BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7093_g1_i1 len=428 path=[406:0-427]

Length=428
                                                                      Score     E

emb|CAN76849.1|  hypothetical protein VITISV_005997                     108   2e-24   Vitis vinifera
emb|CBI41007.3|  unnamed protein product                                107   4e-24   
ref|XP_002263717.2|  PREDICTED: (3S,6E)-nerolidol synthase 1-like       107   6e-24   Vitis vinifera
gb|AEY82696.1|  (3S)-linalool/(E)-nerolidol synthase                    106   9e-24   
gb|ADR74212.1|  (3S)-linalool/(E)-nerolidol synthase                    105   1e-23   
gb|ADR74211.1|  (3S)-linalool/(E)-nerolidol synthase                    104   3e-23   
emb|CBI41006.3|  unnamed protein product                              97.8    3e-21   
emb|CBI40949.3|  unnamed protein product                              93.2    8e-21   
ref|XP_010646667.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  93.2    1e-20   
emb|CBI40951.3|  unnamed protein product                              92.8    3e-20   
emb|CBI33220.3|  unnamed protein product                              95.9    3e-20   
emb|CBI33221.3|  unnamed protein product                              95.5    4e-20   
ref|XP_010646705.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  95.5    5e-20   
ref|NP_001267895.1|  (3S,6E)-nerolidol synthase 1, chloroplastic-...  95.1    7e-20   
emb|CBI40952.3|  unnamed protein product                              93.6    7e-20   
ref|XP_003635177.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  95.1    8e-20   
ref|XP_010646706.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  94.7    1e-19   
emb|CBI41004.3|  unnamed protein product                              94.4    1e-19   
ref|XP_010646907.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  94.4    1e-19   
ref|XP_010646906.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  94.0    2e-19   
ref|NP_001267928.1|  (3S,6E)-nerolidol synthase 1, chloroplastic-...  93.6    3e-19   
gb|ADD81295.1|  linalool synthase                                     93.6    3e-19   Actinidia polygama
ref|NP_001267990.1|  (3S)-linalool/(E)-nerolidol /(E,E)-geranyl l...  93.2    3e-19   
emb|CAN81698.1|  hypothetical protein VITISV_037651                   92.8    5e-19   Vitis vinifera
emb|CBI23523.3|  unnamed protein product                              89.4    7e-19   
ref|XP_010646921.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  90.1    8e-19   
emb|CBI23481.3|  unnamed protein product                              89.7    9e-19   
gb|ADR74213.1|  (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalo...  92.0    1e-18   
ref|XP_003635282.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     91.7    1e-18   
ref|XP_010646919.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  91.3    1e-18   
ref|XP_003635413.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     91.3    2e-18   
ref|XP_003635168.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     91.3    2e-18   
emb|CBI23507.3|  unnamed protein product                              88.2    2e-18   
emb|CBI23482.3|  unnamed protein product                              90.9    2e-18   
emb|CAN66667.1|  hypothetical protein VITISV_032494                   90.5    2e-18   Vitis vinifera
ref|XP_004151014.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     90.5    3e-18   
ref|XP_004166431.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     91.3    3e-18   
gb|KGN64589.1|  hypothetical protein Csa_1G068570                     90.5    3e-18   
gb|ADD81294.1|  linalool synthase                                     90.5    4e-18   Actinidia arguta
gb|KDP42343.1|  hypothetical protein JCGZ_02816                       89.7    6e-18   
ref|NP_001268060.1|  (3S,6E)-nerolidol synthase 1-like                89.7    6e-18   
emb|CBI23484.3|  unnamed protein product                              86.7    7e-18   
emb|CBI40948.3|  unnamed protein product                              88.6    7e-18   
ref|XP_008441685.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     89.4    8e-18   
ref|XP_007025896.1|  3S-linalool/(E)-nerolidol /(E,E)-geranyl lin...  89.0    1e-17   
ref|XP_006377269.1|  hypothetical protein POPTR_0011s03490g           86.7    4e-17   
emb|CDO99690.1|  unnamed protein product                              87.0    6e-17   
gb|KDP42342.1|  hypothetical protein JCGZ_02815                       86.3    9e-17   
emb|CBI23483.3|  unnamed protein product                              82.4    1e-16   
ref|XP_008224889.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     85.9    1e-16   
emb|CAN81129.1|  hypothetical protein VITISV_002911                   85.5    2e-16   Vitis vinifera
emb|CBI23480.3|  unnamed protein product                              81.3    3e-16   
ref|XP_002282488.1|  PREDICTED: (-)-germacrene D synthase             84.7    3e-16   Vitis vinifera
gb|AGX26045.1|  bifunctional terpenoid synthase                       84.7    3e-16   
gb|AEI52903.1|  terpene synthase 3                                    84.7    4e-16   
ref|XP_007025895.1|  3S-linalool/(E)-nerolidol /(E,E)-geranyl lin...  84.3    5e-16   
ref|XP_007213872.1|  hypothetical protein PRUPE_ppa003380mg           84.0    8e-16   
ref|XP_010248179.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     83.6    9e-16   
ref|XP_006365871.1|  PREDICTED: (-)-alpha-terpineol synthase-like     82.8    1e-15   
gb|AEP82768.1|  terpene synthase                                      82.8    1e-15   
ref|XP_004233802.1|  PREDICTED: (-)-alpha-terpineol synthase-like     82.8    2e-15   
ref|XP_004309665.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  82.8    2e-15   
sp|P0CV96.1|NES1_FRAVE  RecName: Full=(3S,6E)-nerolidol synthase ...  82.8    2e-15   
ref|XP_004293480.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...  82.8    2e-15   
gb|AER36088.1|  nerolidol synthase                                    82.4    2e-15   
sp|P0CV95.1|NES2_FRAAN  RecName: Full=(3S,6E)-nerolidol synthase ...  82.4    2e-15   
gb|AIC76501.1|  terpene synthase                                      82.4    2e-15   
ref|XP_007159218.1|  hypothetical protein PHAVU_002G219100g           81.6    4e-15   
emb|CAN83267.1|  hypothetical protein VITISV_023827                   80.9    6e-15   Vitis vinifera
ref|XP_010999558.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     80.9    7e-15   
ref|XP_010241001.1|  PREDICTED: (-)-germacrene D synthase-like        80.9    9e-15   
ref|XP_008245818.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     80.9    9e-15   
gb|KDP20831.1|  hypothetical protein JCGZ_21302                       80.5    1e-14   
ref|XP_006365869.1|  PREDICTED: (-)-alpha-terpineol synthase-like...  80.5    1e-14   
emb|CAN64072.1|  hypothetical protein VITISV_038269                   80.1    1e-14   Vitis vinifera
ref|XP_002513346.1|  1,8-cineole synthase, chloroplast precursor,...  79.7    2e-14   Ricinus communis
dbj|BAG50433.1|  sesquiterpene synthase 3                             79.7    2e-14   Zingiber zerumbet [bitter ginger]
gb|EYU19193.1|  hypothetical protein MIMGU_mgv1a018094mg              79.3    2e-14   
ref|XP_002518583.1|  1,8-cineole synthase, chloroplast precursor,...  79.3    2e-14   Ricinus communis
ref|XP_007148287.1|  hypothetical protein PHAVU_006G195600g           79.3    2e-14   
ref|XP_010644187.1|  PREDICTED: (-)-germacrene D synthase-like        79.3    3e-14   
gb|ADK73615.1|  terpene synthase 6                                    79.3    3e-14   
gb|ABX57720.1|  sesquiterpene synthase                                79.3    3e-14   Vanda hybrid cultivar
ref|XP_006420934.1|  hypothetical protein CICLE_v10004558mg           79.3    3e-14   
emb|CBI20287.3|  unnamed protein product                              79.3    3e-14   
ref|XP_009388236.1|  PREDICTED: (S)-beta-bisabolene synthase-like     79.0    3e-14   
gb|KEH31175.1|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...  79.0    3e-14   
ref|XP_010059420.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     79.3    3e-14   
gb|AGB05615.1|  sesquiterpene synthase 6                              78.6    3e-14   
ref|XP_003528417.2|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...  79.0    4e-14   
ref|XP_004243482.2|  PREDICTED: (-)-germacrene D synthase             78.6    5e-14   
dbj|BAP75560.1|  linalool synthase                                    78.6    5e-14   
gb|AEP17005.1|  (E)-beta-caryophyllene synthase                       78.2    6e-14   
sp|Q5SBP4.1|AZIS_OCIBA  RecName: Full=Alpha-zingiberene synthase      78.2    6e-14   Ocimum basilicum [basil]
ref|NP_001268213.1|  (-)-germacrene D synthase                        78.2    6e-14   
emb|CAN83470.1|  hypothetical protein VITISV_030783                   78.2    7e-14   Vitis vinifera
gb|AGW18161.1|  terpene synthase 4-1                                  78.2    7e-14   
ref|XP_010686917.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  78.2    7e-14   
ref|XP_006352644.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  77.8    8e-14   
ref|XP_010686918.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  77.8    8e-14   
sp|P0CV94.1|NES1_FRAAN  RecName: Full=(3S,6E)-nerolidol synthase ...  77.8    8e-14   
gb|KDP20833.1|  hypothetical protein JCGZ_21304                       77.8    8e-14   
emb|CAN68620.1|  hypothetical protein VITISV_013313                   77.8    8e-14   Vitis vinifera
ref|XP_010247958.1|  PREDICTED: (-)-germacrene D synthase-like        77.8    8e-14   
emb|CBI20483.3|  unnamed protein product                              77.8    1e-13   
ref|XP_010059436.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.1    1e-13   
ref|XP_011071312.1|  PREDICTED: uncharacterized protein LOC105156792  78.2    1e-13   
gb|AGL98419.1|  B-caryophyllene synthase                              77.4    1e-13   
ref|XP_010057691.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     77.4    1e-13   
gb|AGW18157.1|  terpene synthase 4                                    77.4    1e-13   
ref|XP_006493821.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  77.4    1e-13   
ref|XP_006493063.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     77.4    1e-13   
ref|NP_001268015.1|  (-)-germacrene D synthase-like                   77.0    1e-13   
emb|CBI20174.3|  unnamed protein product                              77.0    1e-13   
sp|J7LJN5.1|TPS6_PHYDL  RecName: Full=Beta-caryophyllene synthase...  77.0    2e-13   
ref|XP_003596560.1|  Alpha-humulene/(-)-(E)-beta-caryophyllene sy...  77.0    2e-13   
ref|XP_002283076.1|  PREDICTED: (-)-germacrene D synthase             77.0    2e-13   Vitis vinifera
ref|XP_002283070.1|  PREDICTED: (-)-germacrene D synthase             77.0    2e-13   Vitis vinifera
gb|AHE41084.1|  geraniol synthase                                     77.0    2e-13   
ref|XP_006365870.1|  PREDICTED: (-)-alpha-terpineol synthase-like...  76.6    2e-13   
ref|NP_001268204.1|  uncharacterized protein LOC100257265             76.6    2e-13   
gb|AGB05612.1|  sesquiterpene synthase 3                              76.6    2e-13   
ref|XP_010657363.1|  PREDICTED: R-linalool synthase, chloroplasti...  76.6    2e-13   
ref|XP_008245819.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     76.3    3e-13   
gb|AGW18162.1|  terpene synthase 4-2                                  76.3    3e-13   
ref|NP_001267920.1|  geraniol synthase                                76.6    3e-13   
emb|CBI20482.3|  unnamed protein product                              76.6    3e-13   
gb|AEP82784.1|  terpene synthase                                      76.3    3e-13   
ref|XP_007149935.1|  hypothetical protein PHAVU_005G111500g           76.3    3e-13   
ref|XP_006369784.1|  hypothetical protein POPTR_0001s31570g           76.3    3e-13   
gb|ADK73616.1|  terpene synthase 6                                    75.9    3e-13   
ref|XP_002523475.1|  (+)-delta-cadinene synthase isozyme A, putative  75.9    4e-13   Ricinus communis
emb|CBI20475.3|  unnamed protein product                              76.3    4e-13   
emb|CDP12281.1|  unnamed protein product                              75.9    4e-13   
ref|XP_006352599.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.9    4e-13   
sp|Q84LG0.1|5EAS4_NICAT  RecName: Full=Probable 5-epi-aristoloche...  75.9    4e-13   Nicotiana attenuata
ref|XP_010038257.1|  PREDICTED: (-)-germacrene D synthase-like        75.9    4e-13   
ref|XP_004145158.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.9    4e-13   
gb|ADR74217.1|  geraniol synthase                                     75.9    4e-13   
sp|B1B1U4.1|TPSBE_ZINZE  RecName: Full=Beta-eudesmol synthase; Al...  75.9    4e-13   Zingiber zerumbet [bitter ginger]
gb|AGB05613.1|  sesquiterpene synthase 4                              75.9    4e-13   
ref|XP_008452330.1|  PREDICTED: (+)-gamma-cadinene synthase-like      75.9    5e-13   
ref|XP_006352642.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...  75.9    5e-13   
ref|XP_002283344.1|  PREDICTED: (-)-germacrene D synthase             75.5    5e-13   Vitis vinifera
ref|XP_006388836.1|  hypothetical protein POPTR_0092s00200g           75.5    5e-13   
sp|Q5SBP6.1|GDS_OCIBA  RecName: Full=Germacrene-D synthase; AltNa...  75.5    5e-13   Ocimum basilicum [basil]
ref|XP_008224888.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  75.5    5e-13   
ref|XP_008441664.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.5    5e-13   
ref|XP_007149934.1|  hypothetical protein PHAVU_005G111400g           75.5    5e-13   
gb|KGN55876.1|  hypothetical protein Csa_3G021130                     75.5    5e-13   
emb|CAN62603.1|  hypothetical protein VITISV_009665                   75.5    6e-13   Vitis vinifera
gb|AJD19682.1|  sesquiterpene synthase Tps1                           75.5    6e-13   
ref|XP_004147250.1|  PREDICTED: (-)-germacrene D synthase-like        75.1    6e-13   
ref|NP_001268099.1|  R-linalool synthase, chloroplastic-like          75.5    6e-13   
ref|XP_007211378.1|  hypothetical protein PRUPE_ppa002670mg           75.5    6e-13   
ref|XP_006369780.1|  hypothetical protein POPTR_0001s315502g          75.5    6e-13   
ref|XP_011015877.1|  PREDICTED: terpene synthase 10-like              75.5    7e-13   
ref|NP_001284382.1|  (+)-gamma-cadinene synthase                      75.1    7e-13   
ref|XP_006363765.1|  PREDICTED: (-)-germacrene D synthase-like        75.1    7e-13   
gb|KDP31577.1|  hypothetical protein JCGZ_14802                       75.1    7e-13   
ref|XP_008441674.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.1    7e-13   
gb|AGV40228.1|  sesquiterpene synthase                                75.1    8e-13   
ref|XP_006367561.1|  PREDICTED: germacrene C synthase-like            75.1    8e-13   
gb|ADT64306.1|  E-beta-farnesene synthase 1                           75.1    8e-13   
ref|XP_006493822.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  74.7    8e-13   
gb|AIK19227.1|  sesquiterpene synthase                                75.1    8e-13   
gb|ADT64308.1|  E-beta-farnesene synthase 1                           75.1    8e-13   
sp|Q5SBP7.1|SELS_OCIBA  RecName: Full=Selinene synthase               75.1    8e-13   Ocimum basilicum [basil]
ref|XP_008383955.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.1    8e-13   
ref|XP_008446523.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     75.1    8e-13   
ref|XP_011095305.1|  PREDICTED: LOW QUALITY PROTEIN: beta-caryoph...  75.1    8e-13   
emb|CAN62114.1|  hypothetical protein VITISV_032023                   74.7    9e-13   Vitis vinifera
ref|XP_006369785.1|  hypothetical protein POPTR_0001s31580g           74.7    9e-13   
ref|XP_010248057.1|  PREDICTED: probable terpene synthase 2           75.1    9e-13   
ref|XP_010645662.1|  PREDICTED: (-)-alpha-terpineol synthase          74.7    9e-13   
emb|CAN69555.1|  hypothetical protein VITISV_013102                   74.7    9e-13   Vitis vinifera
ref|XP_010908676.1|  PREDICTED: alpha-humulene synthase-like          74.7    1e-12   
emb|CAN82665.1|  hypothetical protein VITISV_017009                   74.7    1e-12   Vitis vinifera
gb|KEH34289.1|  sesquiterpene synthase                                74.7    1e-12   
gb|ADT64310.1|  E-beta-farnesene synthase 4                           74.7    1e-12   
ref|XP_006449155.1|  hypothetical protein CICLE_v10014632mg           74.7    1e-12   
gb|ADR74201.1|  (+)-alpha-phellandrene synthase                       74.7    1e-12   
emb|CDP12296.1|  unnamed protein product                              74.7    1e-12   
ref|NP_001268216.1|  (-)-alpha-terpineol synthase                     74.7    1e-12   
emb|CDP16459.1|  unnamed protein product                              74.3    1e-12   
ref|XP_009387496.1|  PREDICTED: alpha-humulene synthase-like          74.3    1e-12   
emb|CAN76564.1|  hypothetical protein VITISV_029137                   73.9    1e-12   Vitis vinifera
ref|XP_009385198.1|  PREDICTED: probable terpene synthase 11          74.3    1e-12   
emb|CAN82172.1|  hypothetical protein VITISV_040547                   74.3    1e-12   Vitis vinifera
ref|XP_009591578.1|  PREDICTED: (-)-germacrene D synthase-like        74.3    1e-12   
gb|AEM23828.1|  sesquiterpene synthase                                74.3    1e-12   
ref|XP_010645660.1|  PREDICTED: (-)-alpha-terpineol synthase-like     74.3    1e-12   
gb|ADT64309.1|  E-beta-farnesene synthase 3                           74.3    2e-12   
ref|NP_001239041.1|  sesquiterpene synthase                           74.3    2e-12   
ref|XP_010039959.1|  PREDICTED: (-)-alpha-terpineol synthase-like     74.3    2e-12   
ref|XP_004505471.1|  PREDICTED: (-)-germacrene D synthase-like        74.3    2e-12   
gb|AIC76496.1|  linalool/nerolidol synthase                           73.9    2e-12   
ref|XP_010645413.1|  PREDICTED: (-)-alpha-terpineol synthase          73.9    2e-12   
gb|AAX39387.1|  (E)-beta-farnesene synthase                           73.9    2e-12   Artemisia annua [sweet Annie]
ref|XP_004487361.1|  PREDICTED: geraniol synthase, chloroplastic-...  73.9    2e-12   
gb|ADT64307.1|  E-beta-farnesene synthase 2                           73.9    2e-12   
gb|ABX09997.1|  sesquiterpene cyclase                                 73.9    2e-12   Artemisia annua [sweet Annie]
sp|Q9FXY7.1|FARS_ARTAN  RecName: Full=(E)-beta-farnesene synthase...  73.9    2e-12   Artemisia annua [sweet Annie]
sp|Q6PWU2.1|ATESY_VITVI  RecName: Full=(-)-alpha-terpineol synthase   73.9    2e-12   Vitis vinifera
gb|AHC54050.1|  gamma-terpinene synthase                              73.9    2e-12   
ref|XP_006853509.1|  hypothetical protein AMTR_s00032p00219920        73.9    2e-12   
emb|CAN69762.1|  hypothetical protein VITISV_006978                   73.9    2e-12   Vitis vinifera
gb|AGU13712.1|  9-epi-caryophyllene synthase                          73.9    2e-12   
ref|XP_004145159.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...  73.6    2e-12   
emb|CAN64328.1|  hypothetical protein VITISV_027228                   73.9    2e-12   Vitis vinifera
ref|XP_004487383.1|  PREDICTED: geraniol synthase, chloroplastic-...  73.9    2e-12   
gb|KDO46373.1|  hypothetical protein CISIN_1g024780mg                 71.6    2e-12   
emb|CAN76978.1|  hypothetical protein VITISV_044295                   73.6    2e-12   Vitis vinifera
ref|XP_010106430.1|  (3S,6E)-nerolidol synthase 1                     73.9    2e-12   
ref|XP_010908315.1|  PREDICTED: probable terpene synthase 11          73.6    2e-12   
gb|AHY21666.1|  multiproduct monoterpene synthase                     73.6    2e-12   
gb|AES63645.2|  (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linaloo...  73.6    2e-12   
emb|CDP05818.1|  unnamed protein product                              73.6    2e-12   
dbj|BAM24404.1|  +limonene synthase                                   73.6    2e-12   
emb|CBI20288.3|  unnamed protein product                              73.9    2e-12   
dbj|BAH03282.1|  +limonene synthase                                   73.6    3e-12   Toona sinensis
ref|XP_006843915.1|  hypothetical protein AMTR_s00007p00269150        72.8    3e-12   
ref|XP_004294317.1|  PREDICTED: (-)-germacrene D synthase-like        73.6    3e-12   
ref|XP_006853523.1|  hypothetical protein AMTR_s00032p00224550        73.2    3e-12   
emb|CBI31266.3|  unnamed protein product                              73.9    3e-12   
gb|AAU05952.1|  beta-caryophyllene synthase                           73.6    3e-12   Cucumis sativus [cucumbers]
ref|XP_008224887.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  73.2    3e-12   
ref|XP_010258444.1|  PREDICTED: (-)-germacrene D synthase-like        73.6    3e-12   
ref|XP_004169937.1|  PREDICTED: (-)-germacrene D synthase-like        73.2    3e-12   
ref|XP_011005621.1|  PREDICTED: (-)-germacrene D synthase-like        73.2    3e-12   
ref|XP_002273624.2|  PREDICTED: valencene synthase                    73.2    3e-12   Vitis vinifera
gb|ADK73619.1|  terpene synthase 3                                    73.2    3e-12   
ref|NP_001268215.1|  valencene synthase                               73.2    4e-12   
gb|AAG24640.2|AF304444_1  sesquiterpene cyclase                       73.2    4e-12   Artemisia annua [sweet Annie]
gb|KGN64586.1|  hypothetical protein Csa_1G066550                     73.2    4e-12   
gb|AGV54642.1|  nerol synthase                                        72.8    4e-12   
sp|Q6Q3H2.1|TPSVS_VITVI  RecName: Full=Valencene synthase; Short=...  73.2    4e-12   Vitis vinifera
ref|XP_007148288.1|  hypothetical protein PHAVU_006G195700g           73.2    4e-12   
ref|XP_009785131.1|  PREDICTED: (E,E)-germacrene B synthase-like      73.2    4e-12   
ref|XP_006467943.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  73.2    4e-12   
gb|ADR74194.1|  (E)-beta-caryophyllene synthase                       72.8    4e-12   
gb|KDP31579.1|  hypothetical protein JCGZ_14804                       72.8    4e-12   
sp|B1B1U3.1|ZSS1_ZINZE  RecName: Full=Alpha-humulene synthase         72.8    4e-12   Zingiber zerumbet [bitter ginger]
ref|NP_001234766.1|  caryophyllene/alpha-humulene synthase            72.8    5e-12   
ref|XP_010694308.1|  PREDICTED: (-)-germacrene D synthase-like        71.2    5e-12   
