BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c70944_g1_i1 len=147 path=[1:0-146]

Length=147
                                                                      Score     E

ref|XP_009758461.1|  PREDICTED: subtilisin-like protease              63.9    4e-10   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease              63.5    5e-10   
ref|XP_007024651.1|  Subtilase family protein                         62.8    1e-09   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg              62.0    2e-09   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like         61.6    2e-09   
ref|XP_010322825.1|  PREDICTED: subtilisin-like protease              61.2    3e-09   
ref|XP_003570496.1|  PREDICTED: subtilisin-like protease              61.2    4e-09   
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease              60.8    4e-09   
ref|XP_003627323.1|  Cucumisin-like serine protease subtilisin-li...  60.5    6e-09   
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                   59.7    1e-08   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like         59.7    1e-08   
ref|XP_010232411.1|  PREDICTED: subtilisin-like protease              59.7    1e-08   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like         59.3    2e-08   
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease              59.3    2e-08   
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease              58.9    2e-08   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  58.9    2e-08   
ref|XP_007135429.1|  hypothetical protein PHAVU_010G128600g           58.5    3e-08   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...  57.8    5e-08   
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease              57.4    7e-08   
ref|XP_009610930.1|  PREDICTED: subtilisin-like protease              57.4    7e-08   
ref|XP_004245414.1|  PREDICTED: subtilisin-like protease              57.4    8e-08   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg           56.6    1e-07   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like         56.6    1e-07   
dbj|BAJ93208.1|  predicted protein                                    56.6    1e-07   
ref|XP_004510506.1|  PREDICTED: subtilisin-like protease-like iso...  56.6    1e-07   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g           56.6    1e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease              56.6    1e-07   
dbj|BAJ87876.1|  predicted protein                                    56.6    1e-07   
ref|XP_006369129.1|  subtilase family protein                         56.6    1e-07   
ref|XP_011035735.1|  PREDICTED: subtilisin-like protease              56.6    1e-07   
gb|EEC74109.1|  hypothetical protein OsI_09160                        55.8    2e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_003547763.1|  PREDICTED: subtilisin-like protease-like         55.8    2e-07   
gb|EEE57908.1|  hypothetical protein OsJ_08597                        55.5    3e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHN39620.1|  Subtilisin-like protease                              55.5    3e-07   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4       55.5    3e-07   
ref|XP_010688373.1|  PREDICTED: subtilisin-like protease              55.5    3e-07   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                  55.1    4e-07   
gb|KDO64998.1|  hypothetical protein CISIN_1g045236mg                 55.1    4e-07   
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease              55.1    4e-07   
ref|NP_001048300.2|  Os02g0779000                                     55.1    5e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease              54.7    6e-07   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative    54.3    8e-07   Ricinus communis
ref|XP_007136744.1|  hypothetical protein PHAVU_009G070500g           54.3    9e-07   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg           54.3    9e-07   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease              54.3    1e-06   
ref|XP_004305758.1|  PREDICTED: subtilisin-like protease-like         54.3    1e-06   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg           54.3    1e-06   
ref|XP_002460273.1|  hypothetical protein SORBIDRAFT_02g025810        53.9    1e-06   Sorghum bicolor [broomcorn]
ref|XP_010917483.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  53.9    1e-06   
ref|XP_003525925.1|  PREDICTED: subtilisin-like protease-like         53.9    1e-06   
gb|EMT11314.1|  hypothetical protein F775_42966                       53.5    1e-06   
emb|CDY52259.1|  BnaC05g52030D                                        53.9    1e-06   
ref|XP_008792869.1|  PREDICTED: subtilisin-like protease              53.5    1e-06   
ref|XP_003523991.1|  PREDICTED: subtilisin-like protease-like         53.5    2e-06   
ref|XP_004172226.1|  PREDICTED: subtilisin-like protease-like         53.1    2e-06   
ref|NP_001146035.1|  uncharacterized protein LOC100279566             53.1    2e-06   Zea mays [maize]
emb|CDX97539.1|  BnaA05g25400D                                        53.1    2e-06   
ref|XP_002454656.1|  hypothetical protein SORBIDRAFT_04g034980        53.1    2e-06   Sorghum bicolor [broomcorn]
gb|AGN03879.1|  senescence-associated subtilisin protease             53.1    2e-06   
dbj|BAD81785.1|  P69E protein-like                                    53.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|NP_566473.2|  Subtilase family protein                            53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98521.1|  putative subtilisin-like serine proteinase           53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AFW73751.1|  putative subtilase family protein                     53.1    2e-06   
gb|EEC71345.1|  hypothetical protein OsI_03414                        53.1    2e-06   Oryza sativa Indica Group [Indian rice]
ref|NP_001043993.2|  Os01g0702300                                     53.1    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006857985.1|  hypothetical protein AMTR_s00069p00181050        53.1    2e-06   
emb|CDY33251.1|  BnaC01g37240D                                        53.1    3e-06   
gb|EAZ13237.1|  hypothetical protein OsJ_03159                        52.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CBI35855.3|  unnamed protein product                              53.1    3e-06   
gb|EMS68171.1|  Subtilisin-like protease                              52.4    3e-06   
dbj|BAD36156.1|  putative serine protease                             52.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006356658.1|  PREDICTED: subtilisin-like protease-like         52.8    3e-06   
ref|XP_002885009.1|  subtilase family protein                         52.8    3e-06   
gb|KHN07895.1|  Subtilisin-like protease                              52.4    3e-06   
dbj|BAH20348.1|  AT3G14067                                            52.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|ADW11233.1|  subtilisin-like protease 2                            52.8    3e-06   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease              52.4    4e-06   Vitis vinifera
gb|KHN45156.1|  Subtilisin-like protease                              52.4    4e-06   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4       52.4    4e-06   
ref|XP_009391730.1|  PREDICTED: subtilisin-like protease              52.4    4e-06   
ref|XP_006857642.1|  hypothetical protein AMTR_s00061p00139460        49.3    4e-06   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease              52.4    4e-06   
gb|KDO81559.1|  hypothetical protein CISIN_1g0053341mg                52.0    5e-06   
dbj|BAJ99493.1|  predicted protein                                    52.0    5e-06   
ref|NP_001063283.2|  Os09g0441000                                     52.0    5e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMT17595.1|  Subtilisin-like protease                              52.0    5e-06   
ref|XP_009782030.1|  PREDICTED: subtilisin-like protease              52.0    5e-06   
emb|CAN75240.1|  hypothetical protein VITISV_014207                   52.0    5e-06   Vitis vinifera
gb|ACB87529.1|  subtilisin protease                                   52.0    5e-06   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007156742.1|  hypothetical protein PHAVU_002G013500g           52.0    5e-06   
ref|XP_010111996.1|  Subtilisin-like protease                         52.0    5e-06   
gb|KGN55992.1|  hypothetical protein Csa_3G045060                     52.0    5e-06   
ref|XP_004148290.1|  PREDICTED: uncharacterized protein LOC101212014  52.4    5e-06   
gb|EMS57180.1|  Subtilisin-like protease                              51.6    6e-06   
ref|XP_009596091.1|  PREDICTED: subtilisin-like protease              52.0    6e-06   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative    52.0    6e-06   Ricinus communis
ref|XP_006472275.1|  PREDICTED: subtilisin-like protease-like         52.0    6e-06   
ref|XP_010238218.1|  PREDICTED: subtilisin-like protease              52.0    6e-06   
ref|XP_006433609.1|  hypothetical protein CICLE_v10000363mg           52.0    6e-06   
ref|XP_010059854.1|  PREDICTED: subtilisin-like protease              52.0    6e-06   
ref|XP_004954115.1|  PREDICTED: subtilisin-like protease-like         51.6    7e-06   
ref|XP_006661279.1|  PREDICTED: subtilisin-like protease-like         51.6    7e-06   
ref|XP_006651839.1|  PREDICTED: subtilisin-like protease-like         51.6    7e-06   
ref|XP_003589103.1|  Subtilisin-like protease                         51.6    7e-06   
gb|ACN27570.1|  unknown                                               51.2    7e-06   Zea mays [maize]
ref|NP_001051353.1|  Os03g0761500                                     51.6    7e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDY39093.1|  BnaA01g29630D                                        51.6    8e-06   
ref|XP_004169297.1|  PREDICTED: subtilisin-like protease-like         51.6    8e-06   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease              51.6    8e-06   
ref|XP_006396129.1|  hypothetical protein EUTSA_v10002410mg           51.6    8e-06   
ref|XP_002463844.1|  hypothetical protein SORBIDRAFT_01g007310        51.6    8e-06   Sorghum bicolor [broomcorn]
gb|ACN34516.1|  unknown                                               50.8    8e-06   Zea mays [maize]
ref|NP_001151463.1|  LOC100285096 precursor                           51.6    8e-06   Zea mays [maize]
gb|EAY87746.1|  hypothetical protein OsI_09161                        51.2    8e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_008792868.1|  PREDICTED: subtilisin-like protease              51.2    9e-06   
tpg|DAA51518.1|  TPA: putative subtilase family protein               51.2    9e-06   
gb|KDP35557.1|  hypothetical protein JCGZ_08995                       51.2    1e-05   
ref|XP_010917484.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  51.2    1e-05   
gb|EPS74243.1|  subtilase family protein                              51.2    1e-05   
ref|XP_010277120.1|  PREDICTED: subtilisin-like protease              51.2    1e-05   
ref|XP_002456214.1|  hypothetical protein SORBIDRAFT_03g032240        50.8    1e-05   Sorghum bicolor [broomcorn]
ref|XP_010693651.1|  PREDICTED: subtilisin-like protease              50.8    1e-05   
gb|ABD33266.1|  Protease-associated PA; Proteinase inhibitor I9, ...  50.8    1e-05   Medicago truncatula
dbj|BAJ98937.1|  predicted protein                                    50.4    1e-05   
ref|XP_006358407.1|  PREDICTED: subtilisin-like protease-like         50.8    1e-05   
gb|EPS65938.1|  hypothetical protein M569_08836                       50.8    1e-05   
ref|XP_004956934.1|  PREDICTED: subtilisin-like protease-like         50.8    1e-05   
ref|XP_009403290.1|  PREDICTED: subtilisin-like protease              50.8    2e-05   
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease              50.8    2e-05   
emb|CDY18654.1|  BnaA09g07410D                                        50.4    2e-05   
ref|XP_003559080.1|  PREDICTED: subtilisin-like protease              50.4    2e-05   
gb|EMT15470.1|  Subtilisin-like protease                              50.4    2e-05   
ref|XP_003636375.1|  Subtilisin-like protease                         50.4    2e-05   
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690        50.4    2e-05   
ref|XP_003605881.1|  Subtilisin-like protease                         50.4    2e-05   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease              50.4    2e-05   
emb|CDP03080.1|  unnamed protein product                              50.4    2e-05   
ref|XP_008810184.1|  PREDICTED: subtilisin-like protease SBT5.3       50.4    2e-05   
dbj|BAJ93872.1|  predicted protein                                    50.4    2e-05   
ref|XP_010519206.1|  PREDICTED: subtilisin-like protease isoform X1   50.4    2e-05   
ref|XP_006342387.1|  PREDICTED: subtilisin-like protease-like         50.4    2e-05   
ref|XP_010412797.1|  PREDICTED: subtilisin-like protease              50.4    2e-05   
gb|EMT22975.1|  Subtilisin-like protease                              50.1    2e-05   
ref|XP_004243704.1|  PREDICTED: subtilisin-like protease              50.4    2e-05   
gb|AES59354.2|  subtilisin-like serine protease                       50.1    2e-05   
dbj|GAD34309.1|  subtilisin-like serine protease                      50.4    2e-05   
ref|WP_036304711.1|  hypothetical protein                             50.4    2e-05   
ref|NP_001048301.1|  Os02g0779200                                     50.1    2e-05   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ89916.1|  predicted protein                                    50.1    2e-05   
ref|XP_004981675.1|  PREDICTED: subtilisin-like protease-like         50.1    2e-05   
ref|XP_006358406.1|  PREDICTED: subtilisin-like protease-like         50.1    2e-05   
emb|CBI38463.3|  unnamed protein product                              50.1    2e-05   
ref|XP_010488783.1|  PREDICTED: subtilisin-like protease              50.1    2e-05   
emb|CDP20511.1|  unnamed protein product                              50.1    2e-05   
ref|XP_010465286.1|  PREDICTED: subtilisin-like protease              50.1    3e-05   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease              50.1    3e-05   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease              50.1    3e-05   
emb|CDO99977.1|  unnamed protein product                              50.1    3e-05   
ref|XP_010248001.1|  PREDICTED: subtilisin-like protease              50.1    3e-05   
ref|XP_006857622.1|  hypothetical protein AMTR_s00061p00122710        50.1    3e-05   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g           49.7    3e-05   
ref|XP_009767539.1|  PREDICTED: subtilisin-like protease              49.7    3e-05   
ref|WP_036325485.1|  hypothetical protein                             50.1    3e-05   
ref|XP_009112378.1|  PREDICTED: subtilisin-like protease              49.7    3e-05   
ref|XP_010467108.1|  PREDICTED: subtilisin-like protease              49.7    3e-05   
emb|CBI38461.3|  unnamed protein product                              48.9    3e-05   
gb|ABZ89187.1|  putative protein                                      49.7    3e-05   Coffea canephora [robusta coffee]
ref|XP_003570962.1|  PREDICTED: subtilisin-like protease SBT5.3       49.7    3e-05   
ref|XP_010541995.1|  PREDICTED: subtilisin-like protease              49.7    3e-05   
ref|XP_004954112.1|  PREDICTED: subtilisin-like protease-like         49.7    3e-05   
gb|KDP41644.1|  hypothetical protein JCGZ_16051                       49.7    3e-05   
gb|AGT17100.1|  serine protease                                       49.7    4e-05   
ref|XP_010105478.1|  Subtilisin-like protease                         49.7    4e-05   
gb|ACN85315.1|  subtilisin-like protease precursor                    49.7    4e-05   Oryza brachyantha
gb|AFB33579.1|  hypothetical protein 2_7189_01                        47.0    4e-05   
gb|KFK39884.1|  hypothetical protein AALP_AA3G301200                  49.3    4e-05   
gb|AFB33576.1|  hypothetical protein 2_7189_01                        47.0    4e-05   
ref|XP_004246134.2|  PREDICTED: subtilisin-like protease              49.3    4e-05   
ref|XP_006297042.1|  hypothetical protein CARUB_v10013038mg           49.3    4e-05   
gb|KHN01421.1|  Subtilisin-like protease                              48.9    4e-05   
gb|ADZ55305.1|  serine protease                                       49.3    4e-05   
dbj|BAK07347.1|  predicted protein                                    49.3    4e-05   
ref|XP_009416811.1|  PREDICTED: subtilisin-like protease              49.3    4e-05   
ref|XP_003570499.1|  PREDICTED: subtilisin-like protease              49.3    4e-05   
gb|AEX12739.1|  hypothetical protein 2_7189_01                        47.0    4e-05   
ref|NP_565330.1|  Subtilase-like protein                              49.3    5e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EYU28325.1|  hypothetical protein MIMGU_mgv1a001748mg              49.3    5e-05   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3       49.3    5e-05   
gb|KHN12975.1|  Subtilisin-like protease                              49.3    5e-05   
ref|XP_007012625.1|  Subtilase family protein                         49.3    5e-05   
ref|XP_008444575.1|  PREDICTED: subtilisin-like protease              49.3    5e-05   
ref|XP_010109072.1|  Subtilisin-like protease                         49.3    5e-05   
ref|XP_003538797.2|  PREDICTED: subtilisin-like protease-like         49.3    5e-05   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              49.3    5e-05   
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g           48.9    5e-05   
ref|XP_010692334.1|  PREDICTED: subtilisin-like protease              48.9    5e-05   
ref|XP_006648425.1|  PREDICTED: subtilisin-like protease-like         48.9    5e-05   
gb|ACN85269.1|  subtilisin-like protease precursor                    48.9    5e-05   Oryza alta
ref|XP_011078099.1|  PREDICTED: subtilisin-like protease              48.9    6e-05   
ref|XP_008354238.1|  PREDICTED: subtilisin-like protease              48.5    6e-05   
dbj|BAJ97136.1|  predicted protein                                    48.9    6e-05   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3       48.9    6e-05   
ref|XP_007050153.1|  Subtilase family protein isoform 1               48.9    6e-05   
ref|XP_009407416.1|  PREDICTED: subtilisin-like protease              48.9    6e-05   
emb|CDY18042.1|  BnaC07g04280D                                        48.9    6e-05   
gb|EEC76224.1|  hypothetical protein OsI_13631                        48.5    7e-05   Oryza sativa Indica Group [Indian rice]
gb|AEX12742.1|  hypothetical protein 2_7189_01                        46.2    7e-05   
ref|XP_003550312.1|  PREDICTED: subtilisin-like protease-like         48.9    7e-05   
gb|AFB33567.1|  hypothetical protein 2_7189_01                        46.2    7e-05   
emb|CAN75239.1|  hypothetical protein VITISV_014205                   48.5    7e-05   Vitis vinifera
ref|XP_003541310.1|  PREDICTED: subtilisin-like protease-like         48.5    7e-05   
gb|AFB33569.1|  hypothetical protein 2_7189_01                        46.2    7e-05   
ref|XP_009412853.1|  PREDICTED: subtilisin-like protease SDD1         48.5    7e-05   
ref|XP_002301156.2|  hypothetical protein POPTR_0002s12130g           48.5    8e-05   Populus trichocarpa [western balsam poplar]
ref|XP_010090170.1|  Subtilisin-like protease                         48.5    8e-05   
emb|CAN77862.1|  hypothetical protein VITISV_022393                   48.5    8e-05   Vitis vinifera
gb|EAY90937.1|  hypothetical protein OsI_12551                        48.1    8e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease              48.5    8e-05   
ref|XP_006358841.1|  PREDICTED: subtilisin-like protease-like         48.5    8e-05   
ref|XP_006843321.1|  hypothetical protein AMTR_s00910p00007910        47.8    8e-05   
ref|XP_009102354.1|  PREDICTED: subtilisin-like protease              48.5    8e-05   
ref|XP_004289987.1|  PREDICTED: subtilisin-like protease SDD1-like    48.5    8e-05   
gb|EAZ22112.1|  hypothetical protein OsJ_05774                        48.5    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010647023.1|  PREDICTED: subtilisin-like protease SBT5.4       48.1    8e-05   
ref|WP_005267086.1|  subtilisin-like extracellular serine protease    48.5    8e-05   
gb|AFB33565.1|  hypothetical protein 2_7189_01                        46.2    8e-05   
gb|ADY38794.1|  serine protease                                       48.5    8e-05   
ref|XP_003544482.1|  PREDICTED: subtilisin-like protease-like         48.5    9e-05   
gb|ACF79126.1|  unknown                                               48.5    9e-05   Zea mays [maize]
gb|ACN85243.1|  subtilisin-like protease precursor                    48.5    9e-05   Oryza officinalis
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg           48.5    9e-05   
ref|NP_001130775.1|  uncharacterized protein LOC100191879 precursor   48.5    9e-05   Zea mays [maize]
ref|XP_004957134.1|  PREDICTED: subtilisin-like protease-like         48.5    9e-05   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease              48.5    9e-05   
