLRY+
Sbjct  207   LAGGRAGAS-DNPDCPLMFRWHGTRYYGAANGLAGILQVLLHFPLSKEDTDDVKGTLRYL  265

Query  1016  IKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIF-ESEEFEQAAMDAGEV  1189
             +  RFP SGNYP++EG    D LV W HGA GI +TL KA+++F E  EF  AA++AGEV
Sbjct  266   MSKRFPHSGNYPSSEGSPR-DKLVQWSHGATGIGITLCKASQVFHEDREFRDAAIEAGEV  324

Query  1190  VWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQ  1369
             VWK GL+K VG+  G++GNAY FLSLYRLTG+  Y  RA+AFG +L+  A  L+      
Sbjct  325   VWKNGLVKEVGLADGVAGNAYAFLSLYRLTGESVYEERARAFGTYLYHNASKLVATQNQV  384

Query  1370  RGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              GD  FSLF G+ G A L+ DL +P K+ FP YEL
Sbjct  385   GGDRLFSLFHGLAGTACLWFDLLEPEKSRFPGYEL  419



>ref|XP_008358138.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein GCL1 [Malus 
domestica]
Length=423

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 187/404 (46%), Positives = 243/404 (60%), Gaps = 25/404 (6%)
 Frame = +2

Query  320   DSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVT------DYTLYTGALGTA  481
             D  AK LSLP  T  +     A+ LKD+VV++TW       T      D T+YTG LGTA
Sbjct  26    DPAAKNLSLPSGTFLRA----AVALKDQVVQDTWEGGXGSGTPTXMVXDPTVYTGLLGTA  81

Query  482   FLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDD  661
             F  L++Y+ TGN  DL LC  I+  C      +S  VTFLCG+ G+YALGAV A   GD 
Sbjct  82    FTCLRSYEATGNRQDLLLCADIVDKCGAVXPASSRHVTFLCGRGGVYALGAVVACLMGDH  141

Query  662   ELLHHYITKFKEIKLPVDL---PDE--------LLYGRAGYLWACSFLNKNLGKGTVSSS  808
             E    Y   F E+     L   P+E        LLYGRAG LWA  F+NK LG+  + S 
Sbjct  142   ERCGLYFNLFLEVAQEKALSVGPEEGGFGMSYDLLYGRAGXLWAALFINKYLGQDKLPSD  201

Query  809   HMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQE  988
              +  + + ++  GR  +   +L  PLMY W G RY GAA+G+AGI+  L+   L  ++ E
Sbjct  202   LLXPVVDAVLAGGRAGAS-HDLSCPLMYRWHGTRYLGAANGVAGILQVLLHFPLCNEDAE  260

Query  989   DVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFE  1162
             DVKATLRYM+ NRFP SGNYP++EG+   D  V W HGA G+A+TL KA+++   + EF 
Sbjct  261   DVKATLRYMMANRFPHSGNYPSSEGNPR-DKFVQWSHGAAGMAITLCKASQVXPGDREFR  319

Query  1163  QAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAH  1342
              AA++AGEVVWK GLLK+VG+  G++GNAY FLSLYRLTG+  Y  RAKAF  FL+  A 
Sbjct  320   DAAIEAGEVVWKNGLLKKVGLADGVAGNAYAFLSLYRLTGESIYEERAKAFASFLYHXAG  379

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                  G     ++ +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  380   EFSIAGRTHGVEYVYSLFQGLAGTACLWFDLHVPENSRFPGYEL  423



>ref|XP_009150615.1| PREDICTED: lanC-like protein GCL1 [Brassica rapa]
Length=433

 Score =   325 bits (832),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 177/379 (47%), Positives = 238/379 (63%), Gaps = 18/379 (5%)
 Frame = +2

Query  383   ALTLKDEVVRETW--GARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKA  556
             A  LKD+VV  TW  G     V D T+YTG LGTAF  LK+Y+VT N+ DL  C  II  
Sbjct  58    ATLLKDQVVEATWKGGPDPGLVLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCADIIDT  117

Query  557   CDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPD----  724
             C   A   +  VTFLCG+ G+YALGA+ A + GD   L  ++  F E+    +LP     
Sbjct  118   CADVARATTRHVTFLCGRGGVYALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEE  177

Query  725   -------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSP  883
                    +LLYGRAG+LWA  FLN+ LG+GTV    +  I   I+  GR +   ++   P
Sbjct  178   GGFGMSYDLLYGRAGFLWAALFLNRYLGEGTVPDHLLSPIVAAILSGGR-VGAADHQACP  236

Query  884   LMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEG  1060
             L+Y + G R+WGAA+GLAGI++ L+   L  ++ +DV+ TLRYM+ NRFP SGNYP +EG
Sbjct  237   LLYRFHGTRFWGAANGLAGILHVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEG  296

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGI  1237
             +   D LV W HGA G+A+TL KA+++F  E +F +AA++AGEVVWK GL+K+VG+  G+
Sbjct  297   NPR-DKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGV  355

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMA  1417
             +GNAY FLSLYRLTG   Y  RAKAF  +L   A  L++   M   ++ +SLF G+ G A
Sbjct  356   AGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARELVS-ATMGEAEYDYSLFRGLAGPA  414

Query  1418  YLFLDLADPSKALFPAYEL  1474
              L+ DL  P  + FP YE+
Sbjct  415   CLWFDLVSPVDSKFPGYEI  433



>ref|XP_010680997.1| PREDICTED: lanC-like protein GCL1 [Beta vulgaris subsp. vulgaris]
Length=433

 Score =   324 bits (830),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 174/382 (46%), Positives = 242/382 (63%), Gaps = 19/382 (5%)
 Frame = +2

Query  377   QDALTLKDEVVRETWGARG--RRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
             Q A+TLK++VV  TW  +   R+  D T+YTG +GTAF    +YQ+T  + DL +C  I+
Sbjct  55    QAAVTLKNQVVEMTWKEKDKERQAIDPTVYTGLMGTAFTCFNSYQLTRCHQDLLMCADIV  114

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKF----KEIKLPVDL  718
             + C  A +H S  VTFL G+ GIYALGAV   H  D +   H++  F    +E  LPV  
Sbjct  115   RTC-AALAHTSRYVTFLSGRGGIYALGAVIMNHMEDHQSCSHFLDMFMKVAQEEALPVGP  173

Query  719   PD-------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLK  877
              D       +LL GRAG+LWA  F+ ++LG+  +SS  +  +   ++  GR  +  +N  
Sbjct  174   EDGGFGMSYDLLCGRAGFLWAALFIKRHLGEEALSSDLLTPVVEAMLAGGRAGAS-DNPS  232

Query  878   SPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAA  1054
              PLMY W G RY G+AHGLAGI++ L+   L  D+ EDVK TLRY++  RFP SGNYP++
Sbjct  233   CPLMYRWHGTRYLGSAHGLAGILHVLLHFPLSGDDSEDVKKTLRYLMSKRFPESGNYPSS  292

Query  1055  EGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICH  1231
             +G+   DNL+ W HGA G+A+TL KA+++F +E EF   A++AGEVVWK GL+K+ G+  
Sbjct  293   DGNPR-DNLIQWSHGATGVAITLCKASQVFPNEREFRDGAIEAGEVVWKSGLVKKAGLAD  351

Query  1232  GISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRG-DHPFSLFEGIG  1408
             G++GNAY FLSLY+LTG+  Y+ RAKAF  FL+ +   ++       G DH +SLF G+ 
Sbjct  352   GVAGNAYAFLSLYKLTGEVVYVERAKAFASFLYHKGSEVVNAEEYPGGTDHAYSLFLGLA  411

Query  1409  GMAYLFLDLADPSKALFPAYEL  1474
             G+A LF DL  P  + FP YEL
Sbjct  412   GVACLFFDLLHPENSKFPGYEL  433



>ref|XP_003538606.1| PREDICTED: lanC-like protein 2-like isoform X1 [Glycine max]
Length=412

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 190/423 (45%), Positives = 259/423 (61%), Gaps = 36/423 (9%)
 Frame = +2

Query  278   TTTVVQ---EIAPHGTKDSLAKLLSLPHNTIS------KRLKQDALTLKDEVVRETWGAR  430
             T++VV+   +   H   D + + ++L    +S      +     A++LKD+VV ETW  R
Sbjct  2     TSSVVEGGRDEGKHEPSDFITETMNLTSPNLSLLPSETETFLSAAISLKDKVVEETWNRR  61

Query  431   GRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQ  610
               +V D T+YTG LGTAF  L++YQVTG  +DL LC  II  C TAA  +   VTFLCG+
Sbjct  62    -DQVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARASLRHVTFLCGR  120

Query  611   AGIYALGAVAAKHCGD----DELLHHYITKFKEIKLPVDLPDE--------LLYGRAGYL  754
              G+YALGAV A +  D    D  L  +    KE  LPV  P+E        LLYGRAG+L
Sbjct  121   GGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVG-PEEGGFGMSYDLLYGRAGFL  179

Query  755   WACSFLNKNLGKGTVSSSHMRAIANEIIKSGRK-LSKLENLKSPLMYEWQGRRYWGAAHG  931
             W   F+NK+LG   V    +  I + ++  GR   S +E+   PLMY W G RY GAA+G
Sbjct  180   WGALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVED--CPLMYRWHGTRYLGAANG  237

Query  932   LAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPG  1108
             LAGI++ L+   L  ++ EDVK TLRY++  RFP SGNYP++EG+   D LV W HGA G
Sbjct  238   LAGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPR-DKLVQWGHGATG  296

Query  1109  IALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGK  1285
             +A+TL+KAA++F ++ E   AA++AGEVVWK GL+K+VG+  G+SGNAY FLSLYRLT +
Sbjct  297   MAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKE  356

Query  1286  EEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPA  1465
               Y  RAK+F  F++D A +L +        + +SL +G+ G   L+ DL  P  + FP 
Sbjct  357   SIYEERAKSFASFMYDNAKSLAS-------ANGYSLSQGLAGTVCLWFDLLAPDSSRFPG  409

Query  1466  YEL  1474
             YEL
Sbjct  410   YEL  412



>ref|XP_010519354.1| PREDICTED: lanC-like protein GCL1 [Tarenaya hassleriana]
Length=428

 Score =   323 bits (828),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 179/404 (44%), Positives = 240/404 (59%), Gaps = 28/404 (7%)
 Frame = +2

Query  314   TKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRR----VTDYTLYTGALGTA  481
             + D  A+ +S P  T  +     AL LKD+VV  TW   G      V D T YTG LGTA
Sbjct  36    SSDPTAQTISFPTETFLRA----ALLLKDQVVEATWKGGGSGSGAVVLDPTAYTGLLGTA  91

Query  482   FLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDD  661
             F  L++Y+VT N  DL  C +I+  C T A  ++  VTFLCG+ G+YALGAV   H GD 
Sbjct  92    FTCLRSYEVTRNRQDLLTCAEIVDTCATVARASTRHVTFLCGRGGVYALGAVVYNHIGDH  151

Query  662   ELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKGTVSSS  808
                  ++  F E+     LP            +LLYGRAG+LWA  FLN +LG G+V   
Sbjct  152   HKRDFFLGLFLELAEERALPAGPEEGGFGMSYDLLYGRAGFLWAALFLNHHLGHGSVPDD  211

Query  809   HMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQE  988
              +  I   ++  GR +   +N   PL+Y + G RYWGAA+GLAGI++  +   L  ++  
Sbjct  212   LLSPIVAAVVAGGR-VGAADNEACPLLYRFHGTRYWGAANGLAGILHVFLHFRLSEEDAN  270

Query  989   DVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFE  1162
             DVK TLRYM+ NRFP SGNYP +EG+   D LV W HGA  +A+TL+KA+++F +E EF 
Sbjct  271   DVKGTLRYMMSNRFPQSGNYPCSEGNPR-DKLVQWAHGATCMAITLSKASQVFPNEREFR  329

Query  1163  QAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAH  1342
              AA++AGEVVW  GL+K+VG+  G++GNAY FLSL+RLTG   Y  RA AF  +L   A 
Sbjct  330   DAAIEAGEVVWNNGLVKKVGLADGVAGNAYAFLSLFRLTGDRIYEERAIAFASYLCHNAR  389

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              L+     +  +H +SLF G+ G A L+ DL  P  + FP YE+
Sbjct  390   DLV-----ENSEHAYSLFRGLAGAACLWFDLVRPESSRFPGYEI  428



>ref|XP_006591491.1| PREDICTED: lanC-like protein 2-like isoform X2 [Glycine max]
 ref|XP_006591492.1| PREDICTED: lanC-like protein 2-like isoform X3 [Glycine max]
Length=413

 Score =   321 bits (822),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 191/424 (45%), Positives = 260/424 (61%), Gaps = 37/424 (9%)
 Frame = +2

Query  278   TTTVVQ---EIAPHGTKDSLAKLLSLPHNTIS------KRLKQDALTLKDEVVRETWGAR  430
             T++VV+   +   H   D + + ++L    +S      +     A++LKD+VV ETW  R
Sbjct  2     TSSVVEGGRDEGKHEPSDFITETMNLTSPNLSLLPSETETFLSAAISLKDKVVEETWNRR  61

Query  431   GRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHA-SGPVTFLCG  607
               +V D T+YTG LGTAF  L++YQVTG  +DL LC  II  C TAA  + S  VTFLCG
Sbjct  62    -DQVVDPTVYTGLLGTAFTCLRSYQVTGCRNDLILCSDIIDTCVTAARASLSRHVTFLCG  120

Query  608   QAGIYALGAVAAKHCGD----DELLHHYITKFKEIKLPVDLPDE--------LLYGRAGY  751
             + G+YALGAV A +  D    D  L  +    KE  LPV  P+E        LLYGRAG+
Sbjct  121   RGGVYALGAVVANYMEDLPKRDLFLGLFFEVAKERALPVG-PEEGGFGMSYDLLYGRAGF  179

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRK-LSKLENLKSPLMYEWQGRRYWGAAH  928
             LW   F+NK+LG   V    +  I + ++  GR   S +E+   PLMY W G RY GAA+
Sbjct  180   LWGALFVNKHLGDDAVPKDILMPIIDAVLAGGRAGASDVED--CPLMYRWHGTRYLGAAN  237

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAP  1105
             GLAGI++ L+   L  ++ EDVK TLRY++  RFP SGNYP++EG+   D LV W HGA 
Sbjct  238   GLAGILHVLLHFPLPREDAEDVKGTLRYLMSKRFPHSGNYPSSEGNPR-DKLVQWGHGAT  296

Query  1106  GIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTG  1282
             G+A+TL+KAA++F ++ E   AA++AGEVVWK GL+K+VG+  G+SGNAY FLSLYRLT 
Sbjct  297   GMAITLSKAAQVFPNDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTK  356

Query  1283  KEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFP  1462
             +  Y  RAK+F  F++D A +L +        + +SL +G+ G   L+ DL  P  + FP
Sbjct  357   ESIYEERAKSFASFMYDNAKSLAS-------ANGYSLSQGLAGTVCLWFDLLAPDSSRFP  409

Query  1463  AYEL  1474
              YEL
Sbjct  410   GYEL  413



>ref|XP_006280490.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
 gb|EOA13388.1| hypothetical protein CARUB_v10026430mg [Capsella rubella]
Length=435

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 184/418 (44%), Positives = 252/418 (60%), Gaps = 27/418 (6%)
 Frame = +2

Query  290   VQEIAPHGTKDSLAKLLSLPHNTI-SKRLKQDALTLKDEVVRETW---------GARGRR  439
             V E    G  D L    S P  ++ ++   + A  LK++VV  TW         G  G  
Sbjct  22    VGETVKTGELDHLHMEPSAPSISLPTESFLRAATLLKNQVVEATWKGGVESLSPGGSGA-  80

Query  440   VTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGI  619
             V D ++YTG LGTAF  LK+Y VT N+ DL  C +II  C   A   +  VTFLCG+ G+
Sbjct  81    VLDPSVYTGLLGTAFTCLKSYGVTRNHQDLLTCAEIIDTCVNVARATTRHVTFLCGRGGV  140

Query  620   YALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACS  766
             YALGA+ A + GD     H++  F E+    +LP            +LLYGRAG+LWA  
Sbjct  141   YALGAIVANYRGDLSKRDHFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWAAL  200