gb|AGS16741.1|  sesquiterpene synthase                                72.8    5e-12   
ref|NP_001268167.1|  (+)-alpha-phellandrene synthase                  72.8    5e-12   
emb|CDP12283.1|  unnamed protein product                              72.8    5e-12   
emb|CAN64943.1|  hypothetical protein VITISV_001721                   72.8    5e-12   Vitis vinifera
ref|XP_006478794.1|  PREDICTED: (-)-germacrene D synthase-like is...  72.8    5e-12   
gb|KDO52415.1|  hypothetical protein CISIN_1g008620mg                 72.8    5e-12   
emb|CAN78244.1|  hypothetical protein VITISV_030603                   72.4    5e-12   Vitis vinifera
gb|ADR74202.1|  terpene synthase                                      72.8    5e-12   
gb|AAF76186.1|  mercene synthase                                      72.8    5e-12   Perilla frutescens [beefsteak-mint]
emb|CAN75756.1|  hypothetical protein VITISV_025496                   72.4    5e-12   Vitis vinifera
ref|XP_007132998.1|  hypothetical protein PHAVU_011G142600g           71.6    6e-12   
ref|XP_004153858.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     72.0    6e-12   
gb|KCW70095.1|  hypothetical protein EUGRSUZ_F03400                   72.4    6e-12   
ref|NP_001268028.1|  valencene synthase-like                          72.4    6e-12   
gb|ADX01384.1|  germacrene D synthase                                 72.4    6e-12   
ref|XP_010657362.1|  PREDICTED: geraniol synthase isoform X1          72.4    6e-12   
gb|ABR24417.1|  nerolidol/linalool synthase 1                         72.4    6e-12   Antirrhinum majus [garden snapdragon]
ref|XP_007133004.1|  hypothetical protein PHAVU_011G143100g           72.4    6e-12   
ref|XP_004173324.1|  PREDICTED: (-)-alpha-terpineol synthase-like     70.5    6e-12   
ref|XP_010062943.1|  PREDICTED: (-)-germacrene D synthase-like is...  72.4    6e-12   
ref|XP_007133009.1|  hypothetical protein PHAVU_011G143500g           72.4    7e-12   
ref|XP_009358866.1|  PREDICTED: (-)-germacrene D synthase-like        72.4    7e-12   
ref|XP_008449182.1|  PREDICTED: (-)-germacrene D synthase-like        72.8    7e-12   
ref|XP_007021115.1|  Delta-cadinene synthase isozyme A, putative      72.4    7e-12   
ref|XP_010059433.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     72.0    7e-12   
ref|XP_010098578.1|  (3S,6E)-nerolidol synthase 1                     72.4    7e-12   
emb|CBI31262.3|  unnamed protein product                              72.4    7e-12   
ref|XP_010267843.1|  PREDICTED: alpha-terpineol synthase, chlorop...  72.4    7e-12   
sp|Q2XSC4.1|LABER_LAVAN  RecName: Full=Exo-alpha-bergamotene synt...  72.0    7e-12   Lavandula angustifolia [lavender]
ref|XP_007133012.1|  hypothetical protein PHAVU_011G143700g           72.0    8e-12   
ref|XP_010055485.1|  PREDICTED: (-)-germacrene D synthase-like        72.4    8e-12   
ref|XP_004168174.1|  PREDICTED: (+)-gamma-cadinene synthase-like      72.0    8e-12   
emb|CBI31310.3|  unnamed protein product                              70.9    8e-12   
gb|KGN62112.1|  hypothetical protein Csa_2G299330                     70.5    8e-12   
gb|KHN25758.1|  R-linalool synthase, chloroplastic                    72.0    8e-12   
dbj|BAP74389.1|  delta-elemene synthase                               72.0    8e-12   
ref|XP_009338863.1|  PREDICTED: (-)-germacrene D synthase-like        72.0    8e-12   
ref|XP_002512868.1|  (R)-limonene synthase, putative                  72.0    8e-12   
ref|XP_006475286.1|  PREDICTED: (-)-germacrene D synthase-like is...  72.0    8e-12   
ref|XP_008461029.1|  PREDICTED: terpene synthase 10-like              72.0    9e-12   
emb|CDP10957.1|  unnamed protein product                              72.0    9e-12   
ref|XP_009779942.1|  PREDICTED: (-)-alpha-terpineol synthase-like     72.0    9e-12   
dbj|BAG50439.1|  sesquiterpene synthase 7                             72.0    9e-12   
gb|ADR66821.1|  germacrene A synthase                                 72.0    9e-12   
ref|XP_006593284.1|  PREDICTED: probable terpene synthase 11-like     72.0    9e-12   
gb|KCW71959.1|  hypothetical protein EUGRSUZ_E00414                   72.0    1e-11   
ref|XP_010507336.1|  PREDICTED: alpha-humulene/(-)-(E)-beta-caryo...  72.0    1e-11   
ref|XP_007133010.1|  hypothetical protein PHAVU_011G143500g           71.6    1e-11   
emb|CAN60797.1|  hypothetical protein VITISV_016813                   72.0    1e-11   
ref|XP_009344725.1|  PREDICTED: (-)-germacrene D synthase-like        71.6    1e-11   
ref|NP_001267972.1|  valencene synthase-like                          71.6    1e-11   
ref|XP_010645872.1|  PREDICTED: LOW QUALITY PROTEIN: valencene sy...  71.6    1e-11   
gb|KHN36571.1|  R-linalool synthase, chloroplastic                    71.6    1e-11   
emb|CDP15198.1|  unnamed protein product                              71.6    1e-11   
gb|AIK19228.1|  sesquiterpene synthase                                71.6    1e-11   
ref|XP_006475307.1|  PREDICTED: (E)-beta-farnesene synthase-like ...  71.6    1e-11   
ref|XP_002274445.2|  PREDICTED: valencene synthase-like               71.6    1e-11   
gb|AGV40227.1|  putative (-)-germacrene-D synthase                    71.6    1e-11   
ref|XP_006594872.1|  PREDICTED: probable terpene synthase 11-like...  71.6    1e-11   
ref|XP_007149937.1|  hypothetical protein PHAVU_005G111700g           71.6    1e-11   
emb|CBI31291.3|  unnamed protein product                              71.6    1e-11   
emb|CAN71873.1|  hypothetical protein VITISV_002877                   71.2    1e-11   
ref|XP_009344731.1|  PREDICTED: (-)-germacrene D synthase-like        71.2    1e-11   
ref|XP_003541931.2|  PREDICTED: probable terpene synthase 11-like...  71.6    1e-11   
gb|AAV36464.1|  wound-inducible putative cytosolic terpene syntha...  71.2    1e-11   
ref|XP_002267453.1|  PREDICTED: (-)-alpha-terpineol synthase          71.6    1e-11   
emb|CAN75099.1|  hypothetical protein VITISV_019788                   71.2    1e-11   
ref|NP_001280833.1|  (3S,6E)-nerolidol synthase 1-like                71.2    1e-11   
ref|XP_006841714.1|  hypothetical protein AMTR_s00003p00254990        71.2    1e-11   
dbj|BAG50438.1|  sesquiterpene synthase 6                             71.2    1e-11   
dbj|BAG50435.1|  sesquiterpene synthase 6                             71.2    1e-11   
emb|CBI31290.3|  unnamed protein product                              72.0    1e-11   
gb|KCW74868.1|  hypothetical protein EUGRSUZ_E03606                   68.6    1e-11   
ref|XP_002275351.1|  PREDICTED: valencene synthase                    71.2    2e-11   
ref|NP_001234060.1|  germacrene C synthase                            71.2    2e-11   
gb|AAX16078.1|  monoterpene synthase                                  69.3    2e-11   
gb|AAG41890.1|AF279454_1  sesquiterpene synthase 2                    71.2    2e-11   
gb|KDP32232.1|  hypothetical protein JCGZ_13839                       71.2    2e-11   
ref|NP_001234481.1|  sesquiterpene synthase 1                         71.2    2e-11   
gb|AID55337.1|  terpene synthase                                      71.2    2e-11   
ref|XP_004308410.1|  PREDICTED: (-)-germacrene D synthase-like        71.2    2e-11   
ref|XP_009757762.1|  PREDICTED: (-)-germacrene D synthase-like is...  71.2    2e-11   
gb|ADR74199.1|  gamma-cadinene synthase                               71.2    2e-11   
ref|XP_011080637.1|  PREDICTED: geraniol synthase, chloroplastic-...  71.2    2e-11   
emb|CDP05817.1|  unnamed protein product                              71.2    2e-11   
ref|XP_011005622.1|  PREDICTED: valencene synthase-like isoform X1    71.2    2e-11   
emb|CAN74705.1|  hypothetical protein VITISV_032402                   71.2    2e-11   
ref|XP_002321642.1|  hypothetical protein POPTR_0015s09710g           70.9    2e-11   
ref|XP_008460927.1|  PREDICTED: terpene synthase 10-like isoform X1   71.2    2e-11   
gb|ABW98504.1|  terpene synthase                                      70.9    2e-11   
ref|XP_002275058.1|  PREDICTED: valencene synthase                    70.9    2e-11   
ref|XP_007133014.1|  hypothetical protein PHAVU_011G143900g           69.7    2e-11   
ref|XP_006358818.1|  PREDICTED: germacrene C synthase-like            70.9    2e-11   
gb|KCW74867.1|  hypothetical protein EUGRSUZ_E03605                   70.9    2e-11   
gb|KDO41838.1|  hypothetical protein CISIN_1g041926mg                 70.9    2e-11   
ref|XP_008460928.1|  PREDICTED: (-)-alpha-terpineol synthase-like...  70.9    2e-11   
ref|XP_011095786.1|  PREDICTED: germacrene-D synthase-like            70.9    2e-11   
ref|XP_003593394.1|  Linalool synthase                                70.9    2e-11   
sp|Q84ND0.1|TPS2_ANTMA  RecName: Full=Tricyclene synthase Oc15, c...  70.9    2e-11   
gb|KGN62109.1|  hypothetical protein Csa_2G298310                     71.2    2e-11   
gb|KCW76745.1|  hypothetical protein EUGRSUZ_D01100                   70.9    2e-11   
ref|XP_009757760.1|  PREDICTED: (-)-germacrene D synthase-like is...  70.9    2e-11   
sp|Q84NC9.1|TPS3_ANTMA  RecName: Full=Tricyclene synthase 1e20, c...  70.9    2e-11   
sp|Q0VHD6.1|TSGD1_ZINOF  RecName: Full=(+)-germacrene D synthase      70.9    2e-11   
gb|KHN36749.1|  (-)-germacrene D synthase                             70.5    2e-11   
ref|XP_007133018.1|  hypothetical protein PHAVU_011G144200g           70.9    2e-11   
ref|XP_008448865.1|  PREDICTED: (-)-germacrene D synthase-like        70.9    2e-11   
ref|XP_010088018.1|  Myrcene synthase                                 70.9    2e-11   
ref|XP_010058977.1|  PREDICTED: (-)-germacrene D synthase-like        70.5    2e-11   
gb|KDO47740.1|  hypothetical protein CISIN_1g048051mg                 68.9    2e-11   
ref|XP_010105617.1|  (-)-germacrene D synthase                        70.5    2e-11   
ref|XP_006365530.1|  PREDICTED: germacrene C synthase-like            70.9    3e-11   
emb|CBI31280.3|  unnamed protein product                              69.7    3e-11   
ref|XP_011090538.1|  PREDICTED: germacrene-D synthase-like            70.5    3e-11   
ref|XP_009349841.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  70.5    3e-11   
gb|AID55338.1|  terpene synthase                                      70.5    3e-11   
gb|AIK19226.1|  sesquiterpene synthase                                70.5    3e-11   
ref|XP_009349840.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like...  70.5    3e-11   
ref|XP_007133003.1|  hypothetical protein PHAVU_011G143100g           70.1    3e-11   
ref|XP_011015484.1|  PREDICTED: valencene synthase-like               70.5    3e-11   
ref|XP_004504949.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...  67.4    3e-11   
gb|AFD64744.1|  plastid geraniol synthase                             70.5    3e-11   
ref|XP_007021121.1|  Delta-cadinene synthase isozyme A                70.5    3e-11   
emb|CAN76687.1|  hypothetical protein VITISV_021510                   70.1    3e-11   
gb|AEM23830.1|  sesquiterpene synthase                                70.1    3e-11   
ref|XP_004295289.1|  PREDICTED: (-)-germacrene D synthase-like        70.1    3e-11   
ref|XP_008371218.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     70.1    4e-11   
gb|KGN56190.1|  hypothetical protein Csa_3G097540                     70.1    4e-11   
gb|AIG92847.1|  sesquiterpene synthase 6                              70.1    4e-11   
sp|J7LQ09.1|TPS7_PHYDL  RecName: Full=Trans-alpha-bergamotene syn...  70.1    4e-11   
dbj|BAI67935.1|  sesquiterpene synthase                               70.1    4e-11   
dbj|BAG50434.1|  sesquiterpene synthase 4                             70.1    4e-11   
ref|XP_011095787.1|  PREDICTED: germacrene-D synthase-like            70.1    4e-11   
gb|AAG01339.1|  terpene synthase                                      70.1    4e-11   
gb|ADB93807.1|  chloroplast terpenoid cyclase                         68.9    4e-11   
ref|XP_006475310.1|  PREDICTED: (-)-germacrene D synthase-like        70.5    4e-11   
ref|XP_006478792.1|  PREDICTED: (-)-germacrene D synthase-like        69.7    5e-11   
gb|KDO38269.1|  hypothetical protein CISIN_1g008206mg                 69.7    5e-11   
emb|CBI31293.3|  unnamed protein product                              67.4    5e-11   
ref|XP_003597053.1|  Myrcene synthase                                 69.7    5e-11   
gb|KDO45658.1|  hypothetical protein CISIN_1g039366mg                 69.7    5e-11   
gb|AGL98420.1|  germacrene-D synthase                                 69.7    5e-11   
gb|KDO38265.1|  hypothetical protein CISIN_1g008206mg                 69.7    5e-11   
ref|XP_008232170.1|  PREDICTED: (-)-germacrene D synthase-like        69.7    5e-11   
ref|XP_008366777.1|  PREDICTED: LOW QUALITY PROTEIN: (-)-germacre...  69.7    5e-11   
sp|Q9FQ27.1|TPSGB_SOLHA  RecName: Full=(E,E)-germacrene B synthase    69.7    5e-11   
gb|AGW18160.1|  terpene synthase 3                                    69.7    5e-11   
emb|CDP12282.1|  unnamed protein product                              69.3    5e-11   
ref|XP_010059288.1|  PREDICTED: (-)-germacrene D synthase-like        70.1    5e-11   
gb|KGN56189.1|  hypothetical protein Csa_3G097040                     69.7    5e-11   
ref|XP_006358783.1|  PREDICTED: germacrene C synthase-like            69.7    5e-11   
gb|KDO38264.1|  hypothetical protein CISIN_1g008206mg                 69.7    5e-11   
dbj|BAG50432.1|  sesquiterpene synthase 5                             69.7    5e-11   
ref|XP_006494713.1|  PREDICTED: (-)-germacrene D synthase-like is...  69.7    5e-11   
ref|XP_010042263.1|  PREDICTED: (-)-germacrene D synthase-like        69.7    5e-11   
ref|XP_006469778.1|  PREDICTED: probable terpene synthase 11-like     69.7    6e-11   
ref|XP_010040556.1|  PREDICTED: beta-bisabolene synthase-like         69.7    6e-11   
ref|XP_006494712.1|  PREDICTED: (-)-germacrene D synthase-like is...  69.7    6e-11   
dbj|BAI67936.1|  sesquiterpene synthase                               69.7    6e-11   
ref|XP_006469889.1|  PREDICTED: (-)-germacrene D synthase-like        69.7    6e-11   
gb|KDO38263.1|  hypothetical protein CISIN_1g008206mg                 69.7    6e-11   
ref|XP_010059419.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     69.7    6e-11   
sp|Q94JS8.1|FARS_CITJU  RecName: Full=(E)-beta-farnesene synthase...  69.7    6e-11   
gb|KCW74839.1|  hypothetical protein EUGRSUZ_E03574                   69.3    6e-11   
ref|XP_011095783.1|  PREDICTED: germacrene-D synthase-like            69.7    6e-11   
gb|ADJ67476.1|  (E)-beta-farnesene synthase                           69.7    6e-11   
ref|NP_193406.3|  terpene synthase 02                                 69.3    6e-11   
gb|AIW60869.1|  E-beta-farnesene synthase                             69.7    6e-11   
ref|XP_010046462.1|  PREDICTED: beta-bisabolene synthase-like         69.7    6e-11   
gb|ADK94034.1|  alpha-copaene synthase                                69.3    6e-11   
ref|XP_004242295.1|  PREDICTED: germacrene C synthase-like            69.3    6e-11   
ref|XP_007149677.1|  hypothetical protein PHAVU_005G089800g           69.3    7e-11   
gb|AII32471.1|  terpene synthase                                      69.3    7e-11   
gb|AFE56211.1|  terpene synthase                                      69.3    7e-11   
ref|XP_006351843.1|  PREDICTED: (-)-camphene/tricyclene synthase,...  69.7    7e-11   
gb|AGZ84810.1|  beta-caryophyllene synthase                           69.3    7e-11   
ref|XP_010321148.1|  PREDICTED: (3S,6E)-nerolidol synthase 1, chl...  67.4    7e-11   
ref|XP_004248509.2|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     69.3    7e-11   
ref|XP_002266808.1|  PREDICTED: (-)-alpha-terpineol synthase          69.3    7e-11   
gb|AEM23825.1|  sesquiterpene synthase                                69.3    7e-11   
gb|KDO38266.1|  hypothetical protein CISIN_1g008206mg                 68.9    7e-11   
ref|XP_004230563.1|  PREDICTED: (-)-camphene/tricyclene synthase,...  69.3    7e-11   
ref|XP_009609204.1|  PREDICTED: LOW QUALITY PROTEIN: germacrene C...  69.3    7e-11   
ref|XP_006351844.1|  PREDICTED: (-)-camphene/tricyclene synthase,...  69.3    7e-11   
gb|AHF22834.1|  drimenol synthase                                     69.3    7e-11   
gb|AEP82782.1|  TPS14                                                 69.3    7e-11   
ref|XP_004247892.1|  PREDICTED: germacrene C synthase-like            69.3    7e-11   
ref|XP_008226805.1|  PREDICTED: (-)-alpha-pinene synthase-like        69.3    8e-11   
ref|XP_004298303.1|  PREDICTED: (-)-germacrene D synthase-like        69.3    8e-11   
emb|CAN78938.1|  hypothetical protein VITISV_029480                   68.9    8e-11   
ref|XP_010440109.1|  PREDICTED: (E)-beta-ocimene synthase, chloro...  69.3    8e-11   
gb|AAL25826.1|  cyclase                                               69.3    8e-11   
gb|KDP42347.1|  hypothetical protein JCGZ_02820                       69.3    8e-11   
ref|XP_010645642.1|  PREDICTED: (-)-alpha-terpineol synthase-like     69.3    8e-11   
sp|K4L9M2.1|STS1_THAGA  RecName: Full=Sesquiterpene synthase 1; A...  69.3    8e-11   
gb|ACI32638.1|  MTS2                                                  69.3    8e-11   
gb|AES98818.2|  sesquiterpene synthase                                68.9    9e-11   
ref|XP_003615860.1|  (+)-delta-cadinene synthase isozyme C2           68.9    9e-11   
pdb|3M01|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...  68.9    9e-11   
pdb|1HXC|A  Chain A, Crystal Structure Of Teas C440w                  68.9    9e-11   
pdb|3LZ9|A  Chain A, The Crystal Structure Of 5-Epi-Aristolochene...  68.9    9e-11   
pdb|1HXG|A  Chain A, Crystal Structure Of Teas W273sC440W             68.9    9e-11   
emb|CAN62729.1|  hypothetical protein VITISV_003091                   68.9    9e-11   
gb|KCW70094.1|  hypothetical protein EUGRSUZ_F03400                   68.9    9e-11   
pdb|5EAU|A  Chain A, 5-Epi-Aristolochene Synthase From Nicotiana ...  68.9    9e-11   
sp|Q40577.3|5EAS_TOBAC  RecName: Full=5-epi-aristolochene synthas...  68.9    9e-11   
sp|P0CJ43.1|OCISB_ARATH  RecName: Full=(E)-beta-ocimene synthase,...  68.9    9e-11   
ref|XP_010092286.1|  (-)-germacrene D synthase                        68.9    9e-11   
gb|ADK62524.1|  geraniol synthase                                     68.9    1e-10   
pdb|1HX9|A  Chain A, Crystal Structure Of Teas W273s Form 1           68.9    1e-10   
gb|AIC76495.1|  terpene synthase                                      68.9    1e-10   
ref|XP_009386877.1|  PREDICTED: alpha-humulene synthase-like          68.9    1e-10   
sp|Q8SA63.1|CARS_ARTAN  RecName: Full=Beta-caryophyllene synthase     68.9    1e-10   
ref|XP_009794478.1|  PREDICTED: germacrene C synthase-like            68.9    1e-10   
ref|XP_003614996.1|  (+)-delta-cadinene synthase isozyme A            68.9    1e-10   
ref|XP_007133006.1|  hypothetical protein PHAVU_011G143300g           68.9    1e-10   
sp|D2YZP9.1|BISS_ZINOF  RecName: Full=(S)-beta-bisabolene synthas...  68.9    1e-10   
gb|KDP32236.1|  hypothetical protein JCGZ_13843                       68.6    1e-10   
ref|XP_006493820.1|  PREDICTED: (E)-beta-farnesene synthase-like      68.6    1e-10   
ref|XP_004308569.1|  PREDICTED: (-)-germacrene D synthase-like        68.9    1e-10   
gb|KCW74836.1|  hypothetical protein EUGRSUZ_E03571                   68.2    1e-10   
emb|CDP20681.1|  unnamed protein product                              68.6    1e-10   
gb|KCW76749.1|  hypothetical protein EUGRSUZ_D01104                   66.2    1e-10   
ref|XP_002519897.1|  Casbene synthase, chloroplast precursor, put...  68.6    1e-10   
ref|XP_010062945.1|  PREDICTED: (-)-germacrene D synthase-like        68.6    1e-10   
emb|CCM43928.1|  linalool/myrcene synthase                            68.6    1e-10   
pdb|4DI5|A  Chain A, Co-Crystal Structure Of Wt 5-Epi-Aristoloche...  68.6    1e-10   
ref|XP_009600964.1|  PREDICTED: (-)-alpha-terpineol synthase-like     68.6    1e-10   
gb|ABW86881.1|  limonene synthase                                     68.6    1e-10   
gb|EYU46035.1|  hypothetical protein MIMGU_mgv1a019488mg              68.6    1e-10   
gb|AIW00680.1|  sesquiterpene cyclase                                 68.6    1e-10   
gb|KDP25062.1|  hypothetical protein JCGZ_22597                       68.9    1e-10   
gb|AGB05616.1|  sesquiterpene synthase 7                              68.6    1e-10   
ref|XP_010645661.1|  PREDICTED: (-)-alpha-terpineol synthase-like     67.0    1e-10   
ref|XP_010109572.1|  R-linalool synthase                              68.6    1e-10   
ref|XP_008462842.1|  PREDICTED: probable terpene synthase 2 isofo...  68.6    1e-10   
ref|XP_010051308.1|  PREDICTED: monoterpene synthase-like isoform X5  68.2    1e-10   
ref|XP_004504948.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     68.6    1e-10   
ref|XP_006374233.1|  hypothetical protein POPTR_0015s05270g           68.2    2e-10   
ref|XP_010109850.1|  (+)-alpha-pinene synthase                        65.9    2e-10   
ref|XP_006467945.1|  PREDICTED: (3S,6E)-nerolidol synthase 2, chl...  68.6    2e-10   
ref|XP_009762840.1|  PREDICTED: 5-epi-aristolochene synthase-like...  68.2    2e-10   
ref|XP_006843914.1|  hypothetical protein AMTR_s00007p00269050        68.2    2e-10   
ref|XP_003597054.1|  Myrcene synthase                                 68.2    2e-10   
ref|XP_010645411.1|  PREDICTED: (-)-alpha-terpineol synthase-like     67.4    2e-10   
ref|XP_010051282.1|  PREDICTED: monoterpene synthase-like isoform X1  68.2    2e-10   
ref|XP_009768422.1|  PREDICTED: (-)-germacrene D synthase-like is...  68.2    2e-10   
gb|AAX16121.1|  germacrene-D synthase                                 68.2    2e-10   
gb|KDP32240.1|  hypothetical protein JCGZ_13847                       68.2    2e-10   
ref|XP_003528418.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     68.2    2e-10   
gb|KDO74408.1|  hypothetical protein CISIN_1g008427mg                 68.2    2e-10   
gb|KDP39015.1|  hypothetical protein JCGZ_00772                       68.2    2e-10   
gb|AGB05614.1|  sesquiterpene synthase 5                              68.2    2e-10   
gb|ADR74206.1|  (E)-beta-ocimene/myrcene synthase                     68.2    2e-10   
ref|XP_010686920.1|  PREDICTED: (3S,6E)-nerolidol synthase 1-like     68.2    2e-10   