tpg|DAA61658.1|  TPA: putative subtilase family protein               48.1    9e-05   
ref|NP_001234282.1|  SBT1 protein precursor                           48.5    9e-05   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative    48.5    1e-04   Ricinus communis
gb|EMS60673.1|  Subtilisin-like protease                              47.8    1e-04   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180        48.1    1e-04   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like         48.1    1e-04   
ref|XP_010666857.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
emb|CBI37197.3|  unnamed protein product                              48.5    1e-04   
gb|EMT11725.1|  Subtilisin-like protease                              48.1    1e-04   
gb|EMS59706.1|  Subtilisin-like protease                              48.1    1e-04   
gb|EMT01939.1|  Subtilisin-like protease                              48.1    1e-04   
gb|KDP32432.1|  hypothetical protein JCGZ_13357                       48.1    1e-04   
ref|XP_006362066.1|  PREDICTED: subtilisin-like protease-like         48.1    1e-04   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative           48.1    1e-04   Musa acuminata [banana]
gb|KDP33922.1|  hypothetical protein JCGZ_07493                       48.1    1e-04   
gb|KDP40686.1|  hypothetical protein JCGZ_24685                       48.1    1e-04   
gb|KHN21060.1|  Subtilisin-like protease                              48.1    1e-04   
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3       48.1    1e-04   
ref|XP_011024491.1|  PREDICTED: subtilisin-like protease SDD1         48.1    1e-04   
emb|CAD29822.2|  putative serine protease                             48.1    1e-04   Populus x canadensis [Canadian poplar]
ref|XP_003597117.1|  Subtilisin-like protease                         48.1    1e-04   
emb|CAN62248.1|  hypothetical protein VITISV_022540                   48.1    1e-04   Vitis vinifera
emb|CBI38458.3|  unnamed protein product                              48.1    1e-04   
ref|XP_002885806.1|  predicted protein                                48.1    1e-04   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease              48.1    1e-04   
gb|KDP26457.1|  hypothetical protein JCGZ_17615                       48.1    1e-04   
ref|XP_006380388.1|  hypothetical protein POPTR_0007s04520g           48.1    1e-04   
ref|NP_001234288.1|  SBT2 protein precursor                           48.1    1e-04   
ref|XP_010050438.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
ref|XP_006368116.1|  PREDICTED: subtilisin-like protease-like         47.4    1e-04   
ref|WP_020576974.1|  hypothetical protein                             48.1    1e-04   
ref|XP_002994398.1|  hypothetical protein SELMODRAFT_236958           48.1    1e-04   
ref|NP_001050634.1|  Os03g0605300                                     48.1    1e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like         48.1    1e-04   
ref|XP_009383069.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
ref|XP_009404128.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
ref|XP_010919951.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
emb|CBI27801.3|  unnamed protein product                              47.8    1e-04   
ref|XP_011093838.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
ref|XP_010442681.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_006651591.1|  PREDICTED: subtilisin-like protease-like         47.4    1e-04   
ref|XP_007154575.1|  hypothetical protein PHAVU_003G130300g           47.8    1e-04   
ref|XP_010914489.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_009335230.1|  PREDICTED: subtilisin-like protease SDD1         47.8    1e-04   
emb|CDY00497.1|  BnaA10g07760D                                        47.8    1e-04   
gb|AIX97848.1|  SBT1.5                                                47.8    1e-04   
ref|XP_009803919.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_010443674.1|  PREDICTED: subtilisin-like protease isoform X2   47.8    1e-04   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_002283279.2|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_010443668.1|  PREDICTED: subtilisin-like protease isoform X1   47.8    1e-04   
ref|XP_009590702.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
ref|XP_009613725.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
ref|XP_009615143.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
ref|XP_009370534.1|  PREDICTED: subtilisin-like protease SDD1         47.8    2e-04   
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
gb|ABR18065.1|  unknown                                               47.8    2e-04   
ref|XP_008440346.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
ref|XP_009107228.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
ref|XP_004499011.1|  PREDICTED: subtilisin-like protease-like         47.8    2e-04   
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3       47.8    2e-04   
gb|EMT07781.1|  Subtilisin-like protease                              47.8    2e-04   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease              47.8    2e-04   
ref|XP_009394691.1|  PREDICTED: subtilisin-like protease SBT5.3       47.8    2e-04   
ref|XP_002448316.1|  hypothetical protein SORBIDRAFT_06g025110        47.8    2e-04   
ref|XP_004141887.1|  PREDICTED: subtilisin-like protease-like         47.8    2e-04   
gb|KFK26784.1|  hypothetical protein AALP_AA8G293000                  47.8    2e-04   
ref|XP_004167070.1|  PREDICTED: subtilisin-like protease-like         47.8    2e-04   
ref|XP_010482516.1|  PREDICTED: subtilisin-like protease isoform X1   47.8    2e-04   
gb|ADE77855.1|  unknown                                               47.0    2e-04   
gb|ADE76648.1|  unknown                                               47.0    2e-04   
ref|XP_003516516.1|  PREDICTED: subtilisin-like protease-like         47.8    2e-04   
emb|CAN71376.1|  hypothetical protein VITISV_001491                   47.4    2e-04   
gb|EMS67510.1|  Subtilisin-like protease                              47.4    2e-04   
emb|CDY18651.1|  BnaA09g07440D                                        47.4    2e-04   
ref|XP_010919952.1|  PREDICTED: subtilisin-like protease SDD1         47.4    2e-04   
ref|XP_002278292.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
ref|XP_004244715.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
gb|EYU25847.1|  hypothetical protein MIMGU_mgv1a001711mg              47.4    2e-04   
ref|XP_010227516.1|  PREDICTED: subtilisin-like protease SBT5.3 i...  47.4    2e-04   
ref|XP_003560594.2|  PREDICTED: subtilisin-like protease SBT5.3 i...  47.4    2e-04   
ref|XP_006280041.1|  hypothetical protein CARUB_v10025918mg           47.4    2e-04   
ref|WP_033362075.1|  hypothetical protein                             47.4    2e-04   
emb|CDY63219.1|  BnaAnng18730D                                        47.4    2e-04   
emb|CDP05276.1|  unnamed protein product                              47.4    2e-04   
ref|XP_009789180.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
gb|AFW73750.1|  putative subtilase family protein                     47.4    2e-04   
ref|NP_001145849.1|  uncharacterized protein LOC100279360 precursor   47.4    2e-04   
ref|XP_008356216.1|  PREDICTED: subtilisin-like protease SDD1         47.4    2e-04   
gb|EFQ30434.1|  PA domain-containing protein                          47.4    2e-04   
ref|XP_010557668.1|  PREDICTED: subtilisin-like protease isoform X1   47.4    2e-04   
ref|XP_004501532.1|  PREDICTED: subtilisin-like protease-like         47.4    2e-04   
ref|WP_018347467.1|  hypothetical protein                             47.4    2e-04   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
emb|CAN62640.1|  hypothetical protein VITISV_010210                   47.0    2e-04   
ref|XP_002526537.1|  Cucumisin precursor, putative                    47.4    2e-04   
ref|NP_568765.1|  subtilase 1.3                                       47.4    2e-04   
emb|CBI22330.3|  unnamed protein product                              44.3    2e-04   
gb|EAY84890.1|  hypothetical protein OsI_06255                        47.4    2e-04   
ref|NP_001046210.1|  Os02g0198700                                     47.4    2e-04   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
ref|XP_011017137.1|  PREDICTED: subtilisin-like protease              47.4    2e-04   
ref|XP_003570964.1|  PREDICTED: subtilisin-like protease SBT5.3       47.4    2e-04   
ref|XP_002864127.1|  subtilase family protein                         47.0    2e-04   
ref|XP_007160895.1|  hypothetical protein PHAVU_001G026100g           47.0    2e-04   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  47.4    3e-04   
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_008450936.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_006401917.1|  hypothetical protein EUTSA_v10012740mg           47.0    3e-04   
ref|WP_033328142.1|  hypothetical protein                             47.0    3e-04   
gb|AIC80766.1|  subtilase                                             47.0    3e-04   
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like         47.0    3e-04   
ref|XP_002301847.2|  STOMATAL DENSITY AND DISTRIBUTION family pro...  47.0    3e-04   
ref|XP_002467295.1|  hypothetical protein SORBIDRAFT_01g023190        47.0    3e-04   
ref|XP_006849717.1|  hypothetical protein AMTR_s00024p00243520        47.0    3e-04   
ref|XP_004142884.1|  PREDICTED: subtilisin-like protease-like iso...  47.0    3e-04   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_006358904.1|  PREDICTED: subtilisin-like protease-like         47.0    3e-04   
ref|XP_004972123.1|  PREDICTED: subtilisin-like protease-like         47.0    3e-04   
ref|WP_036274520.1|  hypothetical protein                             47.0    3e-04   
ref|XP_009614060.1|  PREDICTED: subtilisin-like protease SDD1         47.0    3e-04   
ref|XP_010527146.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_011076276.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_007138654.1|  hypothetical protein PHAVU_009G226900g           47.0    3e-04   
ref|XP_006380386.1|  hypothetical protein POPTR_0007s04510g           47.0    3e-04   
ref|XP_006380387.1|  hypothetical protein POPTR_0007s04510g           47.0    3e-04   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
gb|ACN40199.1|  unknown                                               47.0    3e-04   
gb|EPS61757.1|  hypothetical protein M569_13035                       47.0    3e-04   
ref|XP_006374838.1|  hypothetical protein POPTR_0014s01910g           47.0    3e-04   
gb|KHG30296.1|  Subtilisin-like protease                              47.0    3e-04   
ref|XP_006662325.1|  PREDICTED: subtilisin-like protease-like         46.6    3e-04   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_010920351.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
ref|XP_004171629.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  47.0    3e-04   
gb|ACN85256.1|  subtilisin-like protease precursor                    47.0    3e-04   
ref|XP_004488082.1|  PREDICTED: subtilisin-like protease-like         47.0    3e-04   
ref|XP_008449184.1|  PREDICTED: uncharacterized protein LOC103491134  47.0    3e-04   
ref|XP_009391775.1|  PREDICTED: subtilisin-like protease              47.0    3e-04   
gb|ACL52505.1|  unknown                                               46.2    3e-04   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg          46.6    3e-04   
gb|KEH35793.1|  subtilisin-like serine protease                       46.6    3e-04   
ref|XP_002460418.1|  hypothetical protein SORBIDRAFT_02g027810        46.6    3e-04   
tpg|DAA50070.1|  TPA: putative subtilase family protein               46.6    4e-04   
gb|EMT15112.1|  hypothetical protein F775_52727                       46.6    4e-04   
ref|XP_010652423.1|  PREDICTED: subtilisin-like protease SDD1         46.6    4e-04   
ref|XP_004142885.1|  PREDICTED: subtilisin-like protease-like iso...  46.6    4e-04   
emb|CDP15554.1|  unnamed protein product                              46.6    4e-04   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease              46.6    4e-04   
emb|CBI38462.3|  unnamed protein product                              46.6    4e-04   
gb|AFS34694.1|  subtilisin-like serine protease                       46.6    4e-04   
ref|XP_004245672.2|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  46.6    4e-04   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg              46.6    4e-04   
dbj|BAJ96698.1|  predicted protein                                    46.6    4e-04   
emb|CDY22001.1|  BnaC09g01070D                                        46.6    4e-04   
ref|XP_009760953.1|  PREDICTED: subtilisin-like protease              46.6    4e-04   
dbj|BAJ86110.1|  predicted protein                                    46.6    4e-04   
gb|EAY78354.1|  hypothetical protein OsI_33442                        46.6    4e-04   
gb|EMS48667.1|  Subtilisin-like protease                              46.6    4e-04   
gb|KCW79387.1|  hypothetical protein EUGRSUZ_C00799                   46.6    4e-04   
ref|XP_009629568.1|  PREDICTED: subtilisin-like protease              46.6    4e-04   
dbj|BAJ88205.1|  predicted protein                                    46.6    4e-04   
ref|XP_004140477.1|  PREDICTED: subtilisin-like protease-like         46.6    4e-04   
gb|KHG16003.1|  Subtilisin-like protease                              46.6    4e-04   
ref|XP_007152373.1|  hypothetical protein PHAVU_004G124600g           46.6    4e-04   
ref|XP_008454764.1|  PREDICTED: subtilisin-like protease              46.2    4e-04   
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4       46.2    4e-04   
gb|EPS61652.1|  hypothetical protein M569_13143                       46.2    5e-04   
ref|XP_002886065.1|  predicted protein                                46.2    5e-04   
ref|WP_037363756.1|  hypothetical protein                             46.2    5e-04   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like         46.2    5e-04   
emb|CDX99895.1|  BnaC09g28100D                                        46.2    5e-04   
ref|XP_001777292.1|  predicted protein                                46.2    5e-04   
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like         46.2    5e-04   
ref|XP_011039978.1|  PREDICTED: subtilisin-like protease              46.2    5e-04   
emb|CBI37888.3|  unnamed protein product                              46.2    5e-04   
ref|XP_009790648.1|  PREDICTED: subtilisin-like protease SDD1 iso...  46.2    5e-04   
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease              46.2    5e-04   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like         46.2    5e-04   
ref|XP_009781097.1|  PREDICTED: subtilisin-like protease              46.2    5e-04   
ref|XP_003592386.1|  Subtilisin-like protease                         46.2    6e-04   
ref|XP_011028928.1|  PREDICTED: subtilisin-like protease              46.2    6e-04   
ref|XP_006857969.1|  hypothetical protein AMTR_s00069p00177600        46.2    6e-04   
gb|EYU25025.1|  hypothetical protein MIMGU_mgv1a001588mg              46.2    6e-04   
ref|XP_008792659.1|  PREDICTED: subtilisin-like protease              46.2    6e-04   
ref|XP_009381819.1|  PREDICTED: subtilisin-like protease              46.2    6e-04   
ref|XP_003562295.2|  PREDICTED: subtilisin-like protease              46.2    6e-04   
ref|NP_001145743.1|  uncharacterized protein LOC100279250 precursor   46.2    6e-04   
tpg|DAA50071.1|  TPA: putative subtilase family protein               46.2    6e-04   
ref|XP_009400347.1|  PREDICTED: subtilisin-like protease              46.2    6e-04   
ref|XP_006282063.1|  hypothetical protein CARUB_v10028308mg           46.2    6e-04   
ref|XP_006381615.1|  subtilase family protein                         46.2    6e-04   
gb|AES81608.2|  subtilisin-like serine protease                       46.2    6e-04   
ref|XP_004983113.1|  PREDICTED: subtilisin-like protease-like         45.8    6e-04   
emb|CCH72484.1|  Serine protease, subtilase family                    46.2    6e-04   
ref|XP_003625390.1|  Subtilisin-like protease                         45.8    6e-04   
ref|XP_010049348.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
gb|AES62637.2|  subtilisin-like serine protease                       45.8    6e-04   
ref|WP_036323927.1|  hypothetical protein                             46.2    6e-04   
ref|XP_010042589.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
ref|XP_010273846.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
gb|KCW81959.1|  hypothetical protein EUGRSUZ_C03325                   45.8    6e-04   
ref|XP_010685229.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
ref|WP_033365059.1|  hypothetical protein                             45.8    7e-04   
gb|KCW79385.1|  hypothetical protein EUGRSUZ_C00797                   45.8    7e-04   
ref|XP_006358405.1|  PREDICTED: subtilisin-like protease-like         45.8    7e-04   
ref|XP_010051409.1|  PREDICTED: subtilisin-like protease              45.8    7e-04   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like         45.8    7e-04   
gb|EQM85059.1|  hypothetical protein L687_11230                       45.8    7e-04   
ref|XP_003549134.1|  PREDICTED: subtilisin-like protease-like         45.8    7e-04   
ref|XP_009590434.1|  PREDICTED: subtilisin-like protease SDD1         45.8    7e-04   
emb|CBI30775.3|  unnamed protein product                              45.8    7e-04   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg           45.8    7e-04   
gb|EEC80955.1|  hypothetical protein OsI_23669                        45.8    7e-04   
gb|EPS74284.1|  hypothetical protein M569_00464                       45.8    7e-04   
ref|XP_010272631.1|  PREDICTED: subtilisin-like protease              45.8    7e-04   
gb|ACN85215.1|  subtilisin-like protease precursor                    45.8    7e-04   
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3       45.8    7e-04   
ref|XP_008382710.1|  PREDICTED: subtilisin-like protease SDD1         45.8    7e-04   
ref|XP_006452813.1|  hypothetical protein CICLE_v10007510mg           45.8    7e-04   
ref|XP_006358372.1|  PREDICTED: subtilisin-like protease-like         45.8    7e-04   
ref|XP_009401756.1|  PREDICTED: subtilisin-like protease              45.8    7e-04   
ref|WP_029266495.1|  hypothetical protein                             45.8    7e-04   
ref|XP_008439131.1|  PREDICTED: subtilisin-like protease              45.8    8e-04   
ref|XP_007162604.1|  hypothetical protein PHAVU_001G165300g           45.8    8e-04   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease              45.8    8e-04   
emb|CAN61728.1|  hypothetical protein VITISV_036029                   45.8    8e-04   
ref|XP_004507999.1|  PREDICTED: subtilisin-like protease-like         45.8    8e-04   
ref|XP_006474722.1|  PREDICTED: subtilisin-like protease-like iso...  45.8    8e-04   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3       45.8    8e-04   
ref|WP_031206714.1|  hypothetical protein                             45.8    8e-04   
ref|XP_010937330.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  45.4    8e-04   
gb|KDO73903.1|  hypothetical protein CISIN_1g004261mg                 45.4    8e-04   
emb|CDY67452.1|  BnaCnng55020D                                        45.4    8e-04   
ref|XP_003609994.1|  Subtilisin-like protease                         45.4    8e-04   
ref|WP_029258750.1|  hypothetical protein                             45.8    8e-04   
ref|XP_009359724.1|  PREDICTED: subtilisin-like protease              45.4    8e-04   
gb|AES92191.2|  subtilisin-like serine protease                       45.4    8e-04   
ref|XP_008337844.1|  PREDICTED: subtilisin-like protease              45.4    8e-04   
gb|EMT11726.1|  Subtilisin-like protease                              45.4    8e-04   
ref|XP_008650860.1|  PREDICTED: uncharacterized protein LOC100192...  45.4    8e-04   
emb|CBI38832.3|  unnamed protein product                              45.8    8e-04   
ref|WP_026172274.1|  hypothetical protein                             45.8    9e-04   
ref|XP_010911578.1|  PREDICTED: subtilisin-like protease              45.1    9e-04   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease              45.4    9e-04   
ref|WP_020388467.1|  hypothetical protein                             45.4    9e-04   
ref|XP_009790649.1|  PREDICTED: subtilisin-like protease SDD1 iso...  45.4    9e-04   
ref|WP_036303112.1|  MULTISPECIES: hypothetical protein               45.4    0.001   
gb|KDN67451.1|  putative PA domain-containing protein                 45.4    0.001   
ref|XP_003595292.1|  Subtilisin-like protease                         45.4    0.001   
ref|XP_004144036.1|  PREDICTED: subtilisin-like protease-like         45.4    0.001   
gb|KHN12283.1|  Subtilisin-like protease                              45.1    0.001   
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3       45.4    0.001   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g           45.4    0.001   
ref|XP_001757585.1|  predicted protein                                45.4    0.001   
ref|XP_002453487.1|  hypothetical protein SORBIDRAFT_04g006740        45.1    0.001   