Query  767   FLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIM  946
             FLN+ LG+G+V    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI+
Sbjct  201   FLNRYLGEGSVPDHLLSPIVAAILAGGR-VGAADHEACPLLYRFHGTRFWGAANGLAGIL  259

Query  947   YALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTL  1123
             Y L+   L  ++ +DV+ TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL
Sbjct  260   YVLLHFSLSEEDAKDVQGTLRYMMSNRFPNSGNYPCSEGNPR-DKLVQWAHGATGMAVTL  318

Query  1124  TKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLY  1300
              KA+++F +E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  
Sbjct  319   AKASQVFPNERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEE  378

Query  1301  RAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             RAKAF  +L   A  L++    Q  +H +SLF G+ G   L+LDL  P  + FP YE+
Sbjct  379   RAKAFASYLCHDAVELVSM-TRQETEHDYSLFRGLAGPVCLWLDLVSPVDSKFPGYEI  435



>ref|XP_010444546.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=433

 Score =   320 bits (820),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 184/408 (45%), Positives = 246/408 (60%), Gaps = 27/408 (7%)
 Frame = +2

Query  317   KDSLAKLLSLPHN-TIS---KRLKQDALTLKDEVVRETW-------GARGRRVTDYTLYT  463
             KD L  LLS P   TIS   +   + A  LK++VV  TW             V D T+YT
Sbjct  27    KDELDHLLSEPSAPTISIPTESFLRAATLLKNQVVEATWKGGVEALAPGSGLVLDPTVYT  86

Query  464   GALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAA  643
             G LGTAF  LK+Y+VT N+ DL  C +II  C   A   +  VTFLCG+ G+YALGA+ A
Sbjct  87    GLLGTAFTCLKSYEVTRNHQDLLTCAEIIDRCANVARATTRHVTFLCGRGGVYALGAIVA  146

Query  644   KHCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGK  790
              + G+     H++  F E+    +LP            +LLYGRAG+LW   FLN+ LG+
Sbjct  147   NYRGNQSKRDHFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWGALFLNRYLGE  206

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVEL  970
             GTV    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI+Y L+   L
Sbjct  207   GTVPDHLLSPIVAAILAGGR-VGAADHEACPLLYRFHGTRFWGAANGLAGILYVLLHFPL  265

Query  971   KPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFE  1147
               ++ +DV+ TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F 
Sbjct  266   LEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPR-DKLVQWAHGATGMAITLAKASQVFP  324

Query  1148  SE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCF  1324
              E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  RAKAF  +
Sbjct  325   KERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASY  384

Query  1325  LHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAY  1468
             L   A  L+ D   Q  +H +SLF G+ G   L+ DL  P  + FP Y
Sbjct  385   LCHDARDLL-DMSRQEAEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGY  431



>ref|XP_006394052.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
 gb|ESQ31338.1| hypothetical protein EUTSA_v10004256mg [Eutrema salsugineum]
Length=433

 Score =   320 bits (819),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 182/381 (48%), Positives = 241/381 (63%), Gaps = 21/381 (6%)
 Frame = +2

Query  383   ALTLKDEVVRETW--GARGRR-VTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIK  553
             A  LKD+VV  TW  G  G   V D T+YTG LGTAF  LK+Y+VT N  DL  C +II+
Sbjct  57    ATLLKDKVVEATWKGGVPGPSLVLDPTVYTGLLGTAFTCLKSYEVTRNRQDLLTCAEIIE  116

Query  554   ACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD----DELLHHYITKFKEIKLPVDLP  721
              C   A   +  VTFLCG+ G+YALGA+ A + GD    D  L  ++   +E +LP   P
Sbjct  117   TCANVARATTRHVTFLCGRGGVYALGAIVANYRGDQSKRDLFLALFLELAEERELPAG-P  175

Query  722   DE--------LLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLK  877
             +E        LLYGRAG+LWA  FLN+ LG+GTV    +  I   I+  GR     ++  
Sbjct  176   EEGGFGMSYDLLYGRAGFLWAALFLNRYLGEGTVPDHLLSPIIAAILSGGRA-GAADHQA  234

Query  878   SPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAA  1054
              PL+Y + G R+WGAA+GLAGI++ L+   L  D+ EDV+ TLRYM+ NRFP SGNYP +
Sbjct  235   CPLLYRFHGTRFWGAANGLAGILHVLLHFPLSEDDVEDVQGTLRYMMSNRFPNSGNYPCS  294

Query  1055  EGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICH  1231
             EG+   D LV W HGA G+A+TL KA+++F  E +F +AA++AGEVVWK GL+K+VG+  
Sbjct  295   EGNPR-DKLVQWAHGATGMAITLAKASQVFPKEGDFREAAIEAGEVVWKSGLVKKVGLAD  353

Query  1232  GISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGG  1411
             G++GNAY FLSLYRLTG   Y  RAKAF  +L   A  L+ +  M+  +H +SLF G+ G
Sbjct  354   GVAGNAYAFLSLYRLTGDVVYEERAKAFASYLCCDARDLV-NATMEEAEHDYSLFRGLAG  412

Query  1412  MAYLFLDLADPSKALFPAYEL  1474
                L+ DL  P  + FP YE+
Sbjct  413   PVCLWFDLVSPVDSKFPGYEI  433



>gb|KCW89517.1| hypothetical protein EUGRSUZ_A01805 [Eucalyptus grandis]
Length=196

 Score =   311 bits (796),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 145/196 (74%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = +2

Query  887   MYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDD  1066
             M+EW G +YWGAAHGLAGIM+ LM +ELKPDE EDVK TL+YMI+NRFPSGNYP++E D 
Sbjct  1     MFEWYGEKYWGAAHGLAGIMHVLMHMELKPDEMEDVKGTLKYMIRNRFPSGNYPSSEEDR  60

Query  1067  EADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKRVGICHGISGN  1246
               D LVHWCHGAPGIALTL KAA++F  EEF +AA+DA EVVW RGLLKRVGICHGISGN
Sbjct  61    NRDVLVHWCHGAPGIALTLVKAAEVFRDEEFLRAAVDAAEVVWNRGLLKRVGICHGISGN  120

Query  1247  AYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLF  1426
              YVFLSLYR+TG  E+LYRAKAF CFL DRA  LI+ G M  GD+P+SLFEGIGG AYLF
Sbjct  121   VYVFLSLYRVTGNAEFLYRAKAFACFLLDRALKLISTGEMHGGDNPYSLFEGIGGTAYLF  180

Query  1427  LDLADPSKALFPAYEL  1474
             LD+ +PS A FPAYEL
Sbjct  181   LDMVEPSAARFPAYEL  196



>gb|ADU04150.1| hypothetical protein [Gossypium hirsutum]
Length=432

 Score =   319 bits (817),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 189/429 (44%), Positives = 257/429 (60%), Gaps = 36/429 (8%)
 Frame = +2

Query  284   TVVQEIAPHGTKDSLAKLLSL-PHNTISKRLKQD-----ALTLKDEVVRETW--------  421
             T  QE    G  + L   L++ P  + S  L  D     A+TLK++VV  TW        
Sbjct  8     TASQESHDEGKNERLDNFLNMDPTLSNSLSLSADTFLKAAMTLKNQVVEVTWKGRGSGGG  67

Query  422   -GARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTF  598
              G       D T+YTG LGTAF  L++Y+ TGN  DL L  +I+  C + A  +   VTF
Sbjct  68    GGGGLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLVLSAEIVDTCLSVARASPRHVTF  127

Query  599   LCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIK----LPVDLPDE--------LLYGR  742
             LCG+ G+Y+LGAV A + GD + L  ++  F E+     LPV  P+E        LLYGR
Sbjct  128   LCGRGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVG-PEEGGFGMSYDLLYGR  186

Query  743   AGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKS-PLMYEWQGRRYWG  919
             AG+LWA  FLNK+L    V +  +  I + ++ +GR  +   +L + PLMY W G RYWG
Sbjct  187   AGFLWAALFLNKHLQGEVVPNDVLMPIVDAVLAAGR--TGASDLPACPLMYRWHGTRYWG  244

Query  920   AAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCH  1096
             AA+GLAGI++ L+   L      +VK TLR+M+ NRFP SGNYP++EG+   D LV W H
Sbjct  245   AANGLAGILHVLLHFPLSEGYAGEVKGTLRHMMCNRFPHSGNYPSSEGNPR-DKLVQWSH  303

Query  1097  GAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYR  1273
             GA  +A+TL KA++++ ++ EF  AA++AGEVVWK GL+K+VG+  GI+GN Y FLSLYR
Sbjct  304   GATSMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTYAFLSLYR  363

Query  1274  LTGKEEYLYRAKAFGCFLHDRAHTL--ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPS  1447
             LTG+  Y YRAKAF  FL+     L  I  G   R +  +SLF+G+ G A L+ D+  P 
Sbjct  364   LTGETIYKYRAKAFASFLYHNKRKLAGIEHGGGFRANDEYSLFQGLAGTACLWFDMLAPH  423

Query  1448  KALFPAYEL  1474
             K+ FP YEL
Sbjct  424   KSKFPGYEL  432



>ref|XP_010484384.1| PREDICTED: lanC-like protein GCL1 [Camelina sativa]
Length=434

 Score =   319 bits (817),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 184/411 (45%), Positives = 248/411 (60%), Gaps = 28/411 (7%)
 Frame = +2

Query  317   KDSLAKLLSLPHN-TIS---KRLKQDALTLKDEVVRETWG--------ARGRRVTDYTLY  460
             KD L  LLS P   TIS   +   + A  LK++VV  TW         A    V D T+Y
Sbjct  27    KDELDHLLSKPSAPTISIPTESFLRAATLLKNQVVEATWKGGVEALAPAGSGPVLDPTVY  86

Query  461   TGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVA  640
             TG LGTAF  LK+Y+VT N+ DL  C +II  C   A   +  VTFLCG+ G+YALGA+ 
Sbjct  87    TGLLGTAFTCLKSYEVTMNHQDLLTCAEIIDRCANVARATTRHVTFLCGRGGVYALGAIV  146

Query  641   AKHCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLG  787
             A + G+     +++  F E+     LP            +LLYGRAG+LW   FLN+ LG
Sbjct  147   ANYRGNQSKRDYFLGLFLELAEERALPAGPEEGGFGMSYDLLYGRAGFLWGALFLNRYLG  206

Query  788   KGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVE  967
             +GTV    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI+Y L+   
Sbjct  207   EGTVPDPLLSPIVAAILAGGR-VGAADHEACPLLYRFHGTRFWGAANGLAGILYVLLHFP  265

Query  968   LKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIF  1144
             L  ++ +DV+ TLRYM+ NRFP SGNYP +EG+   + LV W HGA G+A+TL KA+++F
Sbjct  266   LWEEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPR-NKLVQWAHGATGMAITLAKASQVF  324

Query  1145  ESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGC  1321
               E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  RAKAF  
Sbjct  325   PKERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFAS  384

Query  1322  FLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             +L   A  L+ D   Q  +H +SLF G+ G   L+ DL  P  + FP YE+
Sbjct  385   YLCHDARDLL-DMSRQEAEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  434



>emb|CDY08803.1| BnaA06g24210D [Brassica napus]
Length=430

 Score =   318 bits (816),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 177/379 (47%), Positives = 236/379 (62%), Gaps = 21/379 (6%)
 Frame = +2

Query  383   ALTLKDEVVRETW--GARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKA  556
             A  LKD+VV  TW  G     V D T+YTG LGTAF  LK+Y+VT N+ DL  C  II  
Sbjct  58    ATLLKDQVVEATWKGGPDPGLVLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCADIIDT  117

Query  557   CDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPD----  724
             C   A   +  VTFLCG+ G+YALGA+ A + GD   L  ++  F E+    +LP     
Sbjct  118   CADVARATTRHVTFLCGRGGVYALGAIVASYSGDQSKLDLFLGLFLELAEERELPAGPEE  177

Query  725   -------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSP  883
                    +LLYGRAG+LWA  FLN+ LG+GTV    +  I   I+  GR +   ++   P
Sbjct  178   GGFGMSYDLLYGRAGFLWAALFLNRYLGEGTVPDHLLSPIVAAILSGGR-VGAADHQACP  236

Query  884   LMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEG  1060
             L +   G R+WGAA+GLAGI++ L+   L  ++ +DV+ TLRYM+ NRFP SGNYP +EG
Sbjct  237   LFH---GTRFWGAANGLAGILHVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNYPCSEG  293

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGI  1237
             +   D LV W HGA G+A+TL KA+++F  E +F +AA++AGEVVWK GL+K+VG+  G+
Sbjct  294   NPR-DKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVGLADGV  352

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMA  1417
             +GNAY FLSLYRLTG   Y  RAKAF  +L   A  L++   M   +H +SLF G+ G A
Sbjct  353   AGNAYAFLSLYRLTGDVVYEERAKAFASYLCHDARELVS-ATMGEAEHDYSLFRGLAGPA  411

Query  1418  YLFLDLADPSKALFPAYEL  1474
              L+ DL  P  + FP YE+
Sbjct  412   CLWFDLVSPVDSKFPGYEI  430



>gb|KHG19988.1| LanC-like protein 2 [Gossypium arboreum]
Length=432

 Score =   318 bits (814),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 186/410 (45%), Positives = 251/410 (61%), Gaps = 34/410 (8%)
 Frame = +2

Query  323   SLAKLLSLPHNTISKRLKQDALTLKDEVVRETW---------GARGRRVTDYTLYTGALG  475
             +L+  LSL  +T  K     A+TLK++VV  TW         G       D T+YTG LG
Sbjct  31    TLSNSLSLSADTFLKA----AMTLKNQVVEVTWKGRGSGGGGGGGLGTGIDPTVYTGLLG  86

Query  476   TAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCG  655
             TAF  L++Y+ TGN  DL L  +I+  C + A  +   VTFLCG+ G+Y+LGAV A + G
Sbjct  87    TAFTCLRSYEATGNRQDLVLSAEIVDTCLSVARASPRHVTFLCGRGGVYSLGAVVANYMG  146

Query  656   DDELLHHYITKFKEIK----LPVDLPDE--------LLYGRAGYLWACSFLNKNLGKGTV  799
             D + L  ++  F E+     LPV  P+E        LLYGRAG+LWA  FLNK+L    V
Sbjct  147   DHQRLEFFLNLFIEVAQEKALPVG-PEEGGFGMSYDLLYGRAGFLWAALFLNKHLQGEVV  205

Query  800   SSSHMRAIANEIIKSGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVELKP  976
              +  +  I + ++ +GR  +   +L + PLMY W G RYWGAA+GLAGI++ L+   L  
Sbjct  206   PNDVLMPIVDAVLAAGR--TGASDLPACPLMYRWHGTRYWGAANGLAGILHVLLHFPLSE  263

Query  977   DEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE  1153
                 DVK TLR+M+ NRFP SGNYP++EG+   D LV W HGA  +A+TL KA++++ ++
Sbjct  264   GYAGDVKGTLRHMMCNRFPHSGNYPSSEGNPR-DKLVQWSHGATSMAITLAKASQVYPND  322

Query  1154  -EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLH  1330
              EF  AA++AGEVVWK GL+K+VG+  GI+GN Y FLSLYRLTG+  Y  RAKAF  FL+
Sbjct  323   REFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTGETIYKDRAKAFASFLY  382

Query  1331  DRAHTL--ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                  L  I  G   R D  +SLF+G+ G A L+ D+  P K+ FP YEL
Sbjct  383   HNKRKLAGIEHGGGFRADDEYSLFQGLAGTACLWFDMLAPHKSKFPGYEL  432



>ref|XP_002866662.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42921.1| hypothetical protein ARALYDRAFT_358729 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   316 bits (810),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 173/384 (45%), Positives = 234/384 (61%), Gaps = 23/384 (6%)
 Frame = +2

Query  383   ALTLKDEVVRETW-------GARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCL  541
             A  LK++VV   W             V D T+YTG LGTAF  LK+Y+VT N+ DL  C 
Sbjct  54    ATLLKNQVVEAMWKGVVDVLAPGSSPVLDPTVYTGLLGTAFTCLKSYEVTRNHQDLLTCA  113

Query  542   QIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLP  721
             +II  C   A   +  VTFLCG+ G+Y LGA+ A + GD      ++  F E+    +LP
Sbjct  114   EIIDTCANVARATTRHVTFLCGRGGVYTLGAIVANYRGDQSKRDFFLGLFLELAEARELP  173