>emb|CAN76849.1| hypothetical protein VITISV_005997 [Vitis vinifera]
Length=595

 Score =   108 bits (269),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   ++ ED L+ L +I+AIQ LGID+HF+++I ++LQRQY K        ++L+E ++
Sbjct  99   RNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYXKASXHGESIQDLYEVAL  158

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+P+DVF  F N +GKFK+ LSKDIK
Sbjct  159  RFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIK  194



>emb|CBI41007.3| unnamed protein product [Vitis vinifera]
Length=573

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   ++ ED L+ L +I+AIQ LGID+HF+++I ++LQRQY K        ++L+E ++
Sbjct  116  RNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYTKASTHGESIQDLYEVAL  175

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+P+DVF  F N +GKFK+ LSKDIK
Sbjct  176  RFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIK  211



>ref|XP_002263717.2| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=612

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   ++ ED L+ L +I+AIQ LGID+HF+++I ++LQRQY K        ++L+E ++
Sbjct  116  RNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYTKASTHGESIQDLYEVAL  175

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+P+DVF  F N +GKFK+ LSKDIK
Sbjct  176  RFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIK  211



>gb|AEY82696.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=577

 Score =   106 bits (264),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   ++ ED L+ L +I+AIQ LGID+HF+++I ++LQRQY K        ++L+E ++
Sbjct  81   RNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYMKASTHGESIQDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+P+DVF  F N +GKFK+ LSKDIK
Sbjct  141  RFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIK  176



>gb|ADR74212.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=577

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   ++ ED L+ L +I+AIQ LGID+HF+++I ++LQRQY K        ++L+E ++
Sbjct  81   RNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYMKASTHGESIQDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+P+DVF  F N +GKFK+ LSKDIK
Sbjct  141  RFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIK  176



>gb|ADR74211.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=612

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   ++ ED L+ L +I+AIQ LGID+HF+++I ++LQRQY K        ++L+E ++
Sbjct  116  RNVFSEVGEDTLEGLMMIDAIQRLGIDYHFKEEIEAVLQRQYMKASNHGESIQDLYEVAL  175

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+P+DVF  F N +GKFK+ LSKDIK
Sbjct  176  RFRLLRQEGYHVPADVFNNFKNKEGKFKQNLSKDIK  211



>emb|CBI41006.3| unnamed protein product [Vitis vinifera]
Length=408

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  189  VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSDV  368
            +I+AIQ LGID+HF+++I ++LQRQY K G      ++L+E ++ FRLLRQ+GYH+P+DV
Sbjct  1    MIDAIQRLGIDYHFKEEIEAVLQRQYMKAGTHGESIQDLYEVALRFRLLRQEGYHVPADV  60

Query  369  FTKFINDKGKFKEELSKDIK  428
            F  F N +GKFK+ LSKDIK
Sbjct  61   FNNFKNKEGKFKQNLSKDIK  80



>emb|CBI40949.3| unnamed protein product [Vitis vinifera]
Length=160

 Score = 93.2 bits (230),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ FRLL
Sbjct  53   KLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLL  112

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  113  RQEGYTVPADVLNNFKNKEGKFKQNLREDIR  143



>ref|XP_010646667.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Vitis 
vinifera]
Length=177

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ FRLL
Sbjct  55   KLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLL  114

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  115  RQEGYTLPADVLNNFKNKEGKFKQNLREDIR  145



>emb|CBI40951.3| unnamed protein product [Vitis vinifera]
Length=208

 Score = 92.8 bits (229),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ FRLL
Sbjct  86   KLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLL  145

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  146  RQEGYTLPADVLNNFKNKEGKFKQNLREDIR  176



>emb|CBI33220.3| unnamed protein product [Vitis vinifera]
Length=490

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  81   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  141  RFRLLRQEGYTVPADVLNNFKNKEGKFKQNLREDIR  176



>emb|CBI33221.3| unnamed protein product [Vitis vinifera]
Length=508

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  81   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  141  RFRLLRQEGYTVPADVLNNFKNKEGKFKQNLREDIR  176



>ref|XP_010646705.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Vitis 
vinifera]
Length=539

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  81   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  141  RFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIR  176



>ref|NP_001267895.1| (3S,6E)-nerolidol synthase 1, chloroplastic-like [Vitis vinifera]
 gb|ADR74215.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYHVSADVFNNLKDTEGKLQEKLSEDIK  144



>emb|CBI40952.3| unnamed protein product [Vitis vinifera]
Length=388

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 68/91 (75%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ FRLL
Sbjct  53   KLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLL  112

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  113  RQEGYTVPADVLNNFKNKEGKFKQNLREDIR  143



>ref|XP_003635177.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Vitis 
vinifera]
Length=583

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  81   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  141  RFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIR  176



>ref|XP_010646706.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X3 [Vitis 
vinifera]
Length=532

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  30   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  89

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  90   RFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIR  125



>emb|CBI41004.3| unnamed protein product [Vitis vinifera]
Length=550

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  48   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  107

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY +P+DV   F N +GKFK+ L +DI+
Sbjct  108  RFRLLRQEGYTLPADVLNNFKNKEGKFKQNLREDIR  143



>ref|XP_010646907.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X2 [Vitis vinifera]
Length=544

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  48   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  107

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+ +DVF    + +GK +E+LS+DIK
Sbjct  108  GFRLLRQEGYHVSADVFNNLKDTEGKLQEKLSEDIK  143



>ref|XP_010646906.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X1 [Vitis vinifera]
Length=545

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAV  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIK  144



>ref|NP_001267928.1| (3S,6E)-nerolidol synthase 1, chloroplastic-like [Vitis vinifera]
 gb|ADR74210.1| (3S)-linalool/(E)-nerolidol synthase [Vitis vinifera]
Length=584

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++   ++ ED ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++
Sbjct  81   KHVFSKLGEDAMESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVAL  140

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY  P+DV   F N +GKFK+ L +DI+
Sbjct  141  RFRLLRQEGYTXPADVLNNFKNKEGKFKQNLREDIR  176



>gb|ADD81295.1| linalool synthase [Actinidia polygama]
Length=574

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 45/96 (47%), Positives = 70/96 (73%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +++E  L+ L +I+ +Q LGID+HFQ +IG++LQ+Q  K    + ++ +LFE S 
Sbjct  80   RRALREVEETPLEGLVMIDTLQRLGIDYHFQGEIGALLQKQQRKSKCDYPEH-DLFEVST  138

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+G+++P+DVF  F + KG+FK ELS+DI+
Sbjct  139  RFRLLRQEGHNVPADVFNHFRDKKGRFKSELSRDIR  174



>ref|NP_001267990.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
 gb|ADR74214.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIK  144



>emb|CAN81698.1| hypothetical protein VITISV_037651 [Vitis vinifera]
Length=508

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E ++
Sbjct  9    RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAL  68

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  69   GFRLLRQEGYYVSADVFNNLKDTEGKJQEKLSEDIK  104



>emb|CBI23523.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  11   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  70

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  71   GFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIK  106



>ref|XP_010646921.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Vitis 
vinifera]
Length=320

 Score = 90.1 bits (222),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIK  144



>emb|CBI23481.3| unnamed protein product [Vitis vinifera]
Length=291

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  11   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  70

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  71   GFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIK  106



>gb|ADR74213.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score = 92.0 bits (227),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIK  144



>ref|XP_003635282.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=545

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKIQEKLSEDIK  144



>ref|XP_010646919.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X1 [Vitis vinifera]
Length=493

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ FRLLRQ+GY 
Sbjct  1    MESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLLRQEGYT  60

Query  354  IPSDVFTKFINDKGKFKEELSKDIK  428
            +P+DV   F N +GKFK+ L +DI+
Sbjct  61   VPADVLNNFKNKEGKFKQNLREDIR  85



>ref|XP_003635413.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=545

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  49   RRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSQDIK  144



>ref|XP_003635168.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
Length=545

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  49   RRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  109  GFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIK  144



>emb|CBI23507.3| unnamed protein product [Vitis vinifera]
Length=209

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  11   RRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  70

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  71   GFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSQDIK  106



>emb|CBI23482.3| unnamed protein product [Vitis vinifera]
Length=559

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 67/96 (70%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  149  RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  208

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GYH+ +DVF    + +GK +E+LS+DIK
Sbjct  209  GFRLLRQEGYHVSADVFNNLKDTEGKLQEKLSEDIK  244



>emb|CAN66667.1| hypothetical protein VITISV_032494 [Vitis vinifera]
Length=493

 Score = 90.5 bits (223),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/85 (47%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++ + +I+AIQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ FRLLRQ+GY 
Sbjct  1    MESMMMIDAIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLLRQEGYT  60

Query  354  IPSDVFTKFINDKGKFKEELSKDIK  428
            +P+DV   F N +GKFK+ L +DI+
Sbjct  61   LPADVLNNFKNKEGKFKQNLREDIR  85



>ref|XP_004151014.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
Length=565

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF-GILFRDNKELFETSILFRLLRQD  344
            D  + L++I+A Q LGID+HFQ++I ++LQRQY  F  I +  + +L + ++LFRL RQ 
Sbjct  78   DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAIQYNPDTDLHKAALLFRLFRQQ  137

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY + +DVF  F++ KGKFKEEL +D+K
Sbjct  138  GYLVSADVFKSFMDKKGKFKEELREDVK  165



>ref|XP_004166431.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
Length=831

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 43/88 (49%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF-GILFRDNKELFETSILFRLLRQD  344
            D  + L++I+A Q LGID+HFQ++I ++LQRQY  F  I +  + +L + ++LFRL RQ 
Sbjct  344  DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAIQYNPDTDLHKAALLFRLFRQQ  403

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY + +DVF  F++ KGKFKEEL +D+K
Sbjct  404  GYLVSADVFKSFMDKKGKFKEELREDVK  431



>gb|KGN64589.1| hypothetical protein Csa_1G068570 [Cucumis sativus]
Length=574

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF-GILFRDNKELFETSILFRLLRQD  344
            D  + L++I+A Q LGID+HFQ++I ++LQRQY  F  I +  + +L + ++LFRL RQ 
Sbjct  87   DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAIQYNPDTDLHKAALLFRLFRQQ  146

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY + +DVF  F++ KGKFKEEL +D+K
Sbjct  147  GYLVSADVFKSFMDKKGKFKEELREDVK  174



>gb|ADD81294.1| linalool synthase [Actinidia arguta]
Length=574

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 67/96 (70%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +++E  L+ L +I+ +Q LGID+HFQ +IG++LQ+Q  +         +LFE S 
Sbjct  80   RRALREVEETPLEGLVMIDTLQRLGIDYHFQGEIGALLQKQ-QRISTCDYPEHDLFEVST  138

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+G+++P+DVF  F + +G+FK ELS+DI+
Sbjct  139  RFRLLRQEGHNVPADVFNNFRDKEGRFKSELSRDIR  174



>gb|KDP42343.1| hypothetical protein JCGZ_02816 [Jatropha curcas]
Length=569

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 45/95 (47%), Positives = 66/95 (69%), Gaps = 5/95 (5%)
 Frame = +3

Query  159  IQEDD----LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNK-ELFETSIL  323
            ++EDD    L+ L +I+++Q LGI++HFQD+I  +L+  Y K    +   K +L + +I 
Sbjct  75   LEEDDDHLSLESLEMIDSVQRLGIEYHFQDEINEVLENHYKKTSSGYTHQKHDLSQVAIR  134

Query  324  FRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            FRLLRQ GY +P+DVF KF N +GKFK+EL+ DIK
Sbjct  135  FRLLRQQGYCVPADVFKKFKNKEGKFKQELACDIK  169



>ref|NP_001268060.1| (3S,6E)-nerolidol synthase 1-like [Vitis vinifera]
 gb|ADR74216.1| (3S)-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase 
[Vitis vinifera]
Length=545

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  49   RSVLKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTMSDCHNNLYELAL  108

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY+  +DVF    + +GK +E+LS+D+K
Sbjct  109  GFRLLRQEGYYASADVFNNLKDTEGKIQEKLSEDVK  144



>emb|CBI23484.3| unnamed protein product [Vitis vinifera]
Length=208

 Score = 86.7 bits (213),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED ++ + +I+ IQ LGIDHHF+++I ++LQ+QY K  I    +++L+E ++ +RLL
Sbjct  86   KLGEDAMESMMMIDVIQRLGIDHHFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRYRLL  145

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+DV   F   +GKFK+ L +DI+
Sbjct  146  RQEGYTLPADVLNNFKIKEGKFKQNLREDIR  176



>emb|CBI40948.3| unnamed protein product [Vitis vinifera]
Length=432

 Score = 88.6 bits (218),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 43/96 (45%), Positives = 66/96 (69%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L ++ ED L+ L +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++
Sbjct  105  RRALKEVGEDTLEALLMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELAL  164

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF    + +GK +E+LS+DIK
Sbjct  165  GFRLLRQEGYYVSADVFNNLKDTEGKLQEKLSEDIK  200



>ref|XP_008441685.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=578

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF-GILFRDNKELFETSILFRLLRQD  344
            D  + L++I+A Q LGID+HFQ++I ++LQRQY  F  + F    +L + ++LFRL RQ 
Sbjct  91   DPWECLNLIDATQRLGIDYHFQEEIEAVLQRQYVLFNAVQFNPETDLHKAALLFRLFRQQ  150

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY + +DVF  F++ KGKFKE+L +DIK
Sbjct  151  GYLVSADVFKSFMDKKGKFKEDLREDIK  178



>ref|XP_007025896.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
 gb|EOY28518.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
Length=584

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 43/91 (47%), Positives = 62/91 (68%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED LQ L +++AIQ LGIDHHFQ +I  +LQ+QY         + +L E S+ FRLL
Sbjct  87   EVGEDPLQALAMVDAIQRLGIDHHFQYEIDEVLQKQYMLSCTNGVHDYDLQEVSLRFRLL  146

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+ VF +F + +G F+ EL +DIK
Sbjct  147  RQEGYFVPAGVFDRFKDREGGFRNELRRDIK  177



>ref|XP_006377269.1| hypothetical protein POPTR_0011s03490g [Populus trichocarpa]
 gb|ERP55066.1| hypothetical protein POPTR_0011s03490g [Populus trichocarpa]
Length=444

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 43/95 (45%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++ L +  E+ +Q L +I+AIQ L ID+HFQ++I SIL RQ      +  DN  L+E ++
Sbjct  80   KHILRKEGEEPIQGLAMIDAIQRLSIDYHFQEEIDSILTRQSMLLSTIHSDNN-LYEVAL  138

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FRLLRQ GYH+ + VF  F +++G+FK++LS DI
Sbjct  139  RFRLLRQQGYHVSAGVFDTFKDNEGRFKQQLSSDI  173



>emb|CDO99690.1| unnamed protein product [Coffea canephora]
Length=605

 Score = 87.0 bits (214),  Expect = 6e-17, Method: Composition-based stats.
 Identities = 50/119 (42%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +3

Query  45   QSMNSGKQDVPFISKIGKDepevkyeekmeevRNFLYQIQEDDLQVLHVINAIQHLGIDH  224
            Q +NS    + +   +  DE  V+  +KM +VR+ L    ED L+ L +++AIQ LGIDH
Sbjct  44   QCLNSAFNPLIYHEDLVNDELYVRRTQKMMDVRHMLKTGGEDRLKDLRLVDAIQRLGIDH  103

Query  225  HFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSDVFTKFINDKGKF  401
            HFQ++I +++ RQ+      F  ++ L E S+ FRLLRQ+GY++P DVF  F ++KGKF
Sbjct  104  HFQEEIEALIWRQHVSAKCCFDQSEGLHEVSLCFRLLRQEGYYVPPDVFNNFKDEKGKF  162



>gb|KDP42342.1| hypothetical protein JCGZ_02815 [Jatropha curcas]
Length=548

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Composition-based stats.
 Identities = 43/99 (43%), Positives = 65/99 (66%), Gaps = 5/99 (5%)
 Frame = +3

Query  147  FLYQIQEDDLQV----LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNK-ELFE  311
            F   ++EDD  +    L +I+++Q LGI++HFQD+I  +L+ QY K    +   K +L +
Sbjct  48   FRKALEEDDGHLSPESLRMIDSVQRLGIEYHFQDEINEVLETQYKKISTGYTHEKHDLSQ  107

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++ FRLLRQ GY +P++VF KF N  GKFK+EL KD +
Sbjct  108  VALRFRLLRQQGYWVPAEVFNKFKNKDGKFKQELVKDTQ  146



>emb|CBI23483.3| unnamed protein product [Vitis vinifera]
Length=189

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = +3

Query  186  HVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSD  365
            H+I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E ++ FRLLRQ+GY++ +D
Sbjct  6    HMIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAVGFRLLRQEGYYVSAD  65

Query  366  VFTKFINDKGKFKEELSKDIK  428
            VF    + +GK +E+LS+DIK
Sbjct  66   VFNNLKDTEGKLQEKLSEDIK  86



>ref|XP_008224889.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Prunus mume]
Length=580

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 45/102 (44%), Positives = 67/102 (66%), Gaps = 8/102 (8%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY------NKFGILFRDNKE  302
            R+ L ++ E+ ++ L++I+A+Q LGIDHHFQ++I  ILQ+Q+      +  G     + +
Sbjct  78   RHVLRKLGEEAIEGLNMIDAVQRLGIDHHFQEEIDQILQKQHLIITSGSAHGA--DHHSD  135

Query  303  LFETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            L E ++ FRLLRQ GY +P DVF KF    G FK+ LS+DIK
Sbjct  136  LHEVAVRFRLLRQQGYFVPDDVFEKFKESDGSFKQMLSEDIK  177



>emb|CAN81129.1| hypothetical protein VITISV_002911 [Vitis vinifera]
Length=561

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L +I++IQ LG+ +HF+ +I   L+  Y  +  L  DN  L   S+LFRLLRQ+GYHI
Sbjct  77   QLLKLIDSIQRLGLAYHFEREIEEALKAMYQTY-TLVDDNDHLTTVSLLFRLLRQEGYHI  135