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            YCY G+LD  KVAGKIV C+ GGN  VEKG AV++AGGVGMI A
Sbjct  384  YCYPGKLDPKKVAGKIVLCDRGGNARVEKGSAVKQAGGVGMILA  427



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            YCY G+LD  KVAGKIV C+ GGN  VEKG AV++AGGVGMI
Sbjct  384  YCYPGKLDHKKVAGKIVLCDRGGNARVEKGSAVKQAGGVGMI  425



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G L  +KV GKIVFC+ GGN  VEKGFAV+ AGG+GMI A +
Sbjct  381  YCYMGSLSPSKVQGKIVFCDRGGNARVEKGFAVKLAGGLGMILANT  426



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            YCYSG LD++KVAGKIV C+ GGN   EKG AV +AGG GMI A 
Sbjct  385  YCYSGSLDSSKVAGKIVICDRGGNARAEKGNAVHQAGGAGMILAN  429



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            YCY G+LD  KVAGKIV C+ GGN  VEKG AV+ AGGVGMI A
Sbjct  387  YCYPGKLDHKKVAGKIVLCDRGGNARVEKGSAVKLAGGVGMILA  430



>ref|XP_010322825.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=776

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            YCY G+LD  KVAGKIV C+ GGN  VEKG AV+ AGGVGMI A 
Sbjct  386  YCYPGKLDHKKVAGKIVLCDRGGNARVEKGSAVKLAGGVGMILAN  430



>ref|XP_003570496.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=785

 Score = 61.2 bits (147),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G LD +KVAGKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  395  YCYRGSLDESKVAGKIVICDRGGNARVEKGAAVKLAGGIGMILANT  440



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY   LD+TKVAGKIV C+ GGN  V KG AV+ AGGVGMI A +
Sbjct  446  YCYDDSLDSTKVAGKIVVCDRGGNARVAKGSAVKLAGGVGMILANT  491



>ref|XP_003627323.1| Cucumisin-like serine protease subtilisin-like protease [Medicago 
truncatula]
 gb|AET01799.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score = 60.5 bits (145),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G LD++KV GKIV C+ GGN  VEKG AV++AGG+GMI A +
Sbjct  398  YCYLGSLDSSKVQGKIVVCDRGGNARVEKGSAVKKAGGLGMIMANT  443