Query  722   D-----------ELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLE  868
                         +LLYGRAG+LWA  FLN+ LG+GTV    +  I   I+  GR +   +
Sbjct  174   AGPEEGGFGMSYDLLYGRAGFLWAALFLNRYLGQGTVPDHLLSPIVAAILAGGR-VGAAD  232

Query  869   NLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNY  1045
             +   PL+Y + G R+WGAA+GLAGI+Y L+   L  ++ +DV+ TLRYM+ NRFP SGNY
Sbjct  233   HEACPLLYRFHGTRFWGAANGLAGILYVLLHFPLSEEDVKDVQGTLRYMMSNRFPNSGNY  292

Query  1046  PAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVG  1222
             P +EG+   D LV W HGA G+A+TL KA+++F  E +F +AA++AGEVVWK GL+K+VG
Sbjct  293   PCSEGNPR-DKLVQWAHGATGMAITLAKASQVFPKERDFREAAIEAGEVVWKSGLVKKVG  351

Query  1223  ICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEG  1402
             +  G++GNAY FLSLYRLTG   Y  RAKAF  +L   A  L+ +   Q  +H +SLF G
Sbjct  352   LADGVAGNAYAFLSLYRLTGDVLYEERAKAFASYLCHDARDLM-NMTRQEAEHDYSLFRG  410

Query  1403  IGGMAYLFLDLADPSKALFPAYEL  1474
             + G   L+ DL  P  + FP YE+
Sbjct  411   LAGPVCLWFDLVSPVDSRFPGYEI  434



>ref|NP_201331.1| protein GCR2-like 1 [Arabidopsis thaliana]
 sp|Q9FJN7.1|GCL1_ARATH RecName: Full=LanC-like protein GCL1; AltName: Full=G protein-coupled 
receptor 2-like protein 1; Short=Protein GCR2-like 
1 [Arabidopsis thaliana]
 dbj|BAB11664.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAL24184.1| AT5g65280/MQN23_23 [Arabidopsis thaliana]
 gb|AED98033.1| protein GCR2-like 1 [Arabidopsis thaliana]
Length=433

 Score =   316 bits (810),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 178/409 (44%), Positives = 245/409 (60%), Gaps = 27/409 (7%)
 Frame = +2

Query  308   HGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW-------GARGRRVTDYTLYTG  466
             H   +  A  +SLP    ++   + A  LK++VV  TW        +    V D T+YTG
Sbjct  32    HLLSEPSAPTISLP----TESFLRAATLLKNQVVEATWKGGVEALASGSGPVLDPTVYTG  87

Query  467   ALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAK  646
              LGTAF  LK+Y+VT N+ DL  C +II  C   A   +  VTFLCG+ G+  LGA+ A 
Sbjct  88    LLGTAFTCLKSYEVTRNHQDLLTCAEIIDTCANVARATTRHVTFLCGRGGVCTLGAIVAN  147

Query  647   HCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKG  793
             + GD      ++  F E+    +LP            +LLYGRAG+LWA  FLN+ LG+G
Sbjct  148   YRGDQSKRDFFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWAALFLNRYLGQG  207

Query  794   TVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELK  973
             TV    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI+Y L+   L 
Sbjct  208   TVPDHLLSPIVAAILAGGR-VGAADHEACPLLYRFHGTRFWGAANGLAGILYVLLHFPLS  266

Query  974   PDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFES  1150
              ++ +DV+ TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F  
Sbjct  267   EEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPR-DKLVQWAHGATGMAITLAKASQVFPK  325

Query  1151  E-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFL  1327
             E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  RAKAF  +L
Sbjct  326   ERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYL  385

Query  1328  HDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                A  L+ +   Q  +H +SLF G+ G   L+ DL  P  + FP YE+
Sbjct  386   CRDAIELV-NMTSQETEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  433



>gb|AAK96841.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
 gb|AAM91135.1| G protein-coupled receptor-like protein [Arabidopsis thaliana]
Length=433

 Score =   316 bits (809),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 178/409 (44%), Positives = 245/409 (60%), Gaps = 27/409 (7%)
 Frame = +2

Query  308   HGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETW-------GARGRRVTDYTLYTG  466
             H   +  A  +SLP    ++   + A  LK++VV  TW        +    V D T+YTG
Sbjct  32    HLLSEPSAPTISLP----TESFLRAATLLKNQVVEATWKGGVEALASGSGPVLDPTVYTG  87

Query  467   ALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAK  646
              LGTAF  LK+Y+VT N+ DL  C +II  C   A   +  VTFLCG+ G+  LGA+ A 
Sbjct  88    LLGTAFTCLKSYEVTRNHQDLLTCAEIIDTCANVARATTRHVTFLCGRGGVCTLGAIVAN  147

Query  647   HCGDDELLHHYITKFKEIKLPVDLPD-----------ELLYGRAGYLWACSFLNKNLGKG  793
             + GD      ++  F E+    +LP            +LLYGRAG+LWA  FLN+ LG+G
Sbjct  148   YRGDQSKRDFFLGLFLELAEERELPAGPEEGGFGMSYDLLYGRAGFLWAALFLNRYLGQG  207

Query  794   TVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELK  973
             TV    +  I   I+  GR +   ++   PL+Y + G R+WGAA+GLAGI+Y L+   L 
Sbjct  208   TVPDHLLSPIVAAILAGGR-VGAADHEACPLLYRFHGTRFWGAANGLAGILYVLLHFPLS  266

Query  974   PDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFES  1150
              ++ +DV+ TLRYM+ NRFP SGNYP +EG+   D LV W HGA G+A+TL KA+++F  
Sbjct  267   EEDVKDVQGTLRYMMSNRFPNSGNYPCSEGNPR-DKLVQWAHGATGMAITLAKASQVFPK  325

Query  1151  E-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFL  1327
             E +F +AA++AGEVVWK GL+K+VG+  G++GNAY FLSLYRLTG   Y  RAKAF  +L
Sbjct  326   ERDFREAAIEAGEVVWKSGLVKKVGLADGVAGNAYAFLSLYRLTGDVVYEERAKAFASYL  385

Query  1328  HDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                A  L+ +   Q  +H +SLF G+ G   L+ DL  P  + FP YE+
Sbjct  386   CRDAIELV-NMTSQETEHDYSLFRGLAGPVCLWFDLVSPVDSKFPGYEI  433



>gb|ADU04157.1| hypothetical protein [Gossypium hirsutum]
Length=429

 Score =   314 bits (805),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 188/426 (44%), Positives = 254/426 (60%), Gaps = 33/426 (8%)
 Frame = +2

Query  284   TVVQEIAPHGTKDSLAKLLSLP---HNTIS---KRLKQDALTLKDEVVRETW------GA  427
             T  QE    G  + L   L++     NT+S       + A+ LK++VV+ TW      G 
Sbjct  8     TASQESHEEGKNERLDNFLNMDPTLSNTLSLSADTFLKAAMALKNQVVQVTWKGRGSGGG  67

Query  428   RGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCG  607
                   D T+YTG LGTAF  L++Y+ TGN  DL L  +I+  C + A  +   VTFLCG
Sbjct  68    GLGTGIDPTVYTGLLGTAFTCLRSYEATGNRQDLLLSAEIVDTCLSVARASPRHVTFLCG  127

Query  608   QAGIYALGAVAAKHCGDDELLHHYITKFKEIK----LPVDLPDE--------LLYGRAGY  751
             + G+Y+LGAV A + GD + L  ++  F E+     LPV  P+E        LLYGRAG+
Sbjct  128   RGGVYSLGAVVANYMGDHQRLEFFLNLFIEVAQEKALPVG-PEEGGFGMSYDLLYGRAGF  186

Query  752   LWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRK-LSKLENLKSPLMYEWQGRRYWGAAH  928
             LWA  FLNK+L    V +  +  I + ++ +GR   S L     PLMY W G RYWGAA+
Sbjct  187   LWAALFLNKHLQGEVVPNDVLMLIVDAVLAAGRTGASDLPG--CPLMYRWHGTRYWGAAN  244

Query  929   GLAGIMYALMEVELKPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAP  1105
             GLAGI++ L+   L   +  DVK TLR+M+ NRFP SGNYP++EG+   D LV W HGA 
Sbjct  245   GLAGILHVLLHFPLSEGDAGDVKGTLRHMMCNRFPHSGNYPSSEGNPR-DKLVQWSHGAT  303

Query  1106  GIALTLTKAAKIFESE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTG  1282
              +A+TL KA++++ ++ EF  AA++AGEVVWK GL+K+VG+  GI+GN Y FLSLYRLTG
Sbjct  304   SMAITLAKASQVYPNDREFRDAAIEAGEVVWKNGLVKKVGLADGIAGNTYAFLSLYRLTG  363

Query  1283  KEEYLYRAKAFGCFLHDRAHTL--ITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKAL  1456
             +  Y  RAKAF  FL+     L  I  G     D  +SLF+G+ G A L+ D+  P K+ 
Sbjct  364   ETIYKERAKAFASFLYHNKRKLAGIEHGGGFGADDGYSLFQGLAGTACLWFDMLVPLKSK  423

Query  1457  FPAYEL  1474
             FP YEL
Sbjct  424   FPGYEL  429



>gb|KHN31391.1| LanC-like protein 2 [Glycine soja]
Length=419

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 187/410 (46%), Positives = 248/410 (60%), Gaps = 37/410 (9%)
 Frame = +2

Query  314   TKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLL  493
             T +  A  LSLP  T  +     A++LKD+VV ETW  R  +V D T+YTG LGTAF  L
Sbjct  24    TMNLTAPNLSLPSET--ETFLSAAISLKDKVVEETWNRR-DQVVDPTVYTGLLGTAFTCL  80

Query  494   KAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFL--------CGQAGIYALGAVAAKH  649
             ++YQVTG  +DL L  +II  C TAA  +      L            G+YALGAV A +
Sbjct  81    RSYQVTGCRNDLILSSEIIDTCVTAARASLSRKVSLKTKKHLIHSSSRGVYALGAVVANY  140

Query  650   CGD----DELLHHYITKFKEIKLPVDLPDE--------LLYGRAGYLWACSFLNKNLGKG  793
              GD    D  L  +I   KE  LPV  P+E        LLYGRAG+LW   F+NK+LG+ 
Sbjct  141   MGDLQKRDLFLGLFIEVAKERALPVG-PEEGGFGMSYDLLYGRAGFLWGALFVNKHLGED  199

Query  794   TVSSSHMRAIANEIIKSGRKLSKLENLKS-PLMYEWQGRRYWGAAHGLAGIMYALMEVEL  970
              V    +  I + ++  GR  +   ++K  PLMY W G RY GAA+GLAGI++ L+   L
Sbjct  200   AVPKDILMLIIDAVLAGGR--AGASDIKDCPLMYRWHGTRYLGAANGLAGILHVLLHFPL  257

Query  971   KPDEQEDVKATLRYMIKNRFP-SGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFE  1147
               ++ EDVK TL Y++  RFP SGNYP++EG+   D LV W HGA G+A+TL+KAA++F 
Sbjct  258   PREDAEDVKGTLWYLMSKRFPHSGNYPSSEGNPR-DKLVQWGHGATGMAITLSKAAEVFP  316

Query  1148  SE-EFEQAAMDAGEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCF  1324
             ++ E   AA++AGEVVWK GL+K+VG+  G+SGNAY FLSLYRLT +  Y  RAK+F  F
Sbjct  317   NDRELRDAAIEAGEVVWKSGLVKKVGLADGVSGNAYAFLSLYRLTKESIYEERAKSFASF  376

Query  1325  LHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             L+D A +L          + +SLF+G+ G A L+ DL  P  + FP YEL
Sbjct  377   LYDNAKSLAA-------ANGYSLFQGLAGTACLWFDLLAPDNSRFPGYEL  419



>dbj|BAJ96048.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=326

 Score =   300 bits (768),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 155/292 (53%), Positives = 201/292 (69%), Gaps = 18/292 (6%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHG---TKDSLAKLLSLPHNTISKRLKQDALTLKDEV  406
             +R++PN++  F+ E        AP G       L  LLSLP+  +S RL + AL LKD+V
Sbjct  3     DRFFPNDLPDFVAE--------APDGGGPPAAGLRGLLSLPYPRLSDRLLRAALRLKDKV  54

Query  407   VRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASG  586
             V+ETW   G +VTDYTLYTGALGTA LL KA+QVTG+  DL+L   I++ACD A S    
Sbjct  55    VQETWTRTGGQVTDYTLYTGALGTALLLFKAFQVTGDRRDLNLASDIVQACDVA-SLGLP  113

Query  587   PVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACS  766
              +TF+ G+AG+ ALGAV AKHC D  ++ ++++ F EI +   +P+ELLYGRAGYLWAC 
Sbjct  114   FLTFISGRAGVCALGAVIAKHCNDQLMVTNFLSSFDEIIITEKVPNELLYGRAGYLWACL  173

Query  767   FLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIM  946
             FLN++L   T+ + H+ ++A +II+ GRKLS   +   PLMYEW G++YWGAAHGLAGIM
Sbjct  174   FLNEHLSDKTIPAEHISSVAKDIIREGRKLSNKGS--CPLMYEWHGKKYWGAAHGLAGIM  231

Query  947   YALMEVELKPDEQEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGA  1102
             + LM  ELK DEQ+DVK TLRYMI NRFPSGNYP      +  N + WC GA
Sbjct  232   HVLMHTELKLDEQDDVKNTLRYMISNRFPSGNYPRV----KTVNPIAWCIGA  279



>ref|XP_004582540.1| PREDICTED: lanC-like protein 2 [Ochotona princeps]
Length=452

 Score =   280 bits (715),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 173/442 (39%), Positives = 242/442 (55%), Gaps = 28/442 (6%)
 Frame = +2

Query  206   LDMQGSEMAEERYYPNEMAAFIPETTTVVQEIA-------PHGTKDSLAKLLSLPHNTIS  364
             L + G    EER +PN  A + P    +    A       P  T D  +         I 
Sbjct  11    LQLGGEAEMEERAFPNPFADYEPAAAALASAAAEGTGCARPLATADEPSLPFHPDGKIIQ  70

Query  365   KRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQ  544
                +Q    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L 
Sbjct  71    NFTRQIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLD  130

Query  545   IIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV----  712
              +K   T  + +   VTFLCG AG  A+GAV       D      ITK  ++   V    
Sbjct  131   YVKR--TLRNLSGRRVTFLCGDAGPLAVGAVVYHRLRSDCESQECITKLLQLHRTVVSQD  188

Query  713   -DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSP  883
              DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + + II+SG+ LS+ E    + P
Sbjct  189   SDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVDAIIESGKALSREERKAERCP  248

Query  884   LMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAA  1054
             L+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SGNYP++
Sbjct  249   LLYQWHRKQYVGAAHGMAGIYYVLMQPTAKVDQETLMEMVKPSIDYIRHKKFRSGNYPSS  308

Query  1055  EGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICH  1231
               + E D LVHWCHGAPG+   L +A K+F+ E++ + AMD  +V+W+RGLL++  GICH
Sbjct  309   LSN-ETDRLVHWCHGAPGVVHLLMQAYKVFKEEKYLKEAMDCSDVIWQRGLLRKGYGICH  367

Query  1232  GISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIG  1408
             G +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ 
Sbjct  368   GTAGNGYCFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMA  421

Query  1409  GMAYLFLDLADPSKALFPAYEL  1474
             G  +   D+  P  + FPA+EL
Sbjct  422   GAVHFLSDILVPETSRFPAFEL  443



>ref|XP_004602091.1| PREDICTED: lanC-like protein 2 [Sorex araneus]
Length=396

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 155/354 (44%), Positives = 218/354 (62%), Gaps = 19/354 (5%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ ++VT +   L   L  +K   T  + +   VTFLCG AG  A
Sbjct  38    DCSAYTGWTGIALLYLQLHRVTSDQTYLLRSLDYVKR--TLRNLSGRRVTFLCGDAGPLA  95

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAVA      D      +T+  +++  V     DLPDELLYGRAGYL+A  +LN  +G 
Sbjct  96    VGAVAYHKLKSDTEAQECVTRLLQLQRAVVCRDSDLPDELLYGRAGYLYALLYLNSEMGP  155