Query  357  PSDVFTKFINDKGKFKEELSKDI  425
            PSDVF KF+++ G FKE L  D+
Sbjct  136  PSDVFKKFMDEGGNFKESLVGDL  158



>emb|CBI23480.3| unnamed protein product [Vitis vinifera]
Length=167

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED ++ + +I+AIQ LGIDH F+++I ++LQ+QY K  I    +++L+E ++ FRL 
Sbjct  86   KLGEDAMESMMMIDAIQRLGIDHQFEEEIEAVLQKQYMKSSIHGDCDEDLYEVALRFRLF  145

Query  336  RQDGYHIPSDVFTKFINDKGKF  401
            RQ+GY +P+DV   F N +GKF
Sbjct  146  RQEGYTVPADVLNNFKNKEGKF  167



>ref|XP_002282488.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CBI20289.3| unnamed protein product [Vitis vinifera]
 gb|ADR74225.1| selina-411-diene/intermedeol synthase [synthetic construct]
Length=561

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 41/83 (49%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L +I++IQ LG+ +HF+ +I   L+  Y  +  L  DN  L   S+LFRLLRQ+GYHI
Sbjct  77   QLLKLIDSIQRLGLAYHFEREIEEALKAMYQTY-TLVDDNDHLTTVSLLFRLLRQEGYHI  135

Query  357  PSDVFTKFINDKGKFKEELSKDI  425
            PSDVF KF+++ G FKE L  D+
Sbjct  136  PSDVFKKFMDEGGNFKESLVGDL  158



>gb|AGX26045.1| bifunctional terpenoid synthase [Camellia sinensis]
Length=575

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 64/96 (67%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            +  L ++ E+ L+ L +I+ +Q LGID+HFQ++I ++LQ QY K         +L+E S 
Sbjct  81   KRMLRKVGENPLEGLVMIDNLQRLGIDYHFQEEIEALLQSQYTKSNATTL-GYDLYEVST  139

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++P+DVF  F    GKFK EL+ D++
Sbjct  140  RFRLLRQEGYNVPADVFNNFKAKNGKFKPELNADMR  175



>gb|AEI52903.1| terpene synthase 3 [Populus trichocarpa]
Length=573

 Score = 84.7 bits (208),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 61/87 (70%), Gaps = 1/87 (1%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQD  344
            E+ +Q L +I+AIQ L ID+HFQ++I SIL RQ      +  DN  L+E ++ FRLLRQ 
Sbjct  88   EEPIQGLAMIDAIQRLSIDYHFQEEIDSILTRQSMLLSTIHSDNN-LYEVALRFRLLRQQ  146

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDI  425
            GYH+ + VF  F +++G+FK++LS DI
Sbjct  147  GYHVSAGVFDNFKDNEGRFKQQLSSDI  173



>ref|XP_007025895.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
 gb|EOY28517.1| 3S-linalool/(E)-nerolidol /(E,E)-geranyl linalool synthase, putative 
[Theobroma cacao]
Length=583

 Score = 84.3 bits (207),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 42/91 (46%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLL  335
            ++ ED  Q L +I+AIQ LGIDHHFQ +I  +LQ+QY         + +L E ++ FRLL
Sbjct  87   EVGEDPSQGLVMIDAIQRLGIDHHFQYEIDEVLQKQYMLSCTNGVHDYDLHEVALRFRLL  146

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ+GY +P+ VF +F + +G F+ EL +DIK
Sbjct  147  RQEGYFVPAGVFDRFKDREGSFRNELRRDIK  177



>ref|XP_007213872.1| hypothetical protein PRUPE_ppa003380mg [Prunus persica]
 gb|EMJ15071.1| hypothetical protein PRUPE_ppa003380mg [Prunus persica]
Length=579

 Score = 84.0 bits (206),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/100 (46%), Positives = 67/100 (67%), Gaps = 4/100 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY--NKFGILFRDN--KELF  308
            R+ L ++ E+ ++ L++I+A+Q LGIDHHFQ++I  ILQ+Q+     G     N   +L 
Sbjct  77   RHVLSKLGEEAVEGLNMIDAVQRLGIDHHFQEEIDQILQKQHLIITSGSAHGANHHSDLH  136

Query  309  ETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            E ++ FRLLRQ GY +P DVF KF   +G FK+ LS+DIK
Sbjct  137  EVAVRFRLLRQQGYFVPDDVFNKFKESEGSFKQMLSEDIK  176



>ref|XP_010248179.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Nelumbo nucifera]
 ref|XP_010248191.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Nelumbo nucifera]
Length=609

 Score = 83.6 bits (205),  Expect = 9e-16, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 61/90 (68%), Gaps = 2/90 (2%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG--ILFRDNKELFETSILFRLLR  338
            ED L+ + +I+A+Q L IDHHF+++I ++L   Y +FG  I       L + S+ FRL R
Sbjct  117  EDPLESMALIDALQRLCIDHHFEEEIRTVLSVLYTRFGSDIYQMGTGSLHDVSLCFRLFR  176

Query  339  QDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            Q GY +P+DVF KF +++G+FK EL++D +
Sbjct  177  QAGYCVPTDVFDKFRDNRGRFKPELNEDTR  206



>ref|XP_006365871.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum tuberosum]
Length=551

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 64/96 (67%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +I  + L+ L +I+ +Q LGI +HF+++I ++L+  Y  +      ++EL+ T++
Sbjct  51   RRMLEKIMTNSLEQLELIDILQRLGIYYHFEEEIDTVLKHIYVNYNKRDHHDEELYATAL  110

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+P ++F  F+N++GKFK  L +D K
Sbjct  111  EFRLLRQHGYHVPQEIFCSFMNEEGKFKTVLVEDTK  146



>gb|AEP82768.1| terpene synthase [Solanum lycopersicum]
Length=546

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +   + L+ L +++ +Q LGI +HF+++I ++L++ Y  +      N+EL++T++
Sbjct  51   RKMLQKRMTNSLEQLELVDILQRLGIYYHFEEEIDTVLKQIYVNYNKRDHHNEELYDTAL  110

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+P ++F  F+N++GKFK  L +D K
Sbjct  111  EFRLLRQHGYHLPQEIFCSFMNEEGKFKTALVEDTK  146



>ref|XP_004233802.1| PREDICTED: (-)-alpha-terpineol synthase-like [Solanum lycopersicum]
Length=538

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 65/96 (68%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +   + L+ L +++ +Q LGI +HF+++I ++L++ Y  +      N+EL++T++
Sbjct  43   RKMLQKRMTNSLEQLELVDILQRLGIYYHFEEEIDTVLKQIYVNYNKRDHHNEELYDTAL  102

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+P ++F  F+N++GKFK  L +D K
Sbjct  103  EFRLLRQHGYHLPQEIFCSFMNEEGKFKTALVEDTK  138



>ref|XP_004309665.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=585

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQE-DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETS  317
            RN L  + E D L+ L++I+A+Q LGID HFQ +I  IL +Q +    +   + +L E +
Sbjct  92   RNVLRNVAELDALEGLNMIDAVQRLGIDFHFQREIDEILHKQMS----IVSASDDLHEVA  147

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GY +P DVF  F + KG FK+ L +DIK
Sbjct  148  LRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIK  184



>sp|P0CV96.1|NES1_FRAVE RecName: Full=(3S,6E)-nerolidol synthase 1, chloroplastic; Short=FvNES1; 
Flags: Precursor [Fragaria vesca]
Length=580

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 46/97 (47%), Positives = 63/97 (65%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQE-DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETS  317
            RN L    E D L+ L++I+A+Q LGID+HFQ +I  IL +Q    GI+     +L+E +
Sbjct  87   RNVLRNAAELDALEGLNMIDAVQRLGIDYHFQREIDEILHKQ---MGIV-SACDDLYEVA  142

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GY +P DVF  F + KG FK+ L +DIK
Sbjct  143  LRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIK  179



>ref|XP_004293480.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=521

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 62/97 (64%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQE-DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETS  317
            RN L    E D L+ L++I+A+Q LGID+HFQ +I +IL +Q +    +   + +L E +
Sbjct  26   RNVLRNAAEVDALEGLNMIDAVQRLGIDYHFQREIDAILHKQMS----IVSASDDLHEVA  81

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GY +P DVF  F   KG FK+ L +DIK
Sbjct  82   LRFRLLRQHGYSVPEDVFNNFKESKGTFKQVLGEDIK  118



>gb|AER36088.1| nerolidol synthase [Actinidia chinensis]
Length=573

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 67/105 (64%), Gaps = 17/105 (16%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQ---------YNKFGILFRD  293
            R  L +++E+ L+ L +I+A+Q LGID+HF+ +IG+ LQ+Q         Y + G     
Sbjct  75   RKALREVEENPLEGLVMIDALQRLGIDYHFRGEIGAFLQKQQIISSTPDGYPEHG-----  129

Query  294  NKELFETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
               L+E S LFR LRQ+G+++ +DVF  F + +G+F+ ELS DI+
Sbjct  130  ---LYEVSTLFRFLRQEGHNVTADVFNNFKDKEGRFRSELSTDIR  171



>sp|P0CV95.1|NES2_FRAAN RecName: Full=(3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial; 
Short=FaNES2; Flags: Precursor [Fragaria x ananassa]
Length=578

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 44/97 (45%), Positives = 61/97 (63%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQE-DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETS  317
            RN L  + E D L+ L++I+A+Q LGID HFQ +I  IL +Q +        + +L E +
Sbjct  85   RNVLRNVAELDALEGLNMIDAVQRLGIDFHFQREIDEILHKQMSNVSA----SDDLHEVA  140

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GY +P DVF  F + KG FK+ L +DIK
Sbjct  141  LRFRLLRQHGYFVPEDVFNNFKDSKGTFKQVLGEDIK  177



>gb|AIC76501.1| terpene synthase [Prunus cerasoides var. campanulata]
Length=580

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 43/102 (42%), Positives = 67/102 (66%), Gaps = 8/102 (8%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY------NKFGILFRDNKE  302
            R+ L ++ E+ ++ L++I+A+Q LGIDHHFQ++I  ILQ+Q+      +  G     + +
Sbjct  78   RHVLSKLGEEAVEGLNMIDAVQRLGIDHHFQEEIDQILQKQHLIITSGSAHGA--DHHSD  135

Query  303  LFETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            L E ++ FRLLRQ GY +P DVF KF   +G FK+ LS+ I+
Sbjct  136  LHEVAVRFRLLRQQGYFVPDDVFNKFKESEGSFKKMLSEGIQ  177



>ref|XP_007159218.1| hypothetical protein PHAVU_002G219100g [Phaseolus vulgaris]
 gb|ESW31212.1| hypothetical protein PHAVU_002G219100g [Phaseolus vulgaris]
Length=568

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 42/98 (43%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +3

Query  147  FLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY----NKFGILFRDNKELFET  314
            F   + E  L+ L++I+ +Q L ID+HF+++I + L +QY    N  G  + D+  + +T
Sbjct  73   FWKSVDEKSLKDLYMIDVMQRLNIDYHFKEEIEAFLGKQYVNCSNIIGSGYGDH--IHDT  130

Query  315  SILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            ++LFRLLRQ GY +P+DVF KF N + KFK EL ++IK
Sbjct  131  ALLFRLLRQQGYFVPADVFEKFTNKERKFKPELGENIK  168



>emb|CAN83267.1| hypothetical protein VITISV_023827 [Vitis vinifera]
Length=481

 Score = 80.9 bits (198),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 37/80 (46%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  189  VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSDV  368
            +I+AIQ LGID+HF  +I  +LQR + KF  +   +  L+E ++ FRLLRQ+GY++ +DV
Sbjct  1    MIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTVSDCHNNLYELALGFRLLRQEGYYVSADV  60

Query  369  FTKFINDKGKFKEELSKDIK  428
            F    + +GK +E+LS+DIK
Sbjct  61   FNNLKDTEGKJQEKLSEDIK  80



>ref|XP_010999558.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Populus euphratica]
 ref|XP_010999559.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Populus euphratica]
Length=594

 Score = 80.9 bits (198),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 60/87 (69%), Gaps = 1/87 (1%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQD  344
            E+ +Q L +I+AIQ L ID+HFQ++I SIL RQ      +  D   L+E ++ FRLLRQ 
Sbjct  88   EEPIQGLAMIDAIQRLSIDYHFQEEIDSILTRQSMLLSTIHSDTN-LYEVALRFRLLRQQ  146

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDI  425
            GYH+ + VF  F +++G+FK++LS DI
Sbjct  147  GYHVSAGVFDNFKDNEGRFKQKLSCDI  173



>ref|XP_010241001.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 64/97 (66%), Gaps = 1/97 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETS  317
            R+ L       L++L +I+A+Q LG+ +HF+ +I  +L++ ++   + F D +  L   +
Sbjct  64   RSILRNSANKPLEMLSLIDAVQRLGLGYHFEREINKMLEQIFDAHIVYFNDMDDNLNAVA  123

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            +LFRLLRQ GY+IP DVF KF ++ GK +E L++DI+
Sbjct  124  LLFRLLRQHGYNIPCDVFKKFKDEDGKLRESLARDIQ  160



>ref|XP_008245818.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Prunus mume]
Length=580

 Score = 80.9 bits (198),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 65/102 (64%), Gaps = 8/102 (8%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY------NKFGILFRDNKE  302
            R+ L ++ E+ ++ L++I+A+Q LGIDH FQ++I  ILQ Q+      +  G     + +
Sbjct  78   RHVLRKLGEEAVEGLNMIDAVQRLGIDHLFQEEIDQILQEQHLIITSGSAHGA--DHHSD  135

Query  303  LFETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            L E ++ FRLLRQ GY +P DVF KF    G FK+ LS+DIK
Sbjct  136  LHEVAVRFRLLRQQGYFVPDDVFEKFKESDGSFKQMLSEDIK  177



>gb|KDP20831.1| hypothetical protein JCGZ_21302 [Jatropha curcas]
Length=564

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 65/88 (74%), Gaps = 4/88 (5%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQD  344
            ED ++ L +I+AIQ LGI+++FQ++I +IL+RQY    I   ++ +L ET++ FRLLRQ+
Sbjct  81   EDAVEGLVMIDAIQRLGIEYNFQEEIDAILKRQY---LIPTTNDYDLHETALRFRLLRQE  137

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GYH+   VF  F  D+GKFK+EL+ DIK
Sbjct  138  GYHVLPGVFNNF-KDEGKFKKELTDDIK  164



>ref|XP_006365869.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X1 [Solanum 
tuberosum]
Length=553

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/98 (40%), Positives = 63/98 (64%), Gaps = 2/98 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD--NKELFET  314
            R  L +I  + L+ L +I+ +Q LGI +HF ++I + L++ Y  +    RD  N+E++  
Sbjct  51   RRMLDKIMTNSLEQLELIDILQRLGIYYHFAEEIDTALKQTYVNYNYNKRDLNNEEVYAV  110

Query  315  SILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            ++ FRLLRQ GYH+P ++F  F+N +GKFK  L +D K
Sbjct  111  ALEFRLLRQQGYHVPQEIFCSFMNKEGKFKTALVEDTK  148



>emb|CAN64072.1| hypothetical protein VITISV_038269 [Vitis vinifera]
Length=481

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 38/80 (48%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +3

Query  189  VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSDV  368
            +I+AIQ LGID+HF  +I  +LQR + KF  L   +  L+E +  FRLLRQ+GY + +DV
Sbjct  1    MIDAIQRLGIDYHFHGEIEVVLQRLHTKFNTLSDCHNNLYELAXGFRLLRQEGYXVSADV  60

Query  369  FTKFINDKGKFKEELSKDIK  428
            F    + +GK +E+LS+DIK
Sbjct  61   FNNLKDTEGKJQEKLSEDIK  80



>ref|XP_002513346.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
 sp|B9RHX7.1|TPS4_RICCO RecName: Full=Probable terpene synthase 4; Short=RcSeTPS4 [Ricinus 
communis]
 gb|EEF48749.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
Length=563

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +3

Query  156  QIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE--LFETSILFR  329
            ++++D  Q L +I+A+Q LGID+HFQ++   +L+ QYNK   +F  +++  L + ++ FR
Sbjct  69   KVRKDHSQNLIMIDALQRLGIDYHFQEETQDVLEGQYNK---IFAAHQQHHLSDAALRFR  125

Query  330  LLRQDGYHIP-SDVFTKFINDKGKFKEELSKDIK  428
            LLRQ GY++P SDVF++  N +GKFK+EL+ DIK
Sbjct  126  LLRQQGYYVPASDVFSELKNREGKFKQELAADIK  159



>dbj|BAG50433.1| sesquiterpene synthase 3 [Zingiber zerumbet]
 dbj|BAG50437.1| sesquiterpene synthase 3 [Zingiber zerumbet]
Length=552

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN   +  +D LQ+++++++IQ LG+D+HF+ +I ++L+  Y        +N  L+E S+
Sbjct  60   RNLFKEASDDVLQIMNLVDSIQLLGLDYHFEKEIVTVLRLVYGANA----ENYGLYEFSL  115

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY++ +DVF KF +DKG+F   L  D K
Sbjct  116  RFRLLRQHGYYLSADVFNKFKDDKGRFLSTLIGDAK  151



>gb|EYU19193.1| hypothetical protein MIMGU_mgv1a018094mg [Erythranthe guttata]
Length=561

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 4/97 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLH---VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFE  311
            RN L   Q +D  ++H   +I+AIQ LG+ +HF+D+I   L+R Y+  G    +N +L  
Sbjct  65   RNLLTAAQMEDDSLVHKLQLIDAIQRLGVAYHFEDEIEKSLRRMYDG-GEDNINNNDLHF  123

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
             ++ FRLLRQ G+H+P DVF KFI+++G FKE ++ +
Sbjct  124  VALRFRLLRQQGHHVPCDVFNKFIDEEGDFKESITAN  160



>ref|XP_002518583.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
 sp|B9RXW4.1|TPS13_RICCO RecName: Full=Probable terpene synthase 13; Short=RcSeTPS13 [Ricinus 
communis]
 gb|EEF43970.1| 1,8-cineole synthase, chloroplast precursor, putative [Ricinus 
communis]
Length=572

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            +VL +I+AIQ LGIDHHFQD+I  ILQRQY      + DN +L   ++ FRLLRQ GY++
Sbjct  87   EVLAMIDAIQRLGIDHHFQDEIDEILQRQYT-IPSYYNDN-DLHGLALRFRLLRQGGYNV  144

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
             + VF KF + +G F ++LS DI+
Sbjct  145  SAGVFDKFKDKEGNFDQKLSDDIR  168



>ref|XP_007148287.1| hypothetical protein PHAVU_006G195600g [Phaseolus vulgaris]
 gb|ESW20281.1| hypothetical protein PHAVU_006G195600g [Phaseolus vulgaris]
Length=523

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 65/93 (70%), Gaps = 3/93 (3%)
 Frame = +3

Query  159  IQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGIL---FRDNKELFETSILFR  329
            + ED ++  +VI+ IQ LGI+HHFQ++I ++LQ Q + F      F ++ +L+E ++LFR
Sbjct  26   VSEDYMECFYVIDIIQRLGIEHHFQEEIEALLQNQCSIFISHISDFANHHKLYELALLFR  85

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLRQ GYH+P+DVF    ++K +F+ +  +D+K
Sbjct  86   LLRQRGYHVPADVFEGLKSNKREFRAKHGEDVK  118



>ref|XP_010644187.1| PREDICTED: (-)-germacrene D synthase-like [Vitis vinifera]
Length=555

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN L        Q+L+ I++IQ LG+ +HF+ +I   L+  Y  + ++  DN +L   ++
Sbjct  58   RNELKATAGKSSQLLNFIDSIQRLGLAYHFEREIEDALKVMYETYNLVDDDNDDLASAAL  117

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FRLLRQ+GYHIPSDVF KF +++G FKE L  D+
Sbjct  118  RFRLLRQEGYHIPSDVFKKFKDEEGNFKESLVGDL  152



>gb|ADK73615.1| terpene synthase 6 [Origanum vulgare]
Length=554

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            +  L Q + D +  L +I++IQ LG+ +HF+ +I  IL+  +  + I   +NK+L   ++
Sbjct  62   KKLLVQTEYDSILKLELIDSIQRLGVSYHFEKEIDRILRYVHQTYPIYETENKDLRMLAL  121

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ G+H+P DVF++FI+ +G   E ++ DI+
Sbjct  122  RFRLLRQHGFHVPCDVFSEFIDAEGNLMESIAYDIQ  157



>gb|ABX57720.1| sesquiterpene synthase [Vanda hybrid cultivar]
Length=560

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 39/93 (42%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            ++   +D LQ++ +I+AIQ LGI +HF+ +I   L R +N       D  +L+  ++ FR
Sbjct  57   MFNNTKDSLQMMELIDAIQRLGIGYHFEKEINEALSRLFNTA----YDGNDLYTVALRFR  112

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLRQ+ YHI SD F KF+++KG FK+  S D K
Sbjct  113  LLRQNRYHISSDDFNKFLDEKGDFKDCFSSDAK  145



>ref|XP_006420934.1| hypothetical protein CICLE_v10004558mg [Citrus clementina]
 gb|ESR34174.1| hypothetical protein CICLE_v10004558mg [Citrus clementina]
Length=619

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQD  344
            +D  + L +I+ +Q LGID++FQD+I  IL+RQY+ F        +L E ++ FRLLRQ 
Sbjct  133  DDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYSIFFTAGDRYNDLQEVALRFRLLRQQ  192

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDI  425
            GY++ +DVF +F N +G+FK+ +S+DI
Sbjct  193  GYYVSADVFNRFRNKEGEFKQNISEDI  219



>emb|CBI20287.3| unnamed protein product [Vitis vinifera]
Length=595

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 61/95 (64%), Gaps = 0/95 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN L        Q+L+ I++IQ LG+ +HF+ +I   L+  Y  + ++  DN +L   ++
Sbjct  98   RNELKATAGKSSQLLNFIDSIQRLGLAYHFEREIEDALKVMYETYNLVDDDNDDLASAAL  157

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FRLLRQ+GYHIPSDVF KF +++G FKE L  D+
Sbjct  158  RFRLLRQEGYHIPSDVFKKFKDEEGNFKESLVGDL  192



>ref|XP_009388236.1| PREDICTED: (S)-beta-bisabolene synthase-like [Musa acuminata 
subsp. malaccensis]
Length=511