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY   LD+TKVAGKIV C+ GGN  V KG AV+ AGGVGMI A +
Sbjct  395  YCYDDSLDSTKVAGKIVVCDRGGNARVAKGSAVKLAGGVGMILANT  440



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCYSG LD++KVAGKIV C+ GGN  V KG AV+ AGG+GM+ A +
Sbjct  388  YCYSGSLDSSKVAGKIVVCDRGGNARVAKGGAVKSAGGLGMVLANT  433



>ref|XP_010232411.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=815

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/43 (67%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C +G+LD  KVAGKIV C PG NLD EKG AV++AGGVG I A
Sbjct  424  CMAGKLDPIKVAGKIVVCSPGVNLDTEKGAAVKQAGGVGAIIA  466



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            CY G+LD +KVAGKIV C+ GGN  VEKG AV++AGG GM+ A
Sbjct  384  CYPGKLDPSKVAGKIVLCDRGGNARVEKGSAVKQAGGAGMVLA  426



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score = 59.3 bits (142),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            YCY+G+LD  KVAGKIV C+ GGN  VEKG AV  AGG G+I A 
Sbjct  384  YCYTGQLDPAKVAGKIVICDRGGNARVEKGNAVHVAGGAGLIMAN  428



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+LD TKVAGKIV C+ GGN  VEKG A++ +GG GMI A +
Sbjct  391  CYPGKLDPTKVAGKIVVCDRGGNARVEKGSAIKISGGAGMIMANT  435



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCYSG LD++KVAG+IV C+ GGN  V KG AV+ AGG+GM+ A +
Sbjct  388  YCYSGSLDSSKVAGRIVVCDRGGNARVAKGGAVKSAGGLGMVLANT  433



>ref|XP_007135429.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
 gb|ESW07423.1| hypothetical protein PHAVU_010G128600g [Phaseolus vulgaris]
Length=778

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G L+A+KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  390  YCYLGSLEASKVQGKIVVCDRGGNARVEKGSAVKLAGGLGMIMANT  435



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            YCY G L+++KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +  
Sbjct  428  YCYMGSLESSKVQGKIVVCDRGGNARVEKGSAVKLAGGLGMIMANTEA  475



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            CY G+LD +KVAGKIV C+ GGN  VEKG AV+ AGG GM+ A 
Sbjct  388  CYPGKLDPSKVAGKIVLCDRGGNARVEKGSAVKLAGGAGMVLAN  431



>ref|XP_009610930.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=779

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/44 (64%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            CY G+LD +KVAGKIV C+ GGN  VEKG AV+ AGG GM+ A 
Sbjct  391  CYPGKLDPSKVAGKIVLCDRGGNARVEKGSAVKLAGGAGMVLAN  434



>ref|XP_004245414.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=768

 Score = 57.4 bits (137),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C+ G LD   V GK+V C+ GGN  VEKG AV+EA GVGMI A +
Sbjct  387  CFRGSLDPNIVGGKVVLCDRGGNARVEKGLAVKEANGVGMILANT  431



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +CY G L+ +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  390  FCYMGRLEPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  435



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +CY G L+ +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  390  FCYMGRLEPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  435



>dbj|BAJ93208.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  GELD  KVAGKIV CE GGN  V KG AV+EAGG+GMI A +
Sbjct  399  CGRGELDKDKVAGKIVLCERGGNARVAKGAAVQEAGGIGMILANT  443



>ref|XP_004510506.1| PREDICTED: subtilisin-like protease-like isoform X1 [Cicer arietinum]
 ref|XP_004510507.1| PREDICTED: subtilisin-like protease-like isoform X2 [Cicer arietinum]
Length=769

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            YC+ G LD++KV GKIV C+ G N  VEKG AV+ AGG+GMI A + G
Sbjct  384  YCFIGSLDSSKVQGKIVVCDRGVNARVEKGSAVKLAGGLGMIMANTEG  431



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G +  +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  387  YCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  432



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G +  +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  387  YCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  432



>dbj|BAJ87876.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=784

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/45 (67%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  GELD  KVAGKIV CE GGN  V KG AV+EAGG+GMI A +
Sbjct  399  CGRGELDKDKVAGKIVLCERGGNARVAKGAAVQEAGGIGMILANT  443



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G +  +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  385  YCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  430



>ref|XP_011035735.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G +  +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  387  YCYMGSISPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  432



>gb|EEC74109.1| hypothetical protein OsI_09160 [Oryza sativa Indica Group]
Length=733

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G+LDATKVAGKIV CE G  LD EKG AV +AGG G+I
Sbjct  382  CEIGKLDATKVAGKIVLCEAGQALDAEKGVAVAQAGGFGVI  422



>ref|XP_003547763.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            YCY G L+++KV GKIV C+ GGN  VEKG AV+  GG+GMI A +  
Sbjct  385  YCYIGSLESSKVQGKIVVCDRGGNARVEKGSAVKLTGGLGMIMANTEA  432



>gb|EEE57908.1| hypothetical protein OsJ_08597 [Oryza sativa Japonica Group]
Length=733

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G+LDATKVAGKIV CE G  LD EKG AV +AGG G+I
Sbjct  382  CEIGKLDATKVAGKIVLCEAGQVLDAEKGVAVAQAGGFGVI  422



>gb|KHN39620.1| Subtilisin-like protease, partial [Glycine soja]
Length=618

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G L+++KV GKIV C+ GGN  VEKG AV+  GG+GMI A +
Sbjct  230  YCYIGSLESSKVQGKIVVCDRGGNARVEKGSAVKLTGGLGMIMANT  275



>ref|XP_010942943.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=772

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            T C SG LD TKV GKIV C  G N  VEKG AVR+AGG+GMI A
Sbjct  404  TQCISGALDPTKVRGKIVICIRGTNDRVEKGEAVRQAGGIGMILA  448



>ref|XP_010688373.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=813

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            ++C +G L++  V GKIV C+ GGN  V+KG  VR+AGGVGMI A +  
Sbjct  432  SFCMTGSLNSEDVKGKIVVCDRGGNSRVQKGLVVRKAGGVGMILANTEA  480



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 34/45 (76%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CYSG+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  387  CYSGKLNSSLVEGKIVLCDRGGNARVEKGSAVKLAGGAGMILANT  431



>gb|KDO64998.1| hypothetical protein CISIN_1g045236mg, partial [Citrus sinensis]
Length=604

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +CY G L+ +KV GKIV C+ GGN  VEKG AV+ AGG+GMI A +
Sbjct  218  FCYMGRLEPSKVQGKIVVCDRGGNARVEKGAAVKLAGGLGMILANT  263



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV++AGG+GMI A +
Sbjct  392  CYPGKLNSSLVKGKIVLCDRGGNARVEKGSAVKQAGGLGMILANT  436



>ref|NP_001048300.2| Os02g0779000 [Oryza sativa Japonica Group]
 dbj|BAF10214.2| Os02g0779000 [Oryza sativa Japonica Group]
Length=742

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G+LDATKVAGKIV CE G  LD EKG AV +AGG G+I
Sbjct  370  CEIGKLDATKVAGKIVLCEAGQVLDAEKGVAVAQAGGFGVI  410



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G L  +KV GKIV C+ GGN  V KG AV+ AGG+GMI A +
Sbjct  425  YCYEGALQPSKVQGKIVVCDRGGNARVAKGGAVKLAGGLGMILANT  470



>ref|XP_002510119.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF52306.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=769

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            + C SG L  TKVAGKIV C+ GGN  V+KG  V+ AGG+GMI A + 
Sbjct  387  SLCMSGTLIPTKVAGKIVICDRGGNSRVQKGLEVKNAGGIGMILANTE  434



>ref|XP_007136744.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
 gb|ESW08738.1| hypothetical protein PHAVU_009G070500g [Phaseolus vulgaris]
Length=777

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G L A KVAGKIV C+ GGN  VEKG  V+ AGG GMI A S
Sbjct  396  SLCSKGSLIAAKVAGKIVICDRGGNARVEKGLVVKSAGGSGMILANS  442



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY G L  +KV GKIV C+ GGN  V KG AV+ AGG+GMI A +
Sbjct  387  YCYEGALQPSKVQGKIVVCDRGGNARVAKGGAVKLAGGLGMILANT  432



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+A+ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  387  CYPGKLNASLVEGKIVLCDRGGNARVEKGSAVKIAGGAGMILANT  431



>ref|XP_004305758.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=773

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CYSG L  +KV GKIV C+ GGN  V KG AV+ AGG+GMI A +
Sbjct  389  CYSGALQPSKVQGKIVVCDRGGNARVAKGSAVKLAGGIGMIMANT  433



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141   CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
             CY G+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  992   CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKIAGGAGMILANT  1036



>ref|XP_002460273.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
 gb|EER96794.1| hypothetical protein SORBIDRAFT_02g025810 [Sorghum bicolor]
Length=774

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA +V GK+V C+ GGN  VEKG  V++AGGVGM+ A +
Sbjct  397  CMEGTLDAAEVKGKVVLCDRGGNSRVEKGLIVKQAGGVGMVLANT  441



>ref|XP_010917483.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=778

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG LD+ KVAGKIV C+ G N  VEKG AV+ AGG GMI A +
Sbjct  394  CISGYLDSAKVAGKIVLCDRGANARVEKGSAVKLAGGAGMILANT  438



>ref|XP_003525925.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=769

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G L A KVAGKIV C+ GGN  VEKG  V+ AGG+GMI
Sbjct  391  CTRGSLIAKKVAGKIVICDRGGNARVEKGLVVKSAGGIGMI  431



>gb|EMT11314.1| hypothetical protein F775_42966 [Aegilops tauschii]
Length=516

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  GELD  KVAGKIV CE G N  VEKG AV +AGG+GMI A +
Sbjct  92   CLIGELDKDKVAGKIVLCERGVNARVEKGAAVGKAGGIGMILANT  136



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            CY G+L+A+ V GKIV C+ GGN  VEKG AV+ AGG GMI A
Sbjct  348  CYPGKLNASLVEGKIVLCDRGGNARVEKGSAVKIAGGAGMILA  390



>ref|XP_008792869.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=781

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G LD+ KVAGKIV C+ G N  VEKG AV+ AGG GMI A +
Sbjct  397  CITGYLDSAKVAGKIVLCDRGANARVEKGSAVKLAGGAGMILANT  441



>ref|XP_003523991.1| PREDICTED: subtilisin-like protease-like [Glycine max]
 gb|KHN04450.1| Subtilisin-like protease [Glycine soja]
Length=770

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G L A KVAGKIV C+ GGN  VEKG  V+ AGG+GMI
Sbjct  391  CTRGTLIAEKVAGKIVICDRGGNARVEKGLVVKSAGGIGMI  431



>ref|XP_004172226.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=404

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C+ G LD TK  GKI+ C  G N  VEKGF V +AGGVGMI
Sbjct  36   CHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMI  76



>ref|NP_001146035.1| uncharacterized protein LOC100279566 [Zea mays]
 gb|ACL53074.1| unknown [Zea mays]
Length=503

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C  GELD+ KVAGK+V C  G N  VEKG AV+ AGGVGMI A + 
Sbjct  118  CLMGELDSKKVAGKMVLCLRGNNARVEKGAAVKLAGGVGMILANTE  163



>emb|CDX97539.1| BnaA05g25400D [Brassica napus]
Length=481

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+A+ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  92   CYPGKLNASLVEGKIVLCDRGGNARVEKGSAVKIAGGAGMILANT  136



>ref|XP_002454656.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
 gb|EES07632.1| hypothetical protein SORBIDRAFT_04g034980 [Sorghum bicolor]
Length=787

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C  GELD  KVAGKIV C  G N  VEKG AV+ AGGVGMI A + 
Sbjct  402  CLIGELDPKKVAGKIVLCLRGNNARVEKGAAVKLAGGVGMILANTE  447



>gb|AGN03879.1| senescence-associated subtilisin protease [Triticum aestivum]
Length=786

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  GELD  KVAGKIV CE G N  VEKG AV +AGG+GMI A +
Sbjct  401  CLIGELDKDKVAGKIVLCERGVNARVEKGAAVGKAGGIGMILANT  445



>dbj|BAD81785.1| P69E protein-like [Oryza sativa Japonica Group]
 dbj|BAD82227.1| P69E protein-like [Oryza sativa Japonica Group]
Length=980

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C+ G LD+ KV GKIV C  G N  VEKG  V++AGGVGM+
Sbjct  594  TLCFPGSLDSDKVRGKIVVCTRGVNARVEKGLVVKQAGGVGMV  636



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  389  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKLAGGAGMILANT  433



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  389  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKLAGGAGMILANT  433



>gb|AFW73751.1| putative subtilase family protein [Zea mays]
Length=783

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C  GELD+ KVAGK+V C  G N  VEKG AV+ AGGVGMI A + 
Sbjct  398  CLMGELDSKKVAGKMVLCLRGNNARVEKGAAVKLAGGVGMILANTE  443



>gb|EEC71345.1| hypothetical protein OsI_03414 [Oryza sativa Indica Group]
Length=744

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C+ G LD+ KV GKIV C  G N  VEKG  V++AGGVGM+
Sbjct  358  TLCFPGSLDSDKVRGKIVVCTRGVNARVEKGLVVKQAGGVGMV  400



>ref|NP_001043993.2| Os01g0702300 [Oryza sativa Japonica Group]
 dbj|BAF05907.2| Os01g0702300 [Oryza sativa Japonica Group]
Length=741

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C+ G LD+ KV GKIV C  G N  VEKG  V++AGGVGM+
Sbjct  355  TLCFPGSLDSDKVRGKIVVCTRGVNARVEKGLVVKQAGGVGMV  397



