BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c70_g1_i1 len=938 path=[1:0-643 645:644-937]

Length=938
                                                                      Score     E

dbj|BAE44112.1|  CENTRORADIALIS homolog                                 306   3e-101   Ipomoea nil [qian niu]
ref|XP_009594494.1|  PREDICTED: CEN-like protein 2                      304   2e-100   
ref|XP_009611784.1|  PREDICTED: CEN-like protein 4                      299   3e-98    
sp|Q9XH42.1|CET4_TOBAC  RecName: Full=CEN-like protein 4                298   9e-98    Nicotiana tabacum [American tobacco]
ref|XP_009777303.1|  PREDICTED: CEN-like protein 2                      295   8e-97    
ref|NP_001233974.1|  protein SELF-PRUNING                               294   3e-96    
ref|XP_010045223.1|  PREDICTED: CEN-like protein 2                      292   1e-95    
ref|NP_001275478.1|  terminal flower 1 protein                          292   2e-95    
gb|ACL27223.1|  fasciculate                                             291   3e-95    Capsicum frutescens [bird pepper]
ref|XP_011088881.1|  PREDICTED: protein CENTRORADIALIS                  291   4e-95    
ref|XP_007015849.1|  Centroradialis                                     289   2e-94    
gb|AAM46142.1|AF378127_1  terminal flower-like protein 1                288   4e-94    Vitis vinifera
ref|NP_001267929.1|  TFL1A protein                                      288   8e-94    
emb|CAI38702.1|  self-pruning protein                                   287   9e-94    Capsicum annuum
ref|XP_011000909.1|  PREDICTED: CEN-like protein 2                      287   2e-93    
gb|ACY80737.1|  TFL1A protein                                           286   2e-93    Vitis vinifera
gb|ABW24963.1|  terminal flower 1a                                      286   2e-93    Gossypium hirsutum [American cotton]
gb|ABW24967.1|  terminal flower 1a                                      286   2e-93    Gossypium hirsutum [American cotton]
gb|ADF80896.1|  terminal flower 1                                       286   3e-93    
gb|KDP31551.1|  hypothetical protein JCGZ_15206                         285   5e-93    
ref|XP_002312811.1|  TFL1a family protein                               285   5e-93    Populus trichocarpa [western balsam poplar]
gb|ABW24965.1|  terminal flower 1a                                      285   6e-93    Gossypium raimondii
gb|ABW24961.1|  terminal flower 1a                                      285   6e-93    Gossypium arboreum [tree cotton]
ref|XP_006487964.1|  PREDICTED: CEN-like protein 2-like                 285   7e-93    
dbj|BAD22601.1|  flowering locus T like protein                         285   9e-93    Populus nigra [black poplar]
emb|CAJ44126.1|  centroradialis flower development regulation pro...    284   3e-92    Misopates orontium
dbj|BAO93910.1|  terminal flower 1                                      283   3e-92    
gb|AGW23412.1|  terminal flower                                         283   4e-92    
ref|XP_006424257.1|  hypothetical protein CICLE_v10029782mg             283   6e-92    
gb|AGK89940.1|  centroradialis                                          283   6e-92    
gb|AEK06124.1|  terminal flowering 1 protein 1                          283   7e-92    
gb|ADF80900.1|  terminal flower 1                                       282   1e-91    
ref|XP_004291610.1|  PREDICTED: CEN-like protein 2-like                 281   2e-91    
ref|XP_007206006.1|  hypothetical protein PRUPE_ppa012343mg             281   2e-91    
ref|XP_010031504.1|  PREDICTED: protein CENTRORADIALIS-like             281   2e-91    
ref|XP_002453931.1|  hypothetical protein SORBIDRAFT_04g021650          281   3e-91    Sorghum bicolor [broomcorn]
ref|XP_008241250.1|  PREDICTED: CEN-like protein 2                      280   5e-91    
ref|XP_004487504.1|  PREDICTED: CEN-like protein 2-like                 280   5e-91    
gb|AFV67432.1|  centroradialis                                          280   5e-91    
ref|XP_010271687.1|  PREDICTED: protein SELF-PRUNING-like               280   5e-91    
emb|CAC21563.1|  centroradialis                                         280   5e-91    Antirrhinum majus [garden snapdragon]
ref|XP_010557408.1|  PREDICTED: protein CENTRORADIALIS-like             280   6e-91    
emb|CDP06933.1|  unnamed protein product                                280   6e-91    
sp|Q41261.1|CEN_ANTMA  RecName: Full=Protein CENTRORADIALIS             280   8e-91    Antirrhinum majus [garden snapdragon]
gb|AFI93431.1|  terminal flower 1                                       280   9e-91    
gb|AFV67441.1|  centroradialis                                          280   1e-90    
ref|XP_008228487.1|  PREDICTED: CEN-like protein 2                      279   2e-90    
emb|CAC21564.1|  centroradialis                                         279   2e-90    Antirrhinum majus [garden snapdragon]
gb|AFV67438.1|  centroradialis                                          279   2e-90    
gb|AFV67437.1|  centroradialis                                          278   2e-90    
gb|AFV67436.1|  centroradialis                                          278   2e-90    
ref|XP_007202664.1|  hypothetical protein PRUPE_ppa012369mg             278   4e-90    
ref|NP_001276169.1|  CEN-like protein 2-like                            278   4e-90    
gb|KHN27653.1|  CEN-like protein 2                                      278   5e-90    
gb|AFV67433.1|  centroradialis                                          278   5e-90    
gb|AFV67434.1|  centroradialis                                          278   6e-90    
dbj|BAN13572.1|  terminal flower1-like protein                          278   6e-90    
ref|NP_001280940.1|  CEN-like protein 2                                 278   6e-90    
gb|AFV67448.1|  centroradialis                                          278   6e-90    
ref|XP_003596800.1|  Terminal flower                                    278   6e-90    
ref|XP_009371917.1|  PREDICTED: CEN-like protein 2 isoform X2           278   7e-90    
ref|XP_009364306.1|  PREDICTED: CEN-like protein 2 isoform X2           278   7e-90    
gb|AFV67443.1|  centroradialis                                          277   7e-90    
gb|AFV67444.1|  centroradialis                                          277   8e-90    
gb|AFV67439.1|  centroradialis                                          277   8e-90    
ref|XP_009390747.1|  PREDICTED: CEN-like protein 2                      277   8e-90    
gb|AGX25254.1|  MCN5                                                    277   9e-90    
gb|EMT05258.1|  hypothetical protein F775_30982                         277   1e-89    
gb|AFV67442.1|  centroradialis                                          277   1e-89    
ref|XP_008784004.1|  PREDICTED: CEN-like protein 2                      277   1e-89    
ref|XP_006384827.1|  TFL1a family protein                               277   1e-89    
ref|XP_011007279.1|  PREDICTED: CEN-like protein 2                      277   1e-89    
ref|NP_001267654.1|  protein SELF-PRUNING-like                          277   1e-89    
gb|AEO72023.1|  TFL1-like protein                                       276   2e-89    
dbj|BAD22599.1|  terminal flower 1                                      276   2e-89    Populus nigra [black poplar]
gb|AFA42328.1|  TFL1-like protein                                       276   3e-89    
gb|EMS62911.1|  hypothetical protein TRIUR3_23342                       276   3e-89    
ref|NP_001106241.1|  ZCN2 protein                                       276   3e-89    Zea mays [maize]
gb|ADL62862.1|  terminal flower 1                                       276   3e-89    
ref|XP_009592311.1|  PREDICTED: protein SELF-PRUNING-like isoform X2    276   3e-89    
emb|CDP15403.1|  unnamed protein product                                276   3e-89    
ref|XP_010912272.1|  PREDICTED: protein SELF-PRUNING-like               276   4e-89    
gb|AEO72027.1|  TFL1-like protein                                       275   4e-89    
ref|NP_001267006.1|  protein TERMINAL FLOWER 1-like                     275   4e-89    
gb|AGX25244.1|  MCN5                                                    275   6e-89    
gb|ADO61015.1|  terminal flower 1                                       275   6e-89    
ref|NP_001280813.1|  CEN-like protein 2                                 275   6e-89    
gb|AGX25243.1|  MCN4                                                    275   9e-89    
ref|XP_010244607.1|  PREDICTED: CEN-like protein 2                      275   1e-88    
gb|ADO64261.1|  KSN                                                     274   1e-88    
ref|XP_009379789.1|  PREDICTED: protein SELF-PRUNING-like               274   1e-88    
ref|XP_009371916.1|  PREDICTED: CEN-like protein 2 isoform X1           274   1e-88    
ref|XP_009364305.1|  PREDICTED: CEN-like protein 2 isoform X1           274   1e-88    
ref|XP_006647339.1|  PREDICTED: protein SELF-PRUNING-like               274   1e-88    
ref|XP_006652260.1|  PREDICTED: protein SELF-PRUNING-like               274   1e-88    
ref|XP_003575068.1|  PREDICTED: CEN-like protein 2                      274   2e-88    
ref|XP_006430226.1|  hypothetical protein CICLE_v10013475mg             274   2e-88    
ref|XP_009393383.1|  PREDICTED: CEN-like protein 2                      273   2e-88    
dbj|BAL70256.1|  centroradialis                                         273   3e-88    
ref|XP_009411957.1|  PREDICTED: CEN-like protein 2                      273   3e-88    
ref|XP_004952639.1|  PREDICTED: protein SELF-PRUNING-like               273   3e-88    
ref|NP_001066172.1|  Os12g0152000                                       273   4e-88    Oryza sativa Japonica Group [Japonica rice]
emb|CAH67157.1|  H0717B12.4                                             273   5e-88    Oryza sativa [red rice]
ref|NP_001173006.1|  Os02g0531600                                       273   5e-88    
ref|XP_008788083.1|  PREDICTED: protein SELF-PRUNING-like               272   8e-88    
ref|XP_010101582.1|  hypothetical protein L484_015411                   272   9e-88    
ref|XP_003579695.1|  PREDICTED: CEN-like protein 2                      272   9e-88    
ref|XP_010907126.1|  PREDICTED: protein SELF-PRUNING-like               272   9e-88    
ref|XP_002876387.1|  hypothetical protein ARALYDRAFT_486134             272   1e-87    
gb|ABY91243.1|  CTRSTFL-like protein                                    271   2e-87    Citrus trifoliata [hardy orange]
gb|ACX53295.1|  terminal flower 1-like protein                          271   2e-87    
ref|XP_009592303.1|  PREDICTED: protein SELF-PRUNING-like isoform X1    271   2e-87    
ref|XP_002450283.1|  hypothetical protein SORBIDRAFT_05g003200          271   2e-87    Sorghum bicolor [broomcorn]
ref|NP_001052733.1|  Os04g0411400                                       271   2e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010510761.1|  PREDICTED: protein CENTRORADIALIS-like             271   2e-87    
ref|XP_006481791.1|  PREDICTED: protein TERMINAL FLOWER 1 isoform X1    271   2e-87    
gb|AEO72022.1|  RhTFL1                                                  271   3e-87    
gb|ABW24964.1|  terminal flower 1b                                      271   3e-87    Gossypium hirsutum [American cotton]
gb|AGX25250.1|  MCN1                                                    271   3e-87    
ref|NP_180324.1|  protein CENTRORADIALIS-like                           271   3e-87    Arabidopsis thaliana [mouse-ear cress]
gb|AGX25240.1|  MCN1                                                    271   3e-87    
ref|XP_009103610.1|  PREDICTED: protein CENTRORADIALIS-like             271   3e-87    
ref|XP_010089842.1|  hypothetical protein L484_022359                   270   4e-87    
ref|NP_001267931.1|  TFL1B protein                                      270   4e-87    
ref|XP_002442808.1|  hypothetical protein SORBIDRAFT_08g003210          270   4e-87    Sorghum bicolor [broomcorn]
ref|XP_009339416.1|  PREDICTED: CEN-like protein 2                      270   5e-87    
ref|XP_010417907.1|  PREDICTED: protein CENTRORADIALIS-like             270   6e-87    
gb|ABX11008.1|  ZCN6                                                    270   6e-87    Zea mays [maize]
gb|ABY62770.1|  terminal flower 1b                                      270   6e-87    Gossypium hirsutum [American cotton]
gb|AGX25241.1|  MCN2                                                    270   7e-87    
ref|NP_001241437.1|  protein TERMINAL FLOWER 1-like                     270   8e-87    
ref|XP_009792306.1|  PREDICTED: CEN-like protein 2                      269   1e-86    
ref|XP_006409758.1|  hypothetical protein EUTSA_v10017312mg             269   1e-86    
gb|AEH43350.1|  CEN                                                     269   1e-86    
ref|XP_007027716.1|  Centroradialis                                     269   1e-86    
ref|NP_001275848.1|  terminal flower                                    269   1e-86    
ref|XP_003578901.1|  PREDICTED: CEN-like protein 2                      269   2e-86    
gb|ABW24968.1|  terminal flower 1b                                      268   2e-86    Gossypium hirsutum [American cotton]
ref|XP_009766168.1|  PREDICTED: protein TERMINAL FLOWER 1-like          268   2e-86    
gb|ABW24962.1|  terminal flower 1b                                      268   2e-86    Gossypium arboreum [tree cotton]
gb|EMS48180.1|  hypothetical protein TRIUR3_17327                       268   3e-86    
ref|XP_006341131.1|  PREDICTED: CEN-like protein 2-like isoform X1      268   3e-86    
gb|ABW24966.1|  terminal flower 1b                                      268   3e-86    Gossypium raimondii
gb|AHZ46122.1|  TFL1-like flowering time protein                        268   3e-86    
gb|AIU44253.1|  TFL1                                                    268   3e-86    
ref|XP_009140811.1|  PREDICTED: protein CENTRORADIALIS-like             268   4e-86    
ref|NP_001240029.1|  CEN-like protein 2-like                            268   4e-86    
gb|KHN18765.1|  Protein TERMINAL FLOWER 1                               268   4e-86    
gb|EMT24999.1|  hypothetical protein F775_30083                         268   4e-86    
ref|XP_006662737.1|  PREDICTED: CEN-like protein 2-like                 268   5e-86    
ref|NP_001065771.1|  Os11g0152500                                       268   6e-86    Oryza sativa Japonica Group [Japonica rice]
gb|AHB20161.1|  terminal flower 1-like protein                          267   6e-86    
emb|CDX71440.1|  BnaC04g16750D                                          268   6e-86    
ref|XP_004978696.1|  PREDICTED: CEN-like protein 2-like                 267   6e-86    
ref|XP_006341132.1|  PREDICTED: CEN-like protein 2-like isoform X2      267   6e-86    
gb|ACJ61501.1|  terminal flower                                         267   7e-86    
ref|XP_004977568.1|  PREDICTED: CEN-like protein 2-like                 267   7e-86    
ref|XP_010686025.1|  PREDICTED: CEN-like protein 2                      267   8e-86    
ref|NP_001106245.1|  ZCN6 protein                                       267   9e-86    Zea mays [maize]
ref|NP_001105959.1|  LOC100037785                                       267   9e-86    Zea mays [maize]
gb|KDO61123.1|  hypothetical protein CISIN_1g035977mg                   266   1e-85    
gb|ADF30943.1|  Dt1                                                     266   1e-85    
gb|AEO72025.1|  TFL1-like protein                                       266   1e-85    
gb|AGS32268.1|  TFL1-1                                                  266   1e-85    
ref|XP_007162890.1|  hypothetical protein PHAVU_001G189200g             268   2e-85    
dbj|BAM73643.1|  terminal flower1 homologue                             266   2e-85    
ref|XP_009133891.1|  PREDICTED: protein CENTRORADIALIS-like             266   2e-85    
ref|XP_004246534.1|  PREDICTED: CEN-like protein 2                      266   3e-85    
ref|XP_009614479.1|  PREDICTED: protein TERMINAL FLOWER 1-like          265   3e-85    
ref|XP_007150078.1|  hypothetical protein PHAVU_005G124600g             266   3e-85    
gb|ADF30920.1|  Dt1                                                     265   4e-85    
dbj|BAH24197.1|  homologous protein to TFL1                             265   4e-85    Hordeum vulgare [barley]
ref|XP_006293432.1|  hypothetical protein CARUB_v10025606mg             265   6e-85    
ref|XP_003625808.1|  TFL1                                               265   8e-85    
ref|NP_001239629.1|  protein TERMINAL FLOWER 1-like                     264   9e-85    
dbj|BAI66119.1|  terminal flower 1b                                     264   1e-84    Glycine max [soybeans]
gb|KHN14994.1|  Protein CENTRORADIALIS-like                             264   1e-84    
gb|ABX11005.1|  ZCN3                                                    264   1e-84    Zea mays [maize]
ref|XP_006836050.1|  hypothetical protein AMTR_s00114p00070400          264   1e-84    
gb|ADF30918.1|  Dt1                                                     264   1e-84    
gb|ABR53775.2|  TFL1y                                                   263   2e-84    Phaseolus vulgaris [French bean]
dbj|BAJ22384.1|  terminal flower 1a                                     263   2e-84    
ref|XP_011094363.1|  PREDICTED: CEN-like protein 2 isoform X2           263   3e-84    
gb|ABF85670.1|  terminal flower 1-like protein                          263   3e-84    Hordeum vulgare subsp. vulgare [barley]
gb|AAQ93599.1|  CEN/TFL1-like GTP-associated binding protein            263   3e-84    Lotus japonicus
ref|XP_009420516.1|  PREDICTED: CEN-like protein 2                      263   3e-84    
emb|CDY31183.1|  BnaC03g47080D                                          263   4e-84    
ref|NP_001239678.1|  protein SELF-PRUNING-like                          263   4e-84    
ref|XP_004494168.1|  PREDICTED: protein CENTRORADIALIS-like             263   4e-84    
ref|XP_009374732.1|  PREDICTED: protein TERMINAL FLOWER 1-like          263   4e-84    
gb|EYU35477.1|  hypothetical protein MIMGU_mgv1a026117mg                263   5e-84    
gb|AEO72024.1|  TFL1-like protein                                       262   7e-84    
gb|ABI98712.1|  terminal flower 1                                       262   7e-84    Zea mays [maize]
ref|XP_004975557.1|  PREDICTED: CEN-like protein 1-like                 262   8e-84    
ref|NP_001106242.1|  ZCN3 protein                                       262   9e-84    Zea mays [maize]
ref|XP_010521662.1|  PREDICTED: protein CENTRORADIALIS-like             262   9e-84    
gb|AIA10356.1|  TFL1                                                    262   9e-84    
ref|NP_001280887.1|  protein TERMINAL FLOWER 1-like                     262   9e-84    
gb|AFP33418.1|  terminal flower 1                                       262   1e-83    
gb|AGT41971.1|  TFL1                                                    262   1e-83    
ref|XP_006663820.1|  PREDICTED: CEN-like protein 2-like                 261   1e-83    
dbj|BAD10964.1|  TFL1-like protein                                      261   1e-83    Cydonia oblonga [wen po]
ref|XP_010049502.1|  PREDICTED: protein TERMINAL FLOWER 1-like          261   1e-83    
dbj|BAD10966.1|  TFL1-like protein                                      261   1e-83    Eriobotrya japonica [loquat]
gb|AAG31808.1|AF316419_1  terminal flower 1-like protein                261   2e-83    Lolium perenne [perennial ryegrass]
dbj|BAD10965.1|  TFL1-like protein                                      261   2e-83    Chaenomeles sinensis
gb|AHX00603.1|  TFL1a                                                   261   2e-83    
gb|AEH41277.1|  terminal flower 1                                       261   2e-83    
gb|ABP73384.1|  TFL1                                                    260   4e-83    Vicia faba [broad bean]
gb|AFA25738.1|  hypothetical protein                                    260   4e-83    
gb|AIA10351.1|  TFL1                                                    260   6e-83    
gb|ADP00689.1|  CEN                                                     259   6e-83    
gb|ABP73380.1|  TFL1                                                    259   8e-83    Vicia faba [broad bean]
gb|AFK32780.1|  TFL1-like protein                                       259   1e-82    
ref|XP_008462564.1|  PREDICTED: CEN-like protein 2 isoform X2           259   1e-82    
ref|XP_002447782.1|  hypothetical protein SORBIDRAFT_06g015490          259   1e-82    Sorghum bicolor [broomcorn]
gb|ADO60992.1|  terminal flower 1                                       259   1e-82    
gb|AAR03725.1|  TFL1a                                                   259   1e-82    Pisum sativum [garden pea]
gb|ADP00680.1|  CEN                                                     258   1e-82    
dbj|BAD10962.1|  TFL1-like protein                                      258   2e-82    Pyrus pyrifolia [sha li]
ref|XP_011094364.1|  PREDICTED: protein TERMINAL FLOWER 1-like is...    258   2e-82    
gb|ADP00674.1|  CEN                                                     258   2e-82    
gb|ADP00713.1|  CEN                                                     258   2e-82    
gb|ADP00690.1|  CEN                                                     258   2e-82    
gb|ADP00692.1|  CEN                                                     258   2e-82    
gb|ADP00670.1|  CEN                                                     258   3e-82    
gb|ADP00716.1|  CEN                                                     258   3e-82    
gb|ADP00676.1|  CEN                                                     258   4e-82    
gb|AFP33421.1|  terminal flower 1                                       258   4e-82    
ref|XP_010255492.1|  PREDICTED: CEN-like protein 1                      258   4e-82    
ref|XP_004163314.1|  PREDICTED: CEN-like protein 2-like                 258   4e-82    
gb|ADP00694.1|  CEN                                                     257   5e-82    
gb|ABP73381.1|  TFL1                                                    258   5e-82    Vicia faba [broad bean]
emb|CBX25328.1|  hypothetical_protein                                   258   5e-82    
dbj|BAD10970.1|  TFL1-like protein                                      257   5e-82    Cydonia oblonga [wen po]
ref|NP_001280794.1|  protein TERMINAL FLOWER 1-like                     257   6e-82    
dbj|BAD10971.1|  TFL1-like protein                                      257   6e-82    Chaenomeles sinensis
gb|ADP00711.1|  CEN                                                     257   7e-82    
gb|AEO72026.1|  TFL1-like protein                                       257   7e-82    
gb|ADP00714.1|  CEN                                                     257   8e-82    
ref|XP_002873117.1|  hypothetical protein ARALYDRAFT_487163             257   8e-82    
ref|XP_011094361.1|  PREDICTED: CEN-like protein 2 isoform X1           257   1e-81    
ref|XP_011090356.1|  PREDICTED: protein CENTRORADIALIS-like             256   1e-81    
gb|AAM27957.1|AF466817_1  terminal flower 1                             256   1e-81    Arabidopsis lyrata [lyrate rockcress]
gb|ADP00678.1|  CEN                                                     256   1e-81    
gb|ABP73383.1|  TFL1                                                    256   1e-81    Vicia faba [broad bean]
gb|AEH43348.1|  TFL1                                                    256   2e-81    
ref|XP_009130785.1|  PREDICTED: protein TERMINAL FLOWER 1               256   2e-81    
ref|NP_001289244.1|  protein TERMINAL FLOWER 1-like                     256   2e-81    
ref|XP_006398842.1|  hypothetical protein EUTSA_v10015708mg             256   2e-81    
gb|ACF18104.1|  terminal flower 1                                       256   2e-81    Malus prattii
gb|ABP73382.1|  TFL1                                                    256   2e-81    Vicia faba [broad bean]
gb|ADP00710.1|  CEN                                                     255   2e-81    
dbj|BAH37010.1|  terminal flower1-like protein                          256   3e-81    Raphanus sativus
gb|KGN48258.1|  hypothetical protein Csa_6G452100                       256   3e-81    
gb|AAM27947.1|AF466807_1  terminal flower 1                             255   3e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289547.1|  hypothetical protein CARUB_v10003093mg             255   4e-81    
ref|XP_009384535.1|  PREDICTED: CEN-like protein 1                      255   4e-81    
gb|ADP00703.1|  CEN                                                     254   5e-81    
dbj|BAD10972.1|  TFL1-like protein                                      254   5e-81    Eriobotrya japonica [loquat]
ref|NP_001106243.1|  ZCN4 protein                                       254   6e-81    Zea mays [maize]
gb|ADP00708.1|  CEN                                                     254   6e-81    
gb|ADC32542.1|  terminal flower 1-like protein                          254   7e-81    Leavenworthia crassa
gb|ADP00693.1|  CEN                                                     254   7e-81    
gb|ADP00672.1|  CEN                                                     254   8e-81    
ref|NP_196004.1|  protein TERMINAL FLOWER 1                             254   8e-81    Arabidopsis thaliana [mouse-ear cress]
gb|ACF18100.1|  terminal flower 1                                       254   1e-80    Malus fusca [Oregon crabapple]
gb|ACG31744.1|  RCN4 - Corn Centroradialis/TFL1-like protein            254   1e-80    Zea mays [maize]
ref|XP_008462563.1|  PREDICTED: CEN-like protein 2 isoform X1           254   1e-80    
gb|ABX11007.1|  ZCN5                                                    254   1e-80    Zea mays [maize]
emb|CAI61981.1|  TERMINAL FLOWER 1 protein                              254   1e-80    Impatiens balsamina [rose balsam]
ref|XP_010423657.1|  PREDICTED: protein TERMINAL FLOWER 1               254   1e-80    
pdb|1WKO|A  Chain A, Terminal Flower 1 (Tfl1) From Arabidopsis Th...    254   1e-80    
gb|AGN29206.1|  TFL1                                                    254   2e-80    
ref|XP_010683747.1|  PREDICTED: CEN-like protein 4                      253   2e-80    
gb|AAM27952.1|AF466812_1  terminal flower 1                             253   2e-80    Arabidopsis thaliana [mouse-ear cress]
emb|CDX80890.1|  BnaC03g01440D                                          253   2e-80    
emb|CAI61980.1|  TERMINAL FLOWER 1 protein                              253   2e-80    Impatiens balsamina [rose balsam]
ref|XP_009125522.1|  PREDICTED: protein TERMINAL FLOWER 1-like          253   3e-80    
ref|XP_010452279.1|  PREDICTED: protein TERMINAL FLOWER 1-like          253   4e-80    
dbj|BAH28254.1|  TFL1-like protein                                      253   4e-80    
ref|XP_010278585.1|  PREDICTED: CEN-like protein 1                      252   5e-80    
ref|XP_009780427.1|  PREDICTED: CEN-like protein 1                      252   6e-80    
ref|XP_010490878.1|  PREDICTED: protein TERMINAL FLOWER 1-like          252   6e-80    
ref|NP_001106244.1|  ZCN5 protein                                       252   7e-80    
gb|AAM27953.1|AF466813_1  terminal flower 1                             251   1e-79    
gb|ACF18099.1|  terminal flower 1                                       251   1e-79    
dbj|BAK40196.1|  terminal flower 1                                      251   1e-79    
emb|CDP05230.1|  unnamed protein product                                251   1e-79    
gb|ABY79180.1|  At5g03840                                               251   2e-79    
gb|KDP42735.1|  hypothetical protein JCGZ_23675                         251   2e-79    
gb|ADZ72839.1|  terminal flower 1-like protein                          251   3e-79    
emb|CDY14173.1|  BnaC02g02900D                                          250   3e-79    
ref|XP_008442833.1|  PREDICTED: protein SELF-PRUNING                    250   3e-79    
gb|ADP00717.1|  CEN                                                     250   4e-79    
gb|AHY24028.1|  terminal flower 1 protein                               250   4e-79    
emb|CCI55632.1|  TFL1 protein                                           249   4e-79    
ref|NP_001280770.1|  CEN-like protein 1                                 250   5e-79    
ref|XP_006353340.1|  PREDICTED: CEN-like protein 1-like                 250   5e-79    
gb|ABY79175.1|  At5g03840                                               249   5e-79    
gb|ACF18112.1|  terminal flower 1                                       249   6e-79    
gb|AFV67435.1|  centroradialis                                          249   7e-79    
emb|CCI55633.1|  TFL1 protein                                           249   7e-79    
gb|ACF18115.1|  terminal flower 1                                       249   7e-79    
ref|XP_004234370.1|  PREDICTED: CEN-like protein 1                      249   1e-78    
ref|XP_002528731.1|  phosphatidylethanolamine-binding protein, pu...    249   1e-78    
ref|XP_004512822.1|  PREDICTED: CEN-like protein 4-like                 249   1e-78    
gb|ADF80903.1|  terminal flower 1                                       248   1e-78    
gb|ACF18111.1|  terminal flower 1                                       248   2e-78    
ref|XP_004515607.1|  PREDICTED: CEN-like protein 4-like                 248   2e-78    
gb|ADF80901.1|  terminal flower 1                                       247   3e-78    
gb|ACF18122.1|  terminal flower 1                                       247   3e-78    
gb|AFV67451.1|  centroradialis                                          246   3e-78    
ref|XP_011077877.1|  PREDICTED: CEN-like protein 2                      247   4e-78    
ref|XP_010919262.1|  PREDICTED: CEN-like protein 1                      247   5e-78    
gb|ACF18118.1|  terminal flower 1                                       246   6e-78    
ref|XP_011076204.1|  PREDICTED: CEN-like protein 1                      246   8e-78    
ref|XP_008799538.1|  PREDICTED: CEN-like protein 1                      246   8e-78    
dbj|BAM73642.1|  terminal flower1 homologue                             247   8e-78    
ref|XP_002880983.1|  hypothetical protein ARALYDRAFT_481755             246   9e-78    
gb|ACF18109.1|  terminal flower 1                                       246   1e-77    
ref|XP_006365775.1|  PREDICTED: CEN-like protein 1-like                 246   1e-77    
ref|XP_006365770.1|  PREDICTED: CEN-like protein 1-like                 246   2e-77    
ref|XP_009609848.1|  PREDICTED: CEN-like protein 1                      246   2e-77    
gb|ACF18113.1|  terminal flower 1                                       245   2e-77    
ref|XP_009802796.1|  PREDICTED: CEN-like protein 1                      245   3e-77    
ref|XP_002510818.1|  phosphatidylethanolamine-binding protein, pu...    245   3e-77    
ref|XP_009122666.1|  PREDICTED: protein TERMINAL FLOWER 1-like          245   4e-77    
dbj|BAA33415.1|  BNTFL1-1                                               245   4e-77    
dbj|BAA33417.1|  BNTFL1-3                                               245   4e-77    
ref|XP_009611986.1|  PREDICTED: CEN-like protein 1                      244   7e-77    
gb|ACF18119.1|  terminal flower 1                                       244   7e-77    
gb|ADF80898.1|  terminal flower 1                                       243   8e-77    
ref|XP_007145323.1|  hypothetical protein PHAVU_007G229300g             244   1e-76    
ref|XP_004228449.1|  PREDICTED: CEN-like protein 1                      243   1e-76    
gb|ADF80904.1|  terminal flower 1                                       242   1e-76    
ref|XP_010543489.1|  PREDICTED: protein TERMINAL FLOWER 1               244   2e-76    
ref|NP_001274853.1|  CEN-like protein 1-like                            243   2e-76    
gb|EPS71350.1|  hypothetical protein M569_03409                         243   3e-76    
dbj|BAJ22383.1|  terminal flower 1b                                     242   3e-76    
gb|ACF18116.1|  terminal flower 1                                       242   4e-76    
ref|XP_007221173.1|  hypothetical protein PRUPE_ppa021829mg             242   5e-76    
dbj|BAA33421.1|  BOTFL1-2                                               242   6e-76    
gb|KDP22308.1|  hypothetical protein JCGZ_26139                         242   6e-76    
ref|XP_008234274.1|  PREDICTED: CEN-like protein 1                      242   7e-76    
dbj|BAA33416.1|  BNTFL1-2                                               241   9e-76    
gb|EYU25074.1|  hypothetical protein MIMGU_mgv1a022196mg                241   1e-75    
dbj|BAA33419.1|  BRTFL1-2                                               241   1e-75    
emb|CAE53887.1|  putative Cen-like protein, FDR1                        239   2e-75    
gb|AGX25242.1|  MCN3                                                    239   5e-75    
ref|XP_003540243.2|  PREDICTED: LOW QUALITY PROTEIN: CEN-like pro...    239   6e-75    
ref|XP_009401773.1|  PREDICTED: CEN-like protein 1                      239   7e-75    
gb|AGX25252.1|  MCN3                                                    239   8e-75    
emb|CDP06934.1|  unnamed protein product                                238   1e-74    
ref|NP_001236597.1|  brother of FT and TFL1 protein                     238   1e-74    
gb|EMT21165.1|  hypothetical protein F775_12063                         238   1e-74    
gb|EMS52593.1|  hypothetical protein TRIUR3_34862                       238   2e-74    
ref|XP_007038630.1|  PEBP family protein                                237   7e-74    
gb|KEH42040.1|  terminal flower 1                                       236   8e-74    
ref|XP_004308107.1|  PREDICTED: CEN-like protein 1-like                 236   1e-73    
ref|XP_004228452.1|  PREDICTED: CEN-like protein 1                      235   2e-73    
gb|AAQ20811.1|  late-flowering                                          235   3e-73    
dbj|BAN89465.1|  anti-florigenic FT/TFL1 family protein                 235   3e-73    
dbj|BAA33420.1|  BOTFL1-1                                               235   4e-73    
ref|XP_006587343.1|  PREDICTED: CEN-like protein 1-like isoform X2      233   1e-72    
dbj|BAK31019.1|  TFL1-like protein                                      231   3e-72    
ref|NP_001276314.1|  uncharacterized protein LOC100783608               232   3e-72    
ref|XP_010693475.1|  PREDICTED: CEN-like protein 1                      232   4e-72    
ref|XP_003635936.1|  CEN-like protein                                   231   7e-72    
ref|XP_007152319.1|  hypothetical protein PHAVU_004G119700g             231   8e-72    
ref|XP_004515713.1|  PREDICTED: CEN-like protein 1-like                 231   1e-71    
gb|EPS67746.1|  hypothetical protein M569_07027                         231   1e-71    
dbj|BAK31027.1|  TFL1-like protein                                      229   1e-71    
ref|XP_004149257.1|  PREDICTED: CEN-like protein 2-like                 230   3e-71    
gb|KGN46950.1|  hypothetical protein Csa_6G152360                       229   4e-71    
ref|XP_008458582.1|  PREDICTED: CEN-like protein 2                      229   8e-71    
ref|XP_008376539.1|  PREDICTED: CEN-like protein 1                      228   1e-70    
gb|AFV67440.1|  centroradialis                                          228   1e-70    
ref|XP_009371304.1|  PREDICTED: CEN-like protein 1                      228   2e-70    
gb|AEH43349.1|  BFT                                                     228   2e-70    
ref|NP_001267933.1|  TFL1C protein                                      226   7e-70    
dbj|BAK31021.1|  TFL1-like protein                                      225   9e-70    
ref|XP_006421880.1|  hypothetical protein CICLE_v10006042mg             225   2e-69    
dbj|BAH28258.1|  TFL1-like protein                                      225   2e-69    
ref|XP_006281443.1|  hypothetical protein CARUB_v10027522mg             225   3e-69    
ref|XP_010523529.1|  PREDICTED: protein BROTHER of FT and TFL 1         224   3e-69    
emb|CDX86931.1|  BnaC03g52010D                                          225   4e-69    
ref|XP_009151327.1|  PREDICTED: protein BROTHER of FT and TFL 1         225   6e-69    
ref|XP_010035109.1|  PREDICTED: CEN-like protein 1                      224   8e-69    
ref|XP_002321903.2|  flowering locus T like family protein              223   1e-68    
ref|XP_011048673.1|  PREDICTED: CEN-like protein 1                      223   1e-68    
dbj|BAK31018.1|  TFL1-like protein                                      221   2e-68    
ref|XP_006394441.1|  hypothetical protein EUTSA_v10005589mg             223   3e-68    
dbj|BAD08339.1|  flowering locus T like protein                         222   3e-68    
ref|XP_010107418.1|  hypothetical protein L484_015759                   222   4e-68    
ref|XP_010458097.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    222   5e-68    
gb|EYU36071.1|  hypothetical protein MIMGU_mgv1a020992mg                221   9e-68    
ref|XP_010444040.1|  PREDICTED: protein BROTHER of FT and TFL 1         221   1e-67    
ref|NP_201010.1|  protein BROTHER of FT and TFL 1                       220   1e-67    
dbj|BAK31016.1|  TFL1-like protein                                      219   2e-67    
ref|XP_002864769.1|  brother of FT and TFL1 protein                     219   4e-67    
gb|ADO64262.1|  TFL1-like protein                                       217   2e-66    
dbj|BAK31017.1|  TFL1-like protein                                      216   2e-66    
emb|CAX46398.1|  putative TFL1 protein                                  214   1e-65    
ref|XP_010483896.1|  PREDICTED: protein BROTHER of FT and TFL 1-like    215   2e-65    
gb|KHN32880.1|  Protein CENTRORADIALIS                                  214   2e-65    
gb|KEH17362.1|  terminal flower 1                                       213   6e-65    
gb|AEH59567.1|  flowering locus T/Terminal flower1-like protein         213   8e-65    
gb|AGT41972.1|  TFL1                                                    212   9e-65    
dbj|BAK31020.1|  CEN-like protein                                       212   1e-64    
dbj|BAK31026.1|  CEN-like protein                                       211   3e-64    
ref|NP_001276212.1|  protein CENTRORADIALIS-like                        210   4e-64    
gb|ABK25607.1|  unknown                                                 211   6e-64    
ref|XP_008439188.1|  PREDICTED: CEN-like protein 1                      211   7e-64    
ref|XP_006418720.1|  hypothetical protein EUTSA_v10002980mg             210   9e-64    
ref|NP_001267660.1|  CEN-like protein 1-like                            211   1e-63    
ref|XP_004143319.1|  PREDICTED: CEN-like protein 2-like                 208   7e-63    
gb|ABQ85553.1|  flowering locus T-like/terminal flower1-like protein    208   7e-63    
gb|AGO81838.1|  FT-like protein                                         208   8e-63    
gb|ABR23052.1|  terminal flower-like protein                            207   1e-62    
gb|ADP95116.1|  flowering locus T-like protein                          208   2e-62    
ref|XP_006352146.1|  PREDICTED: protein HEADING DATE 3A-like            207   3e-62    
gb|KFK27940.1|  hypothetical protein AALP_AA8G450800                    206   4e-62    
gb|AIJ02002.1|  FT/TFL1-like 2                                          206   4e-62    
gb|ADF80899.1|  terminal flower 1                                       203   9e-62    
ref|XP_004234883.1|  PREDICTED: protein HEADING DATE 3A                 205   1e-61    
gb|AFA52238.1|  TFL1-like protein                                       203   2e-61    
gb|AGI74990.1|  flowering locus T protein                               204   2e-61    
ref|XP_004297273.1|  PREDICTED: protein HEADING DATE 3A-like            204   3e-61    
ref|XP_011084685.1|  PREDICTED: protein HEADING DATE 3A-like            204   4e-61    
ref|XP_010109942.1|  hypothetical protein L484_011784                   203   6e-61    
gb|AEZ63950.1|  FLOWERING LOCUS T2                                      203   8e-61    
gb|KHM99148.1|  CEN-like protein 1                                      201   1e-60    
ref|XP_010915639.1|  PREDICTED: protein HEADING DATE 3A-like isof...    203   1e-60    
emb|CBY25182.1|  flowering locus T protein                              202   1e-60    
gb|AFS60093.1|  flowering locus T                                       202   2e-60    
gb|ABI94605.1|  flowering locus T-like 1                                202   2e-60    
ref|XP_010038569.1|  PREDICTED: protein HEADING DATE 3A isoform X2      202   2e-60    
emb|CAX46426.1|  putative FT protein                                    202   2e-60    
ref|XP_004295610.1|  PREDICTED: protein HEADING DATE 3A-like            202   3e-60    
gb|ABY91244.1|  CTRSFT1-like protein                                    201   3e-60    
ref|XP_010038562.1|  PREDICTED: protein HEADING DATE 3A isoform X1      201   3e-60    
dbj|BAO03056.1|  Hd3a                                                   201   3e-60    
dbj|BAI60052.1|  flowering locus T-like protein                         201   4e-60    
gb|AFK31163.1|  Hd3a                                                    201   5e-60    
gb|AFK31129.1|  Hd3a                                                    201   5e-60    
gb|AEU08961.1|  flowering locus T                                       201   5e-60    
dbj|BAO02921.1|  Hd3a                                                   201   5e-60    
dbj|BAG72295.1|  Hd3a                                                   201   6e-60    
dbj|BAO02929.1|  Hd3a                                                   201   7e-60    
gb|AFK31132.1|  Hd3a                                                    201   7e-60    
dbj|BAH30250.1|  FT-like protein                                        201   7e-60    
gb|AFK31134.1|  Hd3a                                                    201   8e-60    
gb|ABR20498.1|  FTL1                                                    201   8e-60    
ref|NP_001289254.1|  protein HEADING DATE 3A                            201   8e-60    
ref|XP_009396637.1|  PREDICTED: protein HEADING DATE 3A-like            201   9e-60    
ref|XP_008443654.1|  PREDICTED: protein HEADING DATE 3A                 201   9e-60    
gb|ABR20499.1|  FTL2                                                    201   9e-60    
gb|ABI94606.1|  flowering locus T-like 2                                200   1e-59    
dbj|BAO02881.1|  Hd3a                                                   200   1e-59    
dbj|BAG72301.1|  Hd3a                                                   200   1e-59    
ref|XP_009599213.1|  PREDICTED: protein HEADING DATE 3A-like            200   1e-59    
gb|EYU39743.1|  hypothetical protein MIMGU_mgv1a014907mg                200   2e-59    
ref|XP_010268289.1|  PREDICTED: protein HEADING DATE 3A                 199   2e-59    
gb|AGQ51296.1|  flowering locus T-like 2                                199   2e-59    
gb|AFK31118.1|  Hd3a                                                    199   2e-59    
dbj|BAP28173.1|  flowering locus T-like protein                         199   2e-59    
gb|ADW76861.1|  flowering locus T                                       199   2e-59    
dbj|BAO03055.1|  Hd3a                                                   199   2e-59    
ref|XP_009776089.1|  PREDICTED: protein HEADING DATE 3A-like            199   2e-59    
ref|NP_001240995.1|  protein HEADING DATE 3A-like                       199   2e-59    
dbj|BAO03057.1|  Hd3a                                                   199   2e-59    
dbj|BAO02982.1|  Hd3a                                                   199   2e-59    
gb|ADI58462.1|  flowering locus T                                       199   2e-59    
dbj|BAN89456.1|  flowering locus T                                      199   3e-59    
ref|NP_001280810.1|  protein HEADING DATE 3A                            199   3e-59    
gb|AFK31152.1|  Hd3a                                                    199   3e-59    
gb|AFK31165.1|  Hd3a                                                    199   3e-59    
dbj|BAA77836.1|  CiFT                                                   199   3e-59    
dbj|BAO02930.1|  Hd3a                                                   199   3e-59    
dbj|BAG72293.1|  Hd3a                                                   199   3e-59    
dbj|BAO03052.1|  Hd3a                                                   199   4e-59    
gb|AFU82577.1|  Hd3a protein                                            199   4e-59    
gb|AFB71092.1|  flowering locus T 3                                     199   4e-59    
dbj|BAO03050.1|  Hd3a                                                   199   4e-59    
gb|AFK31116.1|  Hd3a                                                    199   4e-59    
gb|AGB05620.1|  flowering locus T                                       199   4e-59    
dbj|BAB61027.1|  Hd3a                                                   199   4e-59    
gb|AFK31166.1|  Hd3a                                                    199   5e-59    
dbj|BAG72302.1|  Hd3a                                                   199   5e-59    
gb|KDO46010.1|  hypothetical protein CISIN_1g030371mg                   198   5e-59    
gb|AFK31136.1|  Hd3a                                                    198   5e-59    
gb|AEZ63949.1|  FLOWERING LOCUS T1                                      198   6e-59    
dbj|BAO02994.1|  Hd3a                                                   198   6e-59    
gb|AHF27444.1|  flowering locus T-like 2                                198   6e-59    
ref|NP_001056860.1|  Os06g0157700                                       198   6e-59    
gb|AFK31131.1|  Hd3a                                                    198   7e-59    
ref|XP_006480698.1|  PREDICTED: protein HEADING DATE 3A-like            198   7e-59    
dbj|BAH56285.1|  FT-like protein                                        198   7e-59    
gb|AHF27445.1|  flowering locus T-like 3                                198   8e-59    