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTVS S ++ +   II+SG+ LS+ E    + PL+Y+W G++Y GAAHG+ GI Y LM+ 
Sbjct  156   GTVSESAIKEVVTAIIESGKSLSREERKTERCPLLYQWHGKQYVGAAHGMTGIYYMLMQP  215

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             E K D++   E VK ++ Y+   RF SGNYP++  + E D LVHWCHGAPG++  L +A 
Sbjct  216   EAKVDQETLTELVKPSIDYVRHKRFRSGNYPSSLSN-ETDRLVHWCHGAPGVSHMLMQAY  274

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             K+F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  
Sbjct  275   KVFKEEKYLKDAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACK  334

Query  1313  FGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D      T G  +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  335   FAEWCLDYG----THGC-RIPDRPYSLFEGMAGTIHFLSDILVPETSRFPAFEL  383



>emb|CDY31938.1| BnaA07g00570D [Brassica napus]
Length=391

 Score =   273 bits (698),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/272 (51%), Positives = 188/272 (69%), Gaps = 14/272 (5%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R++ N M    P+ +   Q +A  G  DSL  LL++P++ +S+ L++ AL LK+ VV E
Sbjct  3     DRFFDNLM----PDLS---QSVAEEG--DSLMNLLAMPYSFLSQNLQRSALGLKETVVME  53

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA--SHASGP  589
             TWG  G+ V D+ LY+G LG AFLL +AYQVT N +DLSL LQI+KAC            
Sbjct  54    TWGFTGQLVQDFPLYSGTLGAAFLLFRAYQVTANPNDLSLFLQILKACLVMLLLPPLGRD  113

Query  590   VTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVD-LPDELLYGRAGYLWACS  766
             +TF+CG+AG+ ALG  AAK  GD ELL++Y+++F++       + +ELLYG  GYLWAC 
Sbjct  114   ITFICGRAGVCALGTAAAKRSGDQELLNYYLSQFRQFCFSTFYIANELLYGIVGYLWACL  173

Query  767   FLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIM  946
             F+NK +G  T+SS+ +  +  EIIK  R ++K  N KSPLM+EW G+RYWG AHGLAGIM
Sbjct  174   FVNKYVGAETLSSTTIHQVTEEIIKESRSMTK--NEKSPLMFEWYGQRYWGTAHGLAGIM  231

Query  947   YALMEVELKPDEQEDVKATLRYMIKNRFPSGN  1042
             + LM+V+LKPDE EDVK TL+Y+I NRFPSG 
Sbjct  232   HVLMDVQLKPDEAEDVKGTLKYLINNRFPSGT  263


 Score = 42.0 bits (97),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = +2

Query  1403  IGGMAYLFLDLADPSKALFPAYEL  1474
             +G MAYLFLD+ DPS+A FP YEL
Sbjct  368   VGKMAYLFLDMVDPSQARFPGYEL  391


 Score = 35.8 bits (81),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 33/76 (43%), Gaps = 0/76 (0%)
 Frame = +3

Query  1176  MQGRWCGREGY*SELGYAMESVEMLMCFFRSTD*QGKRNTCIGQRHLVVSCMTELIHL*Q  1355
             +Q RW G     S  G  M SV M M F   T+     +   GQ+     C+TE     Q
Sbjct  291   LQQRWFGTVDCSSGWGSVMGSVAMHMFFSPFTELLDGTSISTGQKPSPAFCLTEATSYSQ  350

Query  1356  MGLCSAVITLSRCLRA  1403
                C+ VI L  CL+A
Sbjct  351   KEKCTEVIVLIPCLKA  366



>ref|XP_008260063.1| PREDICTED: lanC-like protein 2 isoform X2 [Oryctolagus cuniculus]
Length=401

 Score =   271 bits (694),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 160/384 (42%), Positives = 224/384 (58%), Gaps = 21/384 (5%)
 Frame = +2

Query  359   ISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLC  538
             I   ++Q    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   
Sbjct  14    IHNFMRQIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRS  73

Query  539   LQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV--  712
             L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  ++   V  
Sbjct  74    LDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHQLRSDCESRECITKLLQLHRTVVC  131

Query  713   ---DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--K  877
                DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + + II+SG+ LS+ E    +
Sbjct  132   QDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVDAIIESGKALSREERKAER  191

Query  878   SPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYP  1048
              PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SGNYP
Sbjct  192   CPLLYQWHRKQYLGAAHGMAGIYYMLMQPAAKVDQETLMEMVKPSIDYVRHKKFRSGNYP  251

Query  1049  AAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGI  1225
             ++  + E D LVHWCHGAPG+   L +A K+F+ E++ + AMD  +V+W+RGLL++  GI
Sbjct  252   SSLSN-ETDRLVHWCHGAPGVVHMLMQAYKVFKEEKYLKEAMDCSDVIWQRGLLRKGYGI  310

Query  1226  CHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEG  1402
             CHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SLFEG
Sbjct  311   CHGTAGNGYCFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEG  364

Query  1403  IGGMAYLFLDLADPSKALFPAYEL  1474
             + G  +   D+  P  + FPA+EL
Sbjct  365   MAGAVHFLSDILVPETSRFPAFEL  388



>ref|XP_002982067.1| hypothetical protein SELMODRAFT_115837, partial [Selaginella 
moellendorffii]
 gb|EFJ16735.1| hypothetical protein SELMODRAFT_115837, partial [Selaginella 
moellendorffii]
Length=215

 Score =   265 bits (676),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 158/218 (72%), Gaps = 3/218 (1%)
 Frame = +2

Query  821   IANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQEDVKA  1000
             I + I+ +GR  +       PLMY+W G RYWGAAHGLAGIMY LM   L   +  DVK 
Sbjct  1     IVDAILAAGR--AGASQSSCPLMYQWHGTRYWGAAHGLAGIMYVLMHFPLSARDAADVKE  58

Query  1001  TLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDA  1180
             TL YMI NRF SGNYP+++G+ + D L+HWCHGAPGI LTL KAAK+F    F +AA+ A
Sbjct  59    TLLYMIANRFQSGNYPSSDGN-QRDKLIHWCHGAPGICLTLCKAAKVFPEPVFREAAVAA  117

Query  1181  GEVVWKRGLLKRVGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDG  1360
             GE++WK+GLL+RVG+CHG+SGN Y FL+LYRLTG  ++L+RA++F  FL ++   LI  G
Sbjct  118   GELIWKKGLLRRVGLCHGVSGNTYPFLALYRLTGDRKHLFRARSFATFLCNQGRELIDSG  177

Query  1361  IMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              M  GDHP+SLFEG+ G A+L+LDL  P +A FP YEL
Sbjct  178   DMHGGDHPYSLFEGLAGTAFLWLDLQRPEEARFPGYEL  215



>ref|XP_008260062.1| PREDICTED: lanC-like protein 2 isoform X1 [Oryctolagus cuniculus]
Length=457

 Score =   273 bits (697),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 169/439 (38%), Positives = 237/439 (54%), Gaps = 29/439 (7%)
 Frame = +2

Query  218   GSEMAEERYYPNEMAAFIPETTTVVQEIA--------PHGTKDSLAKLLSLPHNTISKRL  373
             G    EER +PN    + P  +  +            P    D            I   +
Sbjct  15    GEAEMEERAFPNPFPDYEPAASAALAAAGAEGTGCARPPPATDEPGLPFHQDGKIIHNFM  74

Query  374   KQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIK  553
             +Q    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L  +K
Sbjct  75    RQIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVK  134

Query  554   ACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----DL  718
                T  +     VTFLCG AG  A+GAV       D      ITK  ++   V     DL
Sbjct  135   R--TLRNLNGRRVTFLCGDAGPLAVGAVIYHQLRSDCESRECITKLLQLHRTVVCQDSDL  192

Query  719   PDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMY  892
             PDELLYGRAGYL+A  +LN  +G GTV  S ++ + + II+SG+ LS+ E    + PL+Y
Sbjct  193   PDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVDAIIESGKALSREERKAERCPLLY  252

Query  893   EWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGD  1063
             +W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SGNYP++  +
Sbjct  253   QWHRKQYLGAAHGMAGIYYMLMQPAAKVDQETLMEMVKPSIDYVRHKKFRSGNYPSSLSN  312

Query  1064  DEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGIS  1240
              E D LVHWCHGAPG+   L +A K+F+ E++ + AMD  +V+W+RGLL++  GICHG +
Sbjct  313   -ETDRLVHWCHGAPGVVHMLMQAYKVFKEEKYLKEAMDCSDVIWQRGLLRKGYGICHGTA  371

Query  1241  GNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMA  1417
             GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ G  
Sbjct  372   GNGYCFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGAV  425

Query  1418  YLFLDLADPSKALFPAYEL  1474
             +   D+  P  + FPA+EL
Sbjct  426   HFLSDILVPETSRFPAFEL  444



>gb|EHH52121.1| Testis-specific adriamycin sensitivity protein, partial [Macaca 
fascicularis]
Length=381

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 162/387 (42%), Positives = 228/387 (59%), Gaps = 25/387 (6%)
 Frame = +2

Query  350   HNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDL  529
             HN I +R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L
Sbjct  2     HNLI-RRIQTK---IKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYL  57

Query  530   SLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLP  709
                L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  
Sbjct  58    LRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECITKLLQLQRA  115

Query  710   V-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
             V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ LS+ E  
Sbjct  116   VVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERK  175

Query  875   --KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSG  1039
               + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SG
Sbjct  176   TERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSG  235

Query  1040  NYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-  1216
             NYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++ 
Sbjct  236   NYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKG  294

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSL  1393
              GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SL
Sbjct  295   YGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSL  348

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             FEG+ G  +   D+  P  + FPA+EL
Sbjct  349   FEGMAGAIHFLSDVLGPETSRFPAFEL  375



>ref|XP_003275065.1| PREDICTED: lanC-like protein 2 [Nomascus leucogenys]
Length=450

 Score =   271 bits (693),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 230/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D      +     I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFNQDGKIIHNFVRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVVHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSQFPAFEL  444



>gb|EHH17302.1| Testis-specific adriamycin sensitivity protein, partial [Macaca 
mulatta]
Length=397

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/387 (42%), Positives = 228/387 (59%), Gaps = 25/387 (6%)
 Frame = +2

Query  350   HNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDL  529
             HN I +R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L
Sbjct  18    HNLI-RRIQTK---IKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYL  73

Query  530   SLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLP  709
                L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  
Sbjct  74    LRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECITKLLQLQRA  131

Query  710   V-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
             V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ LS+ E  
Sbjct  132   VVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERK  191

Query  875   --KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSG  1039
               + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SG
Sbjct  192   TERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSG  251

Query  1040  NYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-  1216
             NYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++ 
Sbjct  252   NYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKG  310

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSL  1393
              GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SL
Sbjct  311   YGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSL  364

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             FEG+ G  +   D+  P  + FPA+EL
Sbjct  365   FEGMAGAIHFLSDVLGPETSRFPAFEL  391



>ref|XP_005549615.1| PREDICTED: lanC-like protein 2 isoform X2 [Macaca fascicularis]
 ref|XP_007979470.1| PREDICTED: lanC-like protein 2 isoform X2 [Chlorocebus sabaeus]
 ref|XP_009201188.1| PREDICTED: lanC-like protein 2 isoform X2 [Papio anubis]
Length=363

 Score =   268 bits (685),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 214/355 (60%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLA  69

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       D      ITK  +++  V     DLPDELLYGRAGYL+A  +LN  +G 
Sbjct  70    VGAVIYHKLRSDCESQECITKLLQLQRAVVCQESDLPDELLYGRAGYLYALLYLNTEIGP  129

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTV  S ++ + N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  130   GTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  189

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
               K D++   E VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A 
Sbjct  190   AAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLMQAY  248

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             K+F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  
Sbjct  249   KVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACK  308

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  309   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  357



>ref|NP_001014209.1| lanC-like protein 2 [Rattus norvegicus]
 gb|AAH79412.1| LanC lantibiotic synthetase component C-like 2 (bacterial) [Rattus 
norvegicus]
Length=450

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 167/440 (38%), Positives = 245/440 (56%), Gaps = 30/440 (7%)
 Frame = +2

Query  218   GSEMAEERYYPN-----EMAA----FIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKR  370
             G    EER +PN     E+AA    F   T      + P  T +            +   
Sbjct  14    GEAEMEERSFPNPFLDYEVAASATGFASGTAEETGRVCPLPTTEDPGLPFHPNGKIVPNL  73

Query  371   LKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
             +K+    +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   L  +
Sbjct  74    IKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYV  133

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----D  715
             K   T  + +   VTFLCG AG  A+GAV       +      ITK  ++   +     +
Sbjct  134   KR--TLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESE  191

Query  716   LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLE--NLKSPLM  889
             LPDELL+GRAGYL+A  +LN  +G GTV  + ++ +   II+SG++LS+ E  + + PL+
Sbjct  192   LPDELLFGRAGYLYALLYLNTEIGPGTVGETAIKEVVTAIIESGKRLSREERKSERCPLL  251

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEG  1060
             Y+W  ++Y GAAHG+AGI Y LM+ E K D++   E VK ++ Y+   +F SGNYP++  
Sbjct  252   YQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-  310

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGI  1237
              +E D LVHWCHGAPG+   L +A ++F+ E++ + AM+  +V+W+RGLL++  GICHG 
Sbjct  311   SNETDRLVHWCHGAPGVIHMLLRAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGT  370

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGM  1414
             +GN Y FLSLY+LT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ G 
Sbjct  371   AGNGYSFLSLYQLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGA  424

Query  1415  AYLFLDLADPSKALFPAYEL  1474
              +   D+  P  A FPA+EL
Sbjct  425   VHFLSDMLVPETARFPAFEL  444



>ref|XP_007979469.1| PREDICTED: lanC-like protein 2 isoform X1 [Chlorocebus sabaeus]
Length=450

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 162/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPSATTDEPGLPFHQDGKIIHNLIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      ITK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECITKLLQLQRAVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|XP_007094861.1| PREDICTED: lanC-like protein 2, partial [Panthera tigris altaica]
Length=406

 Score =   269 bits (688),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 164/404 (41%), Positives = 228/404 (56%), Gaps = 43/404 (11%)
 Frame = +2

Query  338   LSLP-HN---TISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQ  505
             L LP HN    I    ++    +KD + +   G +     D + YTG  G A L L+ Y+
Sbjct  11    LGLPFHNDGKIIHNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYR  70

Query  506   VTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYIT  685
             VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       D      IT
Sbjct  71    VTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECIT  128

Query  686   KFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGR  850
             K  +++  +     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+
Sbjct  129   KLLQLQKTIVCRDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGK  188

Query  851   KLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYM  1015
              LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+
Sbjct  189   TLSREERKADRCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYV  248

Query  1016  IKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVW  1195
                RF SGNYP++  + E D LVHWCHGAPG+   LT+A K+F+ E++ + AM+  +V+W
Sbjct  249   RHKRFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLTQAYKVFKEEKYLKEAMECSDVIW  307

Query  1196  KRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF----------GCFLHDRAH  1342
             +RGLL++  GICHG +GN Y FLSLY LT  ++YLYRA  F          GC + DR  
Sbjct  308   QRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIPDR--  365

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                          P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  366   -------------PYSLFEGMAGAIHFLSDILVPETSRFPAFEL  396



>ref|XP_004438431.1| PREDICTED: lanC-like protein 2 [Ceratotherium simum simum]
Length=457

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 172/443 (39%), Positives = 243/443 (55%), Gaps = 29/443 (7%)
 Frame = +2

Query  206   LDMQGSEMAEERYYPNEMAAFIPETTTVVQEIAPHGT----KDSLAKLLSLPHNTISKRL  373
             L + G    EER + N    +    + V    AP  +        A  L LP +   K +
Sbjct  11    LPLGGEADMEERAFVNPFPDYEAAASAVFPAGAPEESGCAHPRPTADELRLPFHKDGKII  70

Query  374   ----KQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCL  541
                 ++    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L
Sbjct  71    HNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSL  130

Query  542   QIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV---  712
               IK   T  +     VTFLCG AG  A+GAV       D      ITK  +++  V   
Sbjct  131   DYIKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDRESQECITKLLQLQRTVVCR  188