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 59/93 (63%), Gaps = 4/93 (4%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            ++Q   D  Q +H+I+ IQ LG+D+HF++++   L+R Y+        N  L+E S+ FR
Sbjct  22   MFQDNNDATQTMHLIDTIQLLGLDYHFEEELTEALKRVYDADSA----NDGLYEVSLRFR  77

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLR+ GY + SDVF KF ++ G F   L++D+K
Sbjct  78   LLREKGYSVTSDVFDKFKDEGGSFSTTLTEDVK  110



>gb|KEH31175.1| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=570

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 64/92 (70%), Gaps = 0/92 (0%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            L  + E+ L+ L++I+A+Q L ID+HF+++I S L+RQY        ++ +L ET++ FR
Sbjct  76   LRNVGENSLKGLYMIDAMQRLNIDYHFEEEIESFLRRQYVTSACGGSNHHDLHETALHFR  135

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            LLRQ G+ +P++VF K+ N++ KF  +L ++I
Sbjct  136  LLRQQGHFVPAEVFNKYTNEEEKFNPKLGENI  167



>ref|XP_010059420.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like, partial [Eucalyptus 
grandis]
Length=709

 Score = 79.3 bits (194),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 88/144 (61%), Gaps = 17/144 (12%)
 Frame = +3

Query  45   QSMNSGKQDVPFISKI---------------GKDepevkyeekmeevRNFLYQIQEDDLQ  179
            QSM+S K++VP  + I                +D+  +K++EK + + +FL ++  + ++
Sbjct  278  QSMDSKKEEVPLPNTIFLVAEILRLWDDLGCAQDDSGIKHDEKTKSLIDFLNKVVNEPVE  337

Query  180  VLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIP  359
             L +++ IQ LG++  F++QI +IL+ QY  F  L     +++E ++ FRLLRQ+GY +P
Sbjct  338  SLIIVDMIQRLGVESLFREQIKAILKWQYTHFSSLNHGKDDVYEIALWFRLLRQEGYRVP  397

Query  360  SDVFTKFINDKGK-FKEELSKDIK  428
            +DVF ++ NDKGK F  +L  +IK
Sbjct  398  ADVF-EYFNDKGKGFVMKLEGNIK  420



>gb|AGB05615.1| sesquiterpene synthase 6 [Valeriana officinalis]
Length=491

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 42/95 (44%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN +    +D L  L +I+ ++ LGI +HF+D+I +ILQ  +N  G + + N++L+ TS+
Sbjct  55   RNLVNIGDDDVLSKLELIDTLERLGIYYHFEDEIHNILQNIHNH-GYMDK-NQDLYTTSL  112

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             F  LRQ G+ +P D+F  F++D+GKFK ELSKDI
Sbjct  113  KFIYLRQHGFDVPQDIFKTFMDDQGKFKGELSKDI  147



>ref|XP_003528417.2| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Glycine max]
Length=573

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 40/98 (41%), Positives = 65/98 (66%), Gaps = 6/98 (6%)
 Frame = +3

Query  147  FLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY----NKFGILFRDNKELFET  314
            F+  + E+ L+ L++I+A+Q L ID+HFQ++I   L+RQY       G  + D  ++ E 
Sbjct  76   FMNTVGENSLRGLYMIDAMQRLNIDYHFQEEIEEFLRRQYVNSTTIAGGYYGD--DIHEI  133

Query  315  SILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            ++ FRLLRQ G+ +P +VF KF N +GKF ++L ++IK
Sbjct  134  ALRFRLLRQQGFFVPEEVFHKFTNKEGKFNQKLGENIK  171



>ref|XP_004243482.2| PREDICTED: (-)-germacrene D synthase [Solanum lycopersicum]
Length=551

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L       LQ L +IN IQ LG+ +HF+ +I   L   YN +     ++ +L + ++
Sbjct  52   RKMLVLSPSKSLQKLELINTIQLLGVSYHFEHEIEESLSEIYNGYEEWIGESHDLHDVAL  111

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY++ SDVF KF +++G +KE L+ D++
Sbjct  112  SFRLLRQQGYYVSSDVFRKFTDERGNYKETLASDVQ  147



>dbj|BAP75560.1| linalool synthase [Citrus unshiu]
Length=581

 Score = 78.6 bits (192),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 63/90 (70%), Gaps = 6/90 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN---KELFETSILFRLL  335
            +D  + L +I+ +Q LGID++FQD+I  IL+RQY+   I F D     +L E ++ FRLL
Sbjct  93   DDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS---IFFTDGDRYNDLQEVALRFRLL  149

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            RQ GY++ +DVF +F N +G+FK+ +S+DI
Sbjct  150  RQQGYYVSADVFNRFRNKEGEFKQNISEDI  179



>gb|AEP17005.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D  Q L +I+AIQ LG+ +HF+ +I  +L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFD--GSVVSAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>sp|Q5SBP4.1|AZIS_OCIBA RecName: Full=Alpha-zingiberene synthase [Ocimum basilicum]
 gb|AAV63788.1| alpha-zingiberene synthase [Ocimum basilicum]
Length=541

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 59/94 (63%), Gaps = 11/94 (12%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN-------KELFETSILF  326
            D+L+ L +I+ +Q LGI HHFQD    ILQ+ Y +     R+        K L  T++ F
Sbjct  51   DELKQLELIDNLQRLGICHHFQDLTKKILQKIYGEE----RNGDHQHYKEKGLHFTALRF  106

Query  327  RLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            R+LRQDGYH+P DVF+ F+N  G F+E LSKD K
Sbjct  107  RILRQDGYHVPQDVFSSFMNKAGDFEESLSKDTK  140



>ref|NP_001268213.1| (-)-germacrene D synthase [Vitis vinifera]
 sp|Q6Q3H3.1|TPSGD_VITVI RecName: Full=(-)-germacrene D synthase [Vitis vinifera]
 gb|AAS66357.1| (-)-germacrene D synthase [Vitis vinifera]
Length=557

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D  Q L +I+AIQ LG+ +HF+ +I  +L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFD--GSVVSAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>emb|CAN83470.1| hypothetical protein VITISV_030783 [Vitis vinifera]
Length=557

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D  Q L +I+AIQ LG+ +HF+ +I  +L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFD--GSVVSAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>gb|AGW18161.1| terpene synthase 4-1 [Copaifera langsdorffii]
Length=557

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSIL---QRQYNKFGILFRDNKELFE  311
            R  L    +  L  + +I++IQ LG+D+HF+ +I  +L   Q  Y K GI+   N++L  
Sbjct  59   RKMLVPATDKPLTKVRLIDSIQRLGVDYHFESEIDEVLCQIQNNYVKDGIITL-NEDLHS  117

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++LFRLLRQ GYH+  DVF KF +++GK  E ++ D++
Sbjct  118  MALLFRLLRQQGYHVSPDVFNKFKDEQGKISETIANDVE  156



>ref|XP_010686917.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=581

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  171  DLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGY  350
            +L+ L +++ IQ LG++ +F++ + + L++   K   +   + + +E ++ FRLLRQ+GY
Sbjct  89   ELEELIMVDIIQRLGLEDYFREDMHAALEKLRAKLCTMKDGDGKFYEVALCFRLLRQNGY  148

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
            H+P+DVF KF ++ GKFK EL KD+K
Sbjct  149  HVPADVFYKFKDNDGKFKHELYKDVK  174



>ref|XP_006352644.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like [Solanum 
tuberosum]
Length=552

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 57/82 (70%), Gaps = 2/82 (2%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +++ +Q +GI+HHFQ++I SILQ++Y +    F   +  F+ S+ FRLLRQ GYH+ +
Sbjct  70   LVLVDTLQRMGIEHHFQEEIQSILQKEYEQ-SACFLKYQTPFDVSLCFRLLRQQGYHVSA  128

Query  363  DVFTKFI-NDKGKFKEELSKDI  425
            DVF KF  ND G F  +LS+D+
Sbjct  129  DVFKKFKNNDDGTFGLKLSQDV  150



>ref|XP_010686918.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=567

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +3

Query  171  DLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGY  350
            +L+ L +++ IQ LG++ +F++ + + L++   K   +   + + +E ++ FRLLRQ+GY
Sbjct  89   ELEELIMVDIIQRLGLEDYFREDMHAALEKLRAKLCTMKDGDGKFYEVALCFRLLRQNGY  148

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
            H+P+DVF KF ++ GKFK EL KD+K
Sbjct  149  HVPADVFYKFKDNDGKFKHELYKDVK  174



>sp|P0CV94.1|NES1_FRAAN RecName: Full=(3S,6E)-nerolidol synthase 1; Short=FaNES1 [Fragaria 
x ananassa]
Length=519

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D L+ L++I+A+Q LGID++FQ +I  IL +Q +    +     +L E ++ FRLLRQ G
Sbjct  36   DALEGLNMIDAVQRLGIDYNFQREIDEILHKQMS----IVSARDDLHEVALRFRLLRQHG  91

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            Y +P DVF  F + KG FK+ L +DIK
Sbjct  92   YFVPEDVFNNFKDSKGTFKQVLGEDIK  118



>gb|KDP20833.1| hypothetical protein JCGZ_21304 [Jatropha curcas]
Length=581

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 63/88 (72%), Gaps = 4/88 (5%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQD  344
            ED  + L +I+AIQ LGI+ +FQ++I +IL+RQY    I   ++ +L ET++ FRLLRQ+
Sbjct  98   EDAFEGLVMIDAIQRLGIECNFQEEIDAILKRQY---LIPTTNDYDLHETALRFRLLRQE  154

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GYH+   VF  F  D+GKFK+EL+ DIK
Sbjct  155  GYHVLPGVFNNF-KDEGKFKKELTDDIK  181



>emb|CAN68620.1| hypothetical protein VITISV_013313 [Vitis vinifera]
Length=557

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D  Q L +I+AIQ LG+ +HF+ +I  +L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFD--GSVVSAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>ref|XP_010247958.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=564

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 37/97 (38%), Positives = 63/97 (65%), Gaps = 1/97 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETS  317
            R+ L       L++L +I+ +Q LG+ + F+ +I  +L++ ++   + F D +  L   +
Sbjct  64   RSILRNSANKPLEMLSLIDGVQRLGLGYQFEREIDKMLEQIFDAHIVYFNDMDDNLNAVA  123

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            +LFRLLRQ GY+IP DVF KF ++ GKF+E L++DI+
Sbjct  124  LLFRLLRQHGYNIPCDVFKKFRDEDGKFRESLARDIQ  160



>emb|CBI20483.3| unnamed protein product [Vitis vinifera]
Length=557

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D  Q L +I+AIQ LG+ +HF+ +I  +L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSAQKLLLIDAIQRLGVAYHFESEIDEVLKHMFD--GSVVSAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>ref|XP_010059436.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=234

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +3

Query  144  NFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSIL  323
            +FL ++  + ++ L +++ IQ LG+   F++QI +IL+ QY  F  L     +++E ++ 
Sbjct  35   DFLNKVVNEPVESLIIVDMIQRLGVKSLFREQIKAILRWQYTHFSSLNHGKDDVYEIALR  94

Query  324  FRLLRQDGYHIPSDVFTKFINDKGK-FKEELSKDIK  428
            FRLLRQ+GYH+P+DVF ++ NDKGK F  +L  +IK
Sbjct  95   FRLLRQEGYHVPADVF-EYFNDKGKGFVMKLEGNIK  129



>ref|XP_011071312.1| PREDICTED: uncharacterized protein LOC105156792 [Sesamum indicum]
Length=1087

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 60/96 (63%), Gaps = 5/96 (5%)
 Frame = +3

Query  147  FLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG--ILFRDNKELFETSI  320
             L +  E+ +  L  ++AIQ +GIDHHF+++I  IL RQY  +G  + F D   L   S+
Sbjct  8    LLQEENENPMDGLMFVDAIQRVGIDHHFEEEIEMILGRQYKFWGKSVCFHD---LHHVSL  64

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY++ +DVF  F    GKF EEL +D++
Sbjct  65   FFRLLRQQGYYVSADVFNNFKGKDGKFLEELKQDVR  100


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L  ++ I  LG DH+F+++I  IL++QY  +    + +  L + S+ FRLLRQ GY++ +
Sbjct  599  LVCVDDIHRLGFDHYFEEEIEIILRQQYYNYNHRAKSSTCLHDVSLFFRLLRQHGYYVSA  658

Query  363  DVFTKFINDKGKFKEELSKDIK  428
            DVF  F  + GKF EEL +DI+
Sbjct  659  DVFNNFKGNDGKFLEELKQDIR  680



>gb|AGL98419.1| B-caryophyllene synthase [Lavandula angustifolia]
Length=548

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 62/96 (65%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN L Q ++D    L +++AIQ LGI +HF+++I + L+  Y+   I   ++  L   ++
Sbjct  55   RNLLLQTRDDSTLKLELVDAIQRLGIGYHFEEEIHNSLRNIYDTNPIYNAEDDNLRVAAL  114

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRL+RQ G+  P DVF KF++++G+FK  +S D++
Sbjct  115  RFRLIRQQGFPAPCDVFRKFVDEEGEFKSWVSNDVE  150



>ref|XP_010057691.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Eucalyptus grandis]
Length=535

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 65/96 (68%), Gaps = 2/96 (2%)
 Frame = +3

Query  144  NFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSIL  323
            +FL ++  + ++ L +++ IQ LG+   F++QI +IL+ QY  F  L     +++E ++ 
Sbjct  35   DFLNKVVNEPVESLIIVDMIQRLGVKSLFREQIKAILRWQYTHFSSLNHGKDDVYEIALR  94

Query  324  FRLLRQDGYHIPSDVFTKFINDKGK-FKEELSKDIK  428
            FRLLRQ+GYH+P+DVF ++ NDKGK F  +L  +IK
Sbjct  95   FRLLRQEGYHVPADVF-EYFNDKGKGFVMKLEGNIK  129



>gb|AGW18157.1| terpene synthase 4 [Copaifera officinalis]
Length=557

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 39/99 (39%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSIL---QRQYNKFGILFRDNKELFE  311
            R  L    +  L  + +I++IQ LG+D+HF+ +I  +L   Q  Y K GI+   N++L  
Sbjct  59   RKMLVPATDKPLTKVRLIDSIQRLGVDYHFESEIDEVLCQIQNNYVKDGIITL-NEDLHS  117

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++LFRLLRQ GYH+  DVF KF +++GK  E ++ D++
Sbjct  118  LALLFRLLRQQGYHVSPDVFNKFKDEQGKISETIANDVE  156



>ref|XP_006493821.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Citrus 
sinensis]
Length=579

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 6/90 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN---KELFETSILFRLL  335
            +D  + L +I+ +Q LGID++FQD+I  IL+RQY+   I F D     +L E ++ FRLL
Sbjct  93   DDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS---IFFTDGDRYNDLQEVALRFRLL  149

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            RQ GY++  DVF +F N +G+FK+ +S+DI
Sbjct  150  RQQGYYVSPDVFNRFRNKEGEFKQNVSEDI  179



>ref|XP_006493063.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Citrus sinensis]
Length=579

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 62/90 (69%), Gaps = 6/90 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN---KELFETSILFRLL  335
            +D  + L +I+ +Q LGID++FQD+I  IL+RQY+   I F D     +L E ++ FRLL
Sbjct  93   DDSFEGLAMIDVVQRLGIDYYFQDEIELILRRQYS---IFFTDGDRYNDLQEVALRFRLL  149

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            RQ GY++  DVF +F N +G+FK+ +S+DI
Sbjct  150  RQQGYYVSPDVFNRFRNKEGEFKQNVSEDI  179



>ref|NP_001268015.1| (-)-germacrene D synthase-like [Vitis vinifera]
 gb|ADR74198.1| (E,E)-alpha-farnesene synthase [Vitis vinifera]
Length=558

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            ++L +I++IQ LG+ +HF+ +I   L+  Y  +  L  DN++L   S+ FRLLRQ+GY +
Sbjct  75   ELLKLIDSIQLLGLTYHFEREIEEALKDMYGTYS-LVDDNEDLTNASLRFRLLRQEGYGV  133

Query  357  PSDVFTKFINDKGKFKEELSKDI  425
            PSDVF+KF + +G FKE L  D+
Sbjct  134  PSDVFSKFKDKEGNFKESLIGDL  156



>emb|CBI20174.3| unnamed protein product [Vitis vinifera]
Length=559

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 37/83 (45%), Positives = 57/83 (69%), Gaps = 1/83 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            ++L +I++IQ LG+ +HF+ +I   L+  Y  +  L  DN++L   S+ FRLLRQ+GY +
Sbjct  75   ELLKLIDSIQLLGLTYHFEREIEEALKDMYGTYS-LVDDNEDLTNASLRFRLLRQEGYGV  133

Query  357  PSDVFTKFINDKGKFKEELSKDI  425
            PSDVF+KF + +G FKE L  D+
Sbjct  134  PSDVFSKFKDKEGNFKESLIGDL  156



>sp|J7LJN5.1|TPS6_PHYDL RecName: Full=Beta-caryophyllene synthase; AltName: Full=Terpene 
synthase 6; Short=LdTPS6 [Phyla dulcis]
 gb|AFR23370.1| beta-caryophyllene synthase [Phyla dulcis]
Length=555

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 4/93 (4%)
 Frame = +3

Query  162  QEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY----NKFGILFRDNKELFETSILFR  329
             +D LQ L +I+AIQ LG+DHHFQ +I   LQ  Y    N       +  +L   ++ FR
Sbjct  63   HDDSLQKLELIDAIQRLGVDHHFQKEIEKSLQDIYLRCCNDKDDYDHNQTDLHTVALRFR  122

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLRQ GY+I S+ F KF +  GKF+E L+ D++
Sbjct  123  LLRQQGYNISSETFNKFTDRNGKFEESLADDVR  155



>ref|XP_003596560.1| Alpha-humulene/(-)-(E)-beta-caryophyllene synthase [Medicago 
truncatula]
 gb|ABN09072.1| Terpene synthase-like; Terpenoid synthase [Medicago truncatula]
 gb|AES66811.1| terpene synthase family, metal-binding domain protein [Medicago 
truncatula]
Length=572

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 64/103 (62%), Gaps = 11/103 (11%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFET--  314
            +  L   + D  Q+L++I+++Q LGI + F+ +I   L++ +N F     DNKE+     
Sbjct  67   KKLLLSSRNDMAQILNLIDSLQRLGISYQFEHEIDEALEQIHNNFS----DNKEMTSEEG  122

Query  315  -----SILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
                 +++FRLLRQ G+H+ SD+F KF N KG F E++SKDI+
Sbjct  123  DLHFLALVFRLLRQKGHHMSSDIFEKFKNPKGNFNEKISKDIQ  165



>ref|XP_002283076.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
Length=559

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN L        Q+L+ I++IQ LG+ + F+ +I   L+  Y  + +   DN +L   S+
Sbjct  62   RNELKATARKSSQLLNFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLTNASL  121

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FRLLRQ+GYHIP DVF KF +D+G FKE L+ D+
Sbjct  122  RFRLLRQEGYHIPPDVFNKFKDDEGNFKESLTGDL  156



>ref|XP_002283070.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CAN76781.1| hypothetical protein VITISV_000919 [Vitis vinifera]
 emb|CBI20476.3| unnamed protein product [Vitis vinifera]
 gb|ADR74226.1| cubebol/delta-cadinene synthase [synthetic construct]
Length=559

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN L        Q+L+ I++IQ LG+ + F+ +I   L+  Y  + +   DN +L   S+
Sbjct  62   RNELKATARKSSQLLNFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLTNASL  121

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FRLLRQ+GYHIP DVF KF +D+G FKE L+ D+
Sbjct  122  RFRLLRQEGYHIPPDVFNKFKDDEGNFKESLTGDL  156



>gb|AHE41084.1| geraniol synthase [Valeriana officinalis]
Length=594

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L     D  + + +I+++Q LG++HHF+  I  +LQ   N+       N++LF TS+
Sbjct  97   RRTLRNESSDSTEKMRLIDSLQRLGLNHHFEQDIKEMLQDFANEHK---NTNQDLFTTSL  153

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
             FRLLR +G+++  DVF KF  + GKFKE L +D
Sbjct  154  RFRLLRHNGFNVTPDVFNKFTEENGKFKESLGED  187



>ref|XP_006365870.1| PREDICTED: (-)-alpha-terpineol synthase-like isoform X2 [Solanum 
tuberosum]
Length=501

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = +3

Query  147  FLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD--NKELFETSI  320
             L +I  + L+ L +I+ +Q LGI +HF+++I ++L++    +    RD  N+E++  ++
Sbjct  1    MLEKIITNSLEQLELIDILQRLGIYYHFEEEIHTVLKQTCVSYNYNKRDLNNEEVYAVAL  60

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+P ++F  F+N +GKFK  L +D K
Sbjct  61   EFRLLRQQGYHVPQEIFCSFMNKEGKFKTALVEDTK  96



>ref|NP_001268204.1| uncharacterized protein LOC100257265 [Vitis vinifera]
 ref|XP_010644042.1| PREDICTED: uncharacterized protein LOC100257265 isoform X1 [Vitis 
vinifera]
 gb|ADR74193.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=557

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D +Q L +I+AIQ LG+ +HF+ +I   L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSVQKLLLIDAIQRLGVAYHFESEIDEALKHMFD--GSVASAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>gb|AGB05612.1| sesquiterpene synthase 3 [Valeriana officinalis]
Length=591

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L     D  + + +I+++Q LG++HHF+  I  +LQ   N+       N++LF TS+
Sbjct  97   RRTLRNESSDSTEKMRLIDSLQRLGLNHHFEQDIKEMLQDFANEHK---NTNQDLFTTSL  153

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
             FRLLR +G+++  DVF KF  + GKFKE L +D
Sbjct  154  RFRLLRHNGFNVTPDVFNKFTEENGKFKESLGED  187



>ref|XP_010657363.1| PREDICTED: R-linalool synthase, chloroplastic-like isoform X1 
[Vitis vinifera]
 ref|XP_010657364.1| PREDICTED: R-linalool synthase, chloroplastic-like isoform X1 
[Vitis vinifera]
Length=587