>dbj|BAE44112.1| CENTRORADIALIS homolog [Ipomoea nil]
Length=175

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+MSD LVIGRVVGDV+D FS SVKM V+YN NKHV+NGHEFFPS +T++P+VEVH GD
Sbjct  1    MAKMSDPLVIGRVVGDVVDHFSQSVKMSVVYNSNKHVYNGHEFFPSLLTSKPKVEVHDGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYE P+PNIGIHRF
Sbjct  61   LRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYETPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+LYKQKRR  + V++  SRDRFN+RKF+DDNDL +PVAAVFFNCQRETAARRR
Sbjct  121  VFLLYKQKRRQSVTVSSSPSRDRFNTRKFADDNDLGSPVAAVFFNCQRETAARRR  175



>ref|XP_009594494.1| PREDICTED: CEN-like protein 2 [Nicotiana tomentosiformis]
Length=173

 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 163/175 (93%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+M+D LVI RVVGDV+D FSPSVKMCVIYNP+KHV+NGHE FPS VT++P+VEVHGGD
Sbjct  1    MAQMTDPLVISRVVGDVVDYFSPSVKMCVIYNPSKHVYNGHELFPSFVTSKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHW++TDIPGTTDSSFG+E+V YEMP PNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWVITDIPGTTDSSFGKEVVGYEMPMPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK+R    V+APLSRDRFN+RK++++N+L +PVAAVFFNCQRETAAR+R
Sbjct  121  VFLLFKQKKR--QTVSAPLSRDRFNTRKYAEENELGSPVAAVFFNCQRETAARKR  173



>ref|XP_009611784.1| PREDICTED: CEN-like protein 4 [Nicotiana tomentosiformis]
 gb|AFY06671.1| TFL protein [Nicotiana tabacum]
Length=175

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/174 (80%), Positives = 161/174 (93%), Gaps = 1/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            ++MSD LVIGRV+G+V+D F+PSVKM V YN +KHV+NGHE FPSSVT++PRVEVHGGD+
Sbjct  3    SKMSDPLVIGRVIGEVVDYFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRVEVHGGDL  62

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGREIV YEMPRPNIGIHRFV
Sbjct  63   RSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREIVGYEMPRPNIGIHRFV  122

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R  + ++APLSRDRFN+RKFS++N+L +PVAAVFFNCQRETAARRR
Sbjct  123  FLLFKQKKRQTL-LSAPLSRDRFNTRKFSEENELGSPVAAVFFNCQRETAARRR  175



>sp|Q9XH42.1|CET4_TOBAC RecName: Full=CEN-like protein 4 [Nicotiana tabacum]
 gb|AAD43530.1|AF145261_1 CEN-like protein 4 [Nicotiana tabacum]
Length=175

 Score =   298 bits (762),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 138/174 (79%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            ++MSD LVIGRV+G+V+D F+PSVKM V YN +KHV+NGHE FPSSVT++PRVEVHGGD+
Sbjct  3    SKMSDPLVIGRVIGEVVDYFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRVEVHGGDL  62

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGREIV YEMPRPNIGIHRFV
Sbjct  63   RSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREIVGYEMPRPNIGIHRFV  122

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R  + ++APLSRDRFN+RKFS++N+L +PVAA FFNCQRETAARRR
Sbjct  123  FLLFKQKKRQTL-LSAPLSRDRFNTRKFSEENELGSPVAAAFFNCQRETAARRR  175



>ref|XP_009777303.1| PREDICTED: CEN-like protein 2 [Nicotiana sylvestris]
 sp|Q9XH43.1|CET2_TOBAC RecName: Full=CEN-like protein 2 [Nicotiana tabacum]
 gb|AAD43529.1|AF145260_1 CEN-like protein 2 [Nicotiana tabacum]
Length=175

 Score =   295 bits (756),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 160/174 (92%), Gaps = 1/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            ++MSD LVIGRV+G+V+D F+PSVKM V YN +KHV+NGHE FPSSVT++PRVEVHGGD+
Sbjct  3    SKMSDPLVIGRVIGEVVDYFTPSVKMSVTYNSSKHVYNGHELFPSSVTSKPRVEVHGGDL  62

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFT+IM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+EIV YEMPRPNIGIHRFV
Sbjct  63   RSFFTMIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGKEIVGYEMPRPNIGIHRFV  122

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R  + + APLSRDRFN+RKF+++N+L +PVAAVFFNCQRETAARRR
Sbjct  123  FLLFKQKKRQTV-LTAPLSRDRFNTRKFAEENELGSPVAAVFFNCQRETAARRR  175



>ref|NP_001233974.1| protein SELF-PRUNING [Solanum lycopersicum]
 sp|O82088.1|SELFP_SOLLC RecName: Full=Protein SELF-PRUNING [Solanum lycopersicum]
 gb|AAC26161.1| self-pruning protein [Solanum lycopersicum]
Length=175

 Score =   294 bits (752),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ++M + LVIGRV+G+V+D F PSVKM V+YN NKHV+NGHEFFPSSVT++PRVEVHGG
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVVYNNNKHVYNGHEFFPSSVTSKPRVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+V YEMPRPNIGIHR
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQK+R  +  +AP+SRD+F+SRKFS++N+L +PVAAVFFNCQRETAARRR
Sbjct  121  FVFLLFKQKKRQTIS-SAPVSRDQFSSRKFSEENELGSPVAAVFFNCQRETAARRR  175



>ref|XP_010045223.1| PREDICTED: CEN-like protein 2 [Eucalyptus grandis]
 gb|KCW87386.1| hypothetical protein EUGRSUZ_B03867 [Eucalyptus grandis]
Length=173

 Score =   292 bits (747),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD LV+GRV+GDVIDCF+ SVK  V YN NKHV NGHE FPS+VT +PRVEVHGGD
Sbjct  1    MARMSDPLVVGRVIGDVIDCFATSVKTTVTYNSNKHVFNGHELFPSTVTAKPRVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+V YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGKEVVEYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    V  P SRDRFN+R+F++DN+L  PVAAV+FN QRETAARRR
Sbjct  121  VFILFKQKRR--DMVRGPSSRDRFNTRRFAEDNELGLPVAAVYFNAQRETAARRR  173



>ref|NP_001275478.1| terminal flower 1 protein [Solanum tuberosum]
 gb|ABC24691.1| terminal flower 1 protein [Solanum tuberosum]
Length=175

 Score =   292 bits (747),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 161/176 (91%), Gaps = 1/176 (1%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ++M + LVIGRV+G+V+D F PSVKM V+YN NKHV+NGHEFFPSSVT++PRVEVHGG
Sbjct  1    MASKMCEPLVIGRVIGEVVDNFCPSVKMSVVYNNNKHVYNGHEFFPSSVTSKPRVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+R+FFTL+M DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+V YEMPRPNIGIHR
Sbjct  61   DLRTFFTLVMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQK+R  +  +AP+SRD+F+SRKFS++N+L +PVAAVFFNCQRETAARRR
Sbjct  121  FVFLLFKQKKRQTIS-SAPVSRDQFSSRKFSEENELGSPVAAVFFNCQRETAARRR  175



>gb|ACL27223.1| fasciculate [Capsicum frutescens]
Length=175

 Score =   291 bits (745),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/176 (77%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ++M + LVIGRV+G+V+D F PSVKM VIYN NKHV+NGHE FPSSVTT+PRVEV+GG
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVIYNSNKHVYNGHELFPSSVTTKPRVEVNGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+V YEMPRP IGIHR
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSFGREVVGYEMPRPTIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L++QK+R  +  NAPLSRDRF +RKFS++N+L +PVAAVFFNCQRETAARRR
Sbjct  121  FVFLLFQQKKRQTIS-NAPLSRDRFCTRKFSEENELGSPVAAVFFNCQRETAARRR  175



>ref|XP_011088881.1| PREDICTED: protein CENTRORADIALIS [Sesamum indicum]
Length=176

 Score =   291 bits (745),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MS D LVIGRVVGDV+D FS +VKM V YN NKHV+NGHE FPS+VT++PRVEVHGG
Sbjct  1    MAKMSSDPLVIGRVVGDVVDHFSSTVKMSVTYNSNKHVYNGHELFPSTVTSKPRVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYEMPRPNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F FVL+KQK+R    V AP  RD FN+R F+ +N+L  PVAAV+FNCQRETAARRR
Sbjct  121  FAFVLFKQKKRQLGCVRAPACRDGFNTRNFAQENELGLPVAAVYFNCQRETAARRR  176



>ref|XP_007015849.1| Centroradialis [Theobroma cacao]
 gb|EOY33468.1| Centroradialis [Theobroma cacao]
Length=174

 Score =   289 bits (740),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVID  +PSVKM V +N NK V+NGHE FPSSVT +P+V+VHGGD
Sbjct  1    MAKLSDPLVVGRVIGDVIDAITPSVKMTVTFNANKQVYNGHELFPSSVTNKPKVDVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR  + ++ P SRD FN+RKF+++N+L  PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKRRQAV-ISTPSSRDHFNTRKFAEENELGLPVAAVYFNAQRETAARRR  174



>gb|AAM46142.1|AF378127_1 terminal flower-like protein 1 [Vitis vinifera]
Length=173

 Score =   288 bits (738),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++GRV+GDV+D F  +VKM V YN NK V+NGHE FPSSVT +P++EV GGD
Sbjct  1    MARMSDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    VN P SRDRF+SR F+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRR--QTVNPPSSRDRFSSRNFAEENELGPPVAAVFFNAQRETAARKR  173



>ref|NP_001267929.1| TFL1A protein [Vitis vinifera]
 gb|ABI99466.1| TFL1A protein [Vitis vinifera]
 emb|CAN69924.1| hypothetical protein VITISV_019378 [Vitis vinifera]
 gb|ACY80736.1| TFL1A protein [Vitis vinifera]
 gb|ADF80895.1| terminal flower 1 [Vitis aestivalis]
 gb|ADF80897.1| terminal flower 1 [Vitis cinerea]
 gb|ADF80902.1| terminal flower 1 [Vitis riparia]
 emb|CBI28335.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   288 bits (736),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++GRV+GDV+D F  +VKM V YN NK V+NGHE FPSSVT +P++EV GGD
Sbjct  1    MARMSDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    VN P SRDRF++R F+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRR--QTVNPPSSRDRFSTRNFAEENELGPPVAAVFFNAQRETAARKR  173



>emb|CAI38702.1| self-pruning protein [Capsicum annuum]
 gb|AAZ66798.1| self-pruning-like protein [Capsicum annuum]
Length=175