Query  713   --DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KS  880
               D+PDELLYGRAGYL+A  +LN  +G GTV  S ++ + + II+SG+ LS+ E    + 
Sbjct  189   DSDIPDELLYGRAGYLYALLYLNTEIGPGTVCESAVKEVVSAIIESGKNLSREERKTERC  248

Query  881   PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPA  1051
             PL+Y+W  ++Y GAAHG+AGI Y LM+ E K D++   E VK ++ Y+   RF SGNYP+
Sbjct  249   PLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLSEMVKPSIDYIRHKRFRSGNYPS  308

Query  1052  AEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGIC  1228
             +  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++  GIC
Sbjct  309   SLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQRGLLRKGYGIC  367

Query  1229  HGISGNAYVFLSLYRLTGKEEYLYRAKAFGCF-LHDRAHTLITDGIMQRGDHPFSLFEGI  1405
             HG +GN Y FLSLY LT   +YLYRA  F  + L   AH        +  D P+SLFEG+
Sbjct  368   HGTAGNGYSFLSLYHLTQDRKYLYRACKFAEWCLEYGAHGC------RVPDRPYSLFEGM  421

Query  1406  GGMAYLFLDLADPSKALFPAYEL  1474
              G  +   D+  P  + FPA+EL
Sbjct  422   AGAVHFLSDVLIPETSWFPAFEL  444



>ref|XP_010623360.1| PREDICTED: lanC-like protein 2 [Fukomys damarensis]
Length=434

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 167/435 (38%), Positives = 238/435 (55%), Gaps = 29/435 (7%)
 Frame = +2

Query  206   LDMQGSEMAEERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDA  385
             L + G    EER + N    +    T           KD   K  +  +  I    ++  
Sbjct  11    LHLGGEADMEERAFSNPFPDYECSCT--------ERNKDKYEKAATKQYIIIQNFSRRIQ  62

Query  386   LTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDT  565
               +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   L  +K   T
Sbjct  63    TKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTHLLRSLDYVKR--T  120

Query  566   AASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDEL  730
               +     VTFLCG AG  A+GAV       D      ITK  ++   +     +LPDEL
Sbjct  121   LRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECITKLLQLHKTIVCQESELPDEL  180

Query  731   LYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQG  904
             LYGRAGYL+A  +LN  +G GTVS S ++ + N II+SG+ LS+ E    + PL+Y+W  
Sbjct  181   LYGRAGYLYALLYLNMEIGPGTVSESAIKEVVNSIIESGKTLSREERKAERCPLLYQWHR  240

Query  905   RRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEAD  1075
             ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SGNYP++  + E D
Sbjct  241   KQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSN-ETD  299

Query  1076  NLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAY  1252
              LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++  G+CHG +GN Y
Sbjct  300   RLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGVCHGTAGNGY  359

Query  1253  VFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFL  1429
              FLSLY LT   +YLYRA  F  +  D  AH        +  D P+SLFEG+ G  +   
Sbjct  360   SFLSLYHLTQDRKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLS  413

Query  1430  DLADPSKALFPAYEL  1474
             D+  P  + FPA+EL
Sbjct  414   DVLVPETSQFPAFEL  428



>ref|XP_003815868.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein 2 [Pan paniscus]
Length=450

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 171/443 (39%), Positives = 243/443 (55%), Gaps = 29/443 (7%)
 Frame = +2

Query  206   LDMQGSEMAEERYYPN-----EMAAFIPETTTVVQE---IAPHGTKDSLAKLLSLPHNTI  361
             L + G    EER + N     E AA     +   +E   + P  T D            I
Sbjct  11    LHLGGEAEMEERAFANPFPDYEAAAGXLLASGAAEETGCVRPPATTDEPGLPFHQDGKII  70

Query  362   SKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCL  541
                +++    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L
Sbjct  71    HNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSL  130

Query  542   QIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV---  712
               +K   T  +     VTFLCG AG  A+GAV       D      +TK  +++  V   
Sbjct  131   DYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQ  188

Query  713   --DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KS  880
               DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ LS+ E    + 
Sbjct  189   ESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERC  248

Query  881   PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPA  1051
             PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SGNYP+
Sbjct  249   PLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSGNYPS  308

Query  1052  AEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGIC  1228
             +   +E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++  GIC
Sbjct  309   SL-SNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGIC  367

Query  1229  HGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGI  1405
             HG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+
Sbjct  368   HGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGM  421

Query  1406  GGMAYLFLDLADPSKALFPAYEL  1474
              G  +   D+  P  + FPA+EL
Sbjct  422   AGAIHFLSDVLGPETSRFPAFEL  444



>dbj|BAG63209.1| unnamed protein product [Homo sapiens]
Length=432

 Score =   270 bits (689),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  32    VRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  91

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  92    ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  149

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  150   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  209

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  210   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  269

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  270   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  328

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  329   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  388

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  389   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  426



>ref|NP_001248105.1| lanC-like protein 2 [Macaca mulatta]
 ref|XP_005549614.1| PREDICTED: lanC-like protein 2 isoform X1 [Macaca fascicularis]
 ref|XP_010378849.1| PREDICTED: lanC-like protein 2 [Rhinopithecus roxellana]
Length=450

 Score =   270 bits (691),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 162/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHQDGKIIHNLIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      ITK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECITKLLQLQRAVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|XP_008825772.1| PREDICTED: lanC-like protein 2 [Nannospalax galili]
Length=449

 Score =   270 bits (690),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 171/441 (39%), Positives = 242/441 (55%), Gaps = 33/441 (7%)
 Frame = +2

Query  218   GSEMAEERYYPNEMAAF------IPETTTVVQEIAPHGTKDSLAKLLSLPHNT----ISK  367
             G    EER +PN    +             V+E  P       A  LSLP +     I  
Sbjct  14    GEPEMEERAFPNPFPDYDAAAATAGLAAGAVEE--PGARPPPPANDLSLPFHADGKIIHN  71

Query  368   RLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQI  547
              +++    +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   L  
Sbjct  72    FIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDY  131

Query  548   IKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----  712
             +K   T  + +   VTFLCG AG  A+GAV       +      ITK  ++   V     
Sbjct  132   VKR--TLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTVICQES  189

Query  713   DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPL  886
             +LPDELLYGRAGYL+A  +LN  +G GTV    ++ +   II+SG+ LS+ E    + PL
Sbjct  190   ELPDELLYGRAGYLYALLYLNTEIGPGTVCEKAIKEVVTAIIESGKNLSREERKTERCPL  249

Query  887   MYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAE  1057
             +Y+W  ++Y GAAHG+AGI Y LM+ E K D++   E VK ++ Y+   RF SGNYP++ 
Sbjct  250   LYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKRFRSGNYPSSL  309

Query  1058  GDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHG  1234
              + E D LVHWCHGAPG+   L +A ++F+ E++ + AM+  +V+W+RGLL++  GICHG
Sbjct  310   SN-ETDRLVHWCHGAPGVIHMLMQAHQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHG  368

Query  1235  ISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGG  1411
              SGN Y FLSLY LT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ G
Sbjct  369   TSGNGYSFLSLYHLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAG  422

Query  1412  MAYLFLDLADPSKALFPAYEL  1474
               +   D+  P  + FPA+EL
Sbjct  423   AVHFLSDILVPETSRFPAFEL  443



>ref|XP_010330054.1| PREDICTED: lanC-like protein 2 isoform X2 [Saimiri boliviensis 
boliviensis]
 ref|XP_010330055.1| PREDICTED: lanC-like protein 2 isoform X2 [Saimiri boliviensis 
boliviensis]
 ref|XP_010330056.1| PREDICTED: lanC-like protein 2 isoform X2 [Saimiri boliviensis 
boliviensis]
Length=370

 Score =   268 bits (684),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 154/355 (43%), Positives = 214/355 (60%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLA  69

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G 
Sbjct  70    VGAVIYHKLRSDCESQECVTKLLQLQKAVVCQESDLPDELLYGRAGYLYALLYLNTEIGP  129

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTV  S ++ + N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  130   GTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  189

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
               K D++   E VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A 
Sbjct  190   AAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAY  248

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             K+F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  
Sbjct  249   KVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACK  308

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  309   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDVLGPEASRFPAFEL  357



>ref|XP_003896011.1| PREDICTED: lanC-like protein 2 isoform X1 [Papio anubis]
Length=450

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 162/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHQDGKIIHNLIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      ITK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECITKLLQLQRAVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>emb|CAD28471.1| hypothetical protein [Homo sapiens]
Length=440

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  40    VRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  99

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  100   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  157

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  158   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  217

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  218   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  277

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  278   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  336

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  337   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  396

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  397   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  434



>dbj|BAE00722.1| unnamed protein product [Macaca fascicularis]
Length=363

 Score =   267 bits (683),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 155/355 (44%), Positives = 213/355 (60%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLA  69

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       D      ITK  +++  V     DLPDELLYGRAGYL+A  +LN  +G 
Sbjct  70    VGAVIYHKLRSDCESQECITKLLQLQRAVVCQESDLPDELLYGRAGYLYALLYLNTEIGP  129

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTV  S ++ + N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  130   GTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  189

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
               K D++   E VK ++ Y+   +F SGNYP+    +E D LVHWCHGAPG+   L +A 
Sbjct  190   AAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSPL-SNETDRLVHWCHGAPGVIHMLMQAY  248

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             K+F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  
Sbjct  249   KVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACK  308

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  309   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  357



>ref|NP_598498.1| lanC-like protein 2 [Mus musculus]
 sp|Q9JJK2.1|LANC2_MOUSE RecName: Full=LanC-like protein 2; AltName: Full=Testis-specific 
adriamycin sensitivity protein [Mus musculus]
 dbj|BAA96801.1| testis-specific adriamycin sensitivity protein [Mus musculus]
 gb|AAH16072.1| Lancl2 protein [Mus musculus]
Length=450

 Score =   270 bits (690),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 227/380 (60%), Gaps = 21/380 (6%)
 Frame = +2

Query  371   LKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
             +K+    +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   L  +
Sbjct  74    IKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYV  133

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----D  715
             K   T  + +   VTFLCG AG  A+GAV       +      ITK  ++   +     +
Sbjct  134   KR--TLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESE  191

Query  716   LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLE--NLKSPLM  889
             LPDELLYGRAGYL+A  +LN  +G GTV  + ++ + + II+SG+ LS+ E  + + PL+
Sbjct  192   LPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVSAIIESGKSLSREERKSERCPLL  251

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEG  1060
             Y+W  ++Y GAAHG+AGI Y LM+ E K D++   E VK ++ Y+   +F SGNYP++  
Sbjct  252   YQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-  310

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGI  1237
              +E D LVHWCHGAPG+   L +A ++F+ E++ + AM+  +V+W+RGLL++  GICHG 
Sbjct  311   SNETDRLVHWCHGAPGVIHVLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGT  370

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGM  1414
             SGN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ G 
Sbjct  371   SGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGA  424

Query  1415  AYLFLDLADPSKALFPAYEL  1474
              +   D+  P  A FPA+EL
Sbjct  425   VHFLSDILVPETARFPAFEL  444



>gb|AAH70049.1| LanC lantibiotic synthetase component C-like 2 (bacterial) [Homo 
sapiens]
 gb|EAL23810.1| LanC lantibiotic synthetase component C-like 2 (bacterial) [Homo 
sapiens]
 gb|EAW50968.1| LanC lantibiotic synthetase component C-like 2 (bacterial) [Homo 
sapiens]
Length=450

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATPDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|NP_061167.1| lanC-like protein 2 [Homo sapiens]
 sp|Q9NS86.1|LANC2_HUMAN RecName: Full=LanC-like protein 2; AltName: Full=Testis-specific 
adriamycin sensitivity protein [Homo sapiens]
 gb|AAK83286.1|AF353942_1 lantibiotic synthetase C-like protein 2 [Homo sapiens]
 dbj|BAA96800.1| testis-specific adriamycin sensitivity protein [Homo sapiens]
 emb|CAC21715.1| LanC-like protein 2 [Homo sapiens]
 gb|AAQ93360.1| unknown [Homo sapiens]
 dbj|BAG36131.1| unnamed protein product [Homo sapiens]
Length=450

 Score =   270 bits (690),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>dbj|BAG53147.1| unnamed protein product [Homo sapiens]
Length=450

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|XP_004045515.1| PREDICTED: lanC-like protein 2 [Gorilla gorilla gorilla]
Length=450

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|XP_003318497.1| PREDICTED: lanC-like protein 2 [Pan troglodytes]
Length=450

 Score =   270 bits (689),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|XP_003733613.1| PREDICTED: LOW QUALITY PROTEIN: lanC-like protein 2 [Callithrix 
jacchus]
Length=450

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 163/393 (41%), Positives = 228/393 (58%), Gaps = 25/393 (6%)
 Frame = +2

Query  344   LPHNT----ISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVT  511
             LP N     I   +++    +KD + +   G +     D + YTG  G A L L+ Y+VT
Sbjct  61    LPFNQDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVT  120

Query  512   GNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKF  691
              +   L   L  +K   T  +     VTFLCG AG  A+GAV       D      ITK 
Sbjct  121   CDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECITKL  178

Query  692   KEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKL  856
              +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ L
Sbjct  179   LQLQKAVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCQSAIKEVVNAIIESGKTL  238

Query  857   SKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIK  1021
             S+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+  
Sbjct  239   SREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRH  298

Query  1022  NRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKR  1201
              +F SGNYP++  + E D LVHWCHGAPG+   L +A KIF+ E++ + AM+  +V+W+R
Sbjct  299   KKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKIFKEEKYLKEAMECSDVIWQR  357

Query  1202  GLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRG  1375
             GLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  
Sbjct  358   GLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIP  411

Query  1376  DHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  412   DRPYSLFEGMAGAIHFLSDVLGPEASRFPAFEL  444



>ref|XP_004839897.1| PREDICTED: lanC-like protein 2 isoform X2 [Heterocephalus glaber]
Length=363

 Score =   267 bits (682),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 214/355 (60%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VTG+   L   L  +K   T  + +   VTFLCG AG  A
Sbjct  12    DCSAYTGWTGVALLYLQLYRVTGDQTHLLRSLDYVKR--TLRNLSGRRVTFLCGDAGPLA  69

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       D      ITK  ++   V     +LPDELLYGRAGYL+A  ++N  +G 
Sbjct  70    VGAVIYHKLKSDCESQECITKLLQLHRTVVCQESELPDELLYGRAGYLYALLYVNTEIGP  129

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTVS S +R + N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  130   GTVSESAVREVVNAIIESGKTLSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  189

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
               K D++   E VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A 
Sbjct  190   SAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLLQAY  248

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             ++F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLY LT   ++LYRA  
Sbjct  249   QVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDRKHLYRACK  308

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  309   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDVLMPETSRFPAFEL  357



>ref|XP_005609226.1| PREDICTED: lanC-like protein 2, partial [Equus caballus]
Length=411

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 162/396 (41%), Positives = 225/396 (57%), Gaps = 43/396 (11%)
 Frame = +2

Query  350   HNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDL  529
             HN  ++R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L
Sbjct  25    HN-FTRRIQSK---IKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYL  80

Query  530   SLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLP  709
                L  IK   T  +     VTFLCG AG  A+GAV       D      ITK  +++  
Sbjct  81    LRSLDYIKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDSESQECITKLLQLQRT  138

Query  710   V-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
             +     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + + II+SG+ LS+ E  
Sbjct  139   IVCRDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVSAIIESGKILSREEKK  198

Query  875   --KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSG  1039
               + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ YM   RF SG
Sbjct  199   TERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQEILTEMVKPSIDYMRHKRFRSG  258

Query  1040  NYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-  1216
             NYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++ 
Sbjct  259   NYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAMECSDVIWQRGLLRKG  317

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF----------GCFLHDRAHTLITDGIM  1366
              GICHG SGN Y FLSLY LT   +YLYRA  F          GC + DR          
Sbjct  318   YGICHGTSGNGYSFLSLYHLTQDRKYLYRACKFAEWCLEYGAHGCRIPDR----------  367

Query  1367  QRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                  P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  368   -----PYSLFEGMAGAIHFLSDVLVPETSRFPAFEL  398



>gb|KFO33010.1| LanC-like protein 2 [Fukomys damarensis]
Length=363

 Score =   266 bits (681),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 213/355 (60%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VTG+   L   L  +K   T  +     VTFLCG AG  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTGDQTHLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLA  69