>ref|XP_006857985.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
 gb|ERN19452.1| hypothetical protein AMTR_s00069p00181050 [Amborella trichopoda]
Length=786

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C +G LD+ KVAGKIV C+ G +  VEKG  V+EAGG+GMI A +
Sbjct  409  SLCLTGTLDSRKVAGKIVICDRGISPRVEKGQVVKEAGGMGMILANT  455



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  387  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKIAGGAGMILANT  431



>gb|EAZ13237.1| hypothetical protein OsJ_03159 [Oryza sativa Japonica Group]
Length=735

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C+ G LD+ KV GKIV C  G N  VEKG  V++AGGVGM+
Sbjct  349  TLCFPGSLDSDKVRGKIVVCTRGVNARVEKGLVVKQAGGVGMV  391



>emb|CBI35855.3| unnamed protein product [Vitis vinifera]
Length=1791

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  144   YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
             +C++G+L+ ++V+GKIV C+ GGN  VEKG AV+ A G GMI A +
Sbjct  1414  FCFTGKLNPSQVSGKIVICDRGGNARVEKGTAVKMALGAGMILANT  1459


 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C +G+L+ + V+GKIV C+ GG   VEKG AV+ AGG GMI A ++
Sbjct  805  CVAGKLNPSLVSGKIVVCDRGGGKRVEKGRAVKLAGGAGMILANTK  850



>gb|EMS68171.1| Subtilisin-like protease [Triticum urartu]
Length=419

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG LDA+ V GK+V C+ GGN  VEKG  V+ AGGVGM+ A +
Sbjct  116  CMSGTLDASAVKGKVVLCDRGGNSRVEKGQVVKLAGGVGMVLANT  160



>dbj|BAD36156.1| putative serine protease [Oryza sativa Japonica Group]
 gb|EAZ09256.1| hypothetical protein OsI_31529 [Oryza sativa Indica Group]
 gb|EAZ44882.1| hypothetical protein OsJ_29522 [Oryza sativa Japonica Group]
Length=770

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA  V GK+V C+ GGN  VEKG  V++AGGVGM+ A +
Sbjct  392  CMEGTLDAAAVKGKVVLCDRGGNSRVEKGLVVKQAGGVGMVLANT  436



>ref|XP_006356658.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=768

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C+ G LD   V GK+V C+ GGN  V KG  V+EA GVGMI A +
Sbjct  385  SLCFRGSLDPNIVGGKVVLCDRGGNDRVAKGLVVKEANGVGMILANT  431



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  389  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKIAGGAGMILANT  433



>gb|KHN07895.1| Subtilisin-like protease [Glycine soja]
Length=519

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G L A KVAGKIV C+ GGN  VEKG  V+ AGG+GMI
Sbjct  145  CTRGSLIAKKVAGKIVICDRGGNARVEKGLVVKSAGGIGMI  185



>dbj|BAH20348.1| AT3G14067 [Arabidopsis thaliana]
Length=601

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+ AGG GMI A +
Sbjct  213  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKLAGGAGMILANT  257



>gb|ADW11233.1| subtilisin-like protease 2 [Phaseolus vulgaris]
Length=810

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 2/48 (4%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVR--EAGGVGMIGAGS  7
            YCY G L+A+KV GKIV C+ GGN  VEKG AV+   AGG+G+I A +
Sbjct  420  YCYLGSLEASKVQGKIVVCDRGGNARVEKGSAVKLAGAGGLGVIMANT  467



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C++G+L+ ++V+GKIV C+ GGN  VEKG AV+ A G GMI A +
Sbjct  383  FCFTGKLNPSQVSGKIVICDRGGNARVEKGTAVKMALGAGMILANT  428



>gb|KHN45156.1| Subtilisin-like protease [Glycine soja]
Length=722

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G L A KVAGKIV C+ GGN  VEKG  V+ AGG+GMI
Sbjct  344  CTRGSLIAKKVAGKIVICDRGGNARVEKGLVVKSAGGIGMI  384



>ref|XP_010942942.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=771

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/45 (62%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            T C SG LD  KV GKIV C  G N  VEKG  VR+AGG GMI A
Sbjct  403  TQCISGALDPAKVTGKIVICIRGTNSRVEKGETVRQAGGTGMILA  447



>ref|XP_009391730.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
 ref|XP_009391731.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=770

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C  G LD  +V GK+VFC+ G N  VEKG  V+EAGGVGMI A +
Sbjct  394  FCMPGTLDPEQVKGKVVFCDRGINARVEKGQVVKEAGGVGMILANA  439



>ref|XP_006857642.1| hypothetical protein AMTR_s00061p00139460 [Amborella trichopoda]
 gb|ERN19109.1| hypothetical protein AMTR_s00061p00139460 [Amborella trichopoda]
Length=128

 Score = 49.3 bits (116),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD TK  GKIV C  G N  VEKG AV++AGGVGMI
Sbjct  8    CLIGSLDPTKTKGKIVACLRGDNARVEKGEAVKQAGGVGMI  48



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score = 52.4 bits (124),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YCY+G L  +KV GKIV C+ GGN  V KG AV+ AGG+G I A +
Sbjct  387  YCYAGALKPSKVQGKIVVCDRGGNARVGKGSAVKLAGGLGFILANT  432



>gb|KDO81559.1| hypothetical protein CISIN_1g0053341mg, partial [Citrus sinensis]
Length=577

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C +G L   KVAGKIV C+ GGN  VEKG  V++AGGVGMI
Sbjct  197  CMTGSLIPAKVAGKIVVCDRGGNSRVEKGVEVKDAGGVGMI  237



>dbj|BAJ99493.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=764

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KGF VR+AGG GM+ A +
Sbjct  390  CMTGTLIPAKVAGKIVLCDRGTNARVQKGFVVRDAGGAGMVLANT  434



>ref|NP_001063283.2| Os09g0441000 [Oryza sativa Japonica Group]
 dbj|BAF25197.2| Os09g0441000 [Oryza sativa Japonica Group]
Length=562

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA  V GK+V C+ GGN  VEKG  V++AGGVGM+ A +
Sbjct  392  CMEGTLDAAAVKGKVVLCDRGGNSRVEKGLVVKQAGGVGMVLANT  436



>gb|EMT17595.1| Subtilisin-like protease [Aegilops tauschii]
Length=490

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KGF VR+AGG GM+ A +
Sbjct  146  CMTGTLIPAKVAGKIVLCDRGTNARVQKGFVVRDAGGAGMVLANT  190



>ref|XP_009782030.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=764

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G LD   V GKIV C+ G N  VEKG  V+EAGGVGMI A +
Sbjct  386  SLCLPGSLDPKMVRGKIVLCDRGTNARVEKGLVVKEAGGVGMILANT  432



>emb|CAN75240.1| hypothetical protein VITISV_014207 [Vitis vinifera]
Length=579

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C++G+L+ ++V+GKIV C+ GGN  VEKG AV+ A G GMI A +
Sbjct  191  FCFTGKLNPSQVSGKIVICDRGGNARVEKGTAVKMALGAGMILANT  236



>gb|ACB87529.1| subtilisin protease [Triticum aestivum]
Length=571

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C  GELD  KVAGK+V CE G N  VEKG AV +AGG+GMI A + 
Sbjct  186  CLIGELDKDKVAGKMVLCERGVNARVEKGAAVGKAGGIGMILANTE  231



>ref|XP_007156742.1| hypothetical protein PHAVU_002G013500g [Phaseolus vulgaris]
 gb|ESW28736.1| hypothetical protein PHAVU_002G013500g [Phaseolus vulgaris]
Length=728

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C +G LD  KV GKIVFC+ G    VEKG  V+ AGGVGM+ A  +
Sbjct  391  CLTGSLDPEKVKGKIVFCDRGNISRVEKGLVVKSAGGVGMVLANGK  436



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/44 (57%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            YC+ G+L   KV G IV C+ GGN  VEKG AV+ AGG GM+ A
Sbjct  437  YCHEGKLIPKKVEGTIVVCDRGGNARVEKGSAVKHAGGFGMVLA  480



>gb|KGN55992.1| hypothetical protein Csa_3G045060 [Cucumis sativus]
Length=746

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C+ G LD TK  GKI+ C  G N  VEKGF V +AGGVGMI
Sbjct  378  CHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMI  418



>ref|XP_004148290.1| PREDICTED: uncharacterized protein LOC101212014 [Cucumis sativus]
Length=1696

 Score = 52.4 bits (124),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C+ G LD TK  GKI+ C  G N  VEKGF V +AGGVGMI
Sbjct  465  CHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMI  505



>gb|EMS57180.1| Subtilisin-like protease [Triticum urartu]
Length=612

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KGF VR+AGG GM+ A +
Sbjct  351  CMTGTLIPAKVAGKIVLCDRGTNARVQKGFVVRDAGGAGMVLANT  395



>ref|XP_009596091.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=764

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G LD   V GKIV C+ G N  VEKG  V+EAGGVGMI A +
Sbjct  386  SLCLPGSLDPKIVRGKIVLCDRGTNARVEKGLVVKEAGGVGMILANT  432



>ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            +C  G L+ +K+ GKIV+C  G N DVEK + V +AGGVGMI
Sbjct  398  FCTPGSLEPSKIKGKIVYCVSGFNQDVEKSWVVAQAGGVGMI  439



>ref|XP_006472275.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=766

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C +G L   KVAGKIV C+ GGN  VEKG  V++AGGVGMI
Sbjct  386  CMTGSLIPAKVAGKIVVCDRGGNSRVEKGVEVKDAGGVGMI  426



>ref|XP_010238218.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=805

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA  V GK+V C+ GGN  VEKG  V++AGGVGM+ A +
Sbjct  420  CMPGSLDAAAVKGKVVLCDRGGNSRVEKGQVVKQAGGVGMVLANT  464



>ref|XP_006433609.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
 gb|ESR46849.1| hypothetical protein CICLE_v10000363mg [Citrus clementina]
Length=766

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C +G L   KVAGKIV C+ GGN  VEKG  V++AGGVGMI
Sbjct  386  CMTGSLIPAKVAGKIVVCDRGGNSRVEKGVEVKDAGGVGMI  426



>ref|XP_010059854.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW66296.1| hypothetical protein EUGRSUZ_F00121 [Eucalyptus grandis]
Length=765

 Score = 52.0 bits (123),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C++G L A+KVAGKIV C+ GGN   +K   V+ AGGVGMI
Sbjct  385  CFTGSLVASKVAGKIVICDRGGNSRAQKSMVVKNAGGVGMI  425



>ref|XP_004954115.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=783

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  GELD  KVAGKIV CE G    VEKG AV+ AGG GMI A +
Sbjct  398  CLLGELDPKKVAGKIVLCERGKTARVEKGAAVKLAGGAGMILANT  442



>ref|XP_006661279.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=635

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA  V GK+V C+ GGN  VEKG  V++AGGVGM+ A +
Sbjct  257  CMEGTLDAAAVKGKVVLCDRGGNSRVEKGLVVKQAGGVGMVLANT  301



>ref|XP_006651839.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=716

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  342  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  386



>ref|XP_003589103.1| Subtilisin-like protease [Medicago truncatula]
Length=858

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C    L ++KV GKIV CE GGN  VEKG  V+ AGGVGMI
Sbjct  382  CIPDSLTSSKVLGKIVICERGGNSRVEKGLVVKNAGGVGMI  422



>gb|ACN27570.1| unknown [Zea mays]
Length=522

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  146  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  190



>ref|NP_001051353.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|AAK63927.1|AC084282_8 putative serine protease [Oryza sativa Japonica Group]
 gb|ABF99010.1| cucumisin-like serine protease, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13267.1| Os03g0761500 [Oryza sativa Japonica Group]
 gb|EAZ28668.1| hypothetical protein OsJ_12679 [Oryza sativa Japonica Group]
 dbj|BAG95169.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95978.1| unnamed protein product [Oryza sativa Japonica Group]
Length=764

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  390  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  434



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+  GG GMI A +
Sbjct  387  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKIGGGAGMILANT  431



>ref|XP_004169297.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
Length=833

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C+ G LD TK  GKI+ C  G N  VEKGF V +AGGVGMI
Sbjct  465  CHKGSLDPTKAKGKIIVCLRGENARVEKGFVVLQAGGVGMI  505



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            CY G+L+++ V GKIV C+ GGN  VEKG AV+  GG GMI A +
Sbjct  387  CYPGKLNSSLVEGKIVLCDRGGNARVEKGSAVKIGGGAGMILANT  431



>ref|XP_006396129.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
 gb|ESQ36908.1| hypothetical protein EUTSA_v10002410mg [Eutrema salsugineum]
Length=762

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD T V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  388  CLPGSLDPTTVRGKIVVCDRGVNARVEKGAVVRDAGGLGMIMANT  432



>ref|XP_002463844.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 ref|XP_002464198.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
 gb|EER90842.1| hypothetical protein SORBIDRAFT_01g007310 [Sorghum bicolor]
 gb|EER91196.1| hypothetical protein SORBIDRAFT_01g013970 [Sorghum bicolor]
Length=764

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  389  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  433



>gb|ACN34516.1| unknown [Zea mays]
Length=384

 Score = 50.8 bits (120),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -1

Query  132  GELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            GELD+ KVAGK+V C  G N  VEKG AV+ AGGVGMI A +
Sbjct  2    GELDSKKVAGKMVLCLRGNNARVEKGAAVKLAGGVGMILANT  43



>ref|NP_001151463.1| LOC100285096 precursor [Zea mays]
 gb|ACG42951.1| subtilisin-like protease precursor [Zea mays]
Length=764

 Score = 51.6 bits (122),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  389  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  433



>gb|EAY87746.1| hypothetical protein OsI_09161 [Oryza sativa Indica Group]
Length=536