 Score =   287 bits (735),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 156/176 (89%), Gaps = 1/176 (1%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ++M + LVIGRV+G+V+D F PSVKM VIYN NKHV+NGHE FPSSVTT+PRVEV+GG
Sbjct  1    MASKMCEPLVIGRVIGEVVDYFCPSVKMSVIYNSNKHVYNGHELFPSSVTTKPRVEVNGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTLIM DPDVPGPSDPYLREHLHWIVTDIPGTTD S GRE+V YEMPRPNIGIHR
Sbjct  61   DLRSFFTLIMIDPDVPGPSDPYLREHLHWIVTDIPGTTDCSLGREVVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L++QK+R  +  NA LSRDRF +RKFS++N+L +PVAAVFFNCQRETA RRR
Sbjct  121  FVFLLFQQKKRQTIS-NAALSRDRFCTRKFSEENELGSPVAAVFFNCQRETATRRR  175



>ref|XP_011000909.1| PREDICTED: CEN-like protein 2 [Populus euphratica]
Length=173

 Score =   287 bits (734),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA +SD LV+GRV+GDVID F+P+VKM V YN NK V+NGHE FPS+VT +P+VEVHGGD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTPNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V++L++QK R    V+ P SRD+FN+RKF+++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYILFRQKGR--QTVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>gb|ACY80737.1| TFL1A protein [Vitis vinifera]
Length=173

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARM+D L++GRV+GDV+D F  +VKM V YN NK V+NGHE FPSSVT +P++EV GGD
Sbjct  1    MARMTDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    VN P SRDRF++R F+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRR--QTVNPPSSRDRFSTRTFAEENELGPPVAAVFFNAQRETAARKR  173



>gb|ABW24963.1| terminal flower 1a [Gossypium hirsutum]
 gb|ABW24970.1| terminal flower 1a [Gossypium hirsutum]
 gb|AIY34696.1| terminal flower 1-like protein [Gossypium hirsutum]
Length=174

 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVID  SPSVKM V +N NK V+NGHEFFPS+VT +P+VEVHGGD
Sbjct  1    MAKLSDPLVVGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R  +  + P SRDRF++RKF+++N+L  PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKGRQTVR-SIPSSRDRFDTRKFAEENELGVPVAAVYFNAQRETAARRR  174



>gb|ABW24967.1| terminal flower 1a [Gossypium hirsutum]
 gb|ABY62769.1| terminal flower 1a [Gossypium hirsutum]
Length=174

 Score =   286 bits (732),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVID  SPSVKM V +N NK V+NGHEFFPS+VT +P+VEVHGGD
Sbjct  1    MAKLSDPLVLGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R  +  + P SRDRF++RKF+++N+L  PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKGRQTVR-SIPSSRDRFDTRKFAEENELGVPVAAVYFNAQRETAARRR  174



>gb|ADF80896.1| terminal flower 1 [Vitis californica]
Length=173

 Score =   286 bits (732),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++GRV+GDV+D F  +VKM V YN NK V+NGHE FPSSVT +P++EV GGD
Sbjct  1    MARMSDPLIVGRVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    VN P SRDRF++R F+ +N+L  PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRR--QTVNPPSSRDRFSTRNFAGENELGPPVAAVFFNAQRETAARKR  173



>gb|KDP31551.1| hypothetical protein JCGZ_15206 [Jatropha curcas]
 gb|AID51386.1| terminal flower 1a [Jatropha curcas]
 gb|AID51392.1| terminal flower 1a [Jatropha curcas]
Length=173

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVID F+P +KM V YN NK V+NGHE FPS+VT +P+VEV G D
Sbjct  1    MAKVSDPLVVGRVIGDVIDYFTPCMKMTVSYNSNKQVYNGHELFPSAVTHKPKVEVQGAD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPY REHLHWIVTDIPGTTD++FG+E+VSYEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDATFGKEVVSYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    VN P SRD+FN+RKF+++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VFILFKQKRR--QMVNTPTSRDKFNTRKFAEENELGLPVAAVFFNAQRETAARRR  173



>ref|XP_002312811.1| TFL1a family protein [Populus trichocarpa]
 gb|EEE86766.1| TFL1a family protein [Populus trichocarpa]
Length=173

 Score =   285 bits (730),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA +SD LV+GRV+GDVID F+P+VKM V YN NK V+NGHE FPS+VT +P+VEVHGGD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTPNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V++L++QK R    V+ P SRD+FN+RKF+++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYLLFRQKGR--QTVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>gb|ABW24965.1| terminal flower 1a [Gossypium raimondii]
Length=174

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 156/175 (89%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVID  SPSVKM V +N NK V+NGHEFFPS+VT +P+VEVHGGD
Sbjct  1    MAKLSDPLVLGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R  +  + P SRDRF +RKF+++N+L  PVAAV+FN QRETAARRR
Sbjct  121  VFLLFKQKGRQTVR-SIPSSRDRFYTRKFAEENELGVPVAAVYFNAQRETAARRR  174



>gb|ABW24961.1| terminal flower 1a [Gossypium arboreum]
Length=174

 Score =   285 bits (730),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVID  SPSVKM V +N NK V+NGHEFFPS+VT +P+VEVHGGD
Sbjct  1    MAKLSDPLVVGRVIGDVIDALSPSVKMSVTFNTNKQVYNGHEFFPSAVTNKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREMVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R  +  + P SRDRF++RKF+++N+L  PVAAV+FN QRETA+RRR
Sbjct  121  VFLLFKQKGRQTVR-SIPSSRDRFDTRKFAEENELGVPVAAVYFNAQRETASRRR  174



>ref|XP_006487964.1| PREDICTED: CEN-like protein 2-like [Citrus sinensis]
Length=175

 Score =   285 bits (729),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKH-VHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MSD+LV+GRVVG+VID F+PSVKM V YN  K  V+NGHE FPS VT +P+VEV GG
Sbjct  1    MAKMSDALVLGRVVGEVIDYFTPSVKMTVTYNSIKQQVYNGHEMFPSQVTQKPKVEVLGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+E+V+YE+PRPNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVNYEIPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQKRR    ++ P SRDRFN+RKF+++NDL  PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFKQKRR-QTEMSVPASRDRFNTRKFAEENDLGLPVAAVFFNAQRETAARRR  175



>dbj|BAD22601.1| flowering locus T like protein [Populus nigra]
 dbj|BAD22602.1| flowering locus T like protein [Populus nigra]
 dbj|BAD22675.1| flowering locus T like protein [Populus nigra]
 dbj|BAD22676.1| flowering locus T like protein [Populus nigra]
 gb|AEK06114.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06115.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06116.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06117.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06118.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06119.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06120.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06121.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06122.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06123.1| terminal flowering 1 protein 1 [Populus balsamifera]
Length=173

 Score =   285 bits (729),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 156/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA +SD LV+GRV+GDVID F+P+VKM V YN NK V+NGHE FPS+VT +P+VEVHGGD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTPNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V++L++QK R    V+ P SRD+FN+RKF+++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYLLFRQKGR--QTVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>emb|CAJ44126.1| centroradialis flower development regulation protein [Misopates 
orontium]
Length=181

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 156/176 (89%), Gaps = 6/176 (3%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPN---KHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            SD LVIGRV+GDV+D F+ SVKM VIYN N   KHV+NGHE FPS+VT+ PRVEVHGGDM
Sbjct  7    SDPLVIGRVIGDVVDHFTSSVKMSVIYNANNSVKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYEMPRPNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  476  FVLYKQKRRLGMGVNAP--LSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R G  + +P  ++RD FN+RKF+ +N+L  PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKR-GQAIMSPPLVTRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>dbj|BAO93910.1| terminal flower 1 [Fragaria x ananassa]
Length=173

 Score =   283 bits (725),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVIDCF+PSVKM V YN +K V+NGHE +PSSVT +P+VEVHGGD
Sbjct  1    MAKISDPLVVGRVIGDVIDCFTPSVKMTVTYNSSKKVYNGHELYPSSVTVKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+V YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGREVVKYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D FNSRKF++ N+   PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGR--QTVIPPPSKDHFNSRKFAEANEFGLPVAAVFFNAQRETAARRR  173



>gb|AGW23412.1| terminal flower [Mangifera indica]
Length=175

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARM-SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM SD LV+GRV+GDV+DC   +VKM V YN +K V+NGHE FPSSVT +P+VEVHGG
Sbjct  1    MARMPSDPLVVGRVIGDVVDCCDQTVKMAVTYNSSKQVYNGHELFPSSVTVKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+V+YEMPRPNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWVVTDIPGTTDATFGKELVNYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L++QKRR  + ++ P SRD FN+RKF++DNDL  PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFRQKRRQTV-ISIPSSRDGFNTRKFAEDNDLGQPVAAVFFNAQRETAARRR  175



>ref|XP_006424257.1| hypothetical protein CICLE_v10029782mg [Citrus clementina]
 gb|ESR37497.1| hypothetical protein CICLE_v10029782mg [Citrus clementina]
 gb|KDO58063.1| hypothetical protein CISIN_1g030564mg [Citrus sinensis]
Length=175

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 156/176 (89%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKH-VHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MSD+LV+GRVVG+VID F+PSVKM + Y+  K  V+NGHE FPS VT +P+VEV GG
Sbjct  1    MAKMSDALVLGRVVGEVIDYFTPSVKMTITYSSIKQQVYNGHEMFPSQVTQKPKVEVLGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+E+V+YE+PRPNIGIHR
Sbjct  61   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVNYEIPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQKRR    ++ P SRDRFN+RKF+++NDL  PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFKQKRR-QTEMSVPASRDRFNTRKFAEENDLGLPVAAVFFNAQRETAARRR  175



>gb|AGK89940.1| centroradialis [Actinidia deliciosa]
Length=173

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+ SD LV+GRV+GDV+D F  SVKM V YN NK V+NGHE FPS VTT+PRVEVHGGD
Sbjct  1    MAKKSDPLVVGRVIGDVVDNFYGSVKMSVTYNSNKRVYNGHELFPSIVTTKPRVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYL+EHLHWI+TDIPGTTDSSFGRE+V+YE+PRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLKEHLHWIITDIPGTTDSSFGREVVNYEIPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ  R    V  P SRD+F++RKF+++NDL+ PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQTSR--QSVTPPPSRDQFSTRKFAEENDLSLPVAAVFFNAQRETAARRR  173



>gb|AEK06124.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06125.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06126.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06127.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06128.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06129.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06130.1| terminal flowering 1 protein 1 [Populus balsamifera]
 gb|AEK06131.1| terminal flowering 1 protein 1 [Populus balsamifera]
Length=173

 Score =   283 bits (723),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA +SD LV+GRV+GDVID F+ +VKM V YN NK V+NGHE FPS+VT +P+VEVHGGD
Sbjct  1    MANLSDPLVVGRVIGDVIDYFTQNVKMTVTYNSNKQVYNGHELFPSAVTHKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+V+YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVNYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V++L++QK R    V+ P SRD+FN+RKF+++N+L  PVAAVFFN QRETAARRR
Sbjct  121  VYLLFRQKGR--QTVSTPSSRDKFNTRKFAEENELDLPVAAVFFNAQRETAARRR  173



>gb|ADF80900.1| terminal flower 1 [Vitis mustangensis]
Length=173

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++G V+GDV+D F  +VKM V YN NK V+NGHE FPSSVT +P++EV GGD
Sbjct  1    MARMSDPLIVGGVIGDVVDSFCSTVKMTVTYNSNKQVYNGHELFPSSVTIKPKIEVEGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDS+FGREIV+YEMPRPNIGIH F
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSTFGREIVNYEMPRPNIGIHGF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQKRR    VN P SRDRF++R F+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKRR--QTVNPPSSRDRFSTRNFAEENELGPPVAAVFFNAQRETAARKR  173



>ref|XP_004291610.1| PREDICTED: CEN-like protein 2-like [Fragaria vesca subsp. vesca]
Length=173

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA++SD LV+GRV+GDVIDCF+PSVKM V YN +K V+NGHE +PSSVT +P+VEVHGGD
Sbjct  1    MAKISDPLVVGRVIGDVIDCFTPSVKMTVTYNSSKKVYNGHELYPSSVTVKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E+V YEMPRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGKEVVKYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D F+SRKF++ N+   PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGR--QTVIPPPSKDHFDSRKFAETNEFGLPVAAVFFNAQRETAARRR  173



>ref|XP_007206006.1| hypothetical protein PRUPE_ppa012343mg [Prunus persica]
 gb|EMJ07205.1| hypothetical protein PRUPE_ppa012343mg [Prunus persica]
Length=173

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+MSD LV+GRV+GDV+D FS SVKM V YN NK V+NGHE FPSS+T +P+VEVHGGD
Sbjct  1    MAKMSDPLVVGRVIGDVVDSFSQSVKMTVTYNSNKKVYNGHELFPSSLTLKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+V YE+PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDNTFGKEVVKYEIPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D FN+RKF++ NDL  PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGR--QTVIPPPSKDNFNTRKFAEANDLGLPVAAVFFNAQRETAARRR  173



>ref|XP_010031504.1| PREDICTED: protein CENTRORADIALIS-like [Eucalyptus grandis]
 gb|KCW50824.1| hypothetical protein EUGRSUZ_J00485 [Eucalyptus grandis]
Length=174

 Score =   281 bits (719),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMSDS-LVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA++S + LV+GR++GDV D FS SVKM V YN NK V NGHE FPS VT +P+VEVHGG
Sbjct  1    MAKVSSNPLVVGRIIGDVTDSFSASVKMTVTYNSNKQVFNGHELFPSWVTAKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+V YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEVVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQKRR    V  P SRDRFN+RKF+DDN+L  PVAAVFFN QRETAARRR
Sbjct  121  FVFLLFKQKRR--EMVRPPSSRDRFNTRKFADDNELGLPVAAVFFNAQRETAARRR  174



>ref|XP_002453931.1| hypothetical protein SORBIDRAFT_04g021650 [Sorghum bicolor]
 gb|EES06907.1| hypothetical protein SORBIDRAFT_04g021650 [Sorghum bicolor]
Length=173

 Score =   281 bits (719),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 155/175 (89%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + L++G+V+G+V+D F+P+VKM V YN NK V NGHEFFPS+VT +PRVEV GGD
Sbjct  1    MSRVLEPLIVGKVIGEVLDHFNPTVKMVVTYNSNKQVFNGHEFFPSAVTAKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYETPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL++QKRR    VN P S+DRF++R+F++DNDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQKRR--QAVNPPSSKDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_008241250.1| PREDICTED: CEN-like protein 2 [Prunus mume]
 dbj|BAJ14521.1| TFL1-like protein [Prunus mume]
 gb|AEO72021.1| TFL1-like protein [Prunus mume]
Length=172

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 154/175 (88%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMS+ LV+GRV+GDV+DCF+P+ KM V YN  + V NG+E +PS+VTT+PRVE+ GGD
Sbjct  1    MARMSEPLVVGRVIGDVLDCFTPTTKMSVTYN-TRLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRTFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ+RR    VN P SRD F++R F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  120  VFVLFKQRRR--QSVNPPSSRDHFSARSFAAENDLGLPVAAVYFNCQRETAARRR  172



>ref|XP_004487504.1| PREDICTED: CEN-like protein 2-like [Cicer arietinum]
 ref|XP_004487505.1| PREDICTED: CEN-like protein 2-like [Cicer arietinum]
Length=177

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 151/172 (88%), Gaps = 1/172 (1%)
 Frame = -1

Query  830  MSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRS  651
            ++D LVIGRVVGDV+D F+ +VKM V YN  K V+NGHEFFPSS+T +P+V +HGGDMRS
Sbjct  7    LADPLVIGRVVGDVVDYFNTTVKMSVTYNNTKQVYNGHEFFPSSLTIKPKVHIHGGDMRS  66

Query  650  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFV  471
            FFTLIMTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E++ YEMPRPNIGIHRFVF+
Sbjct  67   FFTLIMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGKEVIKYEMPRPNIGIHRFVFI  126

Query  470  LYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            LYKQKRR  + +  P SRD FN++KF++DNDL  PVAAVFFN QRETAARRR
Sbjct  127  LYKQKRRQTV-MKIPTSRDHFNTKKFAEDNDLGPPVAAVFFNAQRETAARRR  177



>gb|AFV67432.1| centroradialis [Hordeum vulgare]
 gb|AFV67445.1| centroradialis [Hordeum vulgare]
 gb|AFV67446.1| centroradialis [Hordeum vulgare]
 gb|AFV67447.1| centroradialis [Hordeum vulgare]
 gb|AFV67449.1| centroradialis [Hordeum vulgare]
 gb|AFV67450.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010271687.1| PREDICTED: protein SELF-PRUNING-like [Nelumbo nucifera]
Length=176

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 151/174 (87%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            A++ + L +G+V+GDV+D FSP+VKM V YN NK V+NGHEF+PSSVTT+PRVEV GGDM
Sbjct  5    AKLLEPLTVGKVIGDVLDSFSPTVKMTVTYNSNKQVYNGHEFYPSSVTTKPRVEVQGGDM  64

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            R+FFTL+MTDPD PGPSDPYL EHLHWIVTDIPGTTD++FGRE+VSYE+PRP IGIHRFV
Sbjct  65   RTFFTLVMTDPDAPGPSDPYLMEHLHWIVTDIPGTTDATFGREVVSYEIPRPTIGIHRFV  124

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQKRR    +  P SRD F++RKF+++NDL  PVAAVFFN QRETAARRR
Sbjct  125  FVLFKQKRR--QTITPPASRDHFSTRKFAEENDLGLPVAAVFFNAQRETAARRR  176



>emb|CAC21563.1| centroradialis [Antirrhinum majus]
Length=181

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPN---KHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            SD LVIGRV+GDV+D F+ +VKM VIYN N   KHV+NGHE FPS+VT+ PRVEVHGGDM
Sbjct  7    SDPLVIGRVIGDVVDHFTSTVKMSVIYNANNSIKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYEMPRPNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  476  FVLYKQKRRLGMGVNAP-LSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R    ++ P + RD FN+RKF+ +N+L  PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>ref|XP_010557408.1| PREDICTED: protein CENTRORADIALIS-like [Tarenaya hassleriana]
Length=175

 Score =   280 bits (717),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 133/176 (76%), Positives = 155/176 (88%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D LV+GRV+GDV+D  + +VKM V YN NK V+NGHEFFPS+VT +P+V+VHGG
Sbjct  1    MARISSDPLVVGRVIGDVVDNVTQAVKMTVTYNSNKQVYNGHEFFPSAVTIKPKVDVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGQEIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQKRR G  V+ P  RD+FN+R F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVFMLFKQKRR-GSVVSVPSYRDQFNTRMFAHENDLGLPVAAVFFNCQRETAARRR  175



>emb|CDP06933.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+++D LVIGR+VGDV+D  SP+VKM V YN NK V+NGHE +PSSV  +P+VEV GGD
Sbjct  1    MAKVADPLVIGRIVGDVVDNISPTVKMSVTYNSNKQVYNGHELYPSSVVNKPKVEVLGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTDSSFG E+VSYE+PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDSSFGIEMVSYEVPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    VN PLSRD F++RKF+ +N L  PVAAVFFNCQRETAARRR
Sbjct  121  VFLLFKQKGR--QTVNPPLSRDGFSTRKFAQENQLGLPVAAVFFNCQRETAARRR  173



>sp|Q41261.1|CEN_ANTMA RecName: Full=Protein CENTRORADIALIS [Antirrhinum majus]
 pdb|1QOU|A Chain A, Cen (Centroradialis) Protein From Antirrhinum
 pdb|1QOU|B Chain B, Cen (Centroradialis) Protein From Antirrhinum
 gb|AAB36112.1| CEN [Antirrhinum]
 prf||2206476A CEN gene
Length=181

 Score =   280 bits (716),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPN---KHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            SD LVIGRV+GDV+D F+ +VKM VIYN N   KHV+NGHE FPS+VT+ PRVEVHGGDM
Sbjct  7    SDPLVIGRVIGDVVDHFTSTVKMSVIYNSNNSIKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYEMPRPNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  476  FVLYKQKRRLGMGVNAP-LSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R    ++ P + RD FN+RKF+ +N+L  PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>gb|AFI93431.1| terminal flower 1 [Rosa chinensis]
Length=173

 Score =   280 bits (715),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+MSD LV+GRV+GDV+D FSPSVKM V YN +K V+NGHE FPSSVTT+P+VEV GGD
Sbjct  1    MAKMSDPLVVGRVIGDVVDYFSPSVKMAVTYNSSKKVYNGHELFPSSVTTKPKVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+V YEMPRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGREVVKYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D F+SRKF++ N+   PVAAVFFN QRETAAR+R
Sbjct  121  VFLLFKQKGR--QTVIPPPSKDHFDSRKFAEANEFGLPVAAVFFNAQRETAARKR  173



>gb|AFV67441.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   280 bits (715),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFG+E+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGKEVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_008228487.1| PREDICTED: CEN-like protein 2 [Prunus mume]
Length=173

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+MSD LV+GRV+GDV+D FS SVKM V YN NK V+NGHE FPSS+T +P+VEVHGGD
Sbjct  1    MAKMSDPLVVGRVIGDVVDSFSQSVKMTVTYNSNKKVYNGHELFPSSLTLKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIV DIPGTTD++FG+E+V YE+PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVNDIPGTTDTTFGKEMVKYEIPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D FN+RKF++ NDL  PVAAVFFN QRETAARRR
Sbjct  121  VFLLFKQKGR--QTVIPPPSKDHFNTRKFAEANDLGLPVAAVFFNAQRETAARRR  173



>emb|CAC21564.1| centroradialis [Antirrhinum majus]
Length=181

 Score =   279 bits (714),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/175 (77%), Positives = 154/175 (88%), Gaps = 4/175 (2%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPN---KHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            SD LVIGRV+GDV+D F+ +V+M VIYN N   KHV+NGHE FPS+VT+ PRVEVHGGDM
Sbjct  7    SDPLVIGRVIGDVVDHFTSTVQMSVIYNANNSIKHVYNGHELFPSAVTSTPRVEVHGGDM  66

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYEMPRPNIGIHRFV
Sbjct  67   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEMPRPNIGIHRFV  126

Query  476  FVLYKQKRRLGMGVNAP-LSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R    ++ P + RD FN+RKF+ +N+L  PVAAVFFNCQRETAARRR
Sbjct  127  FLLFKQKKRGQAMLSPPVVCRDGFNTRKFTQENELGLPVAAVFFNCQRETAARRR  181



>gb|AFV67438.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   279 bits (713),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGP+DPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPNDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67437.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDP+VPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPNVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67436.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MT+PDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTNPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_007202664.1| hypothetical protein PRUPE_ppa012369mg [Prunus persica]
 gb|ADL62867.1| terminal flower 1 [Prunus persica]
 gb|EMJ03863.1| hypothetical protein PRUPE_ppa012369mg [Prunus persica]
Length=172

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+S+ LV+GRV+GDV+DCF+P+ KM V YN  + V NG+E +PS+VTT+PRVE+ GGD
Sbjct  1    MARISEPLVVGRVIGDVLDCFTPTTKMSVTYN-TRLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRTFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    VN P SRD F++R F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  120  VFVLFKQTRR--QSVNPPSSRDHFSARSFAAENDLGPPVAAVYFNCQRETAARRR  172



>ref|NP_001276169.1| CEN-like protein 2-like [Glycine max]
 gb|ACU00129.1| CENTRORADIALIS-like protein 3 [Glycine max]
Length=175

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            SD LVIG+V+GDV+D F+P+VK+ V YN NK V+NGHEFFPSSVTT+P+V++HGGDMRSF
Sbjct  6    SDPLVIGKVIGDVVDHFTPTVKITVSYNNNKQVYNGHEFFPSSVTTKPKVQIHGGDMRSF  65

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG E+V YE+PRPNIGIHRFVF++
Sbjct  66   FTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGNEVVEYEIPRPNIGIHRFVFLV  125

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQKRR G+ +  P +RD FNSR F+++N+L  PVAAVFFN QRETAARRR
Sbjct  126  FKQKRRQGV-LKTPTTRDLFNSRSFAEENELGPPVAAVFFNAQRETAARRR  175



>gb|KHN27653.1| CEN-like protein 2 [Glycine soja]
Length=175

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/171 (74%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            SD LVIG+V+GDV+D F+P+VK+ V YN NK V+NGHEFFPSSVTT+P+V++HGGDMRSF
Sbjct  6    SDPLVIGKVIGDVVDHFTPTVKITVSYNNNKQVYNGHEFFPSSVTTKPKVQIHGGDMRSF  65

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG E+V YE+PRPNIGIHRFVF++
Sbjct  66   FTLVMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGNEVVEYEIPRPNIGIHRFVFLV  125

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQKRR G+ +  P +RD FNSR F+++N+L  PVAAVFFN QRETAARRR
Sbjct  126  FKQKRRQGV-LKTPTTRDLFNSRSFAEENELGPPVAAVFFNAQRETAARRR  175



>gb|AFV67433.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (710),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++ R+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKSRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67434.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++ R+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKTRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAN13572.1| terminal flower1-like protein [Chrysanthemum seticuspe f. boreale]
 dbj|BAN89466.1| TFL1 family protein [Chrysanthemum seticuspe f. boreale]
Length=173

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MA+MSD LVIGRVVGDV+D F+P V M V YN +K V+NGHE FPSSVT +P+VEV GGD
Sbjct  1    MAKMSDPLVIGRVVGDVVDTFTPCVDMSVTYNSSKQVYNGHELFPSSVTAKPKVEVRGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVT+IPGTTDSSFG E+V YEMPRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTNIPGTTDSSFGNEVVGYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V +P SR  FN+R F+ +N L +PVA VFFNCQRETAARRR
Sbjct  121  VFLLFKQKGR--QSVTSPSSRHNFNTRSFALENQLGSPVAGVFFNCQRETAARRR  173



>ref|NP_001280940.1| CEN-like protein 2 [Malus domestica]
 dbj|BAG31954.1| CENTRORADIALIS like protein [Malus domestica]
 dbj|BAG31958.1| CENTRORADIALIS like protein [Malus domestica]
Length=174

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA MS D LV+GRV+GDV+D FSPSV+M V YN NK V+NGHE FPSSVT +P+VEVHGG
Sbjct  1    MAMMSSDPLVVGRVIGDVVDYFSPSVRMTVTYNSNKKVYNGHELFPSSVTIKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E+V YEMPRPNIGIHR
Sbjct  61   DLRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGKEVVKYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQK R    V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  121  FVFLLFKQKAR--QTVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>gb|AFV67448.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  N P +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NPPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_003596800.1| Terminal flower [Medicago truncatula]
 gb|AES67051.1| terminal flower 1 [Medicago truncatula]
Length=173

 Score =   278 bits (710),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+ ++D L IGRV+GDV+D F+ ++KM V YN  K V+NGHEFFPSSVTT+P+V++HGGD
Sbjct  1    MSIVTDPLAIGRVIGDVVDYFTSTMKMSVTYN-TKQVYNGHEFFPSSVTTKPKVQIHGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E++ YEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGKEVMKYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+LYKQKRR  + +  P SRD FN++KF+ DNDL  PVAAVFFN QRETAARRR
Sbjct  120  VFLLYKQKRRQTV-MKIPTSRDLFNTKKFAQDNDLGPPVAAVFFNAQRETAARRR  173



>ref|XP_009371917.1| PREDICTED: CEN-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=173

 Score =   278 bits (710),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ D LV+GRV+GDV+D FSPSVKM V YN NK V+NGHE FPSSVT +P+VEVHGGD
Sbjct  1    MSRLLDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YEMPRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  121  VFLLFKQKGR--QTVIPPTSKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  173



>ref|XP_009364306.1| PREDICTED: CEN-like protein 2 isoform X2 [Pyrus x bretschneideri]
Length=173

 Score =   278 bits (710),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ D LV+GRV+GDV+D FSPSVKM V YN NK V+NGHE FPSSVT +P+VEVHGGD
Sbjct  1    MSRLLDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YEMPRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  121  VFLLFKQKGR--QTVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  173