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       D      ITK  ++   +     +LPDELLYGRAGYL+A  +LN  +G 
Sbjct  70    VGAVIYHKLRSDCESQECITKLLQLHKTIVCQESELPDELLYGRAGYLYALLYLNMEIGP  129

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTVS S ++ + N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  130   GTVSESAIKEVVNSIIESGKTLSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  189

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
               K D++   E VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A 
Sbjct  190   AAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLMQAY  248

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             K+F+ E++ + AM+  +V+W+RGLL++  G+CHG +GN Y FLSLY LT   +YLYRA  
Sbjct  249   KVFKEEKYLKEAMECSDVIWQRGLLRKGYGVCHGTAGNGYSFLSLYHLTQDRKYLYRACK  308

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  309   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDVLVPETSQFPAFEL  357



>ref|XP_002833100.1| PREDICTED: lanC-like protein 2 [Pongo abelii]
Length=450

 Score =   269 bits (688),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 161/404 (40%), Positives = 229/404 (57%), Gaps = 21/404 (5%)
 Frame = +2

Query  299   IAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGT  478
             + P  T D            I   +++    +KD + +   G +     D + YTG  G 
Sbjct  50    VRPPATTDEPGLPFHEDGKIIHNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGI  109

Query  479   AFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGD  658
             A L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       
Sbjct  110   ALLYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRS  167

Query  659   DELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAI  823
             D      +TK  +++  V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ +
Sbjct  168   DCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEV  227

Query  824   ANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---E  988
              N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E
Sbjct  228   VNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTE  287

Query  989   DVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQA  1168
              VK ++ Y+   +F SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + 
Sbjct  288   MVKPSIDYVRHKKFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKE  346

Query  1169  AMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AH  1342
             AM+  +V+W+RGLL++  GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH
Sbjct  347   AMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAH  406

Query  1343  TLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
                     +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  407   GC------RIPDRPYSLFEGMAGAIHFLSDVLGPETSRFPAFEL  444



>ref|XP_004794591.1| PREDICTED: lanC-like protein 1 isoform X1 [Mustela putorius furo]
 ref|XP_004794592.1| PREDICTED: lanC-like protein 1 isoform X2 [Mustela putorius furo]
 ref|XP_004794593.1| PREDICTED: lanC-like protein 1 isoform X3 [Mustela putorius furo]
 ref|XP_004794594.1| PREDICTED: lanC-like protein 1 isoform X4 [Mustela putorius furo]
 ref|XP_004794595.1| PREDICTED: lanC-like protein 1 isoform X5 [Mustela putorius furo]
Length=399

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 161/420 (38%), Positives = 228/420 (54%), Gaps = 30/420 (7%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R +PN  A F         +    G  DS  +L        S+RL      +++ + + 
Sbjct  3     QRAFPNPYADF--------NKSLAEGYFDSAGRLTP----EFSQRLNNK---IRELLQQM  47

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
              WG +     D T YTG  G A L L  Y V G+   L +    +K    + S  S  +T
Sbjct  48    EWGLKSADPRDSTAYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLSKRS--IT  105

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEI-KLPVDLPDELLYGRAGYLWACSFL  772
             FLCG AG  A+GAV      +++     IT+   + K+ +  P+E+LYGR GY++A  F+
Sbjct  106   FLCGDAGPLAVGAVVYHKMNNEKQAEDCITRLIHLNKIDLHAPNEVLYGRMGYIYALLFV  165

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIM  946
             NKN G   +  SH++ I   ++ SG  L++  N   K+PLMYEW    Y GAAHGLAGI 
Sbjct  166   NKNFGVEKIPQSHIQQICETVLTSGETLARKRNFTAKTPLMYEWYQEYYVGAAHGLAGIY  225

Query  947   YALMEVELKPDE---QEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIAL  1117
             Y LM+  L+ +    Q  VK ++ Y+ + +FPSGNYP    DD  D LVHWCHG+PG+  
Sbjct  226   YFLMQPSLQVNHVKLQNLVKPSVDYVCQLKFPSGNYPPCV-DDNRDLLVHWCHGSPGVIY  284

Query  1118  TLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEY  1294
              L +A K+F  E +   A   G+++W+ GLL++  G+CHG +GNAY FL+LY LT  ++Y
Sbjct  285   MLIQAYKVFREERYLNDAYQCGDLIWQYGLLRKGYGLCHGTAGNAYAFLTLYNLTQDKKY  344

Query  1295  LYRAKAFGCFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             LYRA  F  +  D       +   +  D PFSLFEG+ G  Y   DL  P+KA FPA+EL
Sbjct  345   LYRACKFAEWCLDYG-----EHGCRTPDTPFSLFEGMAGTIYFLADLLVPTKARFPAFEL  399



>ref|XP_008701796.1| PREDICTED: lanC-like protein 2 [Ursus maritimus]
Length=388

 Score =   267 bits (682),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/374 (42%), Positives = 219/374 (59%), Gaps = 23/374 (6%)
 Frame = +2

Query  392   LKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA  571
             +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L  IK   T  
Sbjct  16    IKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYIKR--TLR  73

Query  572   SHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLY  736
             + +   VTFLCG AG  A+GAV       D      ITK  +++  +     DLPDELLY
Sbjct  74    NLSGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRSIVCRDSDLPDELLY  133

Query  737   GRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRR  910
             GRAGYL+A  +LN  +G GTV  S ++ + + II+SG+ LS+ E    + PL+Y+W  ++
Sbjct  134   GRAGYLYALLYLNTEIGPGTVCESAIKEVVSAIIESGKALSREERKAERCPLLYQWHRKQ  193

Query  911   YWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNL  1081
             Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   RF SGNYP++  + E D L
Sbjct  194   YVGAAHGVAGIYYMLMQPAAKVDQETLTEMVKPSVDYVRHKRFRSGNYPSSLSN-ETDRL  252

Query  1082  VHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVF  1258
             VHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y F
Sbjct  253   VHWCHGAPGVVHMLVQAYKVFKEEKYLKDAMECSDVIWQRGLLRKGYGICHGTAGNGYAF  312

Query  1259  LSLYRLTGKEEYLYRAKAFG--CFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLD  1432
             LSLY LT  ++YLYRA  F   C  +      I        D P+SLFEG+ G  +   D
Sbjct  313   LSLYHLTQDKKYLYRACKFAEWCLEYGAHGCRIP-------DRPYSLFEGMAGAIHFLSD  365

Query  1433  LADPSKALFPAYEL  1474
             +  P  + FPA+EL
Sbjct  366   ILAPETSRFPAFEL  379



>ref|XP_005658651.1| PREDICTED: lanC-like protein 2-like [Sus scrofa]
Length=431

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 159/388 (41%), Positives = 226/388 (58%), Gaps = 27/388 (7%)
 Frame = +2

Query  350   HNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDL  529
             HN  ++R++     +KD + +   G +     D + YTG  G A L L+ Y+VT + + L
Sbjct  10    HN-FTRRIQSK---IKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQNYL  65

Query  530   SLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLP  709
                L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  
Sbjct  66    LRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDGESQECITKLLQLQRT  123

Query  710   V-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
             +     DLPDELL+GRAGYL+A  ++N  +G G V  S ++ + + II SG+ LSK E  
Sbjct  124   IVCRDSDLPDELLFGRAGYLYALLYVNTEMGPGAVCESAIKEVVDAIIDSGKTLSKEERK  183

Query  875   --KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSG  1039
               + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ YM   RF SG
Sbjct  184   AERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSG  243

Query  1040  NYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-  1216
             NYP++   +E D LVHWCHGAPG+  TL +A K+F+ E++ + A++  +V+W+RGLL++ 
Sbjct  244   NYPSSL-SNETDRLVHWCHGAPGVIHTLMQAYKVFKEEKYLRDAVECSDVIWQRGLLRKG  302

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG--CFLHDRAHTLITDGIMQRGDHPFS  1390
              GICHG +GN Y FLSLYRLT  ++YLYRA  F   C  +      I        D P+S
Sbjct  303   YGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLEYGAHGCRIP-------DRPYS  355

Query  1391  LFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             LFEG+ G  +   D+  P  A FPA+EL
Sbjct  356   LFEGMAGAIHFLSDILAPETARFPAFEL  383



>ref|XP_006074845.1| PREDICTED: lanC-like protein 2, partial [Bubalus bubalis]
Length=389

 Score =   266 bits (681),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 223/387 (58%), Gaps = 26/387 (7%)
 Frame = +2

Query  353   NTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLS  532
             N  ++R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L 
Sbjct  3     NNFTRRIQTK---IKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLL  59

Query  533   LCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV  712
               L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  +
Sbjct  60    RSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTI  117

Query  713   -----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL-  874
                  DLPDELLYGRAGYL+A  ++N  +G G V  S ++ + N II+SG+ LSK E   
Sbjct  118   VCRDSDLPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKV  177

Query  875   -KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGN  1042
              + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ YM   RF SGN
Sbjct  178   ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN  237

Query  1043  YPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-V  1219
             YP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + A++  +V+W+RGLL++  
Sbjct  238   YPSSLSN-ETDRLVHWCHGAPGVIHVLMQAYKVFKEEKYLKDAVECSDVIWQRGLLRKGY  296

Query  1220  GICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG--CFLHDRAHTLITDGIMQRGDHPFSL  1393
             GICHG +GN Y FLSLY +T  ++YLYRA  F   C  +      I        D P+SL
Sbjct  297   GICHGTAGNGYSFLSLYHITQDKKYLYRACKFAEWCLEYGAHGCRIP-------DRPYSL  349

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             FEG+ G  +   D+  P  + FPA+EL
Sbjct  350   FEGMAGTIHFLSDILAPEASRFPAFEL  376



>ref|XP_003982670.1| PREDICTED: lanC-like protein 2 [Felis catus]
Length=454

 Score =   268 bits (686),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/403 (40%), Positives = 226/403 (56%), Gaps = 23/403 (6%)
 Frame = +2

Query  305   PHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAF  484
             P  T D L          I    ++    +KD + +   G +     D + YTG  G A 
Sbjct  52    PQPTADELGLPFHNDGKIIHNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIAL  111

Query  485   LLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDE  664
             L L+ Y+VT +   L   L  +K   T  +     VTFLCG AG  A+GAV       D 
Sbjct  112   LYLQLYRVTCDQTYLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDC  169

Query  665   LLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIAN  829
                  ITK  +++  +     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + +
Sbjct  170   ESQECITKLLQLQKTIVCRDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVS  229

Query  830   EIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDV  994
              II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E V
Sbjct  230   AIIESGKTLSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMV  289

Query  995   KATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAM  1174
             K ++ Y+   RF SGNYP++  + E D LVHWCHGAPG+   LT+A K+F+ E++ + AM
Sbjct  290   KPSIDYVRHKRFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLTQAYKVFKEEKYLKEAM  348

Query  1175  DAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG--CFLHDRAHT  1345
             +  +V+W+RGLL++  GICHG +GN Y FLSLY LT  ++YLYRA  F   C  +     
Sbjct  349   ECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGC  408

Query  1346  LITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              I        D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  409   RIP-------DRPYSLFEGMAGAIHFLSDILVPETSRFPAFEL  444



>ref|XP_005360945.1| PREDICTED: lanC-like protein 2 [Microtus ochrogaster]
Length=450

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 157/384 (41%), Positives = 226/384 (59%), Gaps = 21/384 (5%)
 Frame = +2

Query  359   ISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLC  538
             +S  +K+    +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   
Sbjct  70    VSNFIKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRS  129

Query  539   LQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV--  712
             L  +K   T  + +   VTFLCG AG  A+GAV       +      ITK  ++   V  
Sbjct  130   LDYVKR--TLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTVVC  187

Query  713   ---DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--K  877
                +LPDELLYGRAGYL+A  +LN  +G GTV  + ++ +   II+SG+ LS+ E    +
Sbjct  188   QESELPDELLYGRAGYLYALLYLNTEIGPGTVGETAIKEVVTAIIESGKTLSREERKTER  247

Query  878   SPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYP  1048
              PL+Y+W  ++Y GAAHG+AGI Y LM+ E K D++   E VK ++ Y+   +F SGNYP
Sbjct  248   CPLLYQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYP  307

Query  1049  AAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGI  1225
             ++   +E D LVHWCHGAPG+   L +A ++F+ E++ + AM+  +V+W+RGLL++  GI
Sbjct  308   SSL-SNETDRLVHWCHGAPGVTHMLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGI  366

Query  1226  CHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEG  1402
             CHG SGN Y FLSLY LT  ++YLYRA  F  +  D  AH        +  D P+SLFEG
Sbjct  367   CHGTSGNGYSFLSLYHLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEG  420

Query  1403  IGGMAYLFLDLADPSKALFPAYEL  1474
             + G  +   D+  P  + FPA+EL
Sbjct  421   MAGAVHFLSDILVPETSRFPAFEL  444



>ref|XP_005904454.1| PREDICTED: lanC-like protein 2 [Bos mutus]
 ref|XP_010832232.1| PREDICTED: lanC-like protein 2 isoform X1 [Bison bison bison]
 gb|ELR50053.1| LanC-like protein 2 [Bos mutus]
Length=452

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 168/441 (38%), Positives = 244/441 (55%), Gaps = 30/441 (7%)
 Frame = +2

Query  206   LDMQGSEMAEERYYPNEMAAFIPETTTVVQEIAPHGTKDSLA-KLLSLPHNT----ISKR  370
             L + G    E+R +PN    +  E     Q   P  ++  L+ + L LP ++    I+  
Sbjct  11    LQLGGDADMEDRAFPNPFPDY--EAAAERQAEEPPCSRTPLSPEELGLPFHSDGKIINNF  68

Query  371   LKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
              ++    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L  +
Sbjct  69    TRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLLRSLDYV  128

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----D  715
             K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  +     D
Sbjct  129   KR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTIVCRDSD  186

Query  716   LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLM  889
             LPDELLYGRAGYL+A  ++N  +G G V  S ++ + N II+SG+ LSK E    + PL+
Sbjct  187   LPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKVERCPLL  246

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEG  1060
             Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ YM   RF SGNYP++  
Sbjct  247   YQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGNYPSSLS  306

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGI  1237
             + E D LVHWCHGAPG+   L +A K+F+ E++ + A++  +V+W+RGLL++  GICHG 
Sbjct  307   N-ETDRLVHWCHGAPGVIHVLMQAHKVFKEEKYLKDAVECSDVIWQRGLLRKGYGICHGT  365

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFG--CFLHDRAHTLITDGIMQRGDHPFSLFEGIGG  1411
             +GN Y FLSLY +T  ++YLYRA  F   C  +      I        D P+SLFEG+ G
Sbjct  366   AGNGYSFLSLYHITQDKKYLYRACKFAEWCLEYGAHGCRIP-------DRPYSLFEGMAG  418

Query  1412  MAYLFLDLADPSKALFPAYEL  1474
               +   D+  P  + FPA+EL
Sbjct  419   TIHFLSDILAPEASRFPAFEL  439



>ref|XP_004018608.1| PREDICTED: lanC-like protein 2 [Ovis aries]
Length=392

 Score =   266 bits (680),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 225/386 (58%), Gaps = 24/386 (6%)
 Frame = +2

Query  353   NTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLS  532
             N  ++R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L 
Sbjct  6     NNFARRIQT---KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLL  62

Query  533   LCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV  712
               L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  V
Sbjct  63    RSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTV  120

Query  713   -----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL-  874
                  DLPDELLYGRAGYL+A  ++N  +G G V  S ++ + + II+SG+ LS+ E   
Sbjct  121   VCRDSDLPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVSAIIESGKALSREERKV  180

Query  875   -KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGN  1042
              + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ YM   RF SGN
Sbjct  181   ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN  240

Query  1043  YPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-V  1219
             YP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + A++  +V+W+RGLL++  
Sbjct  241   YPSSLSN-ETDRLVHWCHGAPGVIHVLVQAYKVFKEEKYLKDAVECSDVIWQRGLLRKGY  299

Query  1220  GICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLF  1396
             GICHG +GN Y FLSLY +T  ++YLYRA  F  +  D  AH        +  D P+SLF
Sbjct  300   GICHGTAGNGYAFLSLYHITQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLF  353

Query  1397  EGIGGMAYLFLDLADPSKALFPAYEL  1474
             EG+ G  +   D+  P  + FPA+EL
Sbjct  354   EGMAGTVHFLSDILAPEASRFPAFEL  379