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  GELD  KV+GKIV CE G N  V KG AV+ AGG GMI
Sbjct  151  CIIGELDPAKVSGKIVLCERGSNARVAKGGAVKVAGGAGMI  191



>ref|XP_008792868.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=766

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C  G L+  +V GK+VFC+ G N  VEKG  V+EAGGVGMI A +
Sbjct  391  FCLPGSLNPAEVKGKVVFCDRGINARVEKGEVVKEAGGVGMILANA  436



>tpg|DAA51518.1| TPA: putative subtilase family protein [Zea mays]
Length=765

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  389  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  433



>gb|KDP35557.1| hypothetical protein JCGZ_08995 [Jatropha curcas]
Length=786

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 4/48 (8%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFC----EPGGNLDVEKGFAVREAGGVGMIGA  13
            +C  G LD TK+ GKIV+C    +P    DVEKG+ V +AGGVGMI A
Sbjct  406  FCSPGSLDPTKIKGKIVYCLRNLDPEVEPDVEKGWVVAQAGGVGMILA  453



>ref|XP_010917484.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=767

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD  +V GK+VFC+ G N  VEKG  V+EAGGVGMI A +
Sbjct  392  CLPGTLDPAEVKGKVVFCDRGINARVEKGEVVKEAGGVGMILANA  436



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            YCYSG L    VAGKIV C+ GGN  V KG +V  AGGVG+I A 
Sbjct  362  YCYSGRLSPALVAGKIVICDRGGNARVAKGNSVHLAGGVGVILAN  406



>ref|XP_010277120.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=768

 Score = 51.2 bits (121),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L   KVAGKIV C+ G N  V+KGF V++AGGVGMI A +
Sbjct  389  CMVGTLIPEKVAGKIVLCDRGINARVQKGFVVKQAGGVGMILANT  433



>ref|XP_002456214.1| hypothetical protein SORBIDRAFT_03g032240 [Sorghum bicolor]
 gb|EES01334.1| hypothetical protein SORBIDRAFT_03g032240 [Sorghum bicolor]
Length=675

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD  KV GKIV C  G N  VEKGF V++AGGVGM+
Sbjct  260  SLCLPGSLDPDKVKGKIVVCVRGVNARVEKGFVVKQAGGVGMV  302



>ref|XP_010693651.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=782

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/49 (53%), Positives = 31/49 (63%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            + C  G LD  KV GKIV C+ G N  V+KG  V+EAGGVGMI A +  
Sbjct  405  SLCLEGTLDRRKVQGKIVICDRGINPRVQKGQVVKEAGGVGMILANTEA  453



>gb|ABD33266.1| Protease-associated PA; Proteinase inhibitor I9, subtilisin propeptide 
[Medicago truncatula]
Length=765

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C    L ++KV GKIV CE GGN  VEKG  V+ AGGVGMI
Sbjct  382  CIPDSLTSSKVLGKIVICERGGNSRVEKGLVVKNAGGVGMI  422



>dbj|BAJ98937.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=399

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KGF VR+AGG GM+ A +
Sbjct  25   CMTGTLIPAKVAGKIVLCDRGTNARVQKGFVVRDAGGAGMVLANT  69



>ref|XP_006358407.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=743

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            YC  G L+  K+ GKIV C+ G   +VEKG AV++AGGVGMI
Sbjct  372  YCEPGTLNDPKIKGKIVVCKLGNAGNVEKGQAVKDAGGVGMI  413



>gb|EPS65938.1| hypothetical protein M569_08836, partial [Genlisea aurea]
Length=738

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG LD   V GK+V C+ G +  VEKG  VREAGGVGMI A +
Sbjct  362  CLSGSLDPAAVRGKVVLCDRGVSARVEKGAVVREAGGVGMILANT  406



>ref|XP_004956934.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=773

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA +V GK+V C+ G N  VEKG  V++AGGVGM+ A +
Sbjct  396  CMEGTLDAAEVKGKVVLCDRGANSRVEKGQVVKQAGGVGMVLANT  440



>ref|XP_009403290.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=773

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 28/43 (65%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C  G LDA  VAGKIV CE G N  VEKG AV+ AGG GMI A
Sbjct  389  CIPGFLDAAVVAGKIVLCERGTNARVEKGSAVKLAGGAGMILA  431



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G+LD +K AGK+V C+ G    V KG AV++AGGVGMI A +
Sbjct  413  CKAGDLDTSKAAGKMVICDRGDTARVAKGDAVKQAGGVGMILANT  457



>emb|CDY18654.1| BnaA09g07410D [Brassica napus]
Length=745

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C+ G L   KV GKIV CE G N+ VEKG  V+ AGG+GMI A +
Sbjct  373  FCFPGTLIPEKVKGKIVMCEKGVNVRVEKGEVVKAAGGLGMILANT  418



>ref|XP_003559080.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=766

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  388  CMTGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  432



>gb|EMT15470.1| Subtilisin-like protease [Aegilops tauschii]
Length=742

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C+ G LD  KV GKIV C  G N  VEKG  V++AGG+GM+
Sbjct  356  TLCFPGSLDPAKVRGKIVVCTRGVNGRVEKGLVVKQAGGIGMV  398



>ref|XP_003636375.1| Subtilisin-like protease [Medicago truncatula]
Length=742

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C SG LD  KV+GKIVFC+ GG+    KG  V+ AGG+GM+ A
Sbjct  386  CISGSLDPKKVSGKIVFCDGGGSSRTGKGNTVKSAGGLGMVLA  428



>ref|XP_006857645.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
 gb|ERN19112.1| hypothetical protein AMTR_s00061p00140690 [Amborella trichopoda]
Length=774

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C  G LD TK  GKIV C  G N  VEKG AV+ AGGVGMI
Sbjct  406  TNCLLGSLDPTKAKGKIVACLRGDNARVEKGEAVKLAGGVGMI  448



>ref|XP_003605881.1| Subtilisin-like protease [Medicago truncatula]
 gb|KEH17073.1| subtilisin-like serine protease [Medicago truncatula]
Length=760

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C SG LD  KV+GKIVFC+ GG+    KG  V+ AGG+GM+ A
Sbjct  386  CISGSLDPKKVSGKIVFCDGGGSSRTGKGNTVKSAGGLGMVLA  428



>ref|XP_010906269.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=764

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L   KVAGKIV C+ G N  V+KG+ VREAGG GM+ A +
Sbjct  383  CIPGTLIPEKVAGKIVLCDRGINWRVQKGYVVREAGGAGMVLANA  427



>emb|CDP03080.1| unnamed protein product [Coffea canephora]
Length=646

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C  G LD ++V GK+V C+ G N  VEKG  VR+AGG+GMI A +  
Sbjct  357  CMPGSLDPSQVTGKVVLCDRGVNARVEKGGVVRDAGGIGMILANTEA  403



>ref|XP_008810184.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=775

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            T C  G L+  KV GK+V C  G N  VEKG AVR+AGGVGMI A
Sbjct  402  TQCLLGSLEPAKVRGKVVVCLRGNNGRVEKGEAVRQAGGVGMILA  446



>dbj|BAJ93872.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=780

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C +G+L+ T VAGKIV C+PG N   EKGFAV+ AGG G +
Sbjct  398  CEAGKLNPTMVAGKIVLCDPGVNGRTEKGFAVKLAGGAGAV  438



>ref|XP_010519206.1| PREDICTED: subtilisin-like protease isoform X1 [Tarenaya hassleriana]
 ref|XP_010519207.1| PREDICTED: subtilisin-like protease isoform X2 [Tarenaya hassleriana]
Length=775

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            ++C  G LD   VAGKIV C+ G    V+KG  VREAGG+GMI
Sbjct  398  SFCLDGALDRRHVAGKIVICDRGVTPRVQKGQVVREAGGIGMI  440



>ref|XP_006342387.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G L+   V GKIV C+ G N  VEKG  V+EAGGVGMI A +
Sbjct  389  SLCLPGSLNPKDVRGKIVVCDRGTNARVEKGLVVKEAGGVGMILANT  435



>ref|XP_010412797.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=754

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD+T V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  380  CLPGSLDSTLVRGKIVVCDRGVNARVEKGAMVRDAGGLGMIMANT  424



>gb|EMT22975.1| Subtilisin-like protease [Aegilops tauschii]
Length=432

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGM  22
            C SG LDA  V GK+V C+ GGN  VEKG  V+ AGGVGM
Sbjct  116  CMSGTLDAAAVKGKVVLCDRGGNSRVEKGQVVKLAGGVGM  155



>ref|XP_004243704.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=762

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G L+   V GKIV C+ G N  VEKG  V+EAGGVGMI A +
Sbjct  384  SLCLPGSLNPKDVRGKIVVCDRGTNARVEKGLVVKEAGGVGMILANT  430



>gb|AES59354.2| subtilisin-like serine protease [Medicago truncatula]
Length=728

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C    L ++KV GKIV CE GGN  VEKG  V+ AGGVGMI
Sbjct  345  CIPDSLTSSKVLGKIVICERGGNSRVEKGLVVKNAGGVGMI  385



>dbj|GAD34309.1| subtilisin-like serine protease [Microbacterium sp. TS-1]
Length=1203

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD  KV GKIV C+ G N  VEK  AV EAGG+GMI
Sbjct  465  CLLGSLDPAKVTGKIVVCDRGSNARVEKSQAVEEAGGIGMI  505



>ref|WP_036304711.1| hypothetical protein [Microbacterium sp. TS-1]
Length=1213

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD  KV GKIV C+ G N  VEK  AV EAGG+GMI
Sbjct  475  CLLGSLDPAKVTGKIVVCDRGSNARVEKSQAVEEAGGIGMI  515



>ref|NP_001048301.1| Os02g0779200 [Oryza sativa Japonica Group]
 dbj|BAD19517.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF10215.1| Os02g0779200 [Oryza sativa Japonica Group]
 gb|EAZ24820.1| hypothetical protein OsJ_08598 [Oryza sativa Japonica Group]
Length=782

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  GELD  KV+GKIV CE G N  V KG AV+ AGG GMI
Sbjct  397  CIIGELDPAKVSGKIVLCERGSNARVAKGGAVKVAGGAGMI  437



>dbj|BAJ89916.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=772

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG LDA  V GK+V C+ GGN  VEKG  V+ AGGVGM+ A +
Sbjct  393  CMSGTLDAGAVKGKVVLCDRGGNSRVEKGQVVKLAGGVGMVLANT  437



>ref|XP_004981675.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=760

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++ GG GMI A +
Sbjct  386  CMSGSLIPEKVAGKIVLCDRGTNARVQKGFIVKDVGGAGMILANT  430



>ref|XP_006358406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=742

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            YC  G L+  K+ GKIV C+ G    VEKG AV++AGGVGMI
Sbjct  371  YCKPGTLNDPKIKGKIVMCKLGNVAPVEKGQAVKDAGGVGMI  412



>emb|CBI38463.3| unnamed protein product [Vitis vinifera]
Length=846

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C+ G LD  KV GKIV+C  G N  VEK + V +AGG+GMI A
Sbjct  471  CFVGSLDPEKVKGKIVYCLVGLNAIVEKSWVVAQAGGIGMIIA  513



>ref|XP_010488783.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=755

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD+T V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  381  CLPGSLDSTLVRGKIVVCDRGVNARVEKGAMVRDAGGLGMIIANT  425



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 33/46 (72%), Gaps = 1/46 (2%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEP-GGNLDVEKGFAVREAGGVGMIGA  13
            +YCY G LD++KV GKIV C+  GGN  + KG AV+ AGG GMI A
Sbjct  387  SYCYEGRLDSSKVKGKIVICDRGGGNARMAKGTAVKLAGGGGMILA  432



>ref|XP_010465286.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=789

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +GEL+++ V GKIV C+ GG+  VEKG AV+ AGG GMI A +
Sbjct  399  CTTGELNSSLVQGKIVLCDRGGSARVEKGRAVKLAGGAGMILANT  443



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +GEL+++ V GKIV C+ GG+  VEKG AV+ AGG GMI A +
Sbjct  397  CTTGELNSSLVQGKIVLCDRGGSARVEKGRAVKLAGGAGMILANT  441



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +GEL+++ V GKIV C+ GG+  VEKG AV+ AGG GMI A +
Sbjct  398  CTTGELNSSLVQGKIVLCDRGGSARVEKGRAVKLAGGAGMILANT  442



>emb|CDO99977.1| unnamed protein product [Coffea canephora]
Length=733

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPG-GNLDVEKGFAVREAGGVGMI  19
            YC+S  L+++KV GKIV C+ G G  DV+KG  V+ AGGVGMI
Sbjct  391  YCFSSALNSSKVQGKIVVCDYGVGISDVQKGENVKAAGGVGMI  433



>ref|XP_010248001.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=782

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD   VAGKIV C+ G N  VEKG  V+ AGGVGMI
Sbjct  407  CLEGTLDPRTVAGKIVICDRGVNPRVEKGQVVKSAGGVGMI  447



>ref|XP_006857622.1| hypothetical protein AMTR_s00061p00122710 [Amborella trichopoda]
 gb|ERN19089.1| hypothetical protein AMTR_s00061p00122710 [Amborella trichopoda]
Length=775

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD TK  GKIV C  G N  VEKG AV++AGGVGMI
Sbjct  409  CLIGSLDPTKTKGKIVACLRGVNDRVEKGEAVKQAGGVGMI  449



>ref|XP_006377331.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
 gb|ERP55128.1| hypothetical protein POPTR_0011s04970g [Populus trichocarpa]
Length=746

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            CY   LD TKV GKIV+C  G   DVEK   V +AGGVGMI A
Sbjct  375  CYPESLDPTKVRGKIVYCLRGMIPDVEKSLVVAQAGGVGMILA  417