>gb|AFV67443.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   277 bits (709),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNI IHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIDIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67444.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   277 bits (709),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP + D FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTWDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67439.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   277 bits (709),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL EHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLWEHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009390747.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=173

 Score =   277 bits (709),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ D LV+GRV+G+V+D F+PSVKM V YN NK V NGHE +PS+VT++PRVEV GGD
Sbjct  1    MSRLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVTSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVT+IPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTNIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ+RR    V+ P SRD F++R+F+++NDL  PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQQRR--QAVSPPSSRDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>gb|AGX25254.1| MCN5 [Musa AAB Group]
 gb|AGX25259.1| MCN5 [Musa AAB Group]
Length=173

 Score =   277 bits (709),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ D LV+GRV+G+V+D F+PSVKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ+RR    V+ P SRD F++R+F+++NDL  PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQQRR--QAVSPPSSRDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>gb|EMT05258.1| hypothetical protein F775_30982 [Aegilops tauschii]
Length=173

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + L++G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLIVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  N P +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NPPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>gb|AFV67442.1| centroradialis [Hordeum vulgare]
Length=173

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+ NIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKLNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  NAP +RD FN+R+F+D+NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NAPSTRDYFNTRRFADENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_008784004.1| PREDICTED: CEN-like protein 2 [Phoenix dactylifera]
Length=173

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + L++GRV+G+V+D F+PSVKM V YN NK V NGHEF+PS+V ++PRVEV G D
Sbjct  1    MARILEPLIVGRVIGEVLDPFNPSVKMVVTYNSNKLVCNGHEFYPSAVASKPRVEVQGAD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V  P SRD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--QAVAPPDSRDNFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006384827.1| TFL1a family protein [Populus trichocarpa]
 gb|AAQ88444.1| CEN-like protein 1 [Populus trichocarpa]
 dbj|BAD01610.1| terminal flower 1 [Populus nigra]
 dbj|BAD01611.1| terminal flower 1 [Populus nigra]
 gb|ERP62624.1| TFL1a family protein [Populus trichocarpa]
Length=174

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 153/176 (87%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPN-KHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MS+ LV+GRV+GDVID F+ +VKM V Y  N K V NGHE FPS+VT +P+VEVHGG
Sbjct  1    MAKMSEPLVVGRVIGDVIDHFTANVKMTVTYQSNRKQVFNGHELFPSAVTHKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+++YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVMNYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQK R    V  P SRD+FN+RKF+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  FVFLLFKQKGR--QTVTTPASRDKFNTRKFAEENELGLPVAAVFFNAQRETAARKR  174



>ref|XP_011007279.1| PREDICTED: CEN-like protein 2 [Populus euphratica]
Length=174

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 153/176 (87%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPN-KHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MS+ LV+GRV+GDVID F+ +VKM V Y  N K V NGHE FPS+VT +P+VEVHGG
Sbjct  1    MAKMSEPLVVGRVIGDVIDHFTANVKMTVTYQSNRKQVFNGHELFPSAVTHKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+++YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVMNYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R    V  P SR++FN+RKF+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  FVFVLFKQKGR--QTVTTPASREKFNTRKFAEENELGLPVAAVFFNAQRETAARKR  174



>ref|NP_001267654.1| protein SELF-PRUNING-like [Cucumis sativus]
 dbj|BAH28255.1| TFL1-like protein [Cucumis sativus]
 gb|KGN59123.1| hypothetical protein Csa_3G776350 [Cucumis sativus]
Length=177

 Score =   277 bits (708),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/174 (74%), Positives = 149/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            A  S+ LV+GRV+GDV+D F+ S+KM V Y+ NK V NGHEFFPS+V  +PR E+HGGD+
Sbjct  6    AMSSEPLVVGRVIGDVLDSFTQSMKMSVFYSNNKQVFNGHEFFPSAVAAKPRAEIHGGDL  65

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRFV
Sbjct  66   RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYETPKPNIGIHRFV  125

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQKRR    VN P SR+RFN+R F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  126  FVLFKQKRR--QSVNPPSSRERFNTRAFAVDNDLGLPVAAVYFNAQRETAARRR  177



>gb|AEO72023.1| TFL1-like protein [Prunus yedoensis]
Length=172

 Score =   276 bits (707),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR S+ LV+GRV+GDV+DCF+P+ KM V YN  K V NG+E +PS+VTT+PRVE+ GGD
Sbjct  1    MARTSEPLVVGRVIGDVLDCFTPTTKMSVTYN-TKLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTLIMTDPDVP PSDPYLREHLHWIVTDIPGTTD++FGRE++SYEMPRP+IGIHRF
Sbjct  60   MRTFFTLIMTDPDVPAPSDPYLREHLHWIVTDIPGTTDATFGREVMSYEMPRPDIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    VN P SRD F++R F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  120  VFVLFKQKRR--QSVNPPSSRDHFSARSFAAENDLGLPVAAVYFNCQRETAARRR  172



>dbj|BAD22599.1| terminal flower 1 [Populus nigra]
 dbj|BAD22600.1| terminal flower 1 [Populus nigra]
 dbj|BAG12897.1| terminal flower 1 [Populus nigra]
Length=174

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 153/176 (87%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPN-KHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MS+ LV+GRV+GDVID F+ +VKM V Y  + K V NGHE FPS+VT +P+VEVHGG
Sbjct  1    MAKMSEPLVVGRVIGDVIDHFTANVKMTVTYQSSRKQVFNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+++YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVMNYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQK R    V  P SRD+FN+RKF+++N+L  PVAAVFFN QRETAAR+R
Sbjct  121  FVFLLFKQKGR--QTVTTPASRDKFNTRKFAEENELGLPVAAVFFNAQRETAARKR  174



>gb|AFA42328.1| TFL1-like protein [Fragaria x ananassa]
 gb|AFA52237.1| TFL1-like protein [Fragaria x ananassa]
Length=172

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMS+ L +GRV+GDV+D F+P+ KM V YN  K V NGHE FPS+VT +PRVE+ GGD
Sbjct  1    MARMSEPLAVGRVIGDVLDSFTPTTKMIVTYN-TKLVCNGHELFPSAVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+ QKRR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFMQKRR--QSVNPPSSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>gb|EMS62911.1| hypothetical protein TRIUR3_23342 [Triticum urartu]
Length=173

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS+V ++PR+EV GGD
Sbjct  1    MARVLEPLVVGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAVVSKPRIEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             FVL++QK+R  M  N P +RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  TFVLFQQKKRQAM--NPPSTRDYFNTRRFANENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001106241.1| ZCN2 protein [Zea mays]
 gb|ABW96225.1| ZCN2 [Zea mays]
 gb|ABX11004.1| ZCN2 [Zea mays]
 gb|AFW62511.1| ZCN2 [Zea mays]
Length=173

 Score =   276 bits (706),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 154/175 (88%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + L++G+V+G+V+D F+P+VKM V YN NK V NGHEFFPS+V  +PRVEV GGD
Sbjct  1    MSRVLEPLIVGKVIGEVLDHFNPTVKMVVTYNSNKQVFNGHEFFPSAVAAKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+E+VSYE+P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGKEVVSYEIPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL++QK R    VN P S+DRF++R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQKSR--QAVNPPSSKDRFSTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|ADL62862.1| terminal flower 1 [Prunus armeniaca]
Length=172

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 152/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMS+ LV+GRV+GDV+DCF+P+ KM V YN  + V NG+E +PS+VTT+PRVE+ GGD
Sbjct  1    MARMSEPLVVGRVIGDVLDCFTPTTKMSVTYN-TRLVCNGYELYPSAVTTKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIH F
Sbjct  60   MRTFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHTF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V VL+KQKRR    VN P SRD F++R F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  120  VCVLFKQKRR--QSVNPPSSRDHFSARSFAAENDLDLPVAAVYFNCQRETAARRR  172



>ref|XP_009592311.1| PREDICTED: protein SELF-PRUNING-like isoform X2 [Nicotiana tomentosiformis]
Length=172

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRVVGDV+D FSP VKM + YN NK V NGHEFFPS VT+RP+VEV GGD
Sbjct  1    MARSLEPLIVGRVVGDVLDSFSPIVKMTITYN-NKLVCNGHEFFPSIVTSRPKVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHRF
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ+RR    V+ P SRD FN+R F+++NDL+ PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQRRR--QSVSPPTSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAARRR  172



>emb|CDP15403.1| unnamed protein product [Coffea canephora]
Length=172

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR ++ LV+GRV+GDV++ F+PS+KM VIYN NK V NGHE FPS+V +RPRVE+ GGD
Sbjct  1    MARSAEPLVVGRVIGDVLEYFTPSIKMTVIYN-NKQVCNGHELFPSAVVSRPRVEILGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD +FG+E+VSYE+PRPNIGIHRF
Sbjct  60   MRNFFTLVMTDPDVPGPSDPYLREHLHWVVTDIPGTTDVTFGKELVSYEIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    VN P SRD+FN+R F+ +NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKRR--QTVNPPPSRDQFNTRNFATENDLGEPVAAVFFNAQRETAARRR  172



>ref|XP_010912272.1| PREDICTED: protein SELF-PRUNING-like [Elaeis guineensis]
Length=173

 Score =   276 bits (705),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + L++GRV+G+V+D F+PSVKM V YN NK V NGHEF+PS+V +RPRVEV GGD
Sbjct  1    MARILEPLIVGRVIGEVLDPFNPSVKMVVTYNSNKLVCNGHEFYPSAVASRPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHL WIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLQWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V  P SRD F++R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--QAVTPPDSRDNFSTRRFAQENDLGLPVAAVYFNAQRETAARRR  173



>gb|AEO72027.1| TFL1-like protein [Fragaria vesca]
Length=172

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMS+ L +GRV+GDV+D F+P+ KM V YN +K V NGHE FPS+VT +PRVE+ GGD
Sbjct  1    MARMSEPLAVGRVIGDVLDSFTPTTKMIVSYN-SKLVCNGHELFPSAVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+ QKRR  M  N P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFMQKRRQSM--NPPSSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>ref|NP_001267006.1| protein TERMINAL FLOWER 1-like [Fragaria vesca]
 gb|ADO64258.1| TFL1-like protein [Fragaria vesca]
 gb|AEP23097.1| terminal flower 1 [Fragaria vesca]
 dbj|BAO93909.1| terminal flower 1 [Fragaria x ananassa]
Length=172

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMS+ L +GRV+GDV+D F+P+ KM V YN +K V NGHE FPS+VT +PRVE+ GGD
Sbjct  1    MARMSEPLAVGRVIGDVLDSFTPTTKMIVSYN-SKLVCNGHELFPSAVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+ QKRR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFMQKRR--QSVNPPSSRDHFNTRTFAAENDLGVPVAAVYFNAQRETAARRR  172



>gb|AGX25244.1| MCN5 [Musa acuminata AAA Group]
 gb|AGX25249.1| MCN5 [Musa acuminata AAA Group]
Length=173

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ D LV+GRV+G+V+D F+PSVKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRLIDPLVVGRVIGEVLDSFNPSVKMLVTYNSNKLVFNGHELYPSAVASKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ+RR    V+ P S D F++R+F+++NDL  PVAAVFFN QRETAARRR
Sbjct  121  VFVLFKQQRR--QAVSPPSSTDYFSTRRFAEENDLGLPVAAVFFNSQRETAARRR  173



>gb|ADO61015.1| terminal flower 1 [Helianthus annuus]
Length=173

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD LVIGRVVGDV+D F+  V M V YN +K V+NGHE FPSSVTT+P+V+V GGD
Sbjct  1    MARMSDPLVIGRVVGDVVDNFTQCVDMSVTYNSSKQVYNGHELFPSSVTTKPKVDVRGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE+PRPNIGIHRF
Sbjct  61   MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEIPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQ+ R    VN P SR  FN+R F+ +N L +PVA VFFNCQRETAARRR
Sbjct  121  VFLLFKQRGR--QTVNCPPSRHGFNTRNFAHENKLGSPVAGVFFNCQRETAARRR  173



>ref|NP_001280813.1| CEN-like protein 2 [Malus domestica]
 dbj|BAG31953.1| CENTRORADIALIS like protein [Malus domestica]
 dbj|BAG31957.1| CENTRORADIALIS like protein [Malus domestica]
Length=174

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            SD LV+GRV+GDV+D FSPSVKM V YN NK V+NGHE FPSSVT +P+VEVHGGD+RSF
Sbjct  6    SDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGDLRSF  65

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YEMPRPNIGIHRFVF+L
Sbjct  66   FTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGMEVVKYEMPRPNIGIHRFVFLL  125

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQK R    V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  126  FKQKGR--QTVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>gb|AGX25243.1| MCN4 [Musa acuminata AAA Group]
 gb|AGX25248.1| MCN4 [Musa acuminata AAA Group]
 gb|AGX25253.1| MCN4 [Musa AAB Group]
 gb|AGX25258.1| MCN4 [Musa AAB Group]
Length=173

 Score =   275 bits (702),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + LV+GRV+G+V+D F PSV++ V Y+ NK V NGHEF+PS+VT+RPRVEV GGD
Sbjct  1    MSRPVEPLVVGRVIGEVLDSFRPSVRILVTYSSNKLVFNGHEFYPSTVTSRPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V+ P SRDRF++R+F+++N L  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--QAVSPPASRDRFSTRRFAEENGLDLPVAAVYFNSQRETAARRR  173



>ref|XP_010244607.1| PREDICTED: CEN-like protein 2 [Nelumbo nucifera]
Length=176

 Score =   275 bits (702),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/174 (73%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            ARM + L++GRV+GDV+D FSP+VKM V YN NK V NGHEF+PSS+TT+PRVEVHGGDM
Sbjct  5    ARMLEPLIVGRVIGDVLDSFSPTVKMTVTYNSNKQVCNGHEFYPSSITTKPRVEVHGGDM  64

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFT++MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+V YE+P+P IGIHR+V
Sbjct  65   RSFFTVVMTDPDAPGPSDPYLREHLHWIVTDIPGTTDATFGRELVGYEIPKPYIGIHRYV  124

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQK R    V  P SRD F +RKF+++N+L  PVAAVFFN QRETAARRR
Sbjct  125  FVLFKQKGR--QTVTPPSSRDHFRTRKFAEENNLGLPVAAVFFNAQRETAARRR  176



>gb|ADO64261.1| KSN [Rosa chinensis var. spontanea]
Length=172

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+S+ LV+GRV+GDV+D F+P+ KM V Y+  K V NGHE FPS+VT +PRVE+ GGD
Sbjct  1    MARISEPLVVGRVIGDVLDYFTPNTKMIVTYS-TKLVFNGHELFPSAVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD +FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDVTFGREMVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QSVNPPSSRDHFNTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_009379789.1| PREDICTED: protein SELF-PRUNING-like [Musa acuminata subsp. malaccensis]
Length=173

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 153/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + LV+GRV+G+V+D F PSV++ + Y+ NK V NGHEF+PS+VT+RPRVEV GGD
Sbjct  1    MSRPVEPLVVGRVIGEVLDSFRPSVRILITYSSNKLVFNGHEFYPSTVTSRPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V+ P SRDRF++R+F+++N L  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--QAVSPPASRDRFSTRRFAEENGLDLPVAAVYFNSQRETAARRR  173



>ref|XP_009371916.1| PREDICTED: CEN-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=174

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            SD LV+GRV+GDV+D FSPSVKM V YN NK V+NGHE FPSSVT +P+VEVHGGD+RSF
Sbjct  6    SDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGDLRSF  65

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YEMPRPNIGIHRFVF+L
Sbjct  66   FTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRFVFLL  125

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQK R    V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  126  FKQKGR--QTVIPPTSKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>ref|XP_009364305.1| PREDICTED: CEN-like protein 2 isoform X1 [Pyrus x bretschneideri]
Length=174

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 147/171 (86%), Gaps = 2/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            SD LV+GRV+GDV+D FSPSVKM V YN NK V+NGHE FPSSVT +P+VEVHGGD+RSF
Sbjct  6    SDPLVVGRVIGDVVDYFSPSVKMTVSYNSNKKVYNGHELFPSSVTIKPKVEVHGGDLRSF  65

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG E+V YEMPRPNIGIHRFVF+L
Sbjct  66   FTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGIEVVKYEMPRPNIGIHRFVFLL  125

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQK R    V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  126  FKQKGR--QTVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>ref|XP_006647339.1| PREDICTED: protein SELF-PRUNING-like [Oryza brachyantha]
Length=173

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + L++G+V+G+V+D F+P+VKM   Y  NK V NGHEFFPS+V  +PRVEV GGD
Sbjct  1    MSRVLEPLIVGKVIGEVLDNFNPTVKMMATYGANKQVFNGHEFFPSAVAGKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL++QKRR    V+ P SRDRF++R+F++DNDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQKRR--QAVSPPPSRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006652260.1| PREDICTED: protein SELF-PRUNING-like [Oryza brachyantha]
Length=173

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + LV+G+V+G+VID F+P+VKM   Y+ NK V NGHEFFPS+V ++PRVEV GGD
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTATYSSNKQVFNGHEFFPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V VL+KQKRR    V+ P SRD F++R+F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  121  VLVLFKQKRR--QAVSPPSSRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_003575068.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + LV+G+V+G+V+D F+P+VKM   Y+ NK V NGHEFFPS++  +PRVEV GGD
Sbjct  1    MSRVLEPLVVGKVIGEVLDNFNPTVKMTATYSSNKQVFNGHEFFPSAIAVKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            + VL++QK R    V+AP SRDRFN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  ILVLFRQKSR--NAVSAPSSRDRFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006430226.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
 gb|ABY91242.1| CTRSTFL-like protein [Citrus trifoliata]
 gb|ESR43466.1| hypothetical protein CICLE_v10013475mg [Citrus clementina]
Length=173

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ARM + L +GRV+GDVI+ F+PS+KM V YN NK V NGHE FPS+V ++PRVE+ GG
Sbjct  1    MAARMLEPLAVGRVIGDVIESFTPSIKMSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQ RR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRR--QTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009393383.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=174

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARM-SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+ SD LV+G V+G+VID FSPSVKM V YN NK V NGHEFFPS+V ++PRVEV GG
Sbjct  1    MARVPSDPLVVGMVIGEVIDSFSPSVKMTVTYNSNKLVCNGHEFFPSAVVSKPRVEVQGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREH+HWIV+DIPGTTD+SFG+E+VSYE PRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHVHWIVSDIPGTTDASFGKEMVSYESPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL++QKRR    V  P SRD F++R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFQQKRR--QSVTLPASRDHFSTRQFAQENDLGLPVAAVYFNAQRETAARRR  174



>dbj|BAL70256.1| centroradialis [Rhododendron x pulchrum]
Length=174

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 148/175 (85%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR SD LV+GRV+GDV+D F  SVKM V Y  NK V NGHE FPS+VT +PRVEVHGGD
Sbjct  1    MARKSDPLVVGRVIGDVVDNFFASVKMSVTYTSNKKVCNGHELFPSAVTLQPRVEVHGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTLIMTDPDVPGPSDPYL+EHLHWI+TDIPGTTDSSFG+E V YEMP PNIGIHR+
Sbjct  61   LRSFFTLIMTDPDVPGPSDPYLKEHLHWIITDIPGTTDSSFGKEAVKYEMPMPNIGIHRY  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRRL + V    SRD F++R+F+++N L  PVAAVFFN QRETA+RRR
Sbjct  121  VFVLFKQKRRL-LAVTGSTSRDGFSTRRFAEENGLGLPVAAVFFNAQRETASRRR  174



>ref|XP_009411957.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=175

 Score =   273 bits (699),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L +GRV+G+VID F+PSVKM V YN NK V+NGHE FPS+V ++PRVEV GG
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVYNGHELFPSAVVSKPRVEVQGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            +MRSFFTL+MTDPD PGPSDPYLREH+HW+VTDIPGTTD+SFG+E+VSYE PRP+IGIHR
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTTDASFGKEVVSYESPRPSIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR  +   AP SRDRF++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFKQKRRQSVAA-APPSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAARRR  175



>ref|XP_004952639.1| PREDICTED: protein SELF-PRUNING-like [Setaria italica]
Length=173

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + L++G+V+G+V+D F+P+VKM V YN NK V NGHEFFPS V  +PRVEV GGD
Sbjct  1    MSRVLEPLIVGKVIGEVLDHFNPTVKMMVTYNSNKQVFNGHEFFPSVVANKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRELVSYENPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL++Q RR    V+ P SRDRF++R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFRQSRR--QAVSPPSSRDRFSTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001066172.1| Os12g0152000 [Oryza sativa Japonica Group]
 gb|AAD42896.1|AF159883_1 Cen-like protein FDR1 [Oryza sativa]
 gb|ABA95827.1| CENTRORADIALIS, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF29191.1| Os12g0152000 [Oryza sativa Japonica Group]
 gb|EAY82277.1| hypothetical protein OsI_37487 [Oryza sativa Indica Group]
 gb|EAZ19669.1| hypothetical protein OsJ_35245 [Oryza sativa Japonica Group]
Length=173

 Score =   273 bits (698),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + LV+GRV+G+VID F+P  KM V YN NK V NGHEF+PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLVVGRVIGEVIDSFNPCTKMIVTYNSNKLVFNGHEFYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGREI+SYE P+P+IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREIISYESPKPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V  P SRD FN+R+F+++N+L  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--QAVVVPSSRDHFNTRQFAEENELGLPVAAVYFNAQRETAARRR  173



>emb|CAH67157.1| H0717B12.4 [Oryza sativa Indica Group]
 gb|EAY94026.1| hypothetical protein OsI_15804 [Oryza sativa Indica Group]
Length=173

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + LV+G+V+G+VID F+P+VKM   Y+ NK V NGHEFFPS+V ++PRVEV GGD
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTATYSSNKQVFNGHEFFPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V VL+KQKRR    V  P SRD F++R+F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  121  VLVLFKQKRR--QAVTPPSSRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001173006.1| Os02g0531600 [Oryza sativa Japonica Group]
 dbj|BAD28412.1| putative Cen-like protein [Oryza sativa Japonica Group]
 gb|EAY86144.1| hypothetical protein OsI_07517 [Oryza sativa Indica Group]
 gb|EAZ23305.1| hypothetical protein OsJ_07001 [Oryza sativa Japonica Group]
 dbj|BAH01422.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91735.1| Os02g0531600 [Oryza sativa Japonica Group]
Length=173

 Score =   273 bits (697),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + L++G+V+G+V+D F+P+VKM   Y  NK V NGHEFFPS+V  +PRVEV GGD
Sbjct  1    MSRVLEPLIVGKVIGEVLDNFNPTVKMTATYGANKQVFNGHEFFPSAVAGKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            + VL++QKRR    V+ P SRDRF++R+F++DNDL  PVAAV+FN QRETAARRR
Sbjct  121  ILVLFRQKRR--QAVSPPPSRDRFSTRQFAEDNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_008788083.1| PREDICTED: protein SELF-PRUNING-like [Phoenix dactylifera]
Length=173

 Score =   272 bits (696),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+G+V+D F+PSVKM V YN NK V NGHEF+PS+VT++PRVEV GGD
Sbjct  1    MARALEPLIVGRVIGEVLDSFNPSVKMVVAYNFNKVVCNGHEFYPSAVTSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+V YE PRP++GIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVIYESPRPSVGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V  P SRD F++R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--EVVTPPASRDNFSTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010101582.1| hypothetical protein L484_015411 [Morus notabilis]
 gb|EXB88721.1| hypothetical protein L484_015411 [Morus notabilis]
Length=169

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 147/172 (85%), Gaps = 3/172 (2%)
 Frame = -1

Query  830  MSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRS  651
            MS+ LVIGRV+GDV+D F+P+ KM V YN  K V NGHE FPS+VTT+PRVE+ GGDMR 
Sbjct  1    MSEPLVIGRVIGDVLDSFTPTTKMSVSYN-KKQVCNGHELFPSAVTTKPRVEIQGGDMRC  59

Query  650  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFV  471
            FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMP+PNIGIHRFVFV
Sbjct  60   FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRFVFV  119

Query  470  LYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            L+KQK R    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  LFKQKSR--QSVNPPSSRDHFNTRNFAAENDLGLPVAAVYFNAQRETAARRR  169



>ref|XP_003579695.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + LV+G+V+G+VID F+P++KM   Y+ NK V NGHEFFPS+V ++PR+EV G D
Sbjct  1    MARALEPLVVGKVIGEVIDNFNPTMKMTATYSSNKQVFNGHEFFPSAVVSKPRIEVQGSD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+VSYE P+PNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDDSFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V+ P SRD FN+R+F+ +N+L  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QAVSTPSSRDYFNTRRFAAENELGLPVAAVYFNAQRETAARRR  173



>ref|XP_010907126.1| PREDICTED: protein SELF-PRUNING-like [Elaeis guineensis]
Length=173

 Score =   272 bits (695),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 152/175 (87%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+G+V+D F+PSVKM V YN NK V NGHEF+PS+VT++PRVEV G D
Sbjct  1    MARALEPLIVGRVIGEVLDSFNPSVKMVVTYNFNKLVCNGHEFYPSAVTSKPRVEVQGDD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE+VSYE PRP+IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVVSYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V  P SRD F++R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--QVVTPPASRDNFSTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_002876387.1| hypothetical protein ARALYDRAFT_486134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52646.1| hypothetical protein ARALYDRAFT_486134 [Arabidopsis lyrata subsp. 
lyrata]
Length=175

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD SFG+EI+ YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWVVTDIPGTTDVSFGKEIIGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R+F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>gb|ABY91243.1| CTRSTFL-like protein [Citrus trifoliata]
Length=173

 Score =   271 bits (694),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ARM + L +GRV+GDVI+ F+PS+K  V YN NK V NGHE FPS+V ++PRVE+ GG
Sbjct  1    MAARMLEPLAVGRVIGDVIESFTPSIKKSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQ RR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRR--QTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|ACX53295.1| terminal flower 1-like protein [Crocus sativus]
Length=173

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + L++GRV+G+V+D F  S+KM V YN NK V NGHEFFPS+V  +PRVEV G D
Sbjct  1    MARVMEPLIVGRVIGEVLDSFEQSMKMMVTYNSNKLVCNGHEFFPSAVAPKPRVEVQGAD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRPNIGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREMVSYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL++QKRR  +G   P SRDRF++R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFRQKRRQSVG--PPPSRDRFSTRRFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009592303.1| PREDICTED: protein SELF-PRUNING-like isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/176 (74%), Positives = 153/176 (87%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRVVGDV+D FSP VKM + YN NK V NGHEFFPS VT+RP+VEV GGD
Sbjct  1    MARSLEPLIVGRVVGDVLDSFSPIVKMTITYN-NKLVCNGHEFFPSIVTSRPKVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSF-GREIVSYEMPRPNIGIHR  483
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++F GRE+VSYE+PRPNIGIHR
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFVGRELVSYEIPRPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQ+RR    V+ P SRD FN+R F+++NDL+ PVAAVFFN QRETAARRR
Sbjct  120  FVFVLFKQRRR--QSVSPPTSRDNFNTRNFAEENDLSQPVAAVFFNAQRETAARRR  173



>ref|XP_002450283.1| hypothetical protein SORBIDRAFT_05g003200 [Sorghum bicolor]
 gb|EES09271.1| hypothetical protein SORBIDRAFT_05g003200 [Sorghum bicolor]
Length=173