>ref|XP_003943908.1| PREDICTED: lanC-like protein 2 isoform X1 [Saimiri boliviensis 
boliviensis]
Length=457

 Score =   268 bits (685),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 161/387 (42%), Positives = 228/387 (59%), Gaps = 25/387 (6%)
 Frame = +2

Query  350   HNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDL  529
             HN I +R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L
Sbjct  71    HNFI-RRIQT---KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYL  126

Query  530   SLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLP  709
                L  +K   T  +     VTFLCG AG  A+GAV       D      +TK  +++  
Sbjct  127   LRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQKA  184

Query  710   V-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL  874
             V     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ LS+ E  
Sbjct  185   VVCQESDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERK  244

Query  875   --KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSG  1039
               + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SG
Sbjct  245   TERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKKFRSG  304

Query  1040  NYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-  1216
             NYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++ 
Sbjct  305   NYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKG  363

Query  1217  VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSL  1393
              GICHG +GN Y FLSLYRLT  ++YLYRA  F  +  D  AH        +  D P+SL
Sbjct  364   YGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSL  417

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             FEG+ G  +   D+  P  + FPA+EL
Sbjct  418   FEGMAGAIHFLSDVLGPEASRFPAFEL  444



>ref|XP_006236642.2| PREDICTED: lanC-like protein 2 isoform X1 [Rattus norvegicus]
Length=407

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 154/380 (41%), Positives = 227/380 (60%), Gaps = 21/380 (6%)
 Frame = +2

Query  371   LKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
             +K+    +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   L  +
Sbjct  31    IKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYV  90

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----D  715
             K   T  + +   VTFLCG AG  A+GAV       +      ITK  ++   +     +
Sbjct  91    KR--TLRNLSGRRVTFLCGDAGPLAVGAVIYHKLKSECESQECITKLLQMHRTIVCQESE  148

Query  716   LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLE--NLKSPLM  889
             LPDELL+GRAGYL+A  +LN  +G GTV  + ++ +   II+SG++LS+ E  + + PL+
Sbjct  149   LPDELLFGRAGYLYALLYLNTEIGPGTVGETAIKEVVTAIIESGKRLSREERKSERCPLL  208

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEG  1060
             Y+W  ++Y GAAHG+AGI Y LM+ E K D++   E VK ++ Y+   +F SGNYP++  
Sbjct  209   YQWHRKQYVGAAHGMAGIYYMLMQPEAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-  267

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGI  1237
              +E D LVHWCHGAPG+   L +A ++F+ E++ + AM+  +V+W+RGLL++  GICHG 
Sbjct  268   SNETDRLVHWCHGAPGVIHMLLRAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGT  327

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGM  1414
             +GN Y FLSLY+LT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ G 
Sbjct  328   AGNGYSFLSLYQLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGA  381

Query  1415  AYLFLDLADPSKALFPAYEL  1474
              +   D+  P  A FPA+EL
Sbjct  382   VHFLSDMLVPETARFPAFEL  401



>ref|XP_006236643.1| PREDICTED: lanC-like protein 2 isoform X2 [Rattus norvegicus]
Length=363

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 150/355 (42%), Positives = 217/355 (61%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VTG+   L   L  +K   T  + +   VTFLCG AG  A
Sbjct  12    DCSAYTGWTGIALLYLQLYRVTGDQTYLLRSLDYVK--RTLRNLSGRRVTFLCGDAGPLA  69

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       +      ITK  ++   +     +LPDELL+GRAGYL+A  +LN  +G 
Sbjct  70    VGAVIYHKLKSECESQECITKLLQMHRTIVCQESELPDELLFGRAGYLYALLYLNTEIGP  129

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLE--NLKSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTV  + ++ +   II+SG++LS+ E  + + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  130   GTVGETAIKEVVTAIIESGKRLSREERKSERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  189

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
             E K D++   E VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A 
Sbjct  190   EAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLLRAY  248

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             ++F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLY+LT  ++YLYRA  
Sbjct  249   QVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYQLTQDKKYLYRACK  308

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  A FPA+EL
Sbjct  309   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAVHFLSDMLVPETARFPAFEL  357



>ref|XP_004877353.1| PREDICTED: lanC-like protein 2 [Heterocephalus glaber]
Length=443

 Score =   267 bits (683),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 153/355 (43%), Positives = 214/355 (60%), Gaps = 21/355 (6%)
 Frame = +2

Query  446   DYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYA  625
             D + YTG  G A L L+ Y+VTG+   L   L  +K   T  + +   VTFLCG AG  A
Sbjct  92    DCSAYTGWTGVALLYLQLYRVTGDQTHLLRSLDYVKR--TLRNLSGRRVTFLCGDAGPLA  149

Query  626   LGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGK  790
             +GAV       D      ITK  ++   V     +LPDELLYGRAGYL+A  ++N  +G 
Sbjct  150   VGAVIYHKLKSDCESQECITKLLQLHRTVVCQESELPDELLYGRAGYLYALLYVNTEIGP  209

Query  791   GTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEV  964
             GTVS S +R + N II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+ 
Sbjct  210   GTVSESAVREVVNAIIESGKTLSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQP  269

Query  965   ELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAA  1135
               K D++   E VK ++ Y+   +F SGNYP++   +E D LVHWCHGAPG+   L +A 
Sbjct  270   SAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLLQAY  328

Query  1136  KIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKA  1312
             ++F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y FLSLY LT   ++LYRA  
Sbjct  329   QVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDRKHLYRACK  388

Query  1313  FGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             F  +  D  AH        +  D P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  389   FAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDVLMPETSRFPAFEL  437



>ref|XP_003766010.1| PREDICTED: lanC-like protein 1 [Sarcophilus harrisii]
Length=411

 Score =   266 bits (680),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 154/394 (39%), Positives = 222/394 (56%), Gaps = 20/394 (5%)
 Frame = +2

Query  329   AKLLSLPHNTISKRLKQDALTLKDEVVRETW-----GARGRRVTDYTLYTGALGTAFLLL  493
             +K  ++ +   S RL  D     +  +RE       G +     D T YTG  G A L L
Sbjct  26    SKSQTMEYFDTSGRLTTDFSQRINNKIRELLQQMEIGLKSADRRDCTTYTGWAGIALLYL  85

Query  494   KAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLH  673
               Y+V G+   L +  + +K      +  +  +TFLCG AG  A+GAV     G+++ + 
Sbjct  86    HLYEVYGDPVYLQMSHEYVKKSLNTLTKRT--ITFLCGDAGPLAIGAVVYHKMGNEKQVE  143

Query  674   HYITKFKEI-KLPVDLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGR  850
               +T+   + KL    PDE+LYGR GY++A  F+NK  G+  +   H++ I + ++ SG 
Sbjct  144   DCLTRLVHLHKLDPRAPDEMLYGRMGYIYALLFVNKYFGQEKIPQHHIQQICDMVVSSGE  203

Query  851   KLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDE---QEDVKATLRYM  1015
              L++  N   K+PLMYEW    Y GAAHGLAGI Y LM+  L+  +      VK ++ Y+
Sbjct  204   GLARKRNFISKTPLMYEWYQEYYVGAAHGLAGIYYFLMQPVLQVSQVKLHNVVKPSVDYV  263

Query  1016  IKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVW  1195
                +FPSGNYP+   DD  D LVHWCHGAPG+   L +A KIF+ E++   A    +V+W
Sbjct  264   CDLKFPSGNYPSCV-DDTRDLLVHWCHGAPGVIYMLVQAYKIFDEEKYLNDAFKCADVIW  322

Query  1196  KRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQR  1372
             K GLL++  G+CHG++GNAY FLSLY++T   +YLYRA  F  +  D       + + + 
Sbjct  323   KYGLLRKGYGLCHGVAGNAYAFLSLYKITHDVKYLYRACKFAEWCLDYG-----EHVCRT  377

Query  1373  GDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              D PFSLFEG+ G  Y   DL  P+KA FPA+E+
Sbjct  378   PDTPFSLFEGMAGTIYFLSDLLVPTKARFPAFEI  411



>ref|XP_008576884.1| PREDICTED: lanC-like protein 2 [Galeopterus variegatus]
Length=441

 Score =   267 bits (682),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 157/380 (41%), Positives = 222/380 (58%), Gaps = 21/380 (6%)
 Frame = +2

Query  371   LKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQII  550
             +K+    +KD + +   G +     D + YTG  G A L L+ Y+VT +   L   L  +
Sbjct  65    IKRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYV  124

Query  551   KACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----D  715
             K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  V     D
Sbjct  125   KR--TLRNLNGRRVTFLCGDAGPLAVGAVIYHKLNSDSESRECITKLLQLQRTVVCQDSD  182

Query  716   LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLM  889
             LPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ LS+ E    + PL+
Sbjct  183   LPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLL  242

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEG  1060
             Y+W  ++Y GAAHG+AGI Y LM+     D++   E VK ++ Y+   +F SGNYP++  
Sbjct  243   YQWHRKQYVGAAHGMAGIYYMLMQPAANVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-  301

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGI  1237
              +E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++  GICHG 
Sbjct  302   SNETDRLVHWCHGAPGVIHMLMQAHKVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGT  361

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGM  1414
             +GN Y FLSLY LT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+ G 
Sbjct  362   AGNGYSFLSLYHLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGA  415

Query  1415  AYLFLDLADPSKALFPAYEL  1474
              +   D+  P  + FPA+EL
Sbjct  416   IHFLSDVLVPETSQFPAFEL  435



>ref|NP_001095726.1| lanC-like protein 2 [Bos taurus]
 gb|AAI49312.1| LANCL2 protein [Bos taurus]
Length=433

 Score =   266 bits (681),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 156/387 (40%), Positives = 223/387 (58%), Gaps = 26/387 (7%)
 Frame = +2

Query  353   NTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLS  532
             N  ++R++     +KD + +   G +     D + YTG  G A L L+ Y+VT +   L 
Sbjct  48    NNFTRRIQT---KIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQSYLL  104

Query  533   LCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV  712
               L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  +++  +
Sbjct  105   RSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLKSDCESQECITKLLQLQRTI  162

Query  713   -----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL-  874
                  DLPDELLYGRAGYL+A  ++N  +G G V  S ++ + N II+SG+ LSK E   
Sbjct  163   VCRDSDLPDELLYGRAGYLYALLYVNTEIGPGAVCESAIKEVVNAIIESGKALSKEEKKV  222

Query  875   -KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGN  1042
              + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ YM   RF SGN
Sbjct  223   ERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYMRHKRFRSGN  282

Query  1043  YPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-V  1219
             YP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + A++  +V+W+RGLL++  
Sbjct  283   YPSSLSN-ETDRLVHWCHGAPGVIHVLMQAHKVFKEEKYLKDAVECSDVIWQRGLLRKGY  341

Query  1220  GICHGISGNAYVFLSLYRLTGKEEYLYRAKAFG--CFLHDRAHTLITDGIMQRGDHPFSL  1393
             GICHG +GN Y FLSLY +T  ++YLYRA  F   C  +      I        D P+SL
Sbjct  342   GICHGTAGNGYSFLSLYHITQDKKYLYRACKFAEWCLEYGAHGCRIP-------DRPYSL  394

Query  1394  FEGIGGMAYLFLDLADPSKALFPAYEL  1474
             FEG+ G  +   D+  P  + FPA+EL
Sbjct  395   FEGMAGTIHFLSDILAPEASRFPAFEL  421



>ref|XP_004646693.1| PREDICTED: lanC-like protein 2 [Octodon degus]
Length=449

 Score =   267 bits (682),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 159/383 (42%), Positives = 222/383 (58%), Gaps = 20/383 (5%)
 Frame = +2

Query  359   ISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLC  538
             I    K+    +KD + +   G +     D + YTG  G A L L+  +VTG+   L   
Sbjct  70    IQNFTKRIQTKIKDLLQQMEEGLKTADPHDCSTYTGWTGIALLYLQLSRVTGDQTHLLRS  129

Query  539   LQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV--  712
             L  +K   T  +     VTFLCG AG  A+GAV       D      ITK  ++   V  
Sbjct  130   LDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVHHKLKSDCESQECITKLLQLHRTVCQ  187

Query  713   --DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KS  880
               +LPDELLYGRAGYL+A  +LN  +G GTV  S ++ + N II+SG+ LS+ E    + 
Sbjct  188   ESELPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERC  247

Query  881   PLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPA  1051
             PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   RF SGNYP+
Sbjct  248   PLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMVKPSIDYVRHKRFRSGNYPS  307

Query  1052  AEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGIC  1228
             +  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM+  +V+W+RGLL++  GIC
Sbjct  308   SLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMECSDVIWQRGLLRKGYGIC  366

Query  1229  HGISGNAYVFLSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGI  1405
             HG +GN Y FLSLY LT  ++YLYRA  F  +  D  AH        +  D P+SLFEG+
Sbjct  367   HGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGM  420

Query  1406  GGMAYLFLDLADPSKALFPAYEL  1474
              G  +   D+  P  + FPA+EL
Sbjct  421   AGAIHFLSDVLVPETSRFPAFEL  443



>ref|XP_006022339.1| PREDICTED: lanC-like protein 1 [Alligator sinensis]
Length=399

 Score =   265 bits (678),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 154/360 (43%), Positives = 206/360 (57%), Gaps = 19/360 (5%)
 Frame = +2

Query  422   GARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFL  601
             G +     D T YTG  G A L L  Y V G+   L +  + +K   +  +  S  +TFL
Sbjct  50    GLKSADPRDCTTYTGWAGIALLYLHLYDVYGDPSYLQVAQEYVKKSLSCLTKRS--ITFL  107

Query  602   CGQAGIYALGAVAAKHCGDDELLHHYITKFKEI-KLPVDLPDELLYGRAGYLWACSFLNK  778
             CG AG  A+GAV       ++     IT+   + KL   +PDELLYGR GYL+A  FLNK
Sbjct  108   CGDAGPLAIGAVVYHKLQHEKQAEDCITRLLHLHKLDARVPDELLYGRIGYLYALVFLNK  167

Query  779   NLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYA  952
             + G+  +  SH++ ++  ++ SG  L+K  N   KSPLMYEW    Y GAAHGLAGI Y 
Sbjct  168   HFGEEKIPQSHIQQVSEAVVASGENLAKRRNFTAKSPLMYEWYQEYYIGAAHGLAGIYYY  227

Query  953   LMEVELKPDE---QEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTL  1123
             LM+  L   +      VK ++ Y+ + +FPSGNYP    DD  D LVHWCHGAPG+   L
Sbjct  228   LMQSGLGVSQVKLHNTVKPSMDYVCQLKFPSGNYPPCI-DDTRDLLVHWCHGAPGVIYML  286

Query  1124  TKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLY  1300
              +A K+F  +++   A+   EV+W+ GLLK+  G+CHG +GNAY FL+LY LT   +YLY
Sbjct  287   AQAYKVFGDQQYLNDALQCAEVIWQFGLLKKGYGLCHGTAGNAYAFLTLYNLTQNMKYLY  346

Query  1301  RAKAFG--CFLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
             RA  F   C  + + H   T       D PFSLFEG+ G  Y   D+  P+KA FPA+EL
Sbjct  347   RACKFAEWCLSYGQ-HGCRTP------DTPFSLFEGMAGTIYFLADILVPTKAKFPAFEL  399



>gb|KFK43530.1| hypothetical protein AALP_AA1G138200 [Arabis alpina]
Length=290

 Score =   261 bits (667),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 156/215 (73%), Gaps = 2/215 (1%)
 Frame = +2

Query  383   ALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACD  562
             A T   +VV ETW   G+ V DY +YTG LGTA+LL K+Y VT N +DL LCL+I+KACD
Sbjct  23    AETEAQKVVLETWDRCGKHVRDYNMYTGVLGTAYLLFKSYLVTSNQEDLKLCLEIVKACD  82

Query  563   TAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGR  742
               AS  S  VTF CG AG+ ALGAV AK  GDD+L   Y+T+F+EI+LP+DLP ELLYGR
Sbjct  83    VVASKDSLRVTFFCGYAGVCALGAVVAKCIGDDQLQDRYLTRFREIRLPIDLPYELLYGR  142