>ref|XP_009767539.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=761

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 28/45 (62%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD   V GK+V C+ G N  VEKG  V+EA G+GMI A +
Sbjct  384  CLRGSLDPNVVRGKVVLCDRGANDRVEKGLVVKEANGIGMILANT  428



>ref|WP_036325485.1| hypothetical protein [Microbacterium sp. B19]
Length=1213

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LDA K AGKIV C+ G N  +EK  AV+EAGGVGMI
Sbjct  480  CLLGSLDAAKAAGKIVVCDRGQNARIEKSQAVKEAGGVGMI  520



>ref|XP_009112378.1| PREDICTED: subtilisin-like protease, partial [Brassica rapa]
Length=619

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C+ G L   KV GKIV CE G N+ VEKG  V+ AGG+GMI A +
Sbjct  247  FCFPGTLIPEKVKGKIVMCEKGVNVRVEKGEVVKAAGGLGMILANT  292



>ref|XP_010467108.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=756

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD+T V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  382  CLPGSLDSTLVRGKIVVCDRGVNARVEKGAMVRDAGGLGMIIANT  426



>emb|CBI38461.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C  G LD  KV GKIV+C  G N  VEK + V +AGGVGMI A
Sbjct  52   CSVGSLDPKKVKGKIVYCLVGLNAIVEKSWVVAQAGGVGMILA  94



>gb|ABZ89187.1| putative protein [Coffea canephora]
Length=763

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPG-GNLDVEKGFAVREAGGVGMI  19
            YC+S  L+++KV GKIV C+ G G  DV+KG  V+ AGGVGMI
Sbjct  391  YCFSSALNSSKVQGKIVVCDYGVGISDVQKGENVKAAGGVGMI  433



>ref|XP_003570962.1| PREDICTED: subtilisin-like protease SBT5.3 [Brachypodium distachyon]
Length=783

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            T C+ G LD  KV GKIV C  G N  +EKG  V+EAGGVGM+
Sbjct  386  TLCFPGSLDQAKVKGKIVVCTRGVNGRMEKGQVVKEAGGVGMV  428



>ref|XP_010541995.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=765

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/45 (58%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD T V GKIV C+ G N  VEKG  VR+AGG GMI A +
Sbjct  392  CLPGSLDPTLVRGKIVVCDRGLNARVEKGAVVRDAGGAGMILANT  436



>ref|XP_004954112.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=780

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 26/45 (58%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G+L+A+ VAGKIV C+PG N  VEKG  VR AGG G I  G+
Sbjct  394  CEAGKLNASLVAGKIVVCDPGVNGRVEKGEVVRLAGGAGAILVGN  438



>gb|KDP41644.1| hypothetical protein JCGZ_16051 [Jatropha curcas]
Length=747

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C S  L   +VAGKIV C+ GGN  V+KG  V+ AGGVGMI A +
Sbjct  365  SLCMSDSLIPAQVAGKIVICDRGGNSRVQKGLEVKNAGGVGMILANT  411



>gb|AGT17100.1| serine protease [Saccharum hybrid cultivar R570]
Length=750

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LDA +V GK+V C+ G N  VEKG  V++AGGVGM+ A +
Sbjct  367  CLEGTLDAAEVKGKVVLCDRGSNSRVEKGQIVKQAGGVGMVLANT  411



>ref|XP_010105478.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC04834.1| Subtilisin-like protease [Morus notabilis]
Length=768

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD+ KV GK+V C+ GGN   +KG  V++AGGVGMI
Sbjct  389  CLPGSLDSAKVTGKLVVCDRGGNPRAQKGQVVKDAGGVGMI  429



>gb|ACN85315.1| subtilisin-like protease precursor [Oryza brachyantha]
Length=790

 Score = 49.7 bits (117),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LDA KV GKIV C  GGN  VEKG AV  AGGVGMI
Sbjct  418  CNLGALDAGKVTGKIVVCLRGGNPRVEKGEAVSRAGGVGMI  458



>gb|AFB33579.1| hypothetical protein 2_7189_01, partial [Pinus mugo]
Length=161

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD   + GKIV CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEGSLDPEVIKGKIVLCERGNNPRVLKGSVVKQAGGVGMI  126



>gb|KFK39884.1| hypothetical protein AALP_AA3G301200 [Arabis alpina]
Length=754

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD   V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  380  CLPGSLDPATVKGKIVVCDRGVNARVEKGAVVRDAGGLGMIMANT  424



>gb|AFB33576.1| hypothetical protein 2_7189_01, partial [Pinus mugo]
 gb|AFB33577.1| hypothetical protein 2_7189_01, partial [Pinus mugo]
 gb|AFB33578.1| hypothetical protein 2_7189_01, partial [Pinus mugo]
Length=161

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD   + GKIV CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEGSLDPEVIKGKIVLCERGNNPRVLKGSVVKQAGGVGMI  126



>ref|XP_004246134.2| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=746

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 26/42 (62%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            YCY   L+ T V GKIV CE G    V+KG AV+ AGG  MI
Sbjct  376  YCYPSSLNNTNVMGKIVLCEAGITRAVDKGIAVKAAGGAAMI  417



>ref|XP_006297042.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
 gb|EOA29940.1| hypothetical protein CARUB_v10013038mg [Capsella rubella]
Length=757

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD++ V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  383  CLPGSLDSSIVRGKIVVCDRGVNARVEKGAVVRDAGGLGMIMANT  427



>gb|KHN01421.1| Subtilisin-like protease [Glycine soja]
Length=387

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  132  GELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            G L+++KV GKIV C+ GGN  VEKG AV+ AGG+GMI A + 
Sbjct  2    GSLESSKVQGKIVVCDRGGNARVEKGSAVKLAGGLGMIMANTE  44



>gb|ADZ55305.1| serine protease [Coffea arabica]
Length=763

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPG-GNLDVEKGFAVREAGGVGMI  19
            YC+S  L+++KV GKIV C+ G G  DV+KG  V+ AGGVGMI
Sbjct  391  YCFSSALNSSKVRGKIVVCDYGVGISDVQKGENVKAAGGVGMI  433



>dbj|BAK07347.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=797

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C    LDA K +GKIV C  GGN  +EKG AVR AGGVGMI
Sbjct  418  CMLDSLDAAKASGKIVVCVRGGNRRMEKGEAVRRAGGVGMI  458



>ref|XP_009416811.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=757

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KG  VR+AGG GMI A +
Sbjct  386  CITGTLLPDKVAGKIVLCDRGINARVQKGLVVRDAGGAGMILANT  430



>ref|XP_003570499.1| PREDICTED: subtilisin-like protease [Brachypodium distachyon]
Length=780

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C + +L+ATKVAGKIV C+PG N   EKG AV+ AGG G I A +  
Sbjct  393  CEAQKLNATKVAGKIVLCDPGVNGRAEKGEAVKLAGGAGAILASTEA  439



>gb|AEX12739.1| hypothetical protein 2_7189_01 [Pinus taeda]
 gb|AEX12740.1| hypothetical protein 2_7189_01 [Pinus taeda]
 gb|AEX12741.1| hypothetical protein 2_7189_01 [Pinus radiata]
 gb|AFB33575.1| hypothetical protein 2_7189_01, partial [Pinus mugo]
Length=161

 Score = 47.0 bits (110),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD   + GKIV CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEGSLDPEVIKGKIVLCERGNNPRVVKGSVVKQAGGVGMI  126



>ref|NP_565330.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAC95169.1| subtilisin-like serine protease, putative [Arabidopsis thaliana]
 gb|AAK59595.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAN13182.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEC05985.1| Subtilase-like protein [Arabidopsis thaliana]
Length=754

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD++ V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  380  CLPGSLDSSIVRGKIVVCDRGVNARVEKGAVVRDAGGLGMIMANT  424



>gb|EYU28325.1| hypothetical protein MIMGU_mgv1a001748mg [Erythranthe guttata]
Length=765

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD+  V GK+V C+ G +  VEKG  VR+AGGVGMI A +
Sbjct  391  CLPGSLDSAAVRGKVVLCDRGISPRVEKGMVVRDAGGVGMILANT  435



>ref|XP_011013808.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=749

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            CY   LD  KV GKIV+C  G   DVEK   V +AGGVGMI A
Sbjct  378  CYPESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVGMILA  420



>gb|KHN12975.1| Subtilisin-like protease [Glycine soja]
Length=751

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C +  LD  KV GKIV C+ G +  VEKG  V+ AGGVGM+ A S  
Sbjct  371  CETDSLDPKKVKGKIVLCDRGNSSRVEKGLVVKSAGGVGMVLANSES  417



>ref|XP_007012625.1| Subtilase family protein [Theobroma cacao]
 gb|EOY30244.1| Subtilase family protein [Theobroma cacao]
Length=759

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD   V GK+V C+ G N  VEKG  VR+AGGVGMI A +
Sbjct  385  CLPGSLDPAFVRGKVVICDRGTNARVEKGAVVRDAGGVGMILANT  429



>ref|XP_008444575.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=770

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -1

Query  126  LDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            L+  KVAGKIV C+ GGN  V+KG  V+EAGG+GMI A +  
Sbjct  395  LNPAKVAGKIVVCDRGGNSRVQKGLVVKEAGGLGMILANTEA  436



>ref|XP_010109072.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC20872.1| Subtilisin-like protease [Morus notabilis]
Length=770

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G LD  KVAGKIV C+ G +  V+KG  V++AGGVGMI A +
Sbjct  393  SLCLEGTLDRRKVAGKIVICDRGISPRVQKGQVVKDAGGVGMILANT  439



>ref|XP_003538797.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 29/47 (62%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C +  LD  KV GKIV C+ G +  VEKG  V+ AGGVGM+ A S  
Sbjct  390  CETDSLDPKKVKGKIVLCDRGNSSRVEKGLVVKSAGGVGMVLANSES  436



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score = 49.3 bits (116),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C +G+L+ + V+GKIV C+ GG   VEKG AV+ AGG GMI A ++
Sbjct  403  CVAGKLNPSLVSGKIVVCDRGGGKRVEKGRAVKLAGGAGMILANTK  448



>ref|XP_006377332.1| hypothetical protein POPTR_0011s04980g [Populus trichocarpa]
 gb|ERP55129.1| hypothetical protein POPTR_0011s04980g [Populus trichocarpa]
Length=744

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            CY   LD TKV GKIV+C  G   DVEK   V +AGGVGMI
Sbjct  375  CYPESLDPTKVRGKIVYCLGGMIPDVEKSLVVAQAGGVGMI  415



>ref|XP_010692334.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=777

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            +C +G L ++ V GKIV C+ G N   EKGF V+ AGG GMI
Sbjct  393  FCINGSLSSSLVKGKIVLCDRGSNGRTEKGFVVKSAGGAGMI  434



>ref|XP_006648425.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=748

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAG  10
            C  G LD  KV GKIV C  G N  VEKG AVREAGG GM+ A 
Sbjct  379  CMLGSLDPAKVKGKIVVCLRGVNPRVEKGEAVREAGGAGMVLAN  422



>gb|ACN85269.1| subtilisin-like protease precursor [Oryza alta]
Length=783

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LDA KV GKIV C  GG+  VEKG AV  AGG GMI
Sbjct  410  CELGALDAAKVTGKIVVCMRGGSPRVEKGEAVSRAGGAGMI  450



>ref|XP_011078099.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=758

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G LD   V GK+V C+ G +  VEKG  VREAGGVGMI A +
Sbjct  385  CLAGSLDPATVRGKVVVCDRGISPRVEKGAVVREAGGVGMILANT  429



>ref|XP_008354238.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=440

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD   VAGKIV C+ G +  V+KG  V+EAGGVGMI A +
Sbjct  65   CLEGTLDRRVVAGKIVICDRGISPRVQKGEVVKEAGGVGMILANT  109



>dbj|BAJ97136.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=779

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C  G+L+AT VAGKIV CEPG N    K  AV+ AGG G I A ++
Sbjct  397  CEEGKLNATMVAGKIVLCEPGVNARAAKPLAVKLAGGAGAILASTQ  442



>ref|XP_011013366.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=770

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            CY   LD  KV GKIV+C  G   DVEK   V +AGGVGMI A
Sbjct  399  CYPESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVGMILA  441



>ref|XP_007050153.1| Subtilase family protein isoform 1 [Theobroma cacao]
 ref|XP_007050154.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX94310.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOX94311.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=765

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C+ G L   KV GK+V C+ G N   EKG AV+EAGG  MI A +
Sbjct  388  FCFKGSLPRAKVGGKMVICDRGVNGRAEKGIAVKEAGGAAMILANT  433



>ref|XP_009407416.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=769

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L   KV+GKIV C+ G N  V+KGF VR+AGG GMI A +
Sbjct  389  CMVGTLLPDKVSGKIVLCDRGINARVQKGFVVRDAGGAGMILANT  433



>emb|CDY18042.1| BnaC07g04280D [Brassica napus]
Length=737

 Score = 48.9 bits (115),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L+ T V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  363  CLPGSLEPTTVRGKIVVCDRGVNARVEKGAVVRDAGGLGMIMANT  407



>gb|EEC76224.1| hypothetical protein OsI_13631 [Oryza sativa Indica Group]
Length=459

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N  V+KGF V++AGG GM+ A +
Sbjct  85   CMSGSLIPEKVAGKIVLCDRGTNARVQKGFVVKDAGGAGMVLANT  129



>gb|AEX12742.1| hypothetical protein 2_7189_01 [Pinus lambertiana]
Length=161

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD   + GK+V CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEGSLDPEVIKGKVVLCERGNNPRVLKGSVVKQAGGVGMI  126