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  +SL++GRV+G+V+D FSP VKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVESLIVGRVIGEVLDSFSPCVKMVVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE PRP+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P SRD F +R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QTVAMPSSRDHFITRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001052733.1| Os04g0411400 [Oryza sativa Japonica Group]
 emb|CAD40659.2| OSJNBa0073L04.4 [Oryza sativa Japonica Group]
 dbj|BAF14647.1| Os04g0411400 [Oryza sativa Japonica Group]
 gb|EAZ30664.1| hypothetical protein OsJ_14719 [Oryza sativa Japonica Group]
 dbj|BAG98998.1| unnamed protein product [Oryza sativa Japonica Group]
Length=173

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + LV+G+V+G+VID F+P+VKM   Y+ NK V NGHE FPS+V ++PRVEV GGD
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTATYSSNKQVFNGHELFPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            V VL+KQKRR    V  P SRD F++R+F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  121  VLVLFKQKRR--QAVTPPSSRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010510761.1| PREDICTED: protein CENTRORADIALIS-like [Camelina sativa]
 ref|XP_010473146.1| PREDICTED: protein CENTRORADIALIS-like [Camelina sativa]
Length=175

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+E++ YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEMIGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R+F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_006481791.1| PREDICTED: protein TERMINAL FLOWER 1 isoform X1 [Citrus sinensis]
Length=173

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ARM + L +G V+GDVI+ F+PS+KM V YN NK V NGHE FPS+V ++PRVE+ GG
Sbjct  1    MAARMLEPLAVGGVIGDVIESFTPSIKMSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQ RR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRR--QTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|AEO72022.1| RhTFL1 [Rosa hybrid cultivar]
Length=170

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = -1

Query  830  MSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRS  651
            MSD LV+GRV+GDV+D FSPSVKM V YN +K V+NGHE FPSSVTT+P+VEV GGD+RS
Sbjct  1    MSDPLVVGRVIGDVVDYFSPSVKMAVTYNSSKKVYNGHELFPSSVTTKPKVEVQGGDLRS  60

Query  650  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFV  471
            FFTL++TDPDVPGPSDPYL+EHLHWIV DIPGTTD++FGRE+V YEMPRPNIGIHRFVF+
Sbjct  61   FFTLVVTDPDVPGPSDPYLKEHLHWIVMDIPGTTDNTFGREVVKYEMPRPNIGIHRFVFL  120

Query  470  LYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            L+KQK R    V  P S+D F+SRKF++ N+   PVAAVFFN QRETAARRR
Sbjct  121  LFKQKGR--QTVIPPPSKDHFDSRKFAEANEFGLPVAAVFFNAQRETAARRR  170



>gb|ABW24964.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDV+D F PS+KM V +N NK V NGHEF+PS+V T+PRVEV GGD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMLVTFN-NKQVFNGHEFYPSTVVTKPRVEVAGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    + +P SRD FN+R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QIIKSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>gb|AGX25250.1| MCN1 [Musa AAB Group]
 gb|AGX25255.1| MCN1 [Musa AAB Group]
Length=175

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L +GRV+G+VID F+PSVKM V YN NK V NGHE FPS+V ++PRVEV GG
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVCNGHELFPSAVVSKPRVEVQGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            +MRSFFTL+MTDPD PGPSDPYLREH+HW+VTDIPGTTD+SFG+E+VSYE PRP+IGIHR
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTTDASFGKEVVSYESPRPSIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKR   +   APLSRDRF++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFKQKRGQSVAA-APLSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAARRR  175



>ref|NP_180324.1| protein CENTRORADIALIS-like [Arabidopsis thaliana]
 sp|Q9ZNV5.1|CEN_ARATH RecName: Full=Protein CENTRORADIALIS-like [Arabidopsis thaliana]
 gb|AAC73043.1| similar to terminal flower [Arabidopsis thaliana]
 dbj|BAA75933.1| ATC [Arabidopsis thaliana]
 dbj|BAA75931.1| ATC [Arabidopsis thaliana]
 dbj|BAA75932.1| ATC [Arabidopsis thaliana]
 gb|AAL38687.1| putative terminal flower protein [Arabidopsis thaliana]
 gb|AAM15187.1| similar to terminal flower [Arabidopsis thaliana]
 gb|AAM20165.1| putative terminal flower protein [Arabidopsis thaliana]
 gb|AEC08014.1| protein CENTRORADIALIS-like [Arabidopsis thaliana]
Length=175

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTYKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+EI+ YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEIIGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R+F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQTRR-GSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>gb|AGX25240.1| MCN1 [Musa acuminata AAA Group]
 gb|AGX25245.1| MCN1 [Musa acuminata AAA Group]
Length=175

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L +GRV+G+VID F+PSVKM V YN NK V NGHE FPS+V ++PRVEV GG
Sbjct  1    MARLSSDPLTVGRVIGEVIDSFNPSVKMMVTYNSNKLVCNGHELFPSAVVSKPRVEVQGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            +MRSFFTL+MTDPD PGPSDPYLREH+HW+VTDIPGTTD+SFG+E+VSYE PRP+IGIHR
Sbjct  61   EMRSFFTLVMTDPDAPGPSDPYLREHVHWVVTDIPGTTDASFGKEVVSYESPRPSIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR  +   AP SRDRF++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFKQKRRQSVAA-APPSRDRFSTRGFAQENDLDLPVAAVYFNAQRETAARRR  175



>ref|XP_009103610.1| PREDICTED: protein CENTRORADIALIS-like [Brassica rapa]
 emb|CDY04503.1| BnaA07g13290D [Brassica napus]
Length=175

 Score =   271 bits (692),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MARISADPLMVGRVIGDVVDSCLQAVKMTVTYNCDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG EIV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGNEIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R F+ DNDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFNTRMFAHDNDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_010089842.1| hypothetical protein L484_022359 [Morus notabilis]
 gb|EXB38458.1| hypothetical protein L484_022359 [Morus notabilis]
Length=174

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 152/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MAR-MSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+ MSD LV+GRV+GDV+D FSPS+++ V Y+ NK V+NGHE  PSSVTT+P+VEVHGG
Sbjct  1    MAKHMSDPLVLGRVIGDVVDPFSPSLRISVTYS-NKKVYNGHELLPSSVTTKPKVEVHGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFGRE+VSYEMPRPNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGREVVSYEMPRPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV +L+KQKRR  +    P SR+RF++R F+ +N+L  PVAAVFFN QRETA RRR
Sbjct  120  FVLLLFKQKRRQTVAAPPP-SRERFSTRSFAQENELGLPVAAVFFNAQRETACRRR  174



>ref|NP_001267931.1| TFL1B protein [Vitis vinifera]
 gb|ABI99467.1| TFL1B protein [Vitis vinifera]
 emb|CAN61194.1| hypothetical protein VITISV_028345 [Vitis vinifera]
 emb|CBI30285.3| unnamed protein product [Vitis vinifera]
Length=172

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + L++GRV+GDV+D F P++KM V Y+ NK + NG+E +PSS+T +PRVEV GGD
Sbjct  1    MARILEPLIVGRVIGDVLDPFPPTIKMTVTYH-NKQICNGYELYPSSITVKPRVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE++SYE+P+PNIGIHRF
Sbjct  60   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVLSYEIPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    VN P SRD FN+R F+ +NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKRR--QTVNTPTSRDHFNTRSFAAENDLGLPVAAVFFNAQRETAARRR  172



>ref|XP_002442808.1| hypothetical protein SORBIDRAFT_08g003210 [Sorghum bicolor]
 gb|EES16646.1| hypothetical protein SORBIDRAFT_08g003210 [Sorghum bicolor]
Length=173

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQK R    V  P SRD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKGR--QTVTVPSSRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_009339416.1| PREDICTED: CEN-like protein 2 [Pyrus x bretschneideri]
Length=174

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA MS D LV+GRV+GDV+D FS SV+M + YN NK V+NGHE FPSSVT +P+VEVHGG
Sbjct  1    MAMMSSDPLVVGRVIGDVVDYFSSSVRMTITYNSNKVVYNGHELFPSSVTIKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTL+MTDPDVPGPSDPYL+EHLHWIVTDIPGTTD++FG+E+V YEMPRPNIGIHR
Sbjct  61   DLRSFFTLVMTDPDVPGPSDPYLKEHLHWIVTDIPGTTDNTFGKEVVKYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQK      V  P S+D FN+RKF++ NDL  PV AVFFN QRETAARRR
Sbjct  121  FVFLLFKQKG--WQTVIPPASKDHFNTRKFAEANDLGLPVTAVFFNAQRETAARRR  174



>ref|XP_010417907.1| PREDICTED: protein CENTRORADIALIS-like [Camelina sativa]
Length=175

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+E++ YEMPRPNIGIHR
Sbjct  61   DLRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKEMIGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R+F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFNTREFAHENDLGLPVAAVFFNCQRETAARRR  175



>gb|ABX11008.1| ZCN6 [Zea mays]
 gb|ACG45277.1| RCN1 - Corn Centroradialis/TFL1-like protein [Zea mays]
 gb|AFW64821.1| RCN1-Corn Centroradialis/TFL1-like proteinZCN6 [Zea mays]
Length=177

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 149/177 (84%), Gaps = 2/177 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  +SLV+GRV+G+V+DCFSP VKM V YN N+ V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVESLVVGRVIGEVLDCFSPCVKMVVTYNSNRLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRP IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPGIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNA--PLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V A    SRD F +R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQQQTVAAVPSSSRDHFITRQFAAENDLGHPVAAVYFNAQRETAARRR  177



>gb|ABY62770.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDV+D F PS+KM V +N NK V NGHEF+PS+V T+PRVEV GGD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMSVTFN-NKQVFNGHEFYPSTVVTKPRVEVVGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    + +P SRD FN+R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QIIKSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>gb|AGX25241.1| MCN2 [Musa acuminata AAA Group]
 gb|AGX25246.1| MCN2 [Musa acuminata AAA Group]
 gb|AGX25251.1| MCN2 [Musa AAB Group]
 gb|AGX25256.1| MCN2 [Musa AAB Group]
Length=174

 Score =   270 bits (690),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D LV+G V+G+VID FSPSVKM V  N NK V NGHEFFPS+V ++PRVEV GG
Sbjct  1    MARVSSDPLVVGMVIGEVIDSFSPSVKMTVTCNSNKLVCNGHEFFPSAVVSKPRVEVQGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREH+HWIV+DIPGTTD+SFG+E+VSYE PRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHVHWIVSDIPGTTDASFGKEMVSYESPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL++QKRR    V  P SRD F++R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  FVFVLFQQKRR--QSVTLPASRDHFSTRRFAQENDLGLPVAAVYFNAQRETAARRR  174



>ref|NP_001241437.1| protein TERMINAL FLOWER 1-like [Glycine max]
 gb|ACU00124.1| terminal flowering 1-like protein 2 [Glycine max]
 gb|ACU24420.1| unknown [Glycine max]
 dbj|BAI66120.1| terminal flower 1a [Glycine max]
 gb|ADF31196.1| Dt1-like protein [Glycine max]
 gb|ADF31197.1| Dt1-like protein [Glycine max]
 gb|ADF31198.1| Dt1-like protein [Glycine max]
 gb|ADF31199.1| Dt1-like protein [Glycine max]
 gb|ADF31200.1| Dt1-like protein [Glycine max]
 gb|ADF31201.1| Dt1-like protein [Glycine max]
 gb|ADF31202.1| Dt1-like protein [Glycine max]
 gb|ADF31203.1| Dt1-like protein [Glycine max]
 gb|ADF31204.1| Dt1-like protein [Glycine max]
 gb|ADF31205.1| Dt1-like protein [Glycine max]
 gb|ADF31206.1| Dt1-like protein [Glycine max]
 gb|ADF31207.1| Dt1-like protein [Glycine max]
 gb|ADF31208.1| Dt1-like protein [Glycine max]
 gb|ADF31209.1| Dt1-like protein [Glycine max]
 gb|ADF31210.1| Dt1-like protein [Glycine max]
 gb|ADF31211.1| Dt1-like protein [Glycine max]
 gb|ADF31212.1| Dt1-like protein [Glycine max]
 gb|ADF31213.1| Dt1-like protein [Glycine max]
 gb|ADF31214.1| Dt1-like protein [Glycine max]
 gb|ADF31215.1| Dt1-like protein [Glycine max]
 gb|ADF31216.1| Dt1-like protein [Glycine max]
 gb|ADF31217.1| Dt1-like protein [Glycine max]
 gb|ADF31218.1| Dt1-like protein [Glycine max]
 gb|ADF31219.1| Dt1-like protein [Glycine max]
 gb|ADF31220.1| Dt1-like protein [Glycine max]
 gb|ADF31221.1| Dt1-like protein [Glycine max]
 gb|ADF31222.1| Dt1-like protein [Glycine max]
 gb|ADF31223.1| Dt1-like protein [Glycine max]
 gb|ADF31224.1| Dt1-like protein [Glycine max]
 gb|ADF31225.1| Dt1-like protein [Glycine max]
 gb|ADF31226.1| Dt1-like protein [Glycine max]
 gb|ADF31227.1| Dt1-like protein [Glycine max]
 gb|ADF31228.1| Dt1-like protein [Glycine max]
 gb|ADF31229.1| Dt1-like protein [Glycine max]
 gb|ADF31230.1| Dt1-like protein [Glycine max]
 gb|ADF31231.1| Dt1-like protein [Glycine max]
 gb|ADF31232.1| Dt1-like protein [Glycine max]
 gb|ADF31233.1| Dt1-like protein [Glycine max]
 gb|ADF31234.1| Dt1-like protein [Glycine max]
 gb|ADF31235.1| Dt1-like protein [Glycine max]
 gb|ADF31236.1| Dt1-like protein [Glycine max]
 gb|ADF31237.1| Dt1-like protein [Glycine max]
 gb|ADF31238.1| Dt1-like protein [Glycine max]
 gb|ADF31239.1| Dt1-like protein [Glycine max]
 gb|ADF31240.1| Dt1-like protein [Glycine max]
 gb|ADF31241.1| Dt1-like protein [Glycine max]
 gb|ADF31242.1| Dt1-like protein [Glycine max]
 gb|ADF31243.1| Dt1-like protein [Glycine max]
 gb|ADF31244.1| Dt1-like protein [Glycine max]
 gb|ADF31245.1| Dt1-like protein [Glycine max]
 gb|ADF31246.1| Dt1-like protein [Glycine max]
 gb|ADF31247.1| Dt1-like protein [Glycine max]
 gb|ADF31248.1| Dt1-like protein [Glycine max]
 gb|ADF31249.1| Dt1-like protein [Glycine max]
 gb|ADF31250.1| Dt1-like protein [Glycine max]
 gb|ADF31251.1| Dt1-like protein [Glycine max]
 gb|ADF31252.1| Dt1-like protein [Glycine max]
 gb|ADF31253.1| Dt1-like protein [Glycine max]
 gb|ADF31254.1| Dt1-like protein [Glycine max]
 gb|ADF31255.1| Dt1-like protein [Glycine max]
 gb|ADF31256.1| Dt1-like protein [Glycine max]
 gb|ADF31257.1| Dt1-like protein [Glycine max]
 gb|ADF31258.1| Dt1-like protein [Glycine max]
 gb|ADF31259.1| Dt1-like protein [Glycine max]
 gb|ADF31260.1| Dt1-like protein [Glycine max]
 gb|ADF31261.1| Dt1-like protein [Glycine max]
 gb|ADF31262.1| Dt1-like protein [Glycine max]
 gb|ADF31263.1| Dt1-like protein [Glycine max]
 gb|ADF31264.1| Dt1-like protein [Glycine max]
 gb|ADF31265.1| Dt1-like protein [Glycine max]
 gb|ADF31266.1| Dt1-like protein [Glycine max]
 gb|ADF31267.1| Dt1-like protein [Glycine max]
 gb|ADF31268.1| Dt1-like protein [Glycine max]
 gb|ADF31269.1| Dt1-like protein [Glycine max]
 gb|ADF31270.1| Dt1-like protein [Glycine max]
 gb|ADF31271.1| Dt1-like protein [Glycine max]
 gb|ADF31272.1| Dt1-like protein [Glycine max]
 gb|ADF31273.1| Dt1-like protein [Glycine max]
 gb|ADF31274.1| Dt1-like protein [Glycine max]
 gb|ADF31275.1| Dt1-like protein [Glycine max]
 gb|ADF31276.1| Dt1-like protein [Glycine max]
 gb|ADF31277.1| Dt1-like protein [Glycine max]
 gb|ADF31278.1| Dt1-like protein [Glycine max]
 gb|ADF31279.1| Dt1-like protein [Glycine max]
 gb|ADF31280.1| Dt1-like protein [Glycine max]
 gb|ADF31281.1| Dt1-like protein [Glycine max]
 gb|ADF31282.1| Dt1-like protein [Glycine max]
 gb|ADF31283.1| Dt1-like protein [Glycine max]
 gb|ADF31284.1| Dt1-like protein [Glycine max]
 gb|ADF31285.1| Dt1-like protein [Glycine soja]
 gb|ADF31286.1| Dt1-like protein [Glycine soja]
 gb|ADF31287.1| Dt1-like protein [Glycine soja]
 gb|ADF31288.1| Dt1-like protein [Glycine soja]
 gb|ADF31289.1| Dt1-like protein [Glycine soja]
 gb|ADF31290.1| Dt1-like protein [Glycine soja]
 gb|ADF31291.1| Dt1-like protein [Glycine soja]
 gb|ADF31292.1| Dt1-like protein [Glycine soja]
 gb|ADF31293.1| Dt1-like protein [Glycine soja]
 gb|ADF31294.1| Dt1-like protein [Glycine soja]
 gb|ADF31295.1| Dt1-like protein [Glycine soja]
 gb|ADF31296.1| Dt1-like protein [Glycine soja]
 gb|ADF31297.1| Dt1-like protein [Glycine soja]
 gb|ADF31298.1| Dt1-like protein [Glycine soja]
 gb|ADF31299.1| Dt1-like protein [Glycine soja]
 gb|ADF31300.1| Dt1-like protein [Glycine soja]
 gb|ADF31301.1| Dt1-like protein [Glycine soja]
 gb|ADF31302.1| Dt1-like protein [Glycine soja]
 gb|ADF31303.1| Dt1-like protein [Glycine soja]
 gb|ADF31304.1| Dt1-like protein [Glycine soja]
Length=173

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 152/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM  + L++GRV+G+V+D F+ S KM V YN N+ V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMIVSYNKNQ-VYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+RKF+ +NDLA PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRKFAAENDLALPVAAVYFNAQRETAARRR  173



>ref|XP_009792306.1| PREDICTED: CEN-like protein 2 [Nicotiana sylvestris]
Length=172

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRVVGDV+D FSP +KM + YN NK V NGHE  PS VT RP+VEV GGD
Sbjct  1    MARSLEPLIVGRVVGDVLDSFSPIMKMTISYN-NKLVCNGHELLPSVVTARPKVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+P PNIGIHRF
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPMPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    V++P SRD FN+R F+++NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKRR--QSVSSPTSRDHFNTRNFAEENDLGQPVAAVFFNAQRETAARRR  172



>ref|XP_006409758.1| hypothetical protein EUTSA_v10017312mg [Eutrema salsugineum]
 gb|ESQ51211.1| hypothetical protein EUTSA_v10017312mg [Eutrema salsugineum]
Length=175

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+V+VHGG
Sbjct  1    MARISSDPLIVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHEIFPSTVTNKPKVDVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V  P  RD+FN+R F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVAVPSYRDQFNTRMFAHENDLGLPVAAVFFNCQRETAARRR  175



>gb|AEH43350.1| CEN [Arabis alpina]
 gb|AEH43356.1| CEN [Arabis alpina]
 gb|KFK32394.1| hypothetical protein AALP_AA6G235900 [Arabis alpina]
Length=175

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG++IV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKDIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQSRR-GSVVSVPSYRDQFNTRMFAYENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_007027716.1| Centroradialis [Theobroma cacao]
 gb|EOY08218.1| Centroradialis [Theobroma cacao]
Length=172

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R ++ LV+GRV+GDV+D F PS+ M V +N NK V NGHEF+PS+V T+PRVE+ GGD
Sbjct  1    MSRAAEPLVVGRVIGDVLDSFIPSITMTVTFN-NKRVFNGHEFYPSTVATKPRVEIEGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREH+HWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDATFGREVVSYEIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    + +P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QMITSPSSRDNFSTRGFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|NP_001275848.1| terminal flower [Citrus sinensis]
 gb|AAR04683.1| terminal flower [Citrus sinensis]
 gb|AAR04684.1| terminal flower [Citrus sinensis]
Length=173

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            + ARM + L +G V+GDVI+ F+PS+KM V Y+ NK V NGHE FPS+V ++PRVE+ GG
Sbjct  1    MAARMLEPLAVGGVIGDVIESFTPSIKMSVTYD-NKQVCNGHELFPSTVVSKPRVEIQGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQ RR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQTRR--QTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_003578901.1| PREDICTED: CEN-like protein 2 [Brachypodium distachyon]
Length=173

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVASKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPY REHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V AP  RD FN+R+F++ NDL  PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRR--QTVTAPSFRDHFNTRQFAEQNDLGLPVAAVYFNCQRETAARRR  173



>gb|ABW24968.1| terminal flower 1b [Gossypium hirsutum]
Length=172

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDV+D F PS+KM V +N NK V NGHEF+PS+V T+PRVEV GGD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMSVTFN-NKQVFNGHEFYPSTVVTKPRVEVVGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    + +P SRD FN+R+F  +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QIIKSPCSRDNFNTRRFVSENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_009766168.1| PREDICTED: protein TERMINAL FLOWER 1-like [Nicotiana sylvestris]
Length=172

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 149/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + LV+GRVVGDV+D FSP+VKM V YN NK V NG E FPS+VT RPRVEV GGD
Sbjct  1    MARNVEPLVVGRVVGDVLDSFSPTVKMTVTYN-NKQVCNGQELFPSAVTIRPRVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL++TDPDVPGPSDPYLREH+HWIVTDIPGTTD++FG+E+VSYE+PRPNIGIHRF
Sbjct  60   MRTFFTLVITDPDVPGPSDPYLREHVHWIVTDIPGTTDATFGKELVSYEIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQK R    V+ P SRD FN+R F++ NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKCR--QSVSPPTSRDHFNTRNFANVNDLGPPVAAVFFNAQRETAARRR  172



>gb|ABW24962.1| terminal flower 1b [Gossypium arboreum]
 gb|ABW24969.1| terminal flower 1b [Gossypium arboreum]
Length=172

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 151/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDV+D F PS+KM V +N NK V NGHEF+PS+V T+PRVEV GGD
Sbjct  1    MAREVEPLMVGRVIGDVMDSFIPSIKMSVTFN-NKQVFNGHEFYPSTVVTKPRVEVVGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    + +P SRD FN+R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QIIKSPCSRDNFNTRRFAFENDLGLPVAAVYFNAQRETAARRR  172



>gb|EMS48180.1| hypothetical protein TRIUR3_17327 [Triticum urartu]
Length=173

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+R+F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRR--QTVTVPSFRDHFNTRQFAAENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_006341131.1| PREDICTED: CEN-like protein 2-like isoform X1 [Solanum tuberosum]
Length=172

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDVID F+P++KM + YN NK V NGHE FPS+V++RP+VEV GGD
Sbjct  1    MARSLEPLIVGRVIGDVIDSFNPTIKMSITYN-NKLVCNGHELFPSAVSSRPKVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSD YLREHLHWI+TDIPGTTD++FGRE+VSY++PRPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDTYLREHLHWIITDIPGTTDATFGRELVSYDIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQK R    V+ P SRD FN+R F+ +NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKSR--SSVSQPTSRDHFNTRNFAQENDLEQPVAAVFFNAQRETAARRR  172



>gb|ABW24966.1| terminal flower 1b [Gossypium raimondii]
Length=172

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L+ GRV+GDV+D F PS+KM V +N NK V NGHEF+PS+V T+PRVEV GGD
Sbjct  1    MAREVEPLMGGRVIGDVMDSFIPSIKMLVTFN-NKQVFNGHEFYPSTVVTKPRVEVAGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYENPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    + +P SRD FN+R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQKRR--QIIKSPCSRDNFNTRRFASENDLGLPVAAVYFNAQRETAARRR  172



>gb|AHZ46122.1| TFL1-like flowering time protein [Saccharum hybrid cultivar]
Length=173

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  +SLV+GRV+G+V+D FSP V M V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVESLVVGRVIGEVLDFFSPCVNMVVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE PRP+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR  + V  P SRD F +R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQTVAV--PSSRDHFVTRQFAXENDLGLPVAAVYFNAQRETAARRR  173



>gb|AIU44253.1| TFL1 [Oncidium hybrid cultivar]
Length=173

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 150/175 (86%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + LV+GRV+G+V++ F+PSVKM V YN NKHV+NGHE +PS +   PRVEV GGD
Sbjct  1    MARAIEPLVVGRVIGEVLELFNPSVKMKVTYNCNKHVYNGHELYPSVILDMPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTLIMTDPDVPGPSDPYLREH+HWIVTDIPGTTD+SFGRE+V YE PRP IGIHRF
Sbjct  61   LRSFFTLIMTDPDVPGPSDPYLREHVHWIVTDIPGTTDASFGREVVPYESPRPRIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+ QKRRL +G   P+SRDRFN+R F++++DL  PV+AV+FN QRETAARRR
Sbjct  121  VFVLFMQKRRLTVG--PPISRDRFNTRGFAEEHDLGLPVSAVYFNAQRETAARRR  173



>ref|XP_009140811.1| PREDICTED: protein CENTRORADIALIS-like [Brassica rapa]
 emb|CDY51916.1| BnaC01g41050D [Brassica napus]
 emb|CDY30540.1| BnaA04g15930D [Brassica napus]
 emb|CDY27416.1| BnaC03g64560D [Brassica napus]
Length=175

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            M+R+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MSRISSDPLMVGRVIGDVVDNCLQAVKMTVTYNCDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFNTRMFAYENDLGLPVAAVFFNCQRETAARRR  175



>ref|NP_001240029.1| CEN-like protein 2-like [Glycine max]
 gb|ACU00128.1| CENTRORADIALIS-like protein 2 [Glycine max]
 gb|KHN13508.1| CEN-like protein 2 [Glycine soja]
Length=174

 Score =   268 bits (685),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 151/176 (86%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARMS D L+IGRV+GDV+  F+P++KM V YN  K V+NG+EFFPS++TTRPRVE+ GG
Sbjct  1    MARMSTDPLIIGRVIGDVLGSFTPTIKMTVTYN-KKQVYNGYEFFPSTITTRPRVEIGGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TLIMTDPDVPGPSDPYLREHLHW+VTDIPGTT++SFG+ +VSYEMP PNIGIHR
Sbjct  60   DMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGKVLVSYEMPNPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +VFVL KQKRR  +    P SRD FN+RKFS +NDL  PVAAV+FN QRETAARRR
Sbjct  120  YVFVLLKQKRRQCV-TRPPSSRDHFNTRKFSAENDLGLPVAAVYFNAQRETAARRR  174



>gb|KHN18765.1| Protein TERMINAL FLOWER 1 [Glycine soja]
Length=173

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM  + L++GRV+G+V+D F+ S KM V YN N+ V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMIVSYNKNQ-VYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+RKF+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|EMT24999.1| hypothetical protein F775_30083 [Aegilops tauschii]
Length=173

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSMFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+R+F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRR--QTVTVPSFRDHFNTRQFAAENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_006662737.1| PREDICTED: CEN-like protein 2-like [Oryza brachyantha]
Length=173