Query  743   AGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGA  922
              GYLW C FLNK++GK +VSS+ MR +  EI + GR+L K    + PLMYEW G++YWGA
Sbjct  143   VGYLWGCLFLNKHIGKDSVSSARMRFVVEEIFRGGRQLGK--RGECPLMYEWHGKKYWGA  200

Query  923   AHGLAGIMYALMEVELKPDEQEDVKATLRYMIKNR  1027
             AHGLAGIM+ LM +EL+PDE EDVK    Y+ + +
Sbjct  201   AHGLAGIMHVLMHMELEPDEIEDVKGKSEYLYRAK  235


 Score =   105 bits (263),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/92 (55%), Positives = 65/92 (71%), Gaps = 7/92 (8%)
 Frame = +2

Query  1220  GICHGISGNAYVFL-------SLYRLTGKEEYLYRAKAFGCFLHDRAHTLITDGIMQRGD  1378
             G  HG++G  +V +        +  + GK EYLYRAKAF  FL D++  LIT+G MQ GD
Sbjct  199   GAAHGLAGIMHVLMHMELEPDEIEDVKGKSEYLYRAKAFASFLLDKSEKLITEGKMQGGD  258

Query  1379  HPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              PFSLFEGIGGM+Y+FLD+ DP++ALFP YEL
Sbjct  259   RPFSLFEGIGGMSYMFLDMIDPTQALFPGYEL  290



>ref|XP_004839896.1| PREDICTED: lanC-like protein 2 isoform X1 [Heterocephalus glaber]
Length=449

 Score =   266 bits (681),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 156/373 (42%), Positives = 221/373 (59%), Gaps = 21/373 (6%)
 Frame = +2

Query  392   LKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAA  571
             +KD + +   G +     D + YTG  G A L L+ Y+VTG+   L   L  +K   T  
Sbjct  80    IKDLLQQMEEGLKTADPHDCSAYTGWTGVALLYLQLYRVTGDQTHLLRSLDYVKR--TLR  137

Query  572   SHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEIKLPV-----DLPDELLY  736
             + +   VTFLCG AG  A+GAV       D      ITK  ++   V     +LPDELLY
Sbjct  138   NLSGRRVTFLCGDAGPLAVGAVIYHKLKSDCESQECITKLLQLHRTVVCQESELPDELLY  197

Query  737   GRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRR  910
             GRAGYL+A  ++N  +G GTVS S +R + N II+SG+ LS+ E    + PL+Y+W  ++
Sbjct  198   GRAGYLYALLYVNTEIGPGTVSESAVREVVNAIIESGKTLSREERKAERCPLLYQWHRKQ  257

Query  911   YWGAAHGLAGIMYALMEVELKPDEQ---EDVKATLRYMIKNRFPSGNYPAAEGDDEADNL  1081
             Y GAAHG+AGI Y LM+   K D++   E VK ++ Y+   +F SGNYP++   +E D L
Sbjct  258   YVGAAHGMAGIYYMLMQPSAKVDQETLTEMVKPSIDYVRHKKFRSGNYPSSL-SNETDRL  316

Query  1082  VHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVF  1258
             VHWCHGAPG+   L +A ++F+ E++ + AM+  +V+W+RGLL++  GICHG +GN Y F
Sbjct  317   VHWCHGAPGVIHMLLQAYQVFKEEKYLKEAMECSDVIWQRGLLRKGYGICHGTAGNGYSF  376

Query  1259  LSLYRLTGKEEYLYRAKAFGCFLHDR-AHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDL  1435
             LSLY LT   ++LYRA  F  +  D  AH        +  D P+SLFEG+ G  +   D+
Sbjct  377   LSLYHLTQDRKHLYRACKFAEWCLDYGAHGC------RIPDRPYSLFEGMAGAIHFLSDV  430

Query  1436  ADPSKALFPAYEL  1474
               P  + FPA+EL
Sbjct  431   LMPETSRFPAFEL  443



>ref|XP_004417378.1| PREDICTED: lanC-like protein 2 [Odobenus rosmarus divergens]
Length=453

 Score =   266 bits (681),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 161/411 (39%), Positives = 227/411 (55%), Gaps = 39/411 (9%)
 Frame = +2

Query  305   PHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAF  484
             P  T D L          I    ++    +KD + +   G +     D + YTG  G A 
Sbjct  52    PPPTTDELGLPFHNDGKIIHNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIAL  111

Query  485   LLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDE  664
             L L+ Y+VT +   L   L  +K   T  + +   VTFLCG AG  A+GAV       D 
Sbjct  112   LYLQLYRVTCDQTYLLRSLDYVKR--TLRNLSGRRVTFLCGDAGPLAVGAVVYHKLRSDC  169

Query  665   LLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIAN  829
                  ITK  +++  +     DLPDELLYGRAGYL+A  +LN  +G GTV  S ++ + +
Sbjct  170   ESQECITKLLQLQRTIMCRDSDLPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVS  229

Query  830   EIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDV  994
              II+SG+ LS+ E    + PL+Y+W  ++Y GAAHG+AGI Y LM+   K D++   E V
Sbjct  230   AIIESGKTLSREERKAERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMV  289

Query  995   KATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAM  1174
             K ++ Y+   RF SGNYP++  + E D LVHWCHGAPG+   L +A K+F+ E++ + AM
Sbjct  290   KPSIDYVRHKRFRSGNYPSSLSN-ETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAM  348

Query  1175  DAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF----------GC  1321
             +  +V+W+RGLL++  GICHG +GN Y FLSLY LT  ++YLYRA  F          GC
Sbjct  349   ECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGC  408

Query  1322  FLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              + DR               P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  409   RIPDR---------------PYSLFEGMAGAIHFLSDILAPETSQFPAFEL  444



>ref|XP_006276713.1| PREDICTED: lanC-like protein 1 [Alligator mississippiensis]
Length=399

 Score =   265 bits (676),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 157/381 (41%), Positives = 214/381 (56%), Gaps = 22/381 (6%)
 Frame = +2

Query  359   ISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLC  538
              ++RL      L  ++ R   G +     D T YTG  G A L L  Y V G+   L + 
Sbjct  32    FTQRLNNKIRELLQQMER---GLKSADPRDCTAYTGWAGIALLYLHLYDVYGDPSYLQVA  88

Query  539   LQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEI-KLPVD  715
              + +K   +  +  S  +TFLCG AG  A+GAV       ++     IT+   + KL   
Sbjct  89    QEYVKKSLSCLTKRS--ITFLCGDAGPLAIGAVVYLKLQHEKQAEDCITRLLHLHKLDAR  146

Query  716   LPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLM  889
             +PDELLYGR GYL+A  F+NK+ G+  +  SH++ ++  ++ SG  L+K  N   KSPLM
Sbjct  147   VPDELLYGRIGYLYALVFVNKHFGEEKIPQSHIQQVSEAVVASGENLAKRRNFTAKSPLM  206

Query  890   YEWQGRRYWGAAHGLAGIMYALMEVELKPDE---QEDVKATLRYMIKNRFPSGNYPAAEG  1060
             YEW    Y GAAHGLAGI Y LM+  L   +      VK ++ Y+ + +FPSGNYP    
Sbjct  207   YEWYQEYYIGAAHGLAGIYYYLMQSGLGVSQVKLHNTVKPSMDYVCQLKFPSGNYPPCI-  265

Query  1061  DDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGI  1237
             DD  D LVHWCHGAPG+   L +A K+F  +++   A+   EV+W+ GLLK+  G+CHG 
Sbjct  266   DDTRDLLVHWCHGAPGVIYMLAQAYKVFGDQQYLNDALQCAEVIWQFGLLKKGYGLCHGT  325

Query  1238  SGNAYVFLSLYRLTGKEEYLYRAKAFG--CFLHDRAHTLITDGIMQRGDHPFSLFEGIGG  1411
             +GNAY FL+LY LT   +YLYRA  F   C  + + H   T       D PFSLFEG+ G
Sbjct  326   AGNAYAFLTLYNLTQNMKYLYRACKFAEWCLSYGQ-HGCRTP------DTPFSLFEGMAG  378

Query  1412  MAYLFLDLADPSKALFPAYEL  1474
               Y   D+  P+KA FPA+EL
Sbjct  379   TIYFLADILVPTKAKFPAFEL  399



>ref|XP_010661310.1| PREDICTED: lanC-like protein GCL2 [Vitis vinifera]
Length=270

 Score =   260 bits (664),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/265 (50%), Positives = 183/265 (69%), Gaps = 11/265 (4%)
 Frame = +2

Query  260   AAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRR  439
             +  + ET    +E    G KDSL KLLS+P + +S+RLK+ AL LK+  V ETWG  G+ 
Sbjct  3     SELVEETPPTQEETPAQGGKDSLIKLLSIPFSALSQRLKRTALDLKETAVIETWGLIGQH  62

Query  440   VTDYTLYT--GALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQA  613
             V D+TLY+  G LGT +LL  AY VT N  DL LC +I+KACD+  S  S  +TF+CG+A
Sbjct  63    VRDFTLYSESGVLGTTYLL--AYLVTANKTDLGLCSEIVKACDST-SFGSKDITFICGRA  119

Query  614   GIYALGAVAAKHCGDDELLHHYITKFKEIKLPVDLPDELLYGRAGYLWACSFLNKNLGKG  793
             G+ ALGAV  K+ GD+ L+++Y+++F EIKLP  LPDELLYGR G+LWAC FLNK++G+G
Sbjct  120   GVCALGAVVVKYSGDERLMNYYLSRFNEIKLPRSLPDELLYGRVGFLWACLFLNKHIGQG  179

Query  794   TVSSSHMRAIANEIIKSGRKLSKLENLKSPLMYEWQGRRYWGAAHGLAGIMYALMEVELK  973
             TV  ++  A+ +EIIK+G +L+     + PLM+EW G +YWGAAHGL GIM+ LM +EL 
Sbjct  180   TVPPTYTGAVVSEIIKNGIRLAN--KGRCPLMFEWYGEKYWGAAHGLVGIMHVLMRMELI  237

Query  974   PDEQEDVK----ATLRYMIKNRFPS  1036
              DE+E +K     +  + + ++ PS
Sbjct  238   IDEKEMLKHRGCCSFSHDVMSKVPS  262



>ref|XP_006729895.1| PREDICTED: lanC-like protein 2 [Leptonychotes weddellii]
Length=453

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 160/411 (39%), Positives = 227/411 (55%), Gaps = 39/411 (9%)
 Frame = +2

Query  305   PHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRETWGARGRRVTDYTLYTGALGTAF  484
             P  T D L          I    ++    +KD + +   G +     D + YTG  G A 
Sbjct  52    PPPTTDELGLPFHNNGKIIHNFTRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIAL  111

Query  485   LLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVTFLCGQAGIYALGAVAAKHCGDDE  664
             L L+ Y+VTG+   L   L  +K   T  +     VTFLCG AG  A+GAV       D 
Sbjct  112   LYLQLYRVTGDQTHLLRSLDYVKR--TLRNLNGRRVTFLCGDAGPLAVGAVVYHKLRSDC  169

Query  665   LLHHYITKFKEIKLPV-----DLPDELLYGRAGYLWACSFLNKNLGKGTVSSSHMRAIAN  829
                  ITK  +++  +     +LPDELLYGRAGYL+A  +LN  +G GTV  S ++ + +
Sbjct  170   ESQECITKLLQLQRTIVGRDSELPDELLYGRAGYLYALLYLNTEIGPGTVCESAIKEVVS  229

Query  830   EIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIMYALMEVELKPDEQ---EDV  994
              II+SG+ LS+ E    + PL+++W  ++Y GAAHG+AGI Y LM+   K D++   E V
Sbjct  230   AIIESGKTLSREERKAERCPLLFQWHRKQYVGAAHGMAGIYYMLMQPAAKVDQETLTEMV  289

Query  995   KATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIALTLTKAAKIFESEEFEQAAM  1174
             K ++ Y+   RF SGNYP++   +E D LVHWCHGAPG+   L +A K+F+ E++ + AM
Sbjct  290   KPSIDYVRHKRFRSGNYPSSL-SNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKDAM  348

Query  1175  DAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEYLYRAKAF----------GC  1321
             +  +V+W+RGLL++  GICHG +GN Y FLSLY LT  ++YLYRA  F          GC
Sbjct  349   ECSDVIWQRGLLRKGYGICHGTAGNGYSFLSLYHLTQDKKYLYRACKFAEWCLEYGAHGC  408

Query  1322  FLHDRAHTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYEL  1474
              + DR               P+SLFEG+ G  +   D+  P  + FPA+EL
Sbjct  409   RIPDR---------------PYSLFEGMAGAIHFLSDILAPETSQFPAFEL  444



>ref|XP_004767073.1| PREDICTED: lanC-like protein 1 isoform X1 [Mustela putorius furo]
 ref|XP_004767074.1| PREDICTED: lanC-like protein 1 isoform X2 [Mustela putorius furo]
 ref|XP_004767075.1| PREDICTED: lanC-like protein 1 isoform X3 [Mustela putorius furo]
 ref|XP_004767076.1| PREDICTED: lanC-like protein 1 isoform X4 [Mustela putorius furo]
 ref|XP_004767077.1| PREDICTED: lanC-like protein 1 isoform X5 [Mustela putorius furo]
Length=399

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 164/421 (39%), Positives = 226/421 (54%), Gaps = 32/421 (8%)
 Frame = +2

Query  236   ERYYPNEMAAFIPETTTVVQEIAPHGTKDSLAKLLSLPHNTISKRLKQDALTLKDEVVRE  415
             +R +PN  A F         +    G  DS  +L        S+RL      L  ++ R 
Sbjct  3     QRAFPNPYADF--------NKSLAEGYFDSAGRLTP----EFSQRLNNKIRELLQQMER-  49

Query  416   TWGARGRRVTDYTLYTGALGTAFLLLKAYQVTGNNDDLSLCLQIIKACDTAASHASGPVT  595
               G +     D T YTG  G A L L  Y V G+   L +    +K    + S  S  +T
Sbjct  50    --GLKSADPRDSTAYTGWAGIALLYLHLYDVFGDPAYLQMAHGYVKQSLNSLSKRS--IT  105

Query  596   FLCGQAGIYALGAVAAKHCGDDELLHHYITKFKEI-KLPVDLPDELLYGRAGYLWACSFL  772
             FLCG AG  A+GAV      +++     IT+   + K+ +  P+E+LYGR GY++A  F+
Sbjct  106   FLCGDAGPLAVGAVVYHKMNNEKQAEDCITRLIHLNKIDLHAPNEVLYGRMGYIYALLFV  165

Query  773   NKNLGKGTVSSSHMRAIANEIIKSGRKLSKLENL--KSPLMYEWQGRRYWGAAHGLAGIM  946
             NKN G   +  SH++ I   ++ SG  L++  N   K+PLMYEW    Y GAAHGLAGI 
Sbjct  166   NKNFGVEKIPQSHIQQICETVLTSGETLARKRNFTAKTPLMYEWYQEYYVGAAHGLAGIY  225

Query  947   YALMEVELKPDE---QEDVKATLRYMIKNRFPSGNYPAAEGDDEADNLVHWCHGAPGIAL  1117
             Y LM+  L+ +    Q  VK ++ Y+ + +FPSGNYP    DD  D LVHWCHG+PG+  
Sbjct  226   YFLMQPSLQVNHVKLQNLVKPSVDYVCQLKFPSGNYPPCV-DDNRDLLVHWCHGSPGVIY  284

Query  1118  TLTKAAKIFESEEFEQAAMDAGEVVWKRGLLKR-VGICHGISGNAYVFLSLYRLTGKEEY  1294
              L +A K+F  E +   A   G+++W+ GLL++  G+CHG +GNAY FL+LY LT  ++Y
Sbjct  285   MLIQAYKVFREERYLNDAYQCGDLIWQYGLLRKGYGLCHGTAGNAYAFLTLYNLTQDKKY  344

Query  1295  LYRAKAFGCFLHDRA-HTLITDGIMQRGDHPFSLFEGIGGMAYLFLDLADPSKALFPAYE  1471
             LYRA  F  +  D   H   T       D PFSLFEG+ G  Y   DL  P+KA FPA+E
Sbjct  345   LYRACKFAEWCLDYGEHGCRTP------DTPFSLFEGMAGTIYFLADLLVPTKARFPAFE  398

Query  1472  L  1474
             L
Sbjct  399   L  399



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4807603539123