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D    + +++ ++ LG+ +HF+D+I ++LQR  +     +  +++LF TS+ FRLLRQ+G
Sbjct  91   DSRAAMEMVDTVERLGLSYHFEDEIKALLQRFCD-----WNSSEDLFTTSLRFRLLRQNG  145

Query  348  YHIPSDVFTKFINDKGKFKEELSKDI  425
            +   SDVF KF++  GKFKE L++DI
Sbjct  146  FPTHSDVFGKFMDKNGKFKESLTEDI  171



>ref|XP_008245819.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Prunus mume]
Length=536

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETS  317
            ++ L  + ED+L +   ++A+QHLG+DHHF+++I + LQ+QY+     + D N +L E S
Sbjct  30   KDALANVGEDELLI--AVDAMQHLGLDHHFREEIEAFLQKQYHARA--YDDCNHQLLEVS  85

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GYH+ +DVF KF N +      L KDI+
Sbjct  86   LRFRLLRQQGYHVTTDVFNKFKNIEDLTSGLLDKDIE  122



>gb|AGW18162.1| terpene synthase 4-2 [Copaifera langsdorffii]
Length=556

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 62/99 (63%), Gaps = 4/99 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSIL---QRQYNKFGILFRDNKELFE  311
            R  L    +  L  + +I+++Q LG+D+HF+ +I  +L   Q  Y K GI+   N++L  
Sbjct  58   RKMLVPATDKPLTKVRLIDSMQRLGVDYHFESEIDEVLYQIQNNYVKDGIITL-NEDLHS  116

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++LFRLLRQ GYH+  DVF KF +++GK  E ++ D++
Sbjct  117  MALLFRLLRQQGYHVSPDVFNKFKDEQGKISETIANDVE  155



>ref|NP_001267920.1| geraniol synthase [Vitis vinifera]
 gb|ADR74218.1| geraniol synthase [Vitis vinifera]
Length=595

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 60/87 (69%), Gaps = 5/87 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D    + +++ ++ LG+ +HF+D+I ++LQR  +     +  +++LF T++ FRLLRQ+G
Sbjct  101  DSRAAMEMVDTVERLGLSYHFEDEINALLQRFCD-----WNASEDLFTTALRFRLLRQNG  155

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            +   SDVF KF++  GKFKE L++DI+
Sbjct  156  FPTHSDVFGKFMDKNGKFKESLTEDIR  182



>emb|CBI20482.3| unnamed protein product [Vitis vinifera]
Length=725

 Score = 76.6 bits (187),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +D +Q L +I+AIQ LG+ +HF+ +I   L+  ++  G +    ++++  S+
Sbjct  62   RKMLMAADDDSVQKLLLIDAIQRLGVAYHFESEIDEALKHMFD--GSVASAEEDVYTASL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+  D+F  F +++G FKE LS D++
Sbjct  120  RFRLLRQQGYHVSCDLFNNFKDNEGNFKESLSSDVR  155



>gb|AEP82784.1| terpene synthase [Solanum lycopersicum]
Length=555

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +  E  LQ L +I+A+Q LG+ +HF ++I + +Q  ++       ++  L+  S+
Sbjct  51   RKMLVKAPEGSLQKLVLIDAMQRLGVAYHFDNEIETSIQNIFDASSKQNDNDNNLYVVSL  110

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRL+RQ G+++ SDVF +FIN  GKFKE L+ D++
Sbjct  111  RFRLVRQQGHYMSSDVFKQFINQDGKFKETLTNDVQ  146



>ref|XP_007149935.1| hypothetical protein PHAVU_005G111500g [Phaseolus vulgaris]
 gb|ESW21929.1| hypothetical protein PHAVU_005G111500g [Phaseolus vulgaris]
Length=579

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D L+ L +I+ IQ LGI+HHF+++I   L +  +       + K++F T++ FRLLRQ+G
Sbjct  86   DSLRTLKLIDTIQRLGIEHHFEEEINLQLGKVKD-----CNNAKDIFATALQFRLLRQNG  140

Query  348  YHIPSDVFTKFINDKGKFKEELSKDI  425
            +   SDVF KF++  G FKE +++DI
Sbjct  141  WSTSSDVFNKFLDKSGNFKESVTRDI  166



>ref|XP_006369784.1| hypothetical protein POPTR_0001s31570g [Populus trichocarpa]
 gb|ERP66353.1| hypothetical protein POPTR_0001s31570g [Populus trichocarpa]
Length=593

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQD  344
            D +  L +I+ +Q LG+ +HF+ +I SIL+ ++N +    R+ KE L+ TS+ FRLLRQ 
Sbjct  99   DAVYQLELIDNLQRLGVAYHFELEIKSILESRWNNYKEDNREMKEDLYATSVEFRLLRQH  158

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY++P DVF  F +++G FK  L  D+K
Sbjct  159  GYNVPQDVFNSFKDEQGNFKNCLRDDVK  186



>gb|ADK73616.1| terpene synthase 6 [Origanum vulgare]
Length=554

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 35/96 (36%), Positives = 61/96 (64%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            +  L Q + D +  L +I++IQ LG+ +HF+ +I  IL+  +  + I   +NK+L   ++
Sbjct  62   KKLLVQTEYDSILKLELIDSIQRLGVGYHFEKEIDRILRYVHQTYPIYDTENKDLRMLAL  121

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ G+H+P DV ++FI+ +G   E ++ DI+
Sbjct  122  RFRLLRQQGFHVPFDVLSEFIDAEGNLTESIAYDIQ  157



>ref|XP_002523475.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
 sp|B9SBV6.1|TPS3_RICCO RecName: Full=Probable terpene synthase 3; Short=RcSeTPS3 [Ricinus 
communis]
 gb|EEF38934.1| (+)-delta-cadinene synthase isozyme A, putative [Ricinus communis]
Length=547

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +I+ IQ LGI +HF+++IG ++++ Y+ +     D+++L++ ++ FRLLRQ GY++ S
Sbjct  68   LKLIDVIQRLGIAYHFEEEIGEVIEQVYSNYD----DDEDLYDIALRFRLLRQQGYNVSS  123

Query  363  DVFTKFINDKGKFKEELSKDIK  428
            DVF KF + KG FK+ L  D++
Sbjct  124  DVFDKFKDCKGDFKKHLVNDVQ  145



>emb|CBI20475.3| unnamed protein product [Vitis vinifera]
Length=609

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/95 (43%), Positives = 59/95 (62%), Gaps = 0/95 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            RN L        Q+L+ I++IQ LG+ + F+ +I   L+  Y  + +   DN +L   S+
Sbjct  112  RNELKATARKSSQLLNFIDSIQRLGLAYQFEREIKEALEDMYQTYNLDDDDNDDLTNASL  171

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FRLLRQ+GYHIP DVF KF +D+G FKE L+ D+
Sbjct  172  RFRLLRQEGYHIPPDVFNKFKDDEGNFKESLTGDL  206



>emb|CDP12281.1| unnamed protein product [Coffea canephora]
Length=567

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/95 (39%), Positives = 60/95 (63%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L+    +  Q L +I+AIQ LGI +HF+++IG  LQ+ + K    +  N  ++  ++
Sbjct  65   RTELHATASNPSQQLQLIDAIQRLGIAYHFEEEIGQALQKMHEKHQN-WEGNDHIYTAAL  123

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FR+LRQ+G+ I S++F KF+N +GKF E L  D+
Sbjct  124  CFRILRQEGFRISSEIFKKFLNAEGKFGECLVNDV  158



>ref|XP_006352599.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Solanum tuberosum]
Length=564

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 56/82 (68%), Gaps = 2/82 (2%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +++A+Q +G++HHFQ +I SILQ++Y +    ++      + S+ FRLLRQ+GYH+ +
Sbjct  82   LVLVDALQRMGVEHHFQQEIQSILQKEYEQSACFYKYQNH-HDISLCFRLLRQEGYHVSA  140

Query  363  DVFTKFI-NDKGKFKEELSKDI  425
            DVF +F  ND G F   LS+D+
Sbjct  141  DVFKRFKNNDDGTFGLNLSQDV  162



>sp|Q84LG0.1|5EAS4_NICAT RecName: Full=Probable 5-epi-aristolochene synthase 4 [Nicotiana 
attenuata]
 gb|AAO85555.1| 5-epi-aristolochene synthase [Nicotiana attenuata]
Length=548

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 62/95 (65%), Gaps = 4/95 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ L       +  L++I+ I+ LGI +HF+ +I  IL + YN+      ++ +LF +++
Sbjct  54   RSMLVATGRKLVDTLNLIDTIERLGISYHFEKEIDEILDQIYNQNS----NSSDLFTSAL  109

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            LFRLLRQ G++I  ++F+KF ++ GKFKE L+ D+
Sbjct  110  LFRLLRQHGFNISPEIFSKFQDENGKFKESLASDV  144



>ref|XP_010038257.1| PREDICTED: (-)-germacrene D synthase-like [Eucalyptus grandis]
 gb|KCW50081.1| hypothetical protein EUGRSUZ_K03518 [Eucalyptus grandis]
Length=567

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/99 (37%), Positives = 63/99 (64%), Gaps = 3/99 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN---KELFE  311
            +  L  + E  LQ LH+I+ IQ LGI++HF+ ++   L++ +  +  L  ++    +L  
Sbjct  66   KKMLIDVVEKPLQKLHLIDQIQRLGIEYHFEHEVDEQLEQIHKSYSRLDHEDFKVDDLHM  125

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             +++FRLLRQ GY+I S+VF KF + KG F+E L+ D++
Sbjct  126  VALIFRLLRQHGYNISSEVFDKFKDSKGNFRESLTSDVR  164



>ref|XP_004145158.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
 ref|XP_004153857.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis sativus]
Length=555

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 62/92 (67%), Gaps = 5/92 (5%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF----GILFRDNKELFETSILFRL  332
            +D L+ L++I+A+Q LG+D+ FQ +I +IL+R Y  F    G    D+ +L E ++ FRL
Sbjct  55   DDPLETLNLIDAVQRLGLDYRFQTEIDAILERHYAIFVGQEGDGMNDD-DLHEVALRFRL  113

Query  333  LRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LRQ GY + SDVF  F++++G FK+ L  DIK
Sbjct  114  LRQRGYFVSSDVFNVFMDEEGHFKQNLEHDIK  145



>gb|ADR74217.1| geraniol synthase [Vitis vinifera]
Length=591

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D    + +++ ++ LG+ +HF+D+I ++LQR  +     +  +++LF T++ FRLLRQ+G
Sbjct  97   DSRAAMEMVDTVERLGLSYHFEDEINALLQRFCD-----WNASEDLFTTALRFRLLRQNG  151

Query  348  YHIPSDVFTKFINDKGKFKEELSKDI  425
            +   SDVF KF++  GKFKE L++DI
Sbjct  152  FPTHSDVFGKFMDKNGKFKESLTEDI  177



>sp|B1B1U4.1|TPSBE_ZINZE RecName: Full=Beta-eudesmol synthase; AltName: Full=10-epi-gamma-eudesmol 
synthase; AltName: Full=Alpha-eudesmol synthase 
[Zingiber zerumbet]
 dbj|BAG12021.1| beta-eudesmol synthase [Zingiber zerumbet]
 dbj|BAG12022.1| beta-eudesmol synthase [Zingiber zerumbet]
Length=554

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE--LFETSIL  323
            +++   D LQ++++IN+IQ LG+D+HF+++I   L+  Y        D+K   L+ETS+ 
Sbjct  62   MFKDTSDLLQLMNLINSIQMLGLDYHFENEIDEALRLIYEV------DDKSYGLYETSLR  115

Query  324  FRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            F+LLRQ GYH+ +D+F KF +D G F   L+ D K
Sbjct  116  FQLLRQHGYHVSADIFNKFKDDNGSFISSLNGDAK  150



>gb|AGB05613.1| sesquiterpene synthase 4 [Valeriana officinalis]
Length=545

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 3/94 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L     D  + + +I+++Q LG++HHF+  I  +LQ   N+       N++LF TS+
Sbjct  51   RRTLRNESSDSTEKMRLIDSLQRLGLNHHFEQDIKEMLQDFANEHK---NTNQDLFTTSL  107

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
             FRLLR +G+++  DVF KF  + GKFKE L +D
Sbjct  108  RFRLLRHNGFNVTPDVFNKFTEENGKFKESLGED  141



>ref|XP_008452330.1| PREDICTED: (+)-gamma-cadinene synthase-like [Cucumis melo]
Length=570

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG-ILFRDNKE-----LFETSILF  326
            E+ L  L+++++IQ LG+ +HF+D+I   L+  Y  +   L   NK+     L  T++LF
Sbjct  72   ENQLVKLNLVDSIQRLGVSYHFEDEIDEFLEHIYVSYNNSLLLSNKDSEGEDLHITALLF  131

Query  327  RLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
            RLLRQ GY I  D+F KF++D GKFKE L +D
Sbjct  132  RLLRQQGYRISCDIFLKFMDDNGKFKESLVED  163



>ref|XP_006352642.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Solanum tuberosum]
Length=566

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/81 (44%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +++A+Q +GI+HHFQ++I SILQ++Y +    ++      + S+ FRLLRQ+GYH+ +
Sbjct  82   LVLVDALQRMGIEHHFQEEIQSILQKEYEQSACFYKYQNH-HDISLCFRLLRQEGYHVSA  140

Query  363  DVFTKFI-NDKGKFKEELSKD  422
            DVF +F  ND G F   LS+D
Sbjct  141  DVFKRFKNNDDGTFGLNLSQD  161



>ref|XP_002283344.1| PREDICTED: (-)-germacrene D synthase [Vitis vinifera]
 emb|CBI20175.3| unnamed protein product [Vitis vinifera]
 gb|ADR74228.1| (E)-beta-caryophyllene/2-epi-(E)-beta-caryophyllene synthase 
[synthetic construct]
Length=560

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            ++L +I++IQ LG+ HHF+ +I   L+  Y  +  L  DN +    S+ FRLLRQ+GY I
Sbjct  75   ELLKLIDSIQLLGLAHHFEREIEEALKDMYGTYS-LVDDNDDFTNASLRFRLLRQEGYPI  133

Query  357  PSDVFTKFINDKGKFKEELSKD  422
            PSDVF KF + +G FKE L  D
Sbjct  134  PSDVFNKFKDKEGNFKEYLIGD  155



>ref|XP_006388836.1| hypothetical protein POPTR_0092s00200g [Populus trichocarpa]
 gb|ERP47750.1| hypothetical protein POPTR_0092s00200g [Populus trichocarpa]
Length=593

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 60/91 (66%), Gaps = 7/91 (8%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE----LFETSILFRLL  335
            D +  L +I+ +Q LG+ +HF+ +I SIL+ ++N +    +DN+E    L+ TS+ FRLL
Sbjct  99   DAVYQLELIDNLQRLGVAYHFELEIKSILESRWNDYK---KDNREMKQDLYATSVEFRLL  155

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GY++P DVF  F +++G FK  L  D+K
Sbjct  156  RQHGYNVPQDVFNSFKDEQGNFKNCLRDDVK  186



>sp|Q5SBP6.1|GDS_OCIBA RecName: Full=Germacrene-D synthase; AltName: Full=(-)-germacrene 
D synthase [Ocimum basilicum]
 gb|AAV63786.1| germacrene D synthase [Ocimum basilicum]
Length=546

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 63/96 (66%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            +  L Q  +D +  + +I+AIQ LG+ +HF+ +I   L++ Y+ F I  +DN ++   ++
Sbjct  59   KTLLAQTLDDFVLKIELIDAIQRLGVGYHFEKEINHSLRQIYDTFQISSKDN-DIRVVAL  117

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY +PSDVF KFI+++G+  E +  +++
Sbjct  118  RFRLLRQHGYPVPSDVFKKFIDNQGRLDESVMNNVE  153



>ref|XP_008224888.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Prunus 
mume]
Length=524

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/97 (42%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETS  317
            ++ L  + ED+L  L  ++A+QHLG++HHF++++ + LQ+QY+     + D N +L E S
Sbjct  18   KDALANVGEDEL--LIAVDAMQHLGLEHHFREEMEAFLQKQYHARA--YDDCNHQLLEVS  73

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GYH+ +DVF KF N +      L KDI+
Sbjct  74   LRFRLLRQQGYHVTTDVFNKFKNIEDLTSGLLYKDIE  110



>ref|XP_008441664.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=590

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 3/92 (3%)
 Frame = +3

Query  162  QEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGI---LFRDNKELFETSILFRL  332
            + D L+VL++I+ IQ LGIDH F+++I +ILQ+QY        L      L E ++ FRL
Sbjct  97   KNDSLEVLNMIDGIQRLGIDHCFKEEIEAILQKQYTIMATHHYLIDTKCSLHEVALRFRL  156

Query  333  LRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LRQ GY IPSDVF  F++  G+  ++  +DI+
Sbjct  157  LRQRGYFIPSDVFESFMDKNGELNKKGIEDIE  188



>ref|XP_007149934.1| hypothetical protein PHAVU_005G111400g [Phaseolus vulgaris]
 gb|ESW21928.1| hypothetical protein PHAVU_005G111400g [Phaseolus vulgaris]
Length=578

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 5/86 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D L+ L +I+ IQ LGI+HHF+++I   L R  +       + K+LF TS+ FRLLR +G
Sbjct  86   DSLRTLELIDTIQRLGIEHHFEEEINLQLGRVGD-----CNNAKDLFATSLQFRLLRHNG  140

Query  348  YHIPSDVFTKFINDKGKFKEELSKDI  425
            +   SDVF  F++  G FKE +++DI
Sbjct  141  WSTSSDVFNNFLDKSGNFKESVTRDI  166



>gb|KGN55876.1| hypothetical protein Csa_3G021130 [Cucumis sativus]
Length=553

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG--ILFRDNKELFET  314
            R  L    E  L+ L  I+ IQ LG+ +HF  +I   L R Y  +   I    N+++   
Sbjct  51   RKMLITCVEKPLEQLIFIDLIQRLGLAYHFDIEIKEALDRVYMNYNNRITSESNEDIHTV  110

Query  315  SILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            S+ FRLLRQ  Y I  D+F KF ND+G FKE L+KD+K
Sbjct  111  SLRFRLLRQQRYSISCDIFNKFTNDEGNFKETLTKDVK  148



>emb|CAN62603.1| hypothetical protein VITISV_009665 [Vitis vinifera]
Length=587

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            ++L +I++IQ LG+ +HF+ +I   L+  Y  +  L  DN++L   S+ FRLLRQ+GY +
Sbjct  75   ELLKLIDSIQLLGLTYHFEREIEEALKDMYGTYS-LVDDNEDLTNASLRFRLLRQEGYXV  133

Query  357  PSDVFTKFINDKGKFKEELSKDI  425
            PSDVF+KF + +G FK  L  D+
Sbjct  134  PSDVFSKFKDKEGNFKXSLIGDL  156



>gb|AJD19682.1| sesquiterpene synthase Tps1 [Cucumis melo]
Length=570

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 40/92 (43%), Positives = 59/92 (64%), Gaps = 6/92 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG-ILFRDNKE-----LFETSILF  326
            E+ L  L+++++IQ LG+ +HF+D+I   L+  Y  +   L   NK+     L  T++LF
Sbjct  72   ENQLVKLNLVDSIQRLGVSYHFEDEIDEFLKHIYVSYNNSLLLSNKDIEGEDLHITALLF  131

Query  327  RLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
            RLLRQ GY I  D+F KF++D GKFKE L +D
Sbjct  132  RLLRQQGYRISCDIFLKFMDDNGKFKESLVED  163



>ref|XP_004147250.1| PREDICTED: (-)-germacrene D synthase-like [Cucumis sativus]
Length=507

 Score = 75.1 bits (183),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 41/98 (42%), Positives = 55/98 (56%), Gaps = 2/98 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG--ILFRDNKELFET  314
            R  L    E  L+ L  I+ IQ LG+ +HF  +I   L R Y  +   I    N+++   
Sbjct  5    RKMLITCVEKPLEQLIFIDLIQRLGLAYHFDIEIKEALDRVYMNYNNRITSESNEDIHTV  64

Query  315  SILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            S+ FRLLRQ  Y I  D+F KF ND+G FKE L+KD+K
Sbjct  65   SLRFRLLRQQRYSISCDIFNKFTNDEGNFKETLTKDVK  102



>ref|NP_001268099.1| R-linalool synthase, chloroplastic-like [Vitis vinifera]
 gb|ADR66822.1| geraniol synthase [Vitis vinifera]
Length=593

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/86 (40%), Positives = 59/86 (69%), Gaps = 5/86 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D    + +++ ++ LG+ +HF+D+I ++LQR  +     +  +++LF T++ FRLLRQ+G
Sbjct  97   DSRAAMEMVDTVERLGLSYHFEDEINALLQRFCD-----WNASEDLFTTALRFRLLRQNG  151

Query  348  YHIPSDVFTKFINDKGKFKEELSKDI  425
            +   SDVF KF++  GKFKE L++DI
Sbjct  152  FPTHSDVFGKFMDKNGKFKESLTEDI  177



>ref|XP_007211378.1| hypothetical protein PRUPE_ppa002670mg [Prunus persica]
 gb|EMJ12577.1| hypothetical protein PRUPE_ppa002670mg [Prunus persica]
Length=646

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 63/96 (66%), Gaps = 4/96 (4%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++ L  + ED+L +   ++A+QHLG+DHHF+++I + LQ+QY+        N +L E S+
Sbjct  141  KDALANVGEDELLI--AVDAMQHLGLDHHFREEIEAFLQKQYHARAY-DNCNHQLLEVSL  197

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+ +DVF KF N +   K  L KDI+
Sbjct  198  RFRLLRQQGYHVTTDVFNKFKNIQ-DLKSGLDKDIE  232



>ref|XP_006369780.1| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
 gb|ERP66349.1| hypothetical protein POPTR_0001s315502g, partial [Populus trichocarpa]
Length=558

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQD  344
            D +  L +I+ +Q LG+ +HF+ +I SIL+ ++N +    R+ KE L+ TS+ FRLLRQ 
Sbjct  64   DAVYQLELIDNLQRLGVAYHFELEIKSILESRWNDYKKDNREMKEDLYGTSVEFRLLRQH  123