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + LV+GRV+G+V+D F+P +KM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QTVLVPSFRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001065771.1| Os11g0152500 [Oryza sativa Japonica Group]
 gb|AAD42895.1|AF159882_1 Cen-like protein FDR2 [Oryza sativa]
 gb|AAX94844.1| Phosphatidylethanolamine-binding protein [Oryza sativa Japonica 
Group]
 gb|ABA91511.1| CEN-like protein 2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27616.1| Os11g0152500 [Oryza sativa Japonica Group]
 gb|EAZ17463.1| hypothetical protein OsJ_32992 [Oryza sativa Japonica Group]
 gb|EEC67689.1| hypothetical protein OsI_35142 [Oryza sativa Indica Group]
Length=173

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + LV+GRV+G+V+D F+P +KM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QTVIVPSFRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|AHB20161.1| terminal flower 1-like protein [Hemerocallis middendorffii]
 gb|AHB60659.1| terminal flower 1-like protein [Hemerocallis middendorffii]
Length=173

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/175 (73%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR    L++GRV+GDV+D F PS KM V YN NK V N HEF PS+V ++PRV+V GGD
Sbjct  1    MARAVQPLIVGRVIGDVLDTFEPSAKMMVTYNSNKLVCNCHEFSPSAVVSKPRVKVPGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+V+YE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRELVAYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    VN P SRDRFN+R+F++ N+   PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKRR--GSVNTPGSRDRFNARQFAEKNEFGLPVAAVYFNAQRETAARRR  173



>emb|CDX71440.1| BnaC04g16750D [Brassica napus]
Length=175

 Score =   268 bits (684),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/176 (73%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS+VT +P+VEVHGG
Sbjct  1    MARISADPLMVGRVIGDVVDSCLQAVKMTVTYNCDKQVYNGHELFPSAVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG EIV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGNEIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+FN+R F+ DNDL  PVAAVFFNCQRETAAR R
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFNTRMFAHDNDLGLPVAAVFFNCQRETAARCR  175



>ref|XP_004978696.1| PREDICTED: CEN-like protein 2-like [Setaria italica]
Length=173

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+++YE PRP+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVINYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QTVTVPSVRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006341132.1| PREDICTED: CEN-like protein 2-like isoform X2 [Solanum tuberosum]
Length=172

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 150/175 (86%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDVID F+P++KM + YN NK V NGHE FPS+V++RP+VEV GGD
Sbjct  1    MARSLEPLIVGRVIGDVIDSFNPTIKMSITYN-NKLVCNGHELFPSAVSSRPKVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSD YLREHLHWI+TDIPGTTD++FG+E+VSY++PRPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDTYLREHLHWIITDIPGTTDATFGKELVSYDIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQK R    V+ P SRD FN+R F+ +NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKSR--SSVSQPTSRDHFNTRNFAQENDLEQPVAAVFFNAQRETAARRR  172



>gb|ACJ61501.1| terminal flower [Glycine max]
 gb|ACU00123.1| terminal flowering 1-like protein 1 [Glycine max]
 gb|ADF30893.1| Dt1 [Glycine max]
 gb|ADF30894.1| Dt1 [Glycine max]
 gb|ADF30897.1| Dt1 [Glycine max]
 gb|ADF30898.1| Dt1 [Glycine max]
 gb|ADF30900.1| Dt1 [Glycine max]
 gb|ADF30901.1| Dt1 [Glycine max]
 gb|ADF30903.1| Dt1 [Glycine max]
 gb|ADF30906.1| Dt1 [Glycine max]
 gb|ADF30907.1| Dt1 [Glycine max]
 gb|ADF30908.1| Dt1 [Glycine max]
 gb|ADF30911.1| Dt1 [Glycine max]
 gb|ADF30912.1| Dt1 [Glycine max]
 gb|ADF30913.1| Dt1 [Glycine max]
 gb|ADF30915.1| Dt1 [Glycine max]
 gb|ADF30916.1| Dt1 [Glycine max]
 gb|ADF30917.1| Dt1 [Glycine max]
 gb|ADF30919.1| Dt1 [Glycine max]
 gb|ADF30922.1| Dt1 [Glycine max]
 gb|ADF30926.1| Dt1 [Glycine max]
 gb|ADF30928.1| Dt1 [Glycine max]
 gb|ADF30931.1| Dt1 [Glycine max]
 gb|ADF30937.1| Dt1 [Glycine max]
 gb|ADF30939.1| Dt1 [Glycine max]
 gb|ADF30940.1| Dt1 [Glycine max]
 gb|ADF30941.1| Dt1 [Glycine max]
 gb|ADF30946.1| Dt1 [Glycine max]
 gb|ADF30947.1| Dt1 [Glycine max]
 gb|ADF30954.1| Dt1 [Glycine max]
 gb|ADF30956.1| Dt1 [Glycine max]
 gb|ADF30957.1| Dt1 [Glycine max]
 gb|ADF30964.1| Dt1 [Glycine max]
 gb|ADF30966.1| Dt1 [Glycine max]
 gb|ADF30967.1| Dt1 [Glycine max]
 gb|ADF30969.1| Dt1 [Glycine max]
 gb|ADF30971.1| Dt1 [Glycine max]
 gb|ADF30973.1| Dt1 [Glycine max]
 gb|ADF30974.1| Dt1 [Glycine max]
 gb|ADF30976.1| Dt1 [Glycine max]
 gb|ADF30978.1| Dt1 [Glycine max]
 gb|ADF30979.1| Dt1 [Glycine max]
 gb|ADF30980.1| Dt1 [Glycine max]
 gb|ADF30981.1| Dt1 [Glycine soja]
 gb|ADF30982.1| Dt1 [Glycine soja]
 gb|ADF30983.1| Dt1 [Glycine soja]
 gb|ADF30984.1| Dt1 [Glycine soja]
 gb|ADF30985.1| Dt1 [Glycine soja]
 gb|ADF30986.1| Dt1 [Glycine soja]
 gb|ADF30987.1| Dt1 [Glycine soja]
 gb|ADF30988.1| Dt1 [Glycine soja]
 gb|ADF30989.1| Dt1 [Glycine soja]
 gb|ADF30990.1| Dt1 [Glycine soja]
 gb|ADF30991.1| Dt1 [Glycine soja]
 gb|ADF30992.1| Dt1 [Glycine soja]
 gb|ADF30993.1| Dt1 [Glycine soja]
 gb|ADF30994.1| Dt1 [Glycine soja]
 gb|ADF30995.1| Dt1 [Glycine soja]
 gb|ADF30996.1| Dt1 [Glycine soja]
 gb|ADF30997.1| Dt1 [Glycine soja]
 gb|ADF30998.1| Dt1 [Glycine soja]
 gb|ADF30999.1| Dt1 [Glycine soja]
 gb|ADF31000.1| Dt1 [Glycine soja]
 gb|ADF31002.1| Dt1 [Glycine max]
 gb|ADF31003.1| Dt1 [Glycine max]
 gb|ADF31004.1| Dt1 [Glycine max]
 gb|ADF31005.1| Dt1 [Glycine max]
 gb|ADF31008.1| Dt1 [Glycine max]
 gb|ADF31009.1| Dt1 [Glycine max]
 gb|ADF31010.1| Dt1 [Glycine max]
 gb|ADF31011.1| Dt1 [Glycine max]
 gb|ADF31013.1| Dt1 [Glycine max]
 gb|ADF31014.1| Dt1 [Glycine max]
 gb|ADF31016.1| Dt1 [Glycine max]
 gb|ADF31017.1| Dt1 [Glycine max]
 gb|ADF31020.1| Dt1 [Glycine max]
 gb|ADF31021.1| Dt1 [Glycine max]
 gb|ADF31025.1| Dt1 [Glycine max]
 gb|ADF31026.1| Dt1 [Glycine max]
 gb|ADF31027.1| Dt1 [Glycine max]
 gb|ADF31031.1| Dt1 [Glycine max]
 gb|ADF31034.1| Dt1 [Glycine max]
 gb|ADF31039.1| Dt1 [Glycine max]
 gb|ADF31040.1| Dt1 [Glycine max]
 gb|ADF31041.1| Dt1 [Glycine max]
 gb|ADF31045.1| Dt1 [Glycine max]
 gb|ADF31050.1| Dt1 [Glycine max]
 gb|ADF31051.1| Dt1 [Glycine max]
 gb|ADF31052.1| Dt1 [Glycine max]
 gb|ADF31053.1| Dt1 [Glycine max]
 gb|ADF31054.1| Dt1 [Glycine max]
 gb|ADF31055.1| Dt1 [Glycine max]
 gb|ADF31056.1| Dt1 [Glycine max]
 gb|ADF31058.1| Dt1 [Glycine max]
 gb|ADF31060.1| Dt1 [Glycine max]
 gb|ADF31062.1| Dt1 [Glycine max]
 gb|ADF31063.1| Dt1 [Glycine max]
 gb|ADF31064.1| Dt1 [Glycine max]
 gb|ADF31065.1| Dt1 [Glycine max]
 gb|ADF31066.1| Dt1 [Glycine max]
 gb|ADF31067.1| Dt1 [Glycine max]
 gb|ADF31069.1| Dt1 [Glycine max]
 gb|ADF31070.1| Dt1 [Glycine max]
 gb|ADF31073.1| Dt1 [Glycine max]
 gb|ADF31078.1| Dt1 [Glycine max]
 gb|ADF31083.1| Dt1 [Glycine max]
 gb|ADF31095.1| Dt1 [Glycine max]
 gb|ADF31102.1| Dt1 [Glycine max]
 gb|ADF31110.1| Dt1 [Glycine max]
 gb|ADF31111.1| Dt1 [Glycine max]
 gb|ADF31112.1| Dt1 [Glycine max]
 gb|ADF31113.1| Dt1 [Glycine max]
 gb|ADF31114.1| Dt1 [Glycine max]
 gb|ADF31115.1| Dt1 [Glycine max]
 gb|ADF31117.1| Dt1 [Glycine max]
 gb|ADF31118.1| Dt1 [Glycine max]
 gb|ADF31121.1| Dt1 [Glycine max]
 gb|ADF31124.1| Dt1 [Glycine max]
 gb|ADF31125.1| Dt1 [Glycine max]
 gb|ADF31127.1| Dt1 [Glycine max]
 gb|ADF31129.1| Dt1 [Glycine max]
 gb|ADF31130.1| Dt1 [Glycine max]
 gb|ADF31132.1| Dt1 [Glycine max]
 gb|ADF31137.1| Dt1 [Glycine max]
 gb|ADF31138.1| Dt1 [Glycine max]
 gb|ADF31139.1| Dt1 [Glycine max]
 gb|ADF31140.1| Dt1 [Glycine max]
 gb|ADF31141.1| Dt1 [Glycine max]
 gb|ADF31142.1| Dt1 [Glycine max]
 gb|ADF31146.1| Dt1 [Glycine max]
 gb|ADF31148.1| Dt1 [Glycine max]
 gb|ADF31149.1| Dt1 [Glycine max]
 gb|ADF31150.1| Dt1 [Glycine max]
 gb|ADF31153.1| Dt1 [Glycine max]
 gb|ADF31154.1| Dt1 [Glycine max]
 gb|ADF31156.1| Dt1 [Glycine max]
 gb|ADF31157.1| Dt1 [Glycine max]
 gb|ADF31161.1| Dt1 [Glycine max]
 gb|ADF31163.1| Dt1 [Glycine max]
 gb|ADF31164.1| Dt1 [Glycine max]
 gb|ADF31169.1| Dt1 [Glycine max]
 gb|ADF31173.1| Dt1 [Glycine max]
 gb|ADF31177.1| Dt1 [Glycine max]
 gb|ADF31178.1| Dt1 [Glycine max]
 gb|ADF31180.1| Dt1 [Glycine max]
 gb|ADF31181.1| Dt1 [Glycine max]
 gb|ADF31183.1| Dt1 [Glycine max]
 gb|ADF31187.1| Dt1 [Glycine max]
 gb|ADF31188.1| Dt1 [Glycine max]
 gb|ADF31192.1| Dt1 [Glycine max]
 gb|ADF31193.1| Dt1 [Glycine max]
 gb|ADF31194.1| Dt1 [Glycine max]
 gb|ADF31195.1| Dt1 [Glycine max]
Length=173

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+M  + L++GRV+G+V+D F+ S KM V YN  K V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+RKF+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_004977568.1| PREDICTED: CEN-like protein 2-like [Setaria italica]
Length=173

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  ++LV+GRV+G+V+D F+P VKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEALVVGRVIGEVLDSFNPCVKMTVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPY REHLHWIVTDIPGTTD+SFGRE++SYE PRP+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYQREHLHWIVTDIPGTTDASFGREVISYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+++F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QTVTVPSFRDHFNTKQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010686025.1| PREDICTED: CEN-like protein 2 [Beta vulgaris subsp. vulgaris]
 gb|ADM92611.1| centroradialis-like protein CEN1 [Beta vulgaris]
 gb|ADM92612.1| centroradialis-like protein CEN1 [Beta vulgaris]
 gb|AEI55781.1| centroradialis [Beta vulgaris subsp. vulgaris]
Length=171

 Score =   267 bits (682),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/175 (74%), Positives = 150/175 (86%), Gaps = 4/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR SD L+IGRV+GDVID F+PSVKM V YN NK V+NGHE FPSSV  +PRV+VH GD
Sbjct  1    MAR-SDPLIIGRVIGDVIDPFNPSVKMSVTYN-NKQVYNGHELFPSSVNLKPRVQVHDGD  58

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            ++SFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE+PRPNIGIHRF
Sbjct  59   LKSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEVPRPNIGIHRF  118

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
             F+L+KQ RR    V  P +RDRF ++KF++ N L  PVAAV++NCQRETAARRR
Sbjct  119  AFILFKQNRR--GSVVPPSTRDRFFTKKFAEQNQLGLPVAAVYYNCQRETAARRR  171



>ref|NP_001106245.1| ZCN6 protein [Zea mays]
 gb|ABW96229.1| ZCN6 [Zea mays]
Length=177

 Score =   267 bits (682),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 148/177 (84%), Gaps = 2/177 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  +SLV+GRV+G+V+DCFSP VKM V YN N+ V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVESLVVGRVIGEVLDCFSPCVKMVVTYNSNRLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE+VSYE PRP IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVVSYESPRPGIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNA--PLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V A    SRD   +R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRRQQQTVAAVPSSSRDHSITRQFAAENDLGHPVAAVYFNAQRETAARRR  177



>ref|NP_001105959.1| LOC100037785 [Zea mays]
 gb|ABW96224.1| ZCN1 [Zea mays]
 gb|ABX11003.1| ZCN1 [Zea mays]
 tpg|DAA59258.1| TPA: terminal flower 1 [Zea mays]
Length=173

 Score =   267 bits (682),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V YN NK V NGHE +PS++ ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAIVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQK R    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKGR--QTVTVPSFRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|KDO61123.1| hypothetical protein CISIN_1g035977mg [Citrus sinensis]
Length=169

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 146/172 (85%), Gaps = 3/172 (2%)
 Frame = -1

Query  830  MSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRS  651
            M + L +G V+GDVI+ F+PS+KM V YN NK V NGHE FPS+V ++PRVE+ GGDMRS
Sbjct  1    MLEPLAVGGVIGDVIESFTPSIKMSVTYN-NKQVCNGHELFPSTVVSKPRVEIQGGDMRS  59

Query  650  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFV  471
            FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYE+PRPNIGIHRFVFV
Sbjct  60   FFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGRELVSYEIPRPNIGIHRFVFV  119

Query  470  LYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            L+KQ RR    VN P SRD FN+R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  LFKQTRR--QTVNPPSSRDHFNTRAFAAENDLGLPVAAVYFNAQRETAARRR  169



>gb|ADF30943.1| Dt1 [Glycine max]
 gb|ADF30951.1| Dt1 [Glycine max]
 gb|ADF30952.1| Dt1 [Glycine max]
 gb|ADF31012.1| Dt1 [Glycine max]
 gb|ADF31015.1| Dt1 [Glycine max]
 gb|ADF31018.1| Dt1 [Glycine max]
 gb|ADF31024.1| Dt1 [Glycine max]
 gb|ADF31029.1| Dt1 [Glycine max]
 gb|ADF31030.1| Dt1 [Glycine max]
 gb|ADF31059.1| Dt1 [Glycine max]
 gb|ADF31071.1| Dt1 [Glycine max]
 gb|ADF31074.1| Dt1 [Glycine max]
 gb|ADF31079.1| Dt1 [Glycine max]
 gb|ADF31108.1| Dt1 [Glycine max]
 gb|ADF31131.1| Dt1 [Glycine max]
 gb|ADF31147.1| Dt1 [Glycine max]
 gb|ADF31166.1| Dt1 [Glycine max]
 gb|ADF31189.1| Dt1 [Glycine max]
Length=173

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 150/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+M  + L++GRV+G+V+D F+ S KM V YN  K V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKR+    V  P SRD FN+RKF+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRK--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|AEO72025.1| TFL1-like protein [Spiraea cantoniensis]
Length=172

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 147/175 (84%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMS+ LV+GRV+GDV+D F P+ KM V ++ N+ V NGHE  PS+VT +PRVE+ GGD
Sbjct  1    MARMSEPLVVGRVIGDVLDFFIPTTKMTVTFS-NRLVRNGHELLPSAVTVKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGRE VSYE PRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREAVSYEKPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+LYKQ+RR    +N P SRD F +R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFILYKQQRR--QSINPPSSRDHFCARTFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AGS32268.1| TFL1-1 [Litchi chinensis]
Length=173

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 151/174 (87%), Gaps = 3/174 (2%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            +RM D LV+GRV+GDV++ F+PS++M V +N NK V NGHEFFPS+VT +P+V + G DM
Sbjct  3    SRMQDPLVVGRVIGDVLEAFTPSIRMSVTFN-NKQVCNGHEFFPSAVTNKPKVLIQGADM  61

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD++FG+E+V YE+P+PNIGIHRFV
Sbjct  62   RSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDATFGKEVVGYEIPKPNIGIHRFV  121

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQKRR    ++AP SRD+F+++ F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  122  FVLFKQKRR--QTISAPPSRDQFSTKAFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_007162890.1| hypothetical protein PHAVU_001G189200g [Phaseolus vulgaris]
 gb|ESW34884.1| hypothetical protein PHAVU_001G189200g [Phaseolus vulgaris]
Length=220

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/185 (69%), Positives = 152/185 (82%), Gaps = 4/185 (2%)
 Frame = -1

Query  866  YIYYQLIYIMARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTT  690
            Y+Y     +MARM  + L++GRV+G+V+D F+ S+KM V YN  K V+NGHE FPSSV T
Sbjct  39   YLYPYHTLVMARMPLEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVYNGHELFPSSVNT  97

Query  689  RPRVEVHGGDMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEM  510
            +P+V++ G DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+
Sbjct  98   KPKVQIEGADMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEI  157

Query  509  PRPNIGIHRFVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRET  330
            P+PNIGIHRFVFVL+KQKRR    V  P SRD FN+R F+  NDL  PVAAV+FN QRET
Sbjct  158  PKPNIGIHRFVFVLFKQKRR--QCVTPPTSRDHFNTRNFAAQNDLGLPVAAVYFNAQRET  215

Query  329  AARRR  315
            AARRR
Sbjct  216  AARRR  220



>dbj|BAM73643.1| terminal flower1 homologue [Ipomoea nil]
Length=175

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 153/175 (87%), Gaps = 3/175 (2%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSP-SVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            +R  + L++GRVVG+V+D F+P S+++ V YN NK V NGHEFFPS++T+RPRVE+HGGD
Sbjct  3    SRALEPLILGRVVGEVVDPFTPTSIRIVVTYN-NKLVSNGHEFFPSALTSRPRVEIHGGD  61

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+FFTL+MTDPDVPGPSDPYLREH+HWIVTDIPGTTD++FGRE+VSYE P+PNIGIHRF
Sbjct  62   LRTFFTLVMTDPDVPGPSDPYLREHIHWIVTDIPGTTDATFGRELVSYESPKPNIGIHRF  121

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQ RRL + V  PLSRD FN+R+F+ DN L  PVAAVFFN QRETAARRR
Sbjct  122  VFILFKQTRRLSV-VTPPLSRDHFNTRRFAADNGLGLPVAAVFFNAQRETAARRR  175



>ref|XP_009133891.1| PREDICTED: protein CENTRORADIALIS-like [Brassica rapa]
 emb|CDX83272.1| BnaA03g22340D [Brassica napus]
Length=175

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ  R G  ++ P  RD+FN+R F+ +NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNCR-GSVISVPSYRDQFNTRMFAHENDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_004246534.1| PREDICTED: CEN-like protein 2 [Solanum lycopersicum]
 gb|AAO31795.1| SP9D [Solanum lycopersicum]
Length=172

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L++GRV+GDVID F+P++KM + YN NK V NGHE FPS V++RP+VEV GGD
Sbjct  1    MARSLEPLIVGRVIGDVIDSFNPTIKMSITYN-NKLVCNGHELFPSVVSSRPKVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+FFTL+MTDPDVPGPSDPY+REHLHWI+TDIPGTTD++FGRE+VSYE PRPNIGIHRF
Sbjct  60   LRTFFTLVMTDPDVPGPSDPYMREHLHWIITDIPGTTDATFGRELVSYETPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQK R    V+ P SRD FN+R F+ +N+L  PV AVFFN QRETAARRR
Sbjct  120  VFVLFKQKSR--SSVSQPTSRDHFNTRNFAQENNLEQPVTAVFFNAQRETAARRR  172



>ref|XP_009614479.1| PREDICTED: protein TERMINAL FLOWER 1-like [Nicotiana tomentosiformis]
Length=173

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + LV+GRVVGDV+D FSP VKM V YN NK V NG E FPS+VT RPRVEV GGD
Sbjct  1    MARNVEPLVVGRVVGDVLDSFSPKVKMTVTYN-NKQVCNGQELFPSAVTIRPRVEVQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR+FFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+PRPNIGIHRF
Sbjct  60   MRTFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQK R  +  +  +SRD FN+R F++ NDL  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQKCRQSVSPHD-VSRDHFNTRNFANVNDLGPPVAAVFFNAQRETAARRR  173



>ref|XP_007150078.1| hypothetical protein PHAVU_005G124600g [Phaseolus vulgaris]
 gb|ESW22072.1| hypothetical protein PHAVU_005G124600g [Phaseolus vulgaris]
Length=176

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/171 (73%), Positives = 150/171 (88%), Gaps = 2/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            +D LVIGRV+GDV+D F+ ++K+ V YN NK V+NGHEFFPSSVTT+P+V++ GGDMRSF
Sbjct  8    TDPLVIGRVIGDVVDPFTTTLKITVSYN-NKQVYNGHEFFPSSVTTKPKVQIRGGDMRSF  66

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG E+V+YE+PRPNIGIHRFVF+L
Sbjct  67   FTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDTTFGNEVVNYEIPRPNIGIHRFVFLL  126

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQK R  + +  P SRD FN+R F+++NDL  PVAAVFFN QRETAARRR
Sbjct  127  FKQKCRQAV-MKVPSSRDLFNTRSFAEENDLGLPVAAVFFNAQRETAARRR  176



>gb|ADF30920.1| Dt1 [Glycine max]
 gb|ADF30923.1| Dt1 [Glycine max]
 gb|ADF30935.1| Dt1 [Glycine max]
 gb|ADF30942.1| Dt1 [Glycine max]
 gb|ADF31035.1| Dt1 [Glycine max]
 gb|ADF31036.1| Dt1 [Glycine max]
 gb|ADF31042.1| Dt1 [Glycine max]
 gb|ADF31044.1| Dt1 [Glycine max]
 gb|ADF31048.1| Dt1 [Glycine max]
 gb|ADF31049.1| Dt1 [Glycine max]
 gb|ADF31061.1| Dt1 [Glycine max]
 gb|ADF31072.1| Dt1 [Glycine max]
 gb|ADF31075.1| Dt1 [Glycine max]
 gb|ADF31080.1| Dt1 [Glycine max]
 gb|ADF31084.1| Dt1 [Glycine max]
 gb|ADF31091.1| Dt1 [Glycine max]
 gb|ADF31097.1| Dt1 [Glycine max]
 gb|ADF31099.1| Dt1 [Glycine max]
 gb|ADF31122.1| Dt1 [Glycine max]
 gb|ADF31143.1| Dt1 [Glycine max]
 gb|ADF31145.1| Dt1 [Glycine max]
 gb|ADF31155.1| Dt1 [Glycine max]
 gb|ADF31160.1| Dt1 [Glycine max]
 gb|ADF31162.1| Dt1 [Glycine max]
 gb|ADF31190.1| Dt1 [Glycine max]
Length=173

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+M  + L++GRV+G+V+D F+ S KM V YN  K V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DM SFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMSSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+RKF+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAH24197.1| homologous protein to TFL1 [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95559.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99487.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV G  
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGDG  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD+FN+R+F+++NDL  PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRR--QTVTVPSFRDQFNTRQFAEENDLGLPVAAVYFNCQRETAARRR  173



>ref|XP_006293432.1| hypothetical protein CARUB_v10025606mg [Capsella rubella]
 gb|EOA26330.1| hypothetical protein CARUB_v10025606mg [Capsella rubella]
Length=175

 Score =   265 bits (677),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/176 (72%), Positives = 149/176 (85%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE FPS VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLQAVKMTVTYNSDKQVYNGHELFPSVVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD SFG+E + YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVSFGKERIGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ RR G  V+ P  RD+F++R+F+  NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNRR-GSVVSVPSYRDQFSTREFAHANDLGLPVAAVFFNCQRETAARRR  175



>ref|XP_003625808.1| TFL1 [Medicago truncatula]
 gb|AES82026.1| terminal flower 1 [Medicago truncatula]
Length=174

 Score =   265 bits (676),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 150/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARMS + L++GRV+G+V+D F+ S+KM V YN  K V NGHEFFPS++ T+P+VE+ GG
Sbjct  1    MARMSQEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEVVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R  +   +P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKNRESVTA-SPSSRDYFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>ref|NP_001239629.1| protein TERMINAL FLOWER 1-like [Glycine max]
 gb|ACM45957.1| TFL1-like protein [Glycine max]
 gb|KHN02232.1| Protein TERMINAL FLOWER 1 [Glycine soja]
Length=170

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+ S KM V YN  K V+NGHE FPS+V T+P+VE+ GGDMRSFF
Sbjct  4    EPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGGDMRSFF  62

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHRFVFVL+
Sbjct  63   TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHRFVFVLF  122

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V  P SRD FN+RKF+ +NDL  PVAAV+FN QRETAARRR
Sbjct  123  KQKRR--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  170