>ref|XP_003550312.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=777

 Score = 48.9 bits (115),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C    L   KV+GKIV CE GGN  VEKG  V+ AGG GMI A S  
Sbjct  396  CLQDSLIPEKVSGKIVICERGGNPRVEKGLVVKLAGGAGMILANSEA  442



>gb|AFB33567.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
 gb|AFB33568.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
 gb|AFB33570.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
 gb|AFB33571.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
 gb|AFB33572.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
 gb|AFB33573.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
 gb|AFB33574.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
Length=161

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD   + GK+V CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEGSLDPEVIKGKVVLCERGNNPRVLKGSVVKQAGGVGMI  126



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSR  4
            C +G+L+ + V+GKIV C+ GG   VEKG AV+ AGG GMI A ++
Sbjct  383  CVAGKLNPSLVSGKIVVCDRGGGKRVEKGRAVKLAGGAGMILANTK  428



>ref|XP_003541310.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=751

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G LD   V GK+V C+ G N  VEKG  VR+AGGVGMI A +
Sbjct  375  SICMPGSLDPDSVRGKVVVCDRGLNSRVEKGAVVRDAGGVGMILANT  421



>gb|AFB33569.1| hypothetical protein 2_7189_01, partial [Pinus cembra]
Length=161

 Score = 46.2 bits (108),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C  G LD   + GK+V CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEGSLDPEVIKGKVVLCERGNNPRVLKGSVVKQAGGVGMI  126



>ref|XP_009412853.1| PREDICTED: subtilisin-like protease SDD1 [Musa acuminata subsp. 
malaccensis]
Length=747

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C +G LD+  V GKIV C+ G N  VEKG  V++AGG GMI
Sbjct  390  CMNGTLDSVDVRGKIVLCDRGTNARVEKGQVVKKAGGAGMI  430



>ref|XP_002301156.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
 gb|EEE80429.2| hypothetical protein POPTR_0002s12130g [Populus trichocarpa]
Length=779

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C +G L   +VAGKIV C+ GGN  V+KG  V+++GG+GMI A +
Sbjct  397  SLCMTGTLIPAQVAGKIVICDRGGNSRVQKGLVVKDSGGLGMILANT  443



>ref|XP_010090170.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38967.1| Subtilisin-like protease [Morus notabilis]
Length=761

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L+   V GK+V C+ G N  VEKG  VREAGG+GMI A +
Sbjct  387  CLAGSLEPEVVRGKVVLCDRGVNARVEKGAVVREAGGIGMILANT  431



>emb|CAN77862.1| hypothetical protein VITISV_022393 [Vitis vinifera]
Length=757

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 29/43 (67%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C+ G LD  KV GKIV+C  G N  VEK + V +AGG+GMI A
Sbjct  366  CFVGSLDPEKVKGKIVYCLVGLNAIVEKSWVVAQAGGIGMIIA  408



>gb|EAY90937.1| hypothetical protein OsI_12551 [Oryza sativa Indica Group]
Length=470

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G L   KVAGKIV C+ G +  V+KGF VR+AGG GM+
Sbjct  85   CMPGTLTPEKVAGKIVVCDRGVSARVQKGFVVRDAGGAGMV  125



>ref|XP_009348638.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=846

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G LD   VAGKIV C+ G +  V+KG  V+EAGGVGMI A +
Sbjct  469  SLCLEGTLDRRVVAGKIVICDRGISPRVQKGEVVKEAGGVGMILANT  515



>ref|XP_006358841.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=745

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            YC  G L    + GKIV C PG   ++EKG AV++AGGVGMI
Sbjct  378  YCKPGSLTDPSIKGKIVICLPGVVSNIEKGQAVKDAGGVGMI  419



>ref|XP_006843321.1| hypothetical protein AMTR_s00910p00007910, partial [Amborella 
trichopoda]
 gb|ERN04996.1| hypothetical protein AMTR_s00910p00007910, partial [Amborella 
trichopoda]
Length=321

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD TK  GKIV C  G N  VEKG AV++AGG+GMI
Sbjct  204  CLIGSLDPTKTKGKIVACLRGDNARVEKGEAVKQAGGIGMI  244



>ref|XP_009102354.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=763

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 29/45 (64%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C    LD T V GKIV C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  389  CLPASLDPTTVRGKIVVCDRGVNARVEKGAVVRDAGGLGMIMANT  433



>ref|XP_004289987.1| PREDICTED: subtilisin-like protease SDD1-like [Fragaria vesca 
subsp. vesca]
Length=770

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C+ G L   KV GKIV C+ G N   EKG  V+EAGG GMI A +
Sbjct  392  FCFKGSLPRAKVRGKIVVCDRGVNGRAEKGEVVKEAGGAGMILANT  437



>gb|EAZ22112.1| hypothetical protein OsJ_05774 [Oryza sativa Japonica Group]
Length=527

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C+ G LD  KV GKIV C  G N  VEKG AV EAGG GM+ A
Sbjct  151  CFLGSLDPEKVKGKIVVCLRGVNPRVEKGEAVLEAGGAGMVLA  193



>ref|XP_010647023.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=354

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 28/43 (65%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C  G LD  KV GKIV+C  G N  VEK + V +AGGVGMI A
Sbjct  6    CSVGSLDPKKVKGKIVYCLVGLNAIVEKSWVVAQAGGVGMILA  48



>ref|WP_005267086.1| subtilisin-like extracellular serine protease [Arthrobacter crystallopoietes]
 gb|EMY35701.1| subtilisin-like extracellular serine protease [Arthrobacter crystallopoietes 
BAB-32]
Length=1013

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C    LD+TK  GKIV CE G N  VEK   V++AGGVGM+
Sbjct  477  CLPASLDSTKTTGKIVVCERGVNPRVEKSQVVKDAGGVGMV  517



>gb|AFB33565.1| hypothetical protein 2_7189_01, partial [Abies alba]
 gb|AFB33566.1| hypothetical protein 2_7189_01, partial [Abies alba]
Length=161

 Score = 46.2 bits (108),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 26/43 (60%), Gaps = 0/43 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            + C    LD   V GKIV CE G N  V KG  V++AGGVGMI
Sbjct  84   SLCMEDSLDPKLVRGKIVLCERGNNPRVAKGAVVKQAGGVGMI  126



>gb|ADY38794.1| serine protease [Coffea arabica]
Length=763

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLD-VEKGFAVREAGGVGMI  19
            YC+S  L+++KV GKIV C+ GG +   +KG  V+ AGGVGMI
Sbjct  391  YCFSSALNSSKVQGKIVVCDHGGGISGAQKGEHVKAAGGVGMI  433



>ref|XP_003544482.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=774

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C    L   KV+GKIV CE GGN  VEKG  V+ AGG GMI A S  
Sbjct  393  CLQDSLIPEKVSGKIVICERGGNPRVEKGLVVKLAGGAGMILANSEA  439



>gb|ACF79126.1| unknown [Zea mays]
 tpg|DAA61657.1| TPA: putative subtilase family protein [Zea mays]
Length=766

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L+A +V GK+V C+ GGN  VEKG  V+ AGGVGM+ A +
Sbjct  389  CMEGTLNAAEVKGKVVLCDRGGNSRVEKGQIVKLAGGVGMVLANT  433



>gb|ACN85243.1| subtilisin-like protease precursor [Oryza officinalis]
Length=790

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LDA KV GKIV C  GG+  VEKG AV  AGG GMI
Sbjct  417  CELGALDAAKVKGKIVVCMRGGSPRVEKGEAVSRAGGAGMI  457



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 25/45 (56%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  GEL+++ V GKIV C+ GG+  VEKG AV+ AGG GMI A +
Sbjct  395  CSVGELNSSLVEGKIVLCDRGGSARVEKGRAVKLAGGAGMILANT  439



>ref|NP_001130775.1| uncharacterized protein LOC100191879 precursor [Zea mays]
 gb|ACG30165.1| subtilisin-like protease precursor [Zea mays]
Length=766

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L+A +V GK+V C+ GGN  VEKG  V+ AGGVGM+ A +
Sbjct  389  CMEGTLNAAEVKGKVVLCDRGGNSRVEKGQIVKLAGGVGMVLANT  433



>ref|XP_004957134.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=808

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G LD  KV GKIV C  G N  VEKG AVR AGGVG++
Sbjct  416  CIEGSLDKAKVKGKIVVCIRGKNARVEKGEAVRRAGGVGLV  456



>ref|XP_008780900.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=769

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L   KVAGKIV CE G +  V+KG+ VR+AGG GMI A +
Sbjct  388  CMPGTLMPEKVAGKIVLCERGISPRVQKGYVVRDAGGAGMILANT  432



>tpg|DAA61658.1| TPA: putative subtilase family protein [Zea mays]
Length=548

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L+A +V GK+V C+ GGN  VEKG  V+ AGGVGM+ A +
Sbjct  171  CMEGTLNAAEVKGKVVLCDRGGNSRVEKGQIVKLAGGVGMVLANT  215



>ref|NP_001234282.1| SBT1 protein precursor [Solanum lycopersicum]
 emb|CAA67429.1| SBT1 [Solanum lycopersicum]
 emb|CAA06999.1| subtilisin-like protease [Solanum lycopersicum]
Length=766

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N   +KG  V++AGG+GMI A +
Sbjct  386  CTSGSLIPEKVAGKIVVCDRGMNARAQKGLVVKDAGGIGMILANT  430



>ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            +C  G L+ TK+ GKIV+CE G   D++K + V +AGGVGMI A
Sbjct  375  FCVPGSLEPTKMKGKIVYCERGLIPDLQKSWVVAQAGGVGMILA  418



>gb|EMS60673.1| Subtilisin-like protease [Triticum urartu]
Length=352

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 27/43 (63%), Gaps = 0/43 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGA  13
            C  G LD  KV GKIV C  G N  VEKG AV  AGGVG++ A
Sbjct  54   CIEGSLDKKKVRGKIVVCMRGKNARVEKGEAVHRAGGVGLVLA  96



>ref|XP_006828664.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
 gb|ERM96080.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
Length=799

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/49 (51%), Positives = 28/49 (57%), Gaps = 0/49 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            + C    LD   V GKIV C+ G N  V KG  V+EAGGVGMI A   G
Sbjct  415  SLCMENSLDPEMVRGKIVLCDRGSNARVNKGIVVKEAGGVGMILANGAG  463



>ref|XP_004308141.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=778

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  147  TYCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            + C  G L+  KV GKIV CE G +  V+KG  V+ AGGVGMI A +
Sbjct  404  SLCLEGTLNPRKVKGKIVICERGISARVQKGVVVKNAGGVGMILANT  450



>ref|XP_010666857.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=776

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G LD++ V GK+V C+ G N  VEKG  V+EAGG+GMI A +
Sbjct  398  CMPGSLDSSLVKGKVVVCDRGVNPRVEKGEVVKEAGGIGMILANT  442



>emb|CBI37197.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 29/46 (63%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            +C+ G L   KV GK+V C+ G N   EKG AV+EAGG  MI A +
Sbjct  940  FCFKGSLPRAKVLGKMVVCDRGVNGRAEKGEAVKEAGGAAMILANT  985



>gb|EMT11725.1| Subtilisin-like protease [Aegilops tauschii]
Length=525

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGSRG  1
            C  G+L+ATKVAGKIV CE G N    K  AV+ AGG G I A ++ 
Sbjct  144  CEEGKLNATKVAGKIVLCESGVNARAAKPLAVKLAGGAGAILASTKS  190



>gb|EMS59706.1| Subtilisin-like protease [Triticum urartu]
Length=510

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G+L+ T VAGKIV C+PG N   EKG+AV+ AGG G +
Sbjct  128  CEVGKLNPTMVAGKIVLCDPGVNGRTEKGYAVKLAGGAGAV  168



>gb|EMT01939.1| Subtilisin-like protease [Aegilops tauschii]
Length=698

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            C  G+L+ T VAGKIV C+PG N   EKG+AV+ AGG G +
Sbjct  247  CEVGKLNPTMVAGKIVLCDPGVNGRTEKGYAVKLAGGAGAV  287



>gb|KDP32432.1| hypothetical protein JCGZ_13357 [Jatropha curcas]
Length=1003

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMI  19
            +C    L+   V GK+V C+ G  L+ EKG AVREAGGVGMI
Sbjct  352  FCLRNTLNPELVRGKVVICDIGIVLEAEKGLAVREAGGVGMI  393



>ref|XP_006362066.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=766

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C SG L   KVAGKIV C+ G N   +KG  V++AGG+GMI A +
Sbjct  386  CTSGSLIPEKVAGKIVVCDRGMNARAQKGLVVKDAGGIGMILANT  430



>gb|ABF70004.1| subtilisin-like serine proteinase, putative [Musa acuminata]
Length=757

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/45 (56%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C +G L   KVAGKIV C+ G N  V+KG  VR+AGG GMI A +
Sbjct  386  CMTGTLLPDKVAGKIVLCDRGINARVQKGSVVRDAGGAGMILANT  430



>gb|KDP33922.1| hypothetical protein JCGZ_07493 [Jatropha curcas]
Length=765

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -1

Query  141  CYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            C  G L+ T V GK+V C+ G N  VEKG  VR+AGG+GMI A +
Sbjct  387  CLPGSLEPTMVRGKVVVCDRGINARVEKGAVVRDAGGIGMILANT  431



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 25/46 (54%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = -1

Query  144  YCYSGELDATKVAGKIVFCEPGGNLDVEKGFAVREAGGVGMIGAGS  7
            YC  G +  +KV GKIV C+ G N  VEKG AV+ AGG+GMI A +
Sbjct  386  YCLIGGISPSKVQGKIVVCDRGVNARVEKGAAVKLAGGLGMILANT  431



Lambda      K        H        a         alpha
   0.311    0.130    0.378    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 525616678368