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY++P DVF  F +++G FK  L  D+K
Sbjct  124  GYNVPQDVFNSFKDEQGNFKNCLRDDVK  151



>ref|XP_011015877.1| PREDICTED: terpene synthase 10-like [Populus euphratica]
Length=603

 Score = 75.5 bits (184),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQD  344
            D +  L +I+ +Q LG+ +HF+ +I SIL+ ++N +    R+ KE L+ TS+ FRLLRQ 
Sbjct  99   DAVYQLELIDNLQRLGVAYHFELEIKSILESRWNHYKEDNREMKEDLYATSVEFRLLRQH  158

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY++P DVF  F ++ G FK  L  D+K
Sbjct  159  GYNVPQDVFNSFKDEHGNFKNCLRDDVK  186



>ref|NP_001284382.1| (+)-gamma-cadinene synthase [Cucumis melo]
 sp|B2KSJ5.1|GCSY1_CUCME RecName: Full=(+)-gamma-cadinene synthase; Short=CmTpsNY; AltName: 
Full=(+)-delta-cadinene synthase [Cucumis melo]
 gb|ABX83200.1| terpene synthase [Cucumis melo]
Length=571

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 39/92 (42%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQR---QYNKFGILFRDN---KELFETSILF  326
            E+ L  L+++++IQ LG+ +HF+D++   L+     YN   +L   N   ++L  T++LF
Sbjct  72   ENQLIKLNLVDSIQRLGVSYHFEDEVDEFLEHIYVSYNNSLLLSNKNSNGEDLHITALLF  131

Query  327  RLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
            RLLRQ GY I  D+F KF++D GKFKE L +D
Sbjct  132  RLLRQQGYRISCDIFLKFMDDNGKFKESLVED  163



>ref|XP_006363765.1| PREDICTED: (-)-germacrene D synthase-like [Solanum tuberosum]
Length=551

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 12/103 (12%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYN-------KFGILFRDNK  299
            R  L       LQ L +IN IQ LG+ +HF+ +I  +L   Y        +FG       
Sbjct  51   RKMLVMAPSKSLQKLELINTIQLLGVAYHFEHEIEELLSCFYTCYDDWIGEFG-----ES  105

Query  300  ELFETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            +L   ++ FRLLRQ GY++ SD F KFIN++G +KEEL++D++
Sbjct  106  DLHVVALSFRLLRQQGYYVSSDAFGKFINEQGSYKEELARDVQ  148



>gb|KDP31577.1| hypothetical protein JCGZ_14802 [Jatropha curcas]
Length=523

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L    +   + L +I+AIQ LGI +HF+++I + L++ Y  +  L +++  L+   +
Sbjct  52   REMLSSAADKPSEQLKLIDAIQRLGIAYHFEEEIETALKQIYTTYRNL-KEDDNLYTVGL  110

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ+GY++ +DVF KF + +G FKE L KD++
Sbjct  111  RFRLLRQEGYNVSTDVFNKFKDSEGNFKEYLIKDVQ  146



>ref|XP_008441674.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=546

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 60/92 (65%), Gaps = 5/92 (5%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF----GILFRDNKELFETSILFRL  332
            +D L+ L++I+A+Q LG+++ FQ +I +IL+  Y  F    G    DN +L E ++ FRL
Sbjct  46   DDPLESLNLIDAVQRLGLEYRFQTEIDAILEHHYAIFVDHDGDCMNDN-DLHEVALRFRL  104

Query  333  LRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LRQ GY + SDVF  F+N+ G FK+ L  DIK
Sbjct  105  LRQRGYFVSSDVFNIFMNEDGHFKQNLEHDIK  136



>gb|AGV40228.1| sesquiterpene synthase [Aquilaria sinensis]
Length=547

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/82 (43%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +IN+IQ LG+ +HF+D+I ++LQ  +        +N  L   S+LFRLLRQ G  +  
Sbjct  58   LDLINSIQRLGVAYHFEDEIENLLQGIHKNLDNCLEENDNLHGISLLFRLLRQSGLTVSC  117

Query  363  DVFTKFINDKGKFKEELSKDIK  428
            D+F KF ++ GK KE LS+D++
Sbjct  118  DMFNKFKDESGKLKESLSEDVR  139



>ref|XP_006367561.1| PREDICTED: germacrene C synthase-like [Solanum tuberosum]
Length=549

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +  E  LQ L +I+A+Q LG+ +HF +QI + +Q  ++ F     D+  L   S+
Sbjct  50   RKMLVEAPEGSLQKLVLIDAMQRLGVAYHFDNQIETSIQNIFDAFKQ--NDDDNLHVVSL  107

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRL+RQ G+++ SDVF KF    GKFKE L+ D++
Sbjct  108  YFRLVRQQGHYMSSDVFKKFTEQDGKFKETLTNDVQ  143



>gb|ADT64306.1| E-beta-farnesene synthase 1 [Artemisia annua]
Length=574

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            +++L +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLLELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>ref|XP_006493822.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X2 [Citrus 
sinensis]
Length=479

 Score = 74.7 bits (182),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 58/82 (71%), Gaps = 6/82 (7%)
 Frame = +3

Query  189  VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN---KELFETSILFRLLRQDGYHIP  359
            +I+ +Q LGID++FQD+I  IL+RQY+   I F D     +L E ++ FRLLRQ GY++ 
Sbjct  1    MIDVVQRLGIDYYFQDEIELILRRQYS---IFFTDGDRYNDLQEVALRFRLLRQQGYYVS  57

Query  360  SDVFTKFINDKGKFKEELSKDI  425
             DVF +F N +G+FK+ +S+DI
Sbjct  58   PDVFNRFRNKEGEFKQNVSEDI  79



>gb|AIK19227.1| sesquiterpene synthase [Eugenia uniflora]
Length=582

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN---KELFE  311
            R  L    +  LQ LH+I+ IQ LGI++HF+ +I   L+  +  +  L R++    +L  
Sbjct  66   RKMLAGTVDKPLQKLHLIDQIQRLGIEYHFEREIDEQLEHIHKSYSPLCREDYKVDDLHM  125

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
             +++FRLLRQ GY++ S+ F KF + +GKF+E L KD
Sbjct  126  VALIFRLLRQQGYYVSSEAFNKFKDSEGKFRESLIKD  162



>gb|ADT64308.1| E-beta-farnesene synthase 1 [Artemisia annua]
Length=574

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            +++L +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLLELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>sp|Q5SBP7.1|SELS_OCIBA RecName: Full=Selinene synthase [Ocimum basilicum]
 gb|AAV63785.1| selinene synthase [Ocimum basilicum]
Length=550

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 37/96 (39%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            +N L Q  ++    + +I+AIQ LG+ +HF  +I   L++ +   G +  D+ ++   ++
Sbjct  62   KNLLAQTPDESTGKMELIDAIQRLGVGYHFTTEIQESLRQIHE--GQIRNDDDDVRVVAL  119

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY  P DVF KF++D G FKE L KD++
Sbjct  120  RFRLLRQGGYRAPCDVFEKFMDDGGNFKESLKKDVE  155



>ref|XP_008383955.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Malus domestica]
Length=568

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 61/99 (62%), Gaps = 3/99 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQY---NKFGILFRDNKELFE  311
            R+ L ++    ++ L +I+A+Q LGID+HF+D+I  ILQ+Q+   +       D  +L E
Sbjct  71   RSALKKVGGQAVEGLDMIDAVQRLGIDYHFEDEIDQILQKQHIISSTTAHGAHDPTDLHE  130

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++ FRLLRQ GY +  DVF  F   +G F + LS+DIK
Sbjct  131  VALRFRLLRQHGYFVSDDVFNNFKEGEGNFNQMLSEDIK  169



>ref|XP_008446523.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like [Cucumis melo]
Length=588

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGIL-FRDNKELFETSILFRLLRQDGY  350
            L+ L +I+A Q LGID+ F+++I  +L+RQY       F  + +L + ++LFRLLRQ  Y
Sbjct  100  LECLEIIDAAQRLGIDNQFEEEIEDVLKRQYALINAYHFDGDVDLHKAALLFRLLRQQRY  159

Query  351  HIPSDVFTKFINDKGKFKEELSKDI  425
             +  DVF  F+N+KGKFKE+L  D+
Sbjct  160  LVSQDVFKVFLNEKGKFKEKLKADL  184



>ref|XP_011095305.1| PREDICTED: LOW QUALITY PROTEIN: beta-caryophyllene synthase-like 
[Sesamum indicum]
Length=547

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 33/82 (40%), Positives = 55/82 (67%), Gaps = 0/82 (0%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +I++IQ LG+ +HF+++IG  LQ  ++ +      + +L   ++ FRLLRQ GY +  
Sbjct  70   LELIDSIQRLGVSYHFEEEIGKSLQYMHDTYLECCNKDNDLRTVALRFRLLRQQGYRVSC  129

Query  363  DVFTKFINDKGKFKEELSKDIK  428
            DVF KFI+D+G FKE + +D++
Sbjct  130  DVFNKFIDDQGNFKESIMEDVE  151



>emb|CAN62114.1| hypothetical protein VITISV_032023 [Vitis vinifera]
Length=532

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ  Y++F      N +L+  ++ FRLLRQ GY+I
Sbjct  71   QLLNFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNI  130

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
               +F KF ++KG FKE+L  +I+
Sbjct  131  SCGIFNKFKDEKGSFKEDLISNIQ  154



>ref|XP_006369785.1| hypothetical protein POPTR_0001s31580g [Populus trichocarpa]
 gb|ERP66354.1| hypothetical protein POPTR_0001s31580g [Populus trichocarpa]
Length=501

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 38/88 (43%), Positives = 59/88 (67%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQD  344
            D +  L +I+ +Q LG+ +HF+ +I SIL+ ++N +    R+ KE L+ TS+ FRLLRQ 
Sbjct  7    DAVYQLELIDNLQRLGVAYHFELEIKSILESRWNDYKKDNREMKEDLYGTSVEFRLLRQH  66

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY++P DVF  F +++G FK  L  D+K
Sbjct  67   GYNVPQDVFNSFKDEQGNFKNCLRDDVK  94



>ref|XP_010248057.1| PREDICTED: probable terpene synthase 2 [Nelumbo nucifera]
Length=635

 Score = 75.1 bits (183),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/86 (41%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETSILFRLLRQDGY  350
            L++L++I+ +Q LG+ +HF+ +   +L++ +      F D   +L   ++LFRLLRQ GY
Sbjct  148  LEILNLIDTLQRLGLSYHFEGERNQMLEQIFEAHISYFNDMGDDLHAVALLFRLLRQHGY  207

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
            +IP DVF KF +++G FKE L++DI+
Sbjct  208  NIPCDVFNKFKDERGNFKEILTRDIR  233



>ref|XP_010645662.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=546

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD----NKELFETSILFRLL  335
            + L  L +I+ +Q LGI +HF ++I  IL   YN +    R+    N +L+ T++ FRLL
Sbjct  101  EPLHQLELIDTLQRLGIHYHFGEEIKRILHGIYNNYN---RNDTWKNGDLYATALEFRLL  157

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GYH+P DVF  FIN  G  K  L++DIK
Sbjct  158  RQHGYHVPQDVFHIFINKMGTVKPWLNEDIK  188



>emb|CAN69555.1| hypothetical protein VITISV_013102 [Vitis vinifera]
Length=533

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ  Y++F      N +L+  ++ FRLLRQ GY+I
Sbjct  71   QLLNFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNI  130

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
               +F KF ++KG FKE+L  +I+
Sbjct  131  SCGIFNKFKDEKGSFKEDLISNIQ  154



>ref|XP_010908676.1| PREDICTED: alpha-humulene synthase-like [Elaeis guineensis]
Length=556

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 56/87 (64%), Gaps = 4/87 (5%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            DDLQ + +I+A+Q LG+ +HF+ +I  IL + YN    +  D + L   ++ FRLLRQ G
Sbjct  72   DDLQKMELIDALQRLGMAYHFEKEIDEILNQIYN----VHIDGESLHVVALHFRLLRQHG  127

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            Y++P++VF KF   +G FK  L  D+K
Sbjct  128  YNVPANVFNKFKEVEGGFKATLRNDMK  154



>emb|CAN82665.1| hypothetical protein VITISV_017009 [Vitis vinifera]
Length=604

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD----NKELFETSILFRLL  335
            + L  L +I+ +Q LGI +HF ++I  IL   YN +    R+    N +L+ T++ FRLL
Sbjct  101  EPLHQLELIDTLQRLGIHYHFGEEIKRILHSIYNNYN---RNDTWKNGDLYATALEFRLL  157

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GYH+P DVF  FIN  G  K  L++DIK
Sbjct  158  RQHGYHVPQDVFHIFINKMGTVKPWLNEDIK  188



>gb|KEH34289.1| sesquiterpene synthase [Medicago truncatula]
Length=557

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 42/101 (42%), Positives = 62/101 (61%), Gaps = 7/101 (7%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQ---RQYNKFG--ILFRDNKEL  305
            R  L    E  L  +H+I++I  LG+++HF+D+I  ILQ   + Y + G  I F DN  L
Sbjct  57   RKMLVSKSEKPLAKVHLIDSICRLGLNYHFEDEIDEILQDIHKNYVQNGEIITFEDN--L  114

Query  306  FETSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
               ++LFRLLRQ G H+  +VF KF +D+G F E L +D++
Sbjct  115  CSLAVLFRLLRQQGLHVSPNVFYKFKDDQGNFSERLIRDVE  155



>gb|ADT64310.1| E-beta-farnesene synthase 4 [Artemisia annua]
Length=574

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++++ +I+AIQ LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLIELIDAIQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>ref|XP_006449155.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
 ref|XP_006449156.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
 gb|ESR62395.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
 gb|ESR62396.1| hypothetical protein CICLE_v10014632mg [Citrus clementina]
Length=614

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDD-LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETS  317
            ++ L ++ +DD  + L +I+ +Q LGID++FQD+I  ILQRQ   F      + +L E +
Sbjct  112  KHILIRVGDDDPFEGLAMIDTVQRLGIDYYFQDEIEQILQRQSIMFSNHGDRHNDLQEVA  171

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            + FRLLRQ GY++  DVF  F N +GKF + +S DI
Sbjct  172  LRFRLLRQQGYYVSPDVFNNFKNKEGKFTQNISGDI  207



>gb|ADR74201.1| (+)-alpha-phellandrene synthase [Vitis vinifera]
Length=593

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 7/91 (8%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD----NKELFETSILFRLL  335
            + L  L +I+ +Q LGI +HF ++I  IL   YN +    R+    N +L+ T++ FRLL
Sbjct  101  EPLHQLELIDTLQRLGIHYHFGEEIKRILHSIYNNYN---RNDTWKNGDLYATALEFRLL  157

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GYH+P DVF  FIN  G  K  L++DIK
Sbjct  158  RQHGYHVPQDVFHIFINKMGTVKPWLNEDIK  188



>emb|CDP12296.1| unnamed protein product [Coffea canephora]
Length=571

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/96 (35%), Positives = 60/96 (63%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +   + L+ L  I+AIQ LGI++ F+++I   LQ+ + K    + DN   +  ++
Sbjct  65   RTMLQETASNPLEQLQFIDAIQRLGIEYQFEEEISQALQKLHEKHQS-WEDNDHFYTAAL  123

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FR+LRQ+G+ + +D+F KF++ +GKF E L  D++
Sbjct  124  YFRILRQEGFRVSADIFKKFLDAEGKFGEGLVNDVQ  159



>ref|NP_001268216.1| (-)-alpha-terpineol synthase [Vitis vinifera]
 gb|AAS79352.1| (-)-a-terpineol synthase [Vitis vinifera]
Length=590

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQDGY  350
            L  L +I+ +Q LGI +HF+D+I  IL   YN++       K+ L+ T++ FRLLRQ GY
Sbjct  98   LDQLELIDVLQRLGIYYHFKDEIKRILNSIYNQYNRHEEWQKDDLYATALEFRLLRQHGY  157

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
             +P DVF++F +D G FK  L +D+K
Sbjct  158  DVPQDVFSRFKDDTGSFKACLCEDMK  183



>emb|CDP16459.1| unnamed protein product [Coffea canephora]
Length=487

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 55/83 (66%), Gaps = 1/83 (1%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGIL-FRDNKELFETSILFRLLRQDGYHIP  359
            L +I+ IQ LG+ +HF+ +I + LQ+ ++ +  L  +D  +L+  ++ FRLLRQ G+H  
Sbjct  66   LDMIDTIQRLGVSYHFESEIEASLQKIFDAYHELNHKDGNDLYTIALRFRLLRQKGFHAS  125

Query  360  SDVFTKFINDKGKFKEELSKDIK  428
             DVF KF N KG FKE L+ D++
Sbjct  126  CDVFNKFKNPKGDFKESLANDMR  148



>ref|XP_009387496.1| PREDICTED: alpha-humulene synthase-like [Musa acuminata subsp. 
malaccensis]
Length=458

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/93 (40%), Positives = 60/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            +++   D LQ + ++++IQ LG+ +HF+ +I   L R ++     F D + L+ET++ FR
Sbjct  63   MFKDTTDILQTMDLVDSIQLLGLSYHFEKEISEALNRVHDAD---FND-QALYETALRFR  118

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLRQ+GYH+  DVF KF ++KG F   L  D+K
Sbjct  119  LLRQEGYHVTPDVFNKFKDEKGSFMCTLESDVK  151



>emb|CAN76564.1| hypothetical protein VITISV_029137 [Vitis vinifera]
Length=449

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 13/102 (13%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGIL--FRDNKELFET  314
            ++ L ++ E   +VL +I+AIQ L ID+HF D+I +ILQRQY        FRDN  L+E 
Sbjct  30   KSVLNEVGEGTFEVLLMIDAIQRLDIDYHFHDEIEAILQRQYRIVITTDDFRDN--LYEV  87

Query  315  SILFRLLRQDGYHIP---------SDVFTKFINDKGKFKEEL  413
            ++ FRLLRQ+GY++          + VF  F + KGKF+E+L
Sbjct  88   ALRFRLLRQEGYYLIFLVMYMNELTXVFXNFKDKKGKFEEKL  129



>ref|XP_009385198.1| PREDICTED: probable terpene synthase 11 [Musa acuminata subsp. 
malaccensis]
Length=590

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 3/79 (4%)
 Frame = +3

Query  189  VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSDV  368
            +++ IQ LGI H F+D++  IL R  +       D  +LF T++ FRLLRQ GY++ +DV
Sbjct  93   LVDTIQRLGISHQFEDELELILDRNPSAAQ---GDEDDLFSTTLRFRLLRQRGYNVDTDV  149

Query  369  FTKFINDKGKFKEELSKDI  425
            F +F++ KG FKE LSKD+
Sbjct  150  FHEFMDRKGHFKESLSKDL  168



>emb|CAN82172.1| hypothetical protein VITISV_040547 [Vitis vinifera]
 gb|ADR74221.1| (E)-beta-caryophyllene synthase [synthetic construct]
Length=555

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ  Y++F      N +L+  ++ FRLLRQ GY+I
Sbjct  71   QLLNFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNI  130

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
               +F KF ++KG FKE+L  +I+
Sbjct  131  SCGIFNKFKDEKGSFKEDLISNIQ  154



>ref|XP_009591578.1| PREDICTED: (-)-germacrene D synthase-like [Nicotiana tomentosiformis]
Length=552

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 5/88 (6%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE---LFETSIL-FRLLRQD  344
            Q L +I+ IQ LG+ +HF+++I   L+  YN     F DN E   + ET  L FRLLRQ 
Sbjct  64   QKLELIDMIQRLGVSYHFENEIEESLKHIYNSCS-EFDDNDEDHNMLETVALRFRLLRQA  122

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY++P DV  +F++D+GKFKE L  D+K
Sbjct  123  GYNVPCDVLEEFMDDEGKFKEVLVSDVK  150



>gb|AEM23828.1| sesquiterpene synthase [Solanum habrochaites]
Length=554

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 8/99 (8%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIG---SILQRQYNKFGILFRDNKELFE  311
            R  L     + L+ L +IN IQ LG+ +HFQ +I    S +   Y ++ I      +L  
Sbjct  57   RKMLVMAPSNSLEKLELINTIQCLGLAYHFQSEIDESLSYMYTHYEEYSI-----GDLHA  111

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++ FRLLRQ GY++  D F KF ND+G FKEEL KD++
Sbjct  112  IALCFRLLRQQGYYVSCDAFKKFTNDQGNFKEELVKDVE  150



>ref|XP_010645660.1| PREDICTED: (-)-alpha-terpineol synthase-like [Vitis vinifera]
Length=597

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 41/92 (45%), Positives = 56/92 (61%), Gaps = 7/92 (8%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD----NKELFETSILFRL  332
            E  L  L +I+ +Q LGI +HF ++I  IL   YN +    R+    N +L+ T++ FRL
Sbjct  100  EKLLHQLELIDTLQRLGIHYHFGEEIRRILHGIYNNYN---RNDTWKNGDLYATALEFRL  156

Query  333  LRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LRQ GYH+P DVF  FIN  G  K  L++DIK
Sbjct  157  LRQHGYHVPQDVFHIFINKMGTVKPWLNEDIK  188



>gb|ADT64309.1| E-beta-farnesene synthase 3 [Artemisia annua]
Length=574

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++++ +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLIELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>ref|NP_001239041.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEM23832.1| sesquiterpene synthase [Solanum lycopersicum]
 gb|AEP82780.1| TPS17 [Solanum lycopersicum]
Length=554

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 40/99 (40%), Positives = 56/99 (57%), Gaps = 8/99 (8%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIG---SILQRQYNKFGILFRDNKELFE  311
            R  L       L+ L +IN IQ LG+ +HFQ +I    S +   Y ++ I      +L  
Sbjct  57   RKMLVMAPSKSLEKLELINTIQCLGLGYHFQSEIDESLSYMYTHYEEYSI-----GDLHA  111

Query  312  TSILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             ++ FRLLRQ GY++  D F KF ND+G FKEEL KD++
Sbjct  112  IALCFRLLRQQGYYVSCDAFKKFTNDQGNFKEELVKDVE  150