>dbj|BAI66119.1| terminal flower 1b [Glycine max]
 gb|ADF30892.1| Dt1 [Glycine max]
 gb|ADF30895.1| Dt1 [Glycine max]
 gb|ADF30896.1| Dt1 [Glycine max]
 gb|ADF30899.1| Dt1 [Glycine max]
 gb|ADF30902.1| Dt1 [Glycine max]
 gb|ADF30904.1| Dt1 [Glycine max]
 gb|ADF30905.1| Dt1 [Glycine max]
 gb|ADF30909.1| Dt1 [Glycine max]
 gb|ADF30910.1| Dt1 [Glycine max]
 gb|ADF30914.1| Dt1 [Glycine max]
 gb|ADF30921.1| Dt1 [Glycine max]
 gb|ADF30929.1| Dt1 [Glycine max]
 gb|ADF30933.1| Dt1 [Glycine max]
 gb|ADF30934.1| Dt1 [Glycine max]
 gb|ADF30936.1| Dt1 [Glycine max]
 gb|ADF30945.1| Dt1 [Glycine max]
 gb|ADF30948.1| Dt1 [Glycine max]
 gb|ADF30950.1| Dt1 [Glycine max]
 gb|ADF30958.1| Dt1 [Glycine max]
 gb|ADF30959.1| Dt1 [Glycine max]
 gb|ADF30960.1| Dt1 [Glycine max]
 gb|ADF30961.1| Dt1 [Glycine max]
 gb|ADF30965.1| Dt1 [Glycine max]
 gb|ADF30968.1| Dt1 [Glycine max]
 gb|ADF30972.1| Dt1 [Glycine max]
 gb|ADF30975.1| Dt1 [Glycine max]
 gb|ADF30977.1| Dt1 [Glycine max]
 gb|ADF31001.1| Dt1 [Glycine max]
 gb|ADF31006.1| Dt1 [Glycine max]
 gb|ADF31007.1| Dt1 [Glycine max]
 gb|ADF31023.1| Dt1 [Glycine max]
 gb|ADF31033.1| Dt1 [Glycine max]
 gb|ADF31037.1| Dt1 [Glycine max]
 gb|ADF31076.1| Dt1 [Glycine max]
 gb|ADF31082.1| Dt1 [Glycine max]
 gb|ADF31090.1| Dt1 [Glycine max]
 gb|ADF31093.1| Dt1 [Glycine max]
 gb|ADF31109.1| Dt1 [Glycine max]
 gb|ADF31126.1| Dt1 [Glycine max]
 gb|ADF31133.1| Dt1 [Glycine max]
 gb|ADF31136.1| Dt1 [Glycine max]
 gb|ADF31144.1| Dt1 [Glycine max]
 gb|ADF31152.1| Dt1 [Glycine max]
 gb|ADF31158.1| Dt1 [Glycine max]
 gb|ADF31167.1| Dt1 [Glycine max]
 gb|ADF31179.1| Dt1 [Glycine max]
 gb|ADF31182.1| Dt1 [Glycine max]
 gb|ADF31191.1| Dt1 [Glycine max]
Length=173

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+M  + L++GRV+G+V+D F+ S KM V YN  K V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+RKF+ +NDL  PVAAV+FN Q ETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQWETAARRR  173



>gb|KHN14994.1| Protein CENTRORADIALIS-like [Glycine soja]
Length=173

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+MS D L IGRV+GDV+D F+P++KM V Y   K V+NGHEFFPS++TTRP+VE+ GG
Sbjct  1    MAKMSTDPLFIGRVIGDVLDSFTPTIKMTVTYK--KQVYNGHEFFPSTITTRPKVEIGGG  58

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TLIMTDPDVPGPSDPYLREHLHW+VTDIPGTT++SFG  +VSYEMP+PNIGIHR
Sbjct  59   DMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGNVLVSYEMPKPNIGIHR  118

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +VFVL+KQKRR  +    P SRD F++RKFS +NDL  PVA+V+FN QRETAARRR
Sbjct  119  YVFVLFKQKRRQCV-TRPPSSRDHFSTRKFSAENDLGLPVASVYFNAQRETAARRR  173



>gb|ABX11005.1| ZCN3 [Zea mays]
Length=173

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMMVTYNSNKLVFNGHEIYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGR+I+SYE PRP+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRQIISYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQ+ R    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQQGR--QNVTVPSFRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_006836050.1| hypothetical protein AMTR_s00114p00070400 [Amborella trichopoda]
 gb|ERM98903.1| hypothetical protein AMTR_s00114p00070400 [Amborella trichopoda]
Length=173

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + LV+GRV+GDVI+ F PS+KM V YN NK V NGHEF PS+V  +PRVEV GGD
Sbjct  1    MARQIEPLVVGRVIGDVINSFFPSIKMNVTYNSNKQVCNGHEFMPSTVIQKPRVEVSGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+F+TL++TDPDVPGPSDPYLREHLHWIVTDIPGTTD++FGREIV YE PRP+IGIHRF
Sbjct  61   LRTFYTLVLTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGREIVGYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ+ R  +G  +P SRDRFN+R+F++ N L  PVA V+FN QRETAARRR
Sbjct  121  VFVLFKQRGRQTVG--SPSSRDRFNTREFAEQNQLGLPVAVVYFNAQRETAARRR  173



>gb|ADF30918.1| Dt1 [Glycine max]
 gb|ADF30924.1| Dt1 [Glycine max]
 gb|ADF30925.1| Dt1 [Glycine max]
 gb|ADF30927.1| Dt1 [Glycine max]
 gb|ADF30930.1| Dt1 [Glycine max]
 gb|ADF30932.1| Dt1 [Glycine max]
 gb|ADF30938.1| Dt1 [Glycine max]
 gb|ADF30944.1| Dt1 [Glycine max]
 gb|ADF30949.1| Dt1 [Glycine max]
 gb|ADF30953.1| Dt1 [Glycine max]
 gb|ADF30955.1| Dt1 [Glycine max]
 gb|ADF30962.1| Dt1 [Glycine max]
 gb|ADF30963.1| Dt1 [Glycine max]
 gb|ADF30970.1| Dt1 [Glycine max]
 gb|ADF31019.1| Dt1 [Glycine max]
 gb|ADF31022.1| Dt1 [Glycine max]
 gb|ADF31028.1| Dt1 [Glycine max]
 gb|ADF31032.1| Dt1 [Glycine max]
 gb|ADF31038.1| Dt1 [Glycine max]
 gb|ADF31043.1| Dt1 [Glycine max]
 gb|ADF31046.1| Dt1 [Glycine max]
 gb|ADF31047.1| Dt1 [Glycine max]
 gb|ADF31057.1| Dt1 [Glycine max]
 gb|ADF31068.1| Dt1 [Glycine max]
 gb|ADF31077.1| Dt1 [Glycine max]
 gb|ADF31081.1| Dt1 [Glycine max]
 gb|ADF31085.1| Dt1 [Glycine max]
 gb|ADF31086.1| Dt1 [Glycine max]
 gb|ADF31087.1| Dt1 [Glycine max]
 gb|ADF31088.1| Dt1 [Glycine max]
 gb|ADF31089.1| Dt1 [Glycine max]
 gb|ADF31092.1| Dt1 [Glycine max]
 gb|ADF31094.1| Dt1 [Glycine max]
 gb|ADF31096.1| Dt1 [Glycine max]
 gb|ADF31098.1| Dt1 [Glycine max]
 gb|ADF31100.1| Dt1 [Glycine max]
 gb|ADF31101.1| Dt1 [Glycine max]
 gb|ADF31103.1| Dt1 [Glycine max]
 gb|ADF31104.1| Dt1 [Glycine max]
 gb|ADF31105.1| Dt1 [Glycine max]
 gb|ADF31106.1| Dt1 [Glycine max]
 gb|ADF31107.1| Dt1 [Glycine max]
 gb|ADF31116.1| Dt1 [Glycine max]
 gb|ADF31119.1| Dt1 [Glycine max]
 gb|ADF31120.1| Dt1 [Glycine max]
 gb|ADF31123.1| Dt1 [Glycine max]
 gb|ADF31128.1| Dt1 [Glycine max]
 gb|ADF31134.1| Dt1 [Glycine max]
 gb|ADF31135.1| Dt1 [Glycine max]
 gb|ADF31151.1| Dt1 [Glycine max]
 gb|ADF31159.1| Dt1 [Glycine max]
 gb|ADF31165.1| Dt1 [Glycine max]
 gb|ADF31168.1| Dt1 [Glycine max]
 gb|ADF31170.1| Dt1 [Glycine max]
 gb|ADF31171.1| Dt1 [Glycine max]
 gb|ADF31172.1| Dt1 [Glycine max]
 gb|ADF31174.1| Dt1 [Glycine max]
 gb|ADF31175.1| Dt1 [Glycine max]
 gb|ADF31176.1| Dt1 [Glycine max]
 gb|ADF31184.1| Dt1 [Glycine max]
 gb|ADF31185.1| Dt1 [Glycine max]
 gb|ADF31186.1| Dt1 [Glycine max]
Length=173

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+M  + L++GRV+G+V+D F+ S KM V YN  K V+NGHE FPS+V T+P+VE+ GG
Sbjct  1    MAKMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHELFPSTVNTKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+ NIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEVPKLNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+RKF+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRKFAAENDLGLPVAAVYFNAQRETAARRR  173



>gb|ABR53775.2| TFL1y [Phaseolus vulgaris]
 gb|ABR53776.2| TFL1y [Phaseolus vulgaris]
 gb|ABR53777.2| TFL1y [Phaseolus vulgaris]
 gb|AFI47666.1| TFLly [Phaseolus vulgaris]
 gb|AFI47667.1| TFLly [Phaseolus vulgaris]
 gb|AFI47668.1| TFLly [Phaseolus vulgaris]
 gb|AFI47669.1| TFLly [Phaseolus vulgaris]
 gb|AFI47670.1| TFLly [Phaseolus vulgaris]
 gb|AFI47671.1| TFLly [Phaseolus vulgaris]
 gb|AFI47672.1| TFLly [Phaseolus vulgaris]
 gb|AFI47673.1| TFLly [Phaseolus vulgaris]
 gb|AFI47674.1| TFLly [Phaseolus vulgaris]
 gb|AFI47675.1| TFLly [Phaseolus vulgaris]
 gb|AFI47676.1| TFLly [Phaseolus vulgaris]
 gb|AFI47677.1| TFLly [Phaseolus vulgaris]
 gb|AFI47678.1| TFLly [Phaseolus vulgaris]
 gb|AFI47679.1| TFLly [Phaseolus vulgaris]
 gb|AFI47680.1| TFLly [Phaseolus vulgaris]
 gb|AFI47681.1| TFLly [Phaseolus vulgaris]
 gb|AFI47682.1| TFLly [Phaseolus vulgaris]
 gb|AFI47683.1| TFLly [Phaseolus vulgaris]
 gb|AFI47684.1| TFLly [Phaseolus vulgaris]
Length=173

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 148/176 (84%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM  + L++GRV+G+V+D F+ S+KM V YN  K V+NGHE FPSSV T+P+V++ G 
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVYNGHELFPSSVNTKPKVQIEGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPTSRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  173



>dbj|BAJ22384.1| terminal flower 1a [Vigna unguiculata]
 gb|AIA10354.1| TFL1 [Vigna unguiculata]
 gb|AIA10355.1| TFL1 [Vigna unguiculata]
Length=173

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 148/176 (84%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM  + L++GRV+G+V+D F+ S KM V YN  K V+NGHEFFPSS+  +P+VE+ GG
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHEFFPSSINIKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+R F+  N+L  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPSSRDHFNTRNFAAQNELGLPVAAVYFNAQRETAARRR  173



>ref|XP_011094363.1| PREDICTED: CEN-like protein 2 isoform X2 [Sesamum indicum]
Length=173

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++GRV+GDV+D FSP+ KM V Y  NK V NGHEF+PS+V  +PRVE+ GGD
Sbjct  1    MARMSDPLIVGRVIGDVLDSFSPTTKMFVTYA-NKQVFNGHEFYPSAVVMKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+F+TL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+ SYE+P+PNIGIHRF
Sbjct  60   LRTFYTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKELASYEIPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ  R  +  N P +RD FN+R+F+ +N L  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQTGRQTVK-NLPTTRDCFNTRRFAVENGLGLPVAAVFFNAQRETAARRR  173



>gb|ABF85670.1| terminal flower 1-like protein [Hordeum vulgare subsp. vulgare]
Length=173

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV G  
Sbjct  1    MSRSVEPLIVGRVIGEVLDTFNPCVKMVTTYNSNKLVFNGHELYPSAVVSKPRVEVQGDG  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD+FN+R+F+++NDL  PVAAV+FNC+RETAARRR
Sbjct  121  IFVLFKQKRR--QTVTVPSFRDQFNTRQFAEENDLGLPVAAVYFNCRRETAARRR  173



>gb|AAQ93599.1| CEN/TFL1-like GTP-associated binding protein [Lotus japonicus]
Length=174

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 149/171 (87%), Gaps = 3/171 (2%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            +D LV+GRVVGDV+D F+ S+K+ V +N NK V NGHEFFPS++ T+P+V++ GGDMRSF
Sbjct  7    TDPLVVGRVVGDVLDSFTTSMKLTVSFN-NKQVFNGHEFFPSTINTKPKVDIGGGDMRSF  65

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTLIMTDPDVPGPSDPYL+EHLHW+VTDIPGTTD++FG+E+VSYE+P+PNIGIHRFVFVL
Sbjct  66   FTLIMTDPDVPGPSDPYLKEHLHWMVTDIPGTTDATFGKELVSYEIPKPNIGIHRFVFVL  125

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +KQKRR    V+ P SRD FN+R F+  NDLA PVAAV+FN QRETAARRR
Sbjct  126  FKQKRR--QCVSPPSSRDHFNTRSFAAQNDLALPVAAVYFNAQRETAARRR  174



>ref|XP_009420516.1| PREDICTED: CEN-like protein 2 [Musa acuminata subsp. malaccensis]
Length=174

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 1/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+SD L +GRV+G+VID F PSV+M V YN +K V NGHEF+PS+V + PRVEV  GD
Sbjct  1    MARLSDPLAVGRVIGEVIDSFHPSVRMTVTYNSSKLVCNGHEFYPSAVVSEPRVEVQCGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREH+HWIVTDIPGT D+S G+E+V YE PRP+IGIHRF
Sbjct  61   MRSFFTLVMTDPDAPGPSDPYLREHVHWIVTDIPGTPDASLGKEVVGYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL++QKRR  + V  P SRDRFN R+F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFQQKRRQSV-VAPPPSRDRFNPRRFAQENDLGLPVAAVYFNAQRETAARRR  174



>emb|CDY31183.1| BnaC03g47080D [Brassica napus]
Length=175

 Score =   263 bits (672),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 126/176 (72%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S D L++GRV+GDV+D    +VKM V YN +K V+NGHE  PS VT +P+VEVHGG
Sbjct  1    MARISSDPLMVGRVIGDVVDNCLHAVKMTVTYNSDKQVYNGHELLPSVVTNKPKVEVHGG  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD +FG+EIV+YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDVTFGKEIVAYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FV++L+KQ  R G  ++ P  RD+FN+R F+  NDL  PVAAVFFNCQRETAARRR
Sbjct  121  FVYLLFKQNCR-GSVISVPSYRDQFNTRMFAHANDLGLPVAAVFFNCQRETAARRR  175



>ref|NP_001239678.1| protein SELF-PRUNING-like [Glycine max]
 gb|ACU00127.1| CENTRORADIALIS-like protein 1 [Glycine max]
Length=173

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 151/176 (86%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARM-SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MA+M +D L IGRV+GDV+D F+P++KM V Y   K V+NGHEFFPS++TTRP+VE+ GG
Sbjct  1    MAKMWTDPLFIGRVIGDVLDSFTPTIKMTVTYK--KQVYNGHEFFPSTITTRPKVEIGGG  58

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TLIMTDPDVPGPSDPYLREHLHW+VTDIPGTT++SFG  +VSYEMP+PNIGIHR
Sbjct  59   DMRSFYTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTNASFGNVLVSYEMPKPNIGIHR  118

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +VFVL+KQKRR  +    P SRD F++RKFS +NDL  PVA+V+FN QRETAARRR
Sbjct  119  YVFVLFKQKRRQCV-TRPPSSRDHFSTRKFSAENDLGLPVASVYFNAQRETAARRR  173



>ref|XP_004494168.1| PREDICTED: protein CENTRORADIALIS-like [Cicer arietinum]
Length=174

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 149/176 (85%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARMS + L++GRV+G+V+D F+ S+KM V YN  K V NGHEFFPS++  +P+VE+ GG
Sbjct  1    MARMSQEPLLVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINIKPKVEIDGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R  + +  P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKSRESV-MTTPSSRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>ref|XP_009374732.1| PREDICTED: protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10963.1| TFL1-like protein [Pyrus communis]
 dbj|BAJ33557.1| terminal flower 1 [Pyrus pyrifolia var. culta]
 dbj|BAK74838.1| terminal flowering 1 [Pyrus pyrifolia]
Length=172

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R S+ LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMP+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|EYU35477.1| hypothetical protein MIMGU_mgv1a026117mg [Erythranthe guttata]
Length=176

 Score =   263 bits (671),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 148/174 (85%), Gaps = 3/174 (2%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHG-GDMRS  651
            S+ LV+GRV+GDV++CFSP+ KM V Y  +K V NGHEF+PS+VT +PRVE+ G  DMR+
Sbjct  3    SEPLVVGRVIGDVLECFSPTTKMHVTYPNHKQVFNGHEFYPSAVTIKPRVEILGPADMRT  62

Query  650  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFV  471
            FFTL+MTDPDVPGPSDPYL+EHLHW+VTDIPGTTD++FG+E+VSYEMPRPNIGIHRFVFV
Sbjct  63   FFTLVMTDPDVPGPSDPYLKEHLHWLVTDIPGTTDATFGKEMVSYEMPRPNIGIHRFVFV  122

Query  470  LYKQKRRLGMGVNAPLS--RDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            L++QK R  +  N P S  RD FN+R+F+ DNDL  PVAAVFFN QRETAARRR
Sbjct  123  LFQQKGRQTVKTNLPTSSARDNFNTRRFAADNDLGLPVAAVFFNAQRETAARRR  176



>gb|AEO72024.1| TFL1-like protein [Photinia serratifolia]
Length=172

 Score =   262 bits (670),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 145/175 (83%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MARVPEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRE+AARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRESAARRR  172



>gb|ABI98712.1| terminal flower 1 [Zea mays]
Length=173

 Score =   262 bits (670),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V Y+ NK V NGHE +PS++ ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYDSNKLVFNGHEIYPSAIVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYL EHLHWIVTDIPGTTD+SFGRE++SYE PRPNIGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLGEHLHWIVTDIPGTTDASFGREVISYESPRPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQK R    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKGR--QTVTVPSFRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_004975557.1| PREDICTED: CEN-like protein 1-like [Setaria italica]
Length=173

 Score =   262 bits (669),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + LV+G+V+G+VID F+P+VKM V Y+ NK V NGHEFFPS++ ++PRVEV G D
Sbjct  1    MSRVLEPLVMGKVIGEVIDNFNPTVKMTVTYSSNKQVFNGHEFFPSAIVSKPRVEVGGDD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSD YLREHLHWIVTDIPGTTD+SFGRE+V YE P+P IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDSYLREHLHWIVTDIPGTTDASFGRELVMYESPKPYIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF L+KQK R   GV AP SRD F++R+F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  121  VFALFKQKCR--QGVRAPSSRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>ref|NP_001106242.1| ZCN3 protein [Zea mays]
 gb|ABW96226.1| ZCN3 [Zea mays]
Length=173

 Score =   262 bits (669),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V YN NK V NGHE +PS+V ++PRV V GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNKLVFNGHEIYPSAVVSKPRVAVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFGR+I+SYE PRP+IGIHRF
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGRQIISYESPRPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQ+ R    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQQGR--QNVTVPSFRDHFNTRQFAEENDLGLPVAAVYFNAQRETAARRR  173



>ref|XP_010521662.1| PREDICTED: protein CENTRORADIALIS-like [Tarenaya hassleriana]
Length=175

 Score =   262 bits (669),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 148/176 (84%), Gaps = 2/176 (1%)
 Frame = -1

Query  839  MARM-SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM SD LV+G V+GD++D  +  VKM V Y  +K V+NGHE  PS+V  +P+VEVHG 
Sbjct  1    MARMYSDPLVVGGVIGDIVDNVTHVVKMTVTYGSSKQVYNGHELLPSTVANKPKVEVHGC  60

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E++ YEMPRPNIGIHR
Sbjct  61   DMRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEMIGYEMPRPNIGIHR  120

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVF+L+KQKRR  + V+ P  RD+FN+R F+ +NDL  PVAAVFFNCQRETA+RRR
Sbjct  121  FVFMLFKQKRRSSV-VSVPSYRDQFNTRIFAQENDLGLPVAAVFFNCQRETASRRR  175



>gb|AIA10356.1| TFL1 [Vigna unguiculata]
Length=173

 Score =   262 bits (669),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM  + L++GRV+G+V+D F+ S KM V YN  K V+NGHEFFPSS+  +P+VE+ GG
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHEFFPSSINIKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+R F+  N+   PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPPSSRDHFNTRNFAAQNEFGLPVAAVYFNAQRETAARRR  173



>ref|NP_001280887.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD06418.1| TFL1-like protein [Malus domestica]
 dbj|BAD10961.1| TFL1-like protein [Malus domestica]
 gb|ABF84011.1| terminal flower 1 [Malus domestica]
 dbj|BAG31955.1| TFL1 like protein [Malus domestica]
Length=172

 Score =   262 bits (669),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R S+ LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMP+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ +R    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNQR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AFP33418.1| terminal flower 1 [Arachis hypogaea]
Length=180

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 144/171 (84%), Gaps = 2/171 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            SD L IGRV+GDV+D F+ +VKM V YN NKHV+NG EFFPSS++ +PRV +HGGD+RS 
Sbjct  12   SDPLTIGRVIGDVVDDFTETVKMTVTYN-NKHVYNGFEFFPSSISAKPRVHIHGGDLRSS  70

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTLIMTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E++ YEMP+PNIGIHRFV VL
Sbjct  71   FTLIMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGKEVIKYEMPKPNIGIHRFVLVL  130

Query  467  YKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            YKQKRR  +    P SRD FN+RKF  +NDL  PVAAVFFN QRETA R+R
Sbjct  131  YKQKRRQTVN-KVPNSRDLFNTRKFVVENDLGTPVAAVFFNAQRETACRKR  180



>gb|AGT41971.1| TFL1 [Dimocarpus longan]
Length=173

 Score =   262 bits (669),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 149/174 (86%), Gaps = 3/174 (2%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            +RM D LV+GRV+GDV++ F+PS+KM V +N NK V NGHEF PS+VT +PRV + G DM
Sbjct  3    SRMQDPLVVGRVIGDVLEAFTPSIKMSVTFN-NKQVCNGHEFLPSAVTNKPRVLIQGADM  61

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD++FG+E+V YE+P+PNIGIHRFV
Sbjct  62   RSFFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDATFGKEVVGYEIPKPNIGIHRFV  121

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQK R    ++AP SRD+F+++ F+ +NDL  PV+AV+FN QRETAARRR
Sbjct  122  FVLFKQKCR--QTISAPASRDQFSTKAFAAENDLGLPVSAVYFNAQRETAARRR  173



>ref|XP_006663820.1| PREDICTED: CEN-like protein 2-like [Oryza brachyantha]
Length=173

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 149/175 (85%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+   + L++GRV+G+V+D F+P +KM V YN NK V NGHE++PS+V ++PRVEV GGD
Sbjct  1    MSISVEPLIVGRVIGEVLDSFNPCMKMIVTYNSNKLVCNGHEYYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG+EI+SYE P+P+IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGQEIISYESPKPSIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQK R    V  P SRD FN+R+F+++N+L  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKHR--QTVVVPSSRDNFNTRRFAEENELGLPVAAVYFNAQRETAARRR  173



>dbj|BAD10964.1| TFL1-like protein [Cydonia oblonga]
Length=172

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M + S+ LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MKKASEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE++SYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVLSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_010049502.1| PREDICTED: protein TERMINAL FLOWER 1-like [Eucalyptus grandis]
 ref|XP_010049507.1| PREDICTED: protein TERMINAL FLOWER 1-like [Eucalyptus grandis]
 gb|KCW89194.1| hypothetical protein EUGRSUZ_A01505 [Eucalyptus grandis]
Length=172

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + L +GRV+GDVID F+ S++M V YN  K V+NGHE +PSSV  RPRVE+HGGD
Sbjct  1    MARALEPLTVGRVIGDVIDPFTASIRMSVKYN-GKQVNNGHELYPSSVAARPRVEIHGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVT+IPGTTD++FGRE++SYE+PRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDAPGPSDPYLREHLHWIVTNIPGTTDATFGREVMSYEIPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L++QKRR    ++ P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFILFRQKRR--QQISQPSSRDCFSTRNFAAENDLDLPVAAVYFNAQRETAARRR  172



>dbj|BAD10966.1| TFL1-like protein [Eriobotrya japonica]
 gb|ADB92194.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R  + LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MTRALEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AAG31808.1|AF316419_1 terminal flower 1-like protein [Lolium perenne]
Length=173

 Score =   261 bits (667),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF
Sbjct  61   LRSLFTLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVMSYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  121  IFVLFKQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  173



>dbj|BAD10965.1| TFL1-like protein [Pseudocydonia sinensis]
Length=172

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R S+ LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +P+VE+ GGD
Sbjct  1    MKRASEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPKVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIV DIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVADIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>gb|AHX00603.1| TFL1a [Lupinus angustifolius]
 gb|AHX00604.1| TFL1a [Lupinus angustifolius]
Length=173

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/176 (70%), Positives = 149/176 (85%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MAR+S + L++GRV+GDV+D F+ S+KM V YN NK V NGHE FPS+VT +PRVE+ G 
Sbjct  1    MARISSEPLIVGRVIGDVLDSFTTSMKMTVSYN-NKQVFNGHELFPSTVTNKPRVEIDGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTL+MTDPDVPGPSDPY+REHLHWIVTDIPGTTD++FG+E+V+YE+P+PNIGIHR
Sbjct  60   DLRSFFTLVMTDPDVPGPSDPYMREHLHWIVTDIPGTTDATFGKELVNYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V  P SRD FN+  F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTQPSSRDHFNTMNFASENDLGLPVAAVYFNAQRETAARRR  173



>gb|AEH41277.1| terminal flower 1 [Bambusa oldhamii]
Length=173

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 147/175 (84%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + L++GRV+G+V+D F+P VKM V YN N+   NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLIVGRVIGEVLDSFNPCVKMIVTYNSNRLAFNGHELYPSAVESKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RS FTL+MTDPDVPGPSDPYLREHLHWIV+DIPGTTD+SFGRE++SYE P+PNIGIHRF
Sbjct  61   LRSSFTLVMTDPDVPGPSDPYLREHLHWIVSDIPGTTDASFGREVISYESPKPNIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            +FVL+KQKRR    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  IFVLFKQKRR--QTVIVPSFRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  173



>gb|ABP73384.1| TFL1 [Vicia faba]
 gb|ABP73385.1| TFL1 [Vicia faba]
Length=174

 Score =   260 bits (665),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 148/176 (84%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM+ + L++GRV+G+V+D F+ S+KM V YN  K V NGHEFFPS++ T+P+VE+ G 
Sbjct  1    MARMAQEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE+P+PNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R  +    P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRT-TPSSRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|AFA25738.1| hypothetical protein [Phaseolus vulgaris]
Length=170

 Score =   260 bits (664),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/170 (71%), Positives = 144/170 (85%), Gaps = 3/170 (2%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+ S+KM V YN  K V+NGHE FPSSV T+P+V++ G DMRSFF
Sbjct  4    EPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVYNGHELFPSSVNTKPKVQIEGADMRSFF  62

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHRFVFVL+
Sbjct  63   TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHRFVFVLF  122

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V  P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  123  KQKRR--QCVTPPTSRDHFNTRNFAAQNDLGLPVAAVYFNAQRETAARRR  170



>gb|AIA10351.1| TFL1 [Vigna unguiculata]
 gb|AIA10352.1| TFL1 [Vigna unguiculata]
 gb|AIA10353.1| TFL1 [Vigna unguiculata]
Length=173

 Score =   260 bits (664),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 147/176 (84%), Gaps = 4/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM  + L++GRV+G+V+D F+ S KM V YN  K V+NGHEFFPSS+  +P+VE+ GG
Sbjct  1    MARMPLEPLIVGRVIGEVLDSFTTSTKMTVSYN-KKQVYNGHEFFPSSINIKPKVEIEGG  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+E+VSYE+P+PNIGIHR
Sbjct  60   DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKELVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQKRR    V    SRD FN+R F+  N+L  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKRR--QCVTPHSSRDHFNTRNFAAQNELGLPVAAVYFNAQRETAARRR  173



>gb|ADP00689.1| CEN [Festuca pallens]
 gb|ADP00691.1| CEN [Festuca ovina]
Length=169

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDSFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR  + V  P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSV--PSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ABP73380.1| TFL1 [Vicia faba]
Length=174

 Score =   259 bits (663),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 148/176 (84%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM+ + L++GRV+G+V+D F+ S+KM V YN  K V NGHEFFPS++ T+P+VE+ G 
Sbjct  1    MARMAQEPLIVGRVIGEVLDSFTRSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE+P+PNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R  +    P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRT-TPSSRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|AFK32780.1| TFL1-like protein [Eriobotrya japonica]
Length=172

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R  + LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MTRALEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLEVFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSF TL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRSFLTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_008462564.1| PREDICTED: CEN-like protein 2 isoform X2 [Cucumis melo]
Length=181

 Score =   259 bits (663),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 145/174 (83%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
              + + LV+GRV+GDV+D FSP++KM V +  NK V NGHEFFPSS++ +PRV + G DM
Sbjct  10   GELQNPLVLGRVIGDVVDPFSPTIKMSVTFTNNKQVLNGHEFFPSSLSLKPRVHIQGEDM  69

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RS FTL+M DPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E +SYE+P+P IGIHRFV
Sbjct  70   RSLFTLVMVDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKEEMSYEIPKPTIGIHRFV  129

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQKRR    VN P SRDRFN+R+FS +NDL  PVAAV+FN QRETAARRR
Sbjct  130  FILFKQKRR--RSVNPPSSRDRFNTRRFSCENDLGLPVAAVYFNAQRETAARRR  181



>ref|XP_002447782.1| hypothetical protein SORBIDRAFT_06g015490 [Sorghum bicolor]
 gb|EES12110.1| hypothetical protein SORBIDRAFT_06g015490 [Sorghum bicolor]
Length=173

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 144/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R+ + LV+G+V+G+VID F+P+VKM V Y  N  V NGHEFFPS+V ++PRVEV G D
Sbjct  1    MSRVLEPLVVGKVIGEVIDNFNPTVKMTVTYGSNNQVFNGHEFFPSAVLSKPRVEVQGDD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD+SFG E+  YE P+P IGIHRF
Sbjct  61   MRSFFTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDASFGTELAMYESPKPYIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQK R    V  P SRD F++R+F+ DNDL  PVAAV+FN QRETAARRR
Sbjct  121  VFVLFKQKSR--QSVRPPSSRDYFSTRRFAADNDLGLPVAAVYFNAQRETAARRR  173



>gb|ADO60992.1| terminal flower 1 [Helianthus annuus]
 gb|ADO60993.1| terminal flower 1 [Helianthus annuus]
Length=165

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/167 (75%), Positives = 142/167 (85%), Gaps = 2/167 (1%)
 Frame = -1

Query  830  MSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRS  651
            MSD LVIGRVVGDV+D F+  V M V YN +K V+NGHE FPSSVTT+P+V+V GGDMRS
Sbjct  1    MSDPLVIGRVVGDVVDNFTQCVDMSVTYNSSKQVYNGHELFPSSVTTKPKVDVRGGDMRS  60

Query  650  FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFV  471
            FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFG+E+VSYE+PRPNIGIHRFVF+
Sbjct  61   FFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGKEVVSYEIPRPNIGIHRFVFL  120

Query  470  LYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRET  330
            L+KQ+ R    VN P SR  FN+R F+ +N L +PVA VFFNCQRET
Sbjct  121  LFKQRGR--QTVNCPPSRHGFNTRNFAHENKLGSPVAGVFFNCQRET  165



>gb|AAR03725.1| TFL1a [Pisum sativum]
Length=174

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 148/176 (84%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM+ + L++GRV+G+V+D F+ S+KM V YN  K V NGHEFFPS++ T+P+VE+ G 
Sbjct  1    MARMAQEPLIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE+P+PNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQ+ R  +    P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQRARDSVRAT-PSSRDHFNTRSFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|ADP00680.1| CEN [Festuca arundinacea]
 gb|ADP00682.1| CEN [Festuca arundinacea]
Length=169

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGEEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>dbj|BAD10962.1| TFL1-like protein [Pyrus pyrifolia]
Length=172

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M + S+  V+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MKKASEPPVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MRSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMP+PNIGIHRF
Sbjct  60   MRSFFTLVMTDPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+FN QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFNAQRETAARRR  172



>ref|XP_011094364.1| PREDICTED: protein TERMINAL FLOWER 1-like isoform X3 [Sesamum 
indicum]
Length=172

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 148/175 (85%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++GRV+GDV+D FSP+ KM V Y  NK V NGHEF+PS+V  +PRVE+ GGD
Sbjct  1    MARMSDPLIVGRVIGDVLDSFSPTTKMFVTYA-NKQVFNGHEFYPSAVVMKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+F+TL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+ SYE+P+PNIGIHRF
Sbjct  60   LRTFYTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKELASYEIPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ  R  +  N P +RD FN+R+F+ +N L  PVAAVFFN QRETAARRR
Sbjct  120  VFVLFKQTGRQTVK-NLP-TRDCFNTRRFAVENGLGLPVAAVFFNAQRETAARRR  172



>gb|ADP00674.1| CEN [Festuca arundinacea]
 gb|ADP00686.1| CEN [Festuca arundinacea]
Length=169

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAADNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00713.1| CEN [Festuca arundinacea subsp. atlantigena]
Length=169

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+FS DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFSVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00690.1| CEN [Festuca circummediterranea]
Length=169

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V  +PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDSFNPCVKMVATYNSNKLVFNGHELYPSAVVCKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR  + V  P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSV--PSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00692.1| CEN [Festuca tatrae]
Length=169

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR  + V  P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSV--PSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00670.1| CEN [Festuca arundinacea]
 gb|ADP00671.1| CEN [Festuca arundinacea]
 gb|ADP00673.1| CEN [Festuca arundinacea]
 gb|ADP00675.1| CEN [Festuca arundinacea]
 gb|ADP00677.1| CEN [Festuca arundinacea]
 gb|ADP00683.1| CEN [Festuca arundinacea]
 gb|ADP00684.1| CEN [Festuca arundinacea]
 gb|ADP00685.1| CEN [Festuca arundinacea]
 gb|ADP00687.1| CEN [Festuca arundinacea]
 gb|ADP00695.1| CEN [Festuca mairei]
 gb|ADP00696.1| CEN [Festuca arundinacea subsp. cirtensis]
 gb|ADP00697.1| CEN [Festuca arundinacea subsp. cirtensis]
 gb|ADP00698.1| CEN [Festuca arundinacea subsp. fenas]
 gb|ADP00699.1| CEN [Festuca drymeja]
 gb|ADP00700.1| CEN [Festuca lasto]
 gb|ADP00701.1| CEN [Festuca arundinacea subsp. atlantigena]
 gb|ADP00702.1| CEN [Festuca altissima]
 gb|ADP00704.1| CEN [Lolium multiflorum]
 gb|ADP00705.1| CEN [Festuca pratensis]
 gb|ADP00706.1| CEN [Festuca mairei]
 gb|ADP00707.1| CEN [Festuca arundinacea subsp. cirtensis]
 gb|ADP00709.1| CEN [Festuca arundinacea subsp. fenas]
 gb|ADP00712.1| CEN [Festuca gigantea]
Length=169

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00716.1| CEN [Festuca valesiaca]
Length=169

 Score =   258 bits (658),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 119/170 (70%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L +GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLKVGRVIGEVLDSFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+VSYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVVSYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR  + V  P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRRQTLSV--PSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ADP00676.1| CEN [Festuca arundinacea]
 gb|ADP00688.1| CEN [Festuca arundinacea]
Length=169

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDTSFGGEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|AFP33421.1| terminal flower 1 [Arachis hypogaea]
Length=180

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 2/168 (1%)
 Frame = -1

Query  818  LVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFFTL  639
            L IGRV+GDV+D F+ +VKM V YN NKHV+NG EFFPSS++ +PRV +HGGD+RS FTL
Sbjct  15   LTIGRVIGDVVDDFTETVKMTVTYN-NKHVYNGFEFFPSSISAKPRVHIHGGDLRSSFTL  73

Query  638  IMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLYKQ  459
            IMTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E++ YEMP+PNIGIHRFV VLYKQ
Sbjct  74   IMTDPDVPGPSDPYLREHLHWMVTDIPGTTDATFGKEVIKYEMPKPNIGIHRFVLVLYKQ  133

Query  458  KRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KRR  +    P SRD FN+RKF  +NDL  PVAAVFFN QRETA R+R
Sbjct  134  KRRQTVN-KVPNSRDLFNTRKFVVENDLGTPVAAVFFNAQRETACRKR  180



>ref|XP_010255492.1| PREDICTED: CEN-like protein 1 [Nelumbo nucifera]
Length=173

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 143/175 (82%), Gaps = 2/175 (1%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R  + L +GRVVG+V+D F+PSVKM V YN NK V+NGHEF PS +T+RPRVE+ G D
Sbjct  1    MERNLEPLTVGRVVGEVVDAFTPSVKMNVTYNFNKQVYNGHEFMPSVITSRPRVEIGGED  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+ FTLIMTDPD P PSDPYLREHLHWIVTDIPGTTD+SFGREIV YE P+P IGIHRF
Sbjct  61   LRAAFTLIMTDPDAPSPSDPYLREHLHWIVTDIPGTTDASFGREIVGYETPKPVIGIHRF  120

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VF+L+KQK R    V  P SRD+F++RKFS++N L  PVAAV+FN QRETAARRR
Sbjct  121  VFILFKQKGR--KTVKPPASRDQFSTRKFSEENGLGLPVAAVYFNAQRETAARRR  173



>ref|XP_004163314.1| PREDICTED: CEN-like protein 2-like [Cucumis sativus]
Length=182

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/174 (68%), Positives = 146/174 (84%), Gaps = 1/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
              + + LV+GRV+GDV+D FSP++KM V +  NK V NGHEFFPSS++ +PRV + G DM
Sbjct  10   GELQNPLVLGRVIGDVVDPFSPTIKMSVTFTNNKQVLNGHEFFPSSLSFKPRVHIQGEDM  69

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RS FTL+M DPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E +SYE+P+P IGIHRFV
Sbjct  70   RSLFTLVMVDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKEEMSYEIPKPTIGIHRFV  129

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            F+L+KQK+R  + VN P SRDRFN+R+FS +NDL  PVAAV+FN QRETAARRR
Sbjct  130  FILFKQKQRRSV-VNPPSSRDRFNTRRFSCENDLGLPVAAVYFNAQRETAARRR  182



>gb|ADP00694.1| CEN [Festuca scariosa]
Length=169

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVESKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|ABP73381.1| TFL1 [Vicia faba]
Length=174

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM+ +  ++GRV+G+V+D F+ S+KM V YN  K V NGHEFFPS++ T+P+VE+ G 
Sbjct  1    MARMAQEPRIVGRVIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE+P+PNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R  +    P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRT-TPSSRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>emb|CBX25328.1| hypothetical_protein [Oryza brachyantha]
Length=176

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 149/178 (84%), Gaps = 5/178 (3%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M+R  + LV+GRV+G+V+D F+P +KM V YN NK V NGHE +PS+V ++PRVEV GGD
Sbjct  1    MSRSVEPLVVGRVIGEVLDTFNPCMKMIVTYNSNKLVFNGHELYPSAVVSKPRVEVQGGD  60

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHW-IVTDIPGTTDSSF--GREIVSYEMPRPNIGI  489
            +RSFFTL+MTDPDVPGPSDPYLREHLHW IVTDIPGTTD+SF  GRE++SYE P+PNIGI
Sbjct  61   LRSFFTLVMTDPDVPGPSDPYLREHLHWRIVTDIPGTTDASFGRGREVISYESPKPNIGI  120

Query  488  HRFVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            HRF+FVL+KQKRR    V  P  RD FN+R+F+++NDL  PVAAV+FN QRETAARRR
Sbjct  121  HRFIFVLFKQKRR--QTVLVPSFRDHFNTRRFAEENDLGLPVAAVYFNAQRETAARRR  176



>dbj|BAD10970.1| TFL1-like protein [Cydonia oblonga]
Length=172

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR  + LV+GRV+GDV+D F+P+  M V YN  K V NG E FPS VT +PRVE+ GG+
Sbjct  1    MARFPEPLVVGRVIGDVLDSFTPTTHMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGE  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE++SYEMPRPNIGIHRF
Sbjct  60   LRSFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREVLSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    +N P SRD F++R F+ +NDL  PVAAV+FN QRE AARRR
Sbjct  120  VFVLFKQKRR--QSINPPSSRDCFSTRSFAAENDLGLPVAAVYFNAQRENAARRR  172



>ref|NP_001280794.1| protein TERMINAL FLOWER 1-like [Malus domestica]
 dbj|BAD10967.1| TFL1-like protein [Malus domestica]
 dbj|BAG31956.1| TFL1 like protein [Malus domestica]
 dbj|BAG31959.1| TFL1 like protein [Malus domestica]
 gb|ACD69429.1| terminal flower 1 [Malus domestica]
 gb|ACF18114.1| terminal flower 1 [Malus domestica]
Length=172

 Score =   257 bits (656),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 145/175 (83%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+GRV+GDV+D F+P+  M V YN  K V NG E FPS VT +PRVE+ GG+
Sbjct  1    MARVPEPLVVGRVIGDVLDSFTPTTHMSVTYN-AKLVCNGLELFPSVVTAKPRVEIQGGE  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE +SYEMPRPNIGIHRF
Sbjct  60   LRSFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREALSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    +N P SRD F++R F+ +NDL  PVAAV+FN QRE+AARRR
Sbjct  120  VFVLFKQKRR--QSINIPSSRDCFSTRSFAAENDLGLPVAAVYFNAQRESAARRR  172



>dbj|BAD10971.1| TFL1-like protein [Pseudocydonia sinensis]
Length=172

 Score =   257 bits (656),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 145/175 (83%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+GRV+GDV+D F+P+  M V YN  K V NG E FPS VT +PRVE+ GG+
Sbjct  1    MARVPEPLVVGRVIGDVLDSFTPTTHMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGE  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE++SYEMPRPNIGIHRF
Sbjct  60   LRSFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREVLSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    +N P SRD F++R F+ +NDL  PVAA++FN QRE AARRR
Sbjct  120  VFVLFKQKRR--QSINPPSSRDCFSTRSFAAENDLGLPVAALYFNAQRENAARRR  172



>gb|ADP00711.1| CEN [Festuca gigantea]
 gb|ADP00715.1| CEN [Festuca pratensis subsp. apennina]
Length=169

 Score =   257 bits (656),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 118/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVMSYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>gb|AEO72026.1| TFL1-like protein [Pyracantha fortuneana]
Length=172

 Score =   257 bits (656),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 142/175 (81%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            M R S+ LV+GRV+GDV+D F+ + KM V YN  K V NG E FPS VT +PRVE+ GGD
Sbjct  1    MTRASEPLVVGRVIGDVLDSFTATTKMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            MR FFTL+MT PD PGPSDPYLREHLHWIVTDIPGTTD++FGRE+VSYEMPRPNIGIHRF
Sbjct  60   MRCFFTLVMTGPDFPGPSDPYLREHLHWIVTDIPGTTDATFGREVVSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQ RR    +N P SRD F++R F+ +NDL  PVAAV+F+ QRETAARRR
Sbjct  120  VFVLFKQNRR--QSINTPSSRDHFSTRSFAAENDLGLPVAAVYFSAQRETAARRR  172



>gb|ADP00714.1| CEN [Festuca pratensis subsp. apennina]
Length=169

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E+++YE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVITYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ DNDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVDNDLGLPVAAVYFNCQRETAARRR  169



>ref|XP_002873117.1| hypothetical protein ARALYDRAFT_487163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABY79195.1| At5g03840-like protein [Arabidopsis lyrata]
 gb|EFH49376.1| hypothetical protein ARALYDRAFT_487163 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score =   257 bits (656),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
             R+ + L++GRVVGDV+D F+P++KM V YN  K V NGHE FPSSV+++PRVE+HGGD+
Sbjct  6    TRVIEPLIMGRVVGDVLDFFTPTIKMNVSYN-KKQVSNGHELFPSSVSSKPRVEIHGGDL  64

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTL+M DPDVPGPSDP+L+EHLHWIVT+IPGTTD++FG+E+VSYE+PRP+IGIHRFV
Sbjct  65   RSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIGIHRFV  124

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQK+R  +  N P SRD FN+RKF+ + DL  PVAAVFFN QRETAAR+R
Sbjct  125  FVLFKQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNAQRETAARKR  177



>ref|XP_011094361.1| PREDICTED: CEN-like protein 2 isoform X1 [Sesamum indicum]
Length=180

 Score =   257 bits (656),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 148/182 (81%), Gaps = 9/182 (5%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MARMSD L++GRV+GDV+D FSP+ KM V Y  NK V NGHEF+PS+V  +PRVE+ GGD
Sbjct  1    MARMSDPLIVGRVIGDVLDSFSPTTKMFVTY-ANKQVFNGHEFYPSAVVMKPRVEIQGGD  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +R+F+TL+MTDPDVPGPSDPYLREHLHW+VTDIPGTTD++FG+E+ SYE+P+PNIGIHRF
Sbjct  60   LRTFYTLVMTDPDVPGPSDPYLREHLHWLVTDIPGTTDATFGKELASYEIPKPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDR-------FNSRKFSDDNDLAAPVAAVFFNCQRETAAR  321
            VFVL+KQ  R  +  N P SRD        FN+R+F+ +N L  PVAAVFFN QRETAAR
Sbjct  120  VFVLFKQTGRQTVK-NLPTSRDVRKWIGDCFNTRRFAVENGLGLPVAAVFFNAQRETAAR  178

Query  320  RR  315
            RR
Sbjct  179  RR  180



>ref|XP_011090356.1| PREDICTED: protein CENTRORADIALIS-like [Sesamum indicum]
Length=174

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 146/172 (85%), Gaps = 1/172 (1%)
 Frame = -1

Query  827  SDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSF  648
            S++LVIGRV+GDV+D FS +VKM V Y  N HV+NGH+  PS++ + P+V V GGDMR+F
Sbjct  3    SEALVIGRVIGDVVDNFSSTVKMSVRYKCNNHVYNGHQLSPSTLASTPKVHVLGGDMRTF  62

Query  647  FTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVL  468
            FTLIMTDPDVPGPSDPYLREHLHWI+TDIPGTTDSSFGRE+VSYEMPRPNIGIHR VFVL
Sbjct  63   FTLIMTDPDVPGPSDPYLREHLHWIITDIPGTTDSSFGREVVSYEMPRPNIGIHRLVFVL  122

Query  467  YKQKRRLGM-GVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            ++QKRR+ + G+   + RD F++R F+++N+L  PVAA+FFNCQR TA RRR
Sbjct  123  FEQKRRMQVQGIAPSVCRDGFSTRNFAEENELGLPVAALFFNCQRHTAPRRR  174



>gb|AAM27957.1|AF466817_1 terminal flower 1 [Arabidopsis lyrata]
Length=177

 Score =   256 bits (655),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
             R+ + L++GRVVGDV+D F+P++KM V YN  K V NGHE FPSSV+++PRVE+HGGD+
Sbjct  6    TRVIEPLIMGRVVGDVLDFFTPTIKMNVSYN-KKQVSNGHELFPSSVSSKPRVEIHGGDL  64

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTL+M DPDVPGPSDP+L+EHLHWIVT+IPGTTD++FG+E+VSYE+PRP+IGIHRFV
Sbjct  65   RSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIGIHRFV  124

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQK+R  +  N P SRD FN+RKF+ + DL  PVAAVFFN QRETAAR+R
Sbjct  125  FVLFKQKQRRVIFPNIP-SRDHFNTRKFAVEYDLGLPVAAVFFNTQRETAARKR  177



>gb|ADP00678.1| CEN [Festuca arundinacea]
 gb|ADP00679.1| CEN [Festuca arundinacea]
 gb|ADP00681.1| CEN [Festuca arundinacea]
Length=169

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/170 (69%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = -1

Query  824  DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDMRSFF  645
            + L++GRV+G+V+D F+P VKM   YN NK V NGHE +PS+V ++PRVEV GGD+RS F
Sbjct  2    EPLIVGRVIGEVLDPFNPCVKMVATYNSNKLVFNGHELYPSAVVSKPRVEVQGGDLRSLF  61

Query  644  TLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFVFVLY  465
            TL+MTDPDVPGPSDPYLREHLHWIV++IPGTTD+SFG E++SYE P+PNIGIHRF+FVL+
Sbjct  62   TLVMTDPDVPGPSDPYLREHLHWIVSNIPGTTDASFGGEVISYESPKPNIGIHRFIFVLF  121

Query  464  KQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            KQKRR    V+ P  RD FN+R+F+ +NDL  PVAAV+FNCQRETAARRR
Sbjct  122  KQKRR--QTVSVPSFRDHFNTRQFAVNNDLGLPVAAVYFNCQRETAARRR  169



>gb|ABP73383.1| TFL1 [Vicia faba]
Length=174

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 147/176 (84%), Gaps = 3/176 (2%)
 Frame = -1

Query  839  MARMS-DSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            MARM+ +  ++GR++G+V+D F+ S+KM V YN  K V NGHEFFPS++ T+P+VE+ G 
Sbjct  1    MARMAQEPRIVGRMIGEVLDSFTTSMKMTVSYN-KKQVFNGHEFFPSTINTKPKVEIDGA  59

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            DMRSF+TL+MTDPDVPGPSDPYLREHLHWIVTDIPGTTD++FG+EIVSYE+P+PNIGIHR
Sbjct  60   DMRSFYTLVMTDPDVPGPSDPYLREHLHWIVTDIPGTTDATFGKEIVSYEIPKPNIGIHR  119

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK R  +    P SRD FN+R F+  NDL  PVAAV+FN QRETAARRR
Sbjct  120  FVFVLFKQKARDSVRT-TPSSRDHFNTRNFASQNDLGLPVAAVYFNAQRETAARRR  174



>gb|AEH43348.1| TFL1 [Arabis alpina]
 gb|KFK24836.1| dt1 [Arabis alpina]
Length=177

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 152/176 (86%), Gaps = 2/176 (1%)
 Frame = -1

Query  842  IMARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGG  663
            I +R+ + L++GRVVG+V+D F+P++KM V YN  K V NGHE FPS+V+++PRVE+HGG
Sbjct  4    IGSRLIEPLIVGRVVGEVLDYFTPTIKMNVSYN-KKQVSNGHELFPSTVSSKPRVEIHGG  62

Query  662  DMRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHR  483
            D+RSFFTL+M DPDVPGPSDP+L+EHLHWIVT+IPGTTD++FG+E+VSYE+PRP+IGIHR
Sbjct  63   DLRSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIGIHR  122

Query  482  FVFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVFVL+KQK+R  +  N P SRD FN+R+F+ + DL  PVAAVFFN QRETAAR+R
Sbjct  123  FVFVLFKQKQRRVIFPNIP-SRDHFNTREFAVEYDLGLPVAAVFFNAQRETAARKR  177



>ref|XP_009130785.1| PREDICTED: protein TERMINAL FLOWER 1 [Brassica rapa]
Length=177

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
             R+ + L++GRVVGDV+D F+P++KM V YN N+ V NGHE  PSSV+++PRVE+HGGD+
Sbjct  6    VRVIEPLIMGRVVGDVLDFFTPTIKMNVSYNKNQ-VSNGHELLPSSVSSKPRVEIHGGDL  64

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTL+M DPDVPGPSDP+L+EHLHWIVT+IPGTTD++FG+E+VSYE+PRP+IGIHRFV
Sbjct  65   RSFFTLVMIDPDVPGPSDPFLKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIGIHRFV  124

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQK+R  +  N P SRD FN+RKF+ + DL  PVAAVFFN QRETAARRR
Sbjct  125  FVLFKQKQRRVIFPNIP-SRDNFNTRKFAIEYDLGLPVAAVFFNAQRETAARRR  177



>ref|NP_001289244.1| protein TERMINAL FLOWER 1-like [Pyrus x bretschneideri]
 dbj|BAD10968.1| TFL1-like protein [Pyrus pyrifolia]
 dbj|BAD10969.1| TFL1-like protein [Pyrus communis]
 dbj|BAK74839.1| terminal flowering 1 [Pyrus pyrifolia]
 dbj|BAI99732.4| terminal flower1 [Pyrus pyrifolia var. culta]
 gb|AGW22130.1| terminal flower 1 protein [Pyrus x bretschneideri]
Length=172

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 144/175 (82%), Gaps = 3/175 (2%)
 Frame = -1

Query  839  MARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGD  660
            MAR+ + LV+GRV+GDV+D F+P+  M V YN  K V NG E FPS VT +PRVE+ GG+
Sbjct  1    MARVPEPLVVGRVIGDVLDSFTPTTHMSVTYN-TKLVCNGLELFPSVVTAKPRVEIQGGE  59

Query  659  MRSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRF  480
            +RSFFTL+MTDPD PGPSDPYLREHLHWIVTDIPGTTD++FGRE +SYEMPRPNIGIHRF
Sbjct  60   LRSFFTLVMTDPDCPGPSDPYLREHLHWIVTDIPGTTDAAFGREALSYEMPRPNIGIHRF  119

Query  479  VFVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            VFVL+KQKRR    +N P SRD F++R F+ +NDL  PVAAV+FN QRE AARRR
Sbjct  120  VFVLFKQKRR--QSINPPSSRDCFSTRSFAAENDLGLPVAAVYFNAQREGAARRR  172



>ref|XP_006398842.1| hypothetical protein EUTSA_v10015708mg [Eutrema salsugineum]
 gb|ESQ40295.1| hypothetical protein EUTSA_v10015708mg [Eutrema salsugineum]
Length=177

 Score =   256 bits (654),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/174 (68%), Positives = 150/174 (86%), Gaps = 2/174 (1%)
 Frame = -1

Query  836  ARMSDSLVIGRVVGDVIDCFSPSVKMCVIYNPNKHVHNGHEFFPSSVTTRPRVEVHGGDM  657
            +R+ + L++GRVVGDV+D F+P++KM V YN  K V NGHE FPS+V+++PRVE+HGGD+
Sbjct  6    SRVIEPLIVGRVVGDVLDFFTPTIKMSVSYN-KKQVSNGHELFPSTVSSKPRVEIHGGDL  64

Query  656  RSFFTLIMTDPDVPGPSDPYLREHLHWIVTDIPGTTDSSFGREIVSYEMPRPNIGIHRFV  477
            RSFFTL+M DPDVPGPSDP+ +EHLHWIVT+IPGTTD++FG+E+VSYE+PRP+IGIHRFV
Sbjct  65   RSFFTLVMIDPDVPGPSDPFQKEHLHWIVTNIPGTTDATFGKEVVSYELPRPSIGIHRFV  124

Query  476  FVLYKQKRRLGMGVNAPLSRDRFNSRKFSDDNDLAAPVAAVFFNCQRETAARRR  315
            FVL+KQK+R  +  N  LSRD FN+RKF+ + DL  PVAAVFFN QRETAARRR
Sbjct  125  FVLFKQKQRRVIFPNI-LSRDHFNTRKFAIEYDLGLPVAAVFFNAQRETAARRR  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1997200541776