>ref|XP_010039959.1| PREDICTED: (-)-alpha-terpineol synthase-like [Eucalyptus grandis]
Length=596

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            L++ + + +  L   + +Q LG+ +HF+ +I S L   YN        N +L+  S+ FR
Sbjct  100  LFEREMNQVDKLEFFDVVQRLGLGYHFETEIKSALSLIYNNTEDAQLSN-DLYAASLRFR  158

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLRQ GYH+P DVF +F+N  G F E LSKD K
Sbjct  159  LLRQHGYHVPQDVFQRFMNMTGTFNESLSKDAK  191



>ref|XP_004505471.1| PREDICTED: (-)-germacrene D synthase-like [Cicer arietinum]
Length=563

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 2/87 (2%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF--GILFRDNKELFETSILFRLLRQDG  347
            L+  ++I++IQ LG+ HHF+ +IG +LQ  +N +        N++L   +++FRLLRQ G
Sbjct  75   LEEANLIDSIQRLGLYHHFEHEIGEVLQHIHNSYVENGAITLNEDLHCVALVFRLLRQQG  134

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            YHI  DVF KF N++G F E L  D++
Sbjct  135  YHILPDVFKKFKNEQGNFNETLFGDVE  161



>gb|AIC76496.1| linalool/nerolidol synthase [Prunus cerasoides var. campanulata]
Length=561

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 3/96 (3%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            ++ L  + ED  + L  ++A+QHLG+DHHF+++I   LQ+QY+        N +L E S+
Sbjct  57   KDALANVGED--EQLIAVDAMQHLGLDHHFREEIEVFLQKQYHARA-YDNCNHQLLEVSL  113

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GYH+ +DVF KF N +      L KDI+
Sbjct  114  RFRLLRQQGYHVTTDVFNKFKNIEDLTSGLLDKDIE  149



>ref|XP_010645413.1| PREDICTED: (-)-alpha-terpineol synthase [Vitis vinifera]
Length=552

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQDGY  350
            L  L +I+ +Q LGI +HF+D+I  IL   YN++       K+ L+ T++ FRLLRQ GY
Sbjct  98   LDQLELIDVLQRLGIYYHFKDEIKRILNSIYNQYNRHEEWQKDDLYTTALEFRLLRQHGY  157

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
             +P DVF++F ++ G FK  L +DIK
Sbjct  158  DVPQDVFSRFKDETGSFKACLCEDIK  183



>gb|AAX39387.1| (E)-beta-farnesene synthase [Artemisia annua]
Length=574

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++++ +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLIELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>ref|XP_004487361.1| PREDICTED: geraniol synthase, chloroplastic-like [Cicer arietinum]
Length=565

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D +  L +I++IQ LGI HHF+D+I   L R  N     +  ++++F TS+ FRLLR  G
Sbjct  84   DPIATLKMIDSIQGLGISHHFEDEINIQLGRICN-----WDASQDIFATSLQFRLLRHYG  138

Query  348  YHIPSDVFTKFINDKGKFKEELSKDI  425
            Y   SD+F KF++  G FKE  +KDI
Sbjct  139  YPTTSDIFRKFLDKSGNFKESFTKDI  164



>gb|ADT64307.1| E-beta-farnesene synthase 2 [Artemisia annua]
Length=575

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++++ +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  87   VKLIELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  146

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  147  VSSGVFKDFMDEKGKFKESLCND  169



>gb|ABX09997.1| sesquiterpene cyclase [Artemisia annua]
Length=577

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++++ +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLIELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>sp|Q9FXY7.1|FARS_ARTAN RecName: Full=(E)-beta-farnesene synthase; Short=AaFS; AltName: 
Full=Terpene synthase 10 [Artemisia annua]
 emb|CAC12731.1| putative sesquiterpene cyclase [Artemisia annua]
Length=577

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/83 (41%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++++ +I+A+Q LGI +HF+++I   LQ  +  +G  + D + L   S+ FRLLRQ G++
Sbjct  86   VKLIELIDAVQRLGIAYHFEEEIEEALQHIHVTYGEQWVDKENLQSISLWFRLLRQQGFN  145

Query  354  IPSDVFTKFINDKGKFKEELSKD  422
            + S VF  F+++KGKFKE L  D
Sbjct  146  VSSGVFKDFMDEKGKFKESLCND  168



>sp|Q6PWU2.1|ATESY_VITVI RecName: Full=(-)-alpha-terpineol synthase [Vitis vinifera]
 gb|AAS79351.1| (-)-a-terpineol synthase [Vitis vinifera]
Length=590

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQDGY  350
            L  L +I+ +Q LGI +HF+D+I  IL   YN++       K+ L+ T++ FRLLRQ GY
Sbjct  98   LDQLELIDVLQRLGIYYHFKDEIKRILNGIYNQYNRHEEWQKDDLYATALEFRLLRQHGY  157

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
             +P DVF++F +D G FK  L +D+K
Sbjct  158  DVPQDVFSRFKDDTGSFKACLCEDMK  183



>gb|AHC54050.1| gamma-terpinene synthase [Coriandrum sativum]
Length=610

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/96 (40%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +   D L  L +++ IQ LG+ +HFQD+I  IL+  Y+    L   + +L   S+
Sbjct  105  RMLLNKEDLDSLHKLELVDTIQRLGVSYHFQDEIKRILEAMYSTNEKL--HSHDLNAVSL  162

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ  + +P ++F +F+++ GKFK  LSKD+K
Sbjct  163  KFRLLRQHSFDVPEEIFKEFMDESGKFKASLSKDMK  198



>ref|XP_006853509.1| hypothetical protein AMTR_s00032p00219920 [Amborella trichopoda]
 gb|ERN14976.1| hypothetical protein AMTR_s00032p00219920 [Amborella trichopoda]
Length=510

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +3

Query  180  VLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIP  359
            +L +I++IQ LG+ +HF+++I   L   Y    I    + +L+  S+ FRLLRQ GYH+ 
Sbjct  25   LLELIDSIQRLGVGYHFEEEIKVTLDNIYASGNIQHSWSDDLYRVSLAFRLLRQHGYHMS  84

Query  360  SDVFTKFINDKGKFKEELSKDIK  428
            SDVF +F ++KG FK  L  D+K
Sbjct  85   SDVFGRFKDEKGNFKLSLIGDVK  107



>emb|CAN69762.1| hypothetical protein VITISV_006978 [Vitis vinifera]
Length=506

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 43/103 (42%), Positives = 63/103 (61%), Gaps = 13/103 (13%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGIL--FRDNKELFET  314
            ++ L ++ E   +VL +I+AI  LGID+HF D+I +ILQRQY        F DN  L+E 
Sbjct  242  KSVLNEVGEGTFEVLLMIDAIXRLGIDYHFHDEIEAILQRQYRIVITTDDFXDN--LYEV  299

Query  315  SILFRLLRQDGYHIP---------SDVFTKFINDKGKFKEELS  416
            ++ FRL RQ+GY++          +DVF  F + KGKF+E+ S
Sbjct  300  ALRFRLXRQEGYYLIFLVMYMNELTDVFXNFKDKKGKFEEKTS  342



>gb|AGU13712.1| 9-epi-caryophyllene synthase [Lavandula x intermedia]
Length=539

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 59/88 (67%), Gaps = 4/88 (5%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETSILFRLLRQD  344
            D+L+ L +I+ +Q LGI +HFQD I  +L   +N FG   +   K+L  T++ FRLLRQ 
Sbjct  52   DELEQLQLIHLLQRLGISYHFQDCIAKML---HNIFGSENKHVEKDLHLTALKFRLLRQH  108

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GYH+P DVF +F +++G F+  + +D++
Sbjct  109  GYHVPQDVFNRFTDEEGNFETWVGEDVR  136



>ref|XP_004145159.1| PREDICTED: (3S,6E)-nerolidol synthase 2, chloroplastic/mitochondrial-like 
[Cucumis sativus]
Length=503

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGI--LFRDNKELFETSILFRLLRQDG  347
            L+VL++I+ IQ LGIDH F+++I +IL+ QY        F     L E ++ FRLLRQ G
Sbjct  105  LEVLNMIDGIQRLGIDHCFKEEIEAILKEQYTIMATHHYFDTKCSLHEVALRFRLLRQHG  164

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            Y IPSDVF  F    G+  +++ +DI+
Sbjct  165  YFIPSDVFESFTAKNGELNKKVFEDIE  191



>emb|CAN64328.1| hypothetical protein VITISV_027228 [Vitis vinifera]
Length=570

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQDGY  350
            L  L +I+ +Q LGI +HF+D+I  IL   YN++       K+ L+ T++ FRLLRQ GY
Sbjct  98   LDQLELIDVLQRLGIYYHFKDEIKRILNSIYNQYNRHEEWQKDDLYTTALEFRLLRQHGY  157

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
             +P DVF++F ++ G FK  L +DIK
Sbjct  158  DVPQDVFSRFKDETGSFKACLCEDIK  183



>ref|XP_004487383.1| PREDICTED: geraniol synthase, chloroplastic-like [Cicer arietinum]
Length=580

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 5/88 (6%)
 Frame = +3

Query  162  QEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQ  341
              D +  L +I++IQ LGI HHF+D+I   L R  N     +  ++++F TS+ FRLLR 
Sbjct  82   SSDPILTLKMIDSIQGLGISHHFEDEINIQLGRICN-----WDTSQDIFATSLQFRLLRH  136

Query  342  DGYHIPSDVFTKFINDKGKFKEELSKDI  425
            +GY   SDVF KF++  G FKE  +KDI
Sbjct  137  NGYPTTSDVFRKFLDKSGNFKESFTKDI  164



>gb|KDO46373.1| hypothetical protein CISIN_1g024780mg [Citrus sinensis]
Length=262

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 59/96 (61%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R+ +    +   Q L +++A+Q LG+ +HF+ +I   L++ Y+        + +L+  S+
Sbjct  71   RSMITATADTPAQKLQLVDAVQRLGVAYHFEQEIEDALEKIYHDDFDNND-DVDLYSVSL  129

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ G+ +P DVF KF +D+GKFK  L KD++
Sbjct  130  RFRLLRQQGFKVPCDVFEKFKDDEGKFKASLVKDVQ  165



>emb|CAN76978.1| hypothetical protein VITISV_044295 [Vitis vinifera]
Length=524

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L  I+A+Q LG+ +HF+ +I   LQ  Y+ +  +   N +L++ ++ FRLLRQ G++I  
Sbjct  78   LKFIDAVQRLGVAYHFEKEIEEALQNTYDNYHCIDDINDDLYDVALRFRLLRQQGFNISC  137

Query  363  DVFTKFINDKGKFKEELSKD  422
            D+F ++ ++KG+FKE L  D
Sbjct  138  DIFNRYTDEKGRFKESLIND  157



>ref|XP_010106430.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
 gb|EXC10518.1| (3S,6E)-nerolidol synthase 1 [Morus notabilis]
Length=576

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 42/89 (47%), Positives = 56/89 (63%), Gaps = 7/89 (8%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNK-----ELFETSILFRLLRQ  341
            Q L VI+AIQ LGID+ FQ++I  IL+ Q+  F   + DNK      L + ++ FRLLRQ
Sbjct  91   QALKVIDAIQRLGIDYLFQEEIEKILRNQFMSFD-HYTDNKHNIEDHLHDAALRFRLLRQ  149

Query  342  DGYHIPSDVFTKFINDKG-KFKEELSKDI  425
             GY +P+ +F K  + KG  FK EL KDI
Sbjct  150  QGYFVPAGIFNKLKDKKGNNFKTELGKDI  178



>ref|XP_010908315.1| PREDICTED: probable terpene synthase 11 [Elaeis guineensis]
Length=567

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 53/78 (68%), Gaps = 4/78 (5%)
 Frame = +3

Query  189  VINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPSDV  368
            +++ +QHLGI +HF+++   +L R Y        D+ +LF T++ FRLLRQ GY +  DV
Sbjct  92   LVDTLQHLGIGYHFEEETNGVLDRCYGTRS----DDDDLFITALRFRLLRQGGYSVTPDV  147

Query  369  FTKFINDKGKFKEELSKD  422
            F KF+++KG FK+ L+K+
Sbjct  148  FHKFMDNKGNFKDPLAKN  165



>gb|AHY21666.1| multiproduct monoterpene synthase [Populus nigra]
Length=593

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/88 (42%), Positives = 58/88 (66%), Gaps = 1/88 (1%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKE-LFETSILFRLLRQD  344
            D +  L +I+ +Q LG+ +HF+ +I SIL+ ++  +    R+ KE L+ TS+ FRLLRQ 
Sbjct  99   DAVYQLELIDNLQRLGVAYHFELEIKSILESRWTDYKKDNREMKEDLYATSVEFRLLRQH  158

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDIK  428
            GY++P DVF  F +++G FK  L  D+K
Sbjct  159  GYNVPQDVFNSFKDEQGNFKNCLRDDVK  186



>gb|AES63645.2| (3S)-linalool/(E)-nerolidol/(E,E)-geranyl linalool synthase [Medicago 
truncatula]
Length=520

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 37/91 (41%), Positives = 58/91 (64%), Gaps = 3/91 (3%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF---GILFRDNKELFETSILFRLL  335
            ED ++ L +I+ IQ LGI+HHF ++I + LQ Q+  F    I F  + EL E ++ FRLL
Sbjct  27   EDPMKSLCMIDIIQRLGIEHHFAEEIEAALQNQHKMFSRNAIDFVHSHELHEVALTFRLL  86

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ G+++ SD+F   + +K  F E+  +D+K
Sbjct  87   RQGGHYVKSDIFDSLMFNKRNFSEKFGEDVK  117



>emb|CDP05818.1| unnamed protein product [Coffea canephora]
Length=551

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 35/83 (42%), Positives = 54/83 (65%), Gaps = 1/83 (1%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGIL-FRDNKELFETSILFRLLRQDGYHIP  359
            L +I+ IQ LG+ +HF+ +I + LQ+ ++ +  L  +D  +L  T++ FRLLRQ G+H  
Sbjct  66   LDMIDTIQRLGVSYHFESEIEASLQKIFDAYSELNHKDGNDLHTTALRFRLLRQKGFHAS  125

Query  360  SDVFTKFINDKGKFKEELSKDIK  428
             DVF KF N +G FKE L+ D +
Sbjct  126  CDVFDKFKNPEGDFKESLASDAR  148



>dbj|BAM24404.1| +limonene synthase [Toona sinensis]
Length=595

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D L  L  I+ +Q LG+ +H+Q+ I  IL   YN +    +  + L+  ++ FRL RQ G
Sbjct  107  DPLHQLEFIDTLQRLGVSYHYQEGIKGILDTVYNNY---MQKQESLYAVALGFRLFRQHG  163

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            YHIP+D+F+ F +DKG  K  L  D +
Sbjct  164  YHIPADIFSSFRDDKGNLKSCLGDDCR  190



>emb|CBI20288.3| unnamed protein product [Vitis vinifera]
Length=682

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 0/83 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I++IQ  G+ +HF+ +I   L+  Y  + ++  DN +L   ++  RLLRQ+GYHI
Sbjct  60   QLLNFIDSIQRSGLAYHFEREIEEALKVMYETYNLVDDDNDDLASAALRIRLLRQEGYHI  119

Query  357  PSDVFTKFINDKGKFKEELSKDI  425
            PSDVF KF +++G FKE L  D+
Sbjct  120  PSDVFKKFKDEEGNFKESLVGDL  142



>dbj|BAH03282.1| +limonene synthase [Toona sinensis]
Length=595

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            D L  L  I+ +Q LG+ +H+Q+ I  IL   YN +    +  + L+  ++ FRL RQ G
Sbjct  107  DPLHQLEFIDTLQRLGVSYHYQEGIKGILDTVYNNY---MQKQESLYAVALGFRLFRQHG  163

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            YHIP+D+F+ F +DKG  K  L  D +
Sbjct  164  YHIPADIFSSFRDDKGNLKSCLGDDCR  190



>ref|XP_006843915.1| hypothetical protein AMTR_s00007p00269150 [Amborella trichopoda]
 gb|ERN05590.1| hypothetical protein AMTR_s00007p00269150 [Amborella trichopoda]
Length=410

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L +I++IQ LG+ +HF+  I   L   Y+   I    + +L+ TS+ FRLLRQ GY +PS
Sbjct  99   LELIDSIQRLGVGYHFEQDIKVALDTIYSNADIQQSWSDDLYATSLAFRLLRQHGYRMPS  158

Query  363  DVFTKFINDKGKFKEELSKDIK  428
            DVF +F+++KG FK  L  D K
Sbjct  159  DVFCRFMDEKGSFKVSLIGDAK  180



>ref|XP_004294317.1| PREDICTED: (-)-germacrene D synthase-like [Fragaria vesca subsp. 
vesca]
Length=552

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/87 (43%), Positives = 57/87 (66%), Gaps = 7/87 (8%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDN----KELFETSILFRLLRQD  344
            Q L +I+ I  LG+  HF+++   ILQ+ Y+    ++  N    KEL+ TS++FRL+RQ 
Sbjct  66   QKLELIDDITRLGVSRHFEEETDEILQKVYDN---VYHANDLYDKELYFTSLVFRLVRQQ  122

Query  345  GYHIPSDVFTKFINDKGKFKEELSKDI  425
            GY+I  ++F+KF N +GKFKE L  D+
Sbjct  123  GYNISCEIFSKFKNGEGKFKESLVNDV  149



>ref|XP_006853523.1| hypothetical protein AMTR_s00032p00224550 [Amborella trichopoda]
 gb|ERN14990.1| hypothetical protein AMTR_s00032p00224550 [Amborella trichopoda]
Length=487

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDG  347
            + + +L +I++IQ LG+ +HF+++I   L   Y    I    + +L+  S+ FRLLRQ G
Sbjct  33   EPVALLELIDSIQRLGVVYHFEEEIQVALDNMYTSGNIQQSWSDDLYTVSLAFRLLRQHG  92

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            YH+ SDVF  F ++KG FK  L  D+K
Sbjct  93   YHMSSDVFGAFKDEKGSFKVSLVGDVK  119



>emb|CBI31266.3| unnamed protein product [Vitis vinifera]
Length=734

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/84 (42%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ  Y++F      N +L+  ++ FRLLRQ GY+I
Sbjct  71   QLLNFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNI  130

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
               +F KF ++KG FKE+L  +I+
Sbjct  131  SCGIFNKFKDEKGSFKEDLISNIQ  154


 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ  Y++F      + +L+  ++ FRLLRQ GY+I
Sbjct  657  QLLNFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTDDDLYNIALQFRLLRQQGYNI  716



>gb|AAU05952.1| beta-caryophyllene synthase [Cucumis sativus]
Length=567

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/92 (40%), Positives = 60/92 (65%), Gaps = 6/92 (7%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKF--GILFRDNK----ELFETSILF  326
            ++ L  L+++++IQ LG+ +HF+D+I   L+  Y  +   +LF  N     +L  +++LF
Sbjct  69   QNPLVKLNLVDSIQRLGVSYHFEDEIDQFLEHMYVSYNNSLLFSSNDSQDDDLHISALLF  128

Query  327  RLLRQDGYHIPSDVFTKFINDKGKFKEELSKD  422
            RLLRQ GY I  D+F KF+++ GKFKE L +D
Sbjct  129  RLLRQHGYRISCDIFLKFMDNNGKFKESLVED  160



>ref|XP_008224887.1| PREDICTED: (3S,6E)-nerolidol synthase 1-like isoform X1 [Prunus 
mume]
Length=536

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 64/97 (66%), Gaps = 5/97 (5%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD-NKELFETS  317
            ++ L  + ED+L +   ++A+QHLG++HHF++++ + LQ+QY+     + D N +L E S
Sbjct  30   KDALANVGEDELLI--AVDAMQHLGLEHHFREEMEAFLQKQYHARA--YDDCNHQLLEVS  85

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GYH+ +DVF KF N +      L KDI+
Sbjct  86   LRFRLLRQQGYHVTTDVFNKFKNIEDLTSGLLYKDIE  122



>ref|XP_010258444.1| PREDICTED: (-)-germacrene D synthase-like [Nelumbo nucifera]
Length=562

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/85 (40%), Positives = 56/85 (66%), Gaps = 1/85 (1%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQY-NKFGILFRDNKELFETSILFRLLRQDGYH  353
            ++L +I+ IQ LG+ +HF+ +I  IL+       G     + +L   ++ FRLLRQ+GY+
Sbjct  75   EILSLIDTIQRLGLAYHFEREIDEILEHMLVTHVGYFNGVDDDLHTIALWFRLLRQNGYN  134

Query  354  IPSDVFTKFINDKGKFKEELSKDIK  428
            IP D+F KF +D GKF++ L++D+K
Sbjct  135  IPCDIFNKFKDDHGKFRDGLTRDLK  159



>ref|XP_004169937.1| PREDICTED: (-)-germacrene D synthase-like [Cucumis sativus]
Length=501

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 2/90 (2%)
 Frame = +3

Query  165  EDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILF--RDNKELFETSILFRLLR  338
            E  L+ L  I+ IQ LG+ +HF  +I   L R Y  +  L     N+++   S+ FRLLR
Sbjct  7    EKPLEQLIFIDLIQRLGLAYHFDIEIKEALDRVYMNYNNLITSESNEDIHVVSLRFRLLR  66

Query  339  QDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            Q  Y I  D+F KF ND+G FKE L+KD+K
Sbjct  67   QQRYSISCDIFNKFTNDEGNFKETLTKDVK  96



>ref|XP_011005621.1| PREDICTED: (-)-germacrene D synthase-like [Populus euphratica]
Length=554

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/91 (42%), Positives = 61/91 (67%), Gaps = 6/91 (7%)
 Frame = +3

Query  159  IQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYN-KFGILFRDNKELFETSILFRLL  335
            +  D  Q L++I+AIQ LG+ +HF+ +I   LQ  YN + G+   ++ +L+ T++ FRLL
Sbjct  67   LASDSSQQLNLIDAIQRLGVAYHFETEIEEALQHIYNNRIGM---EDDDLYNTALGFRLL  123

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GY++  D+F KF +DKG FK+  S D++
Sbjct  124  RQHGYNVSCDIFNKFKDDKGYFKQ--SNDVR  152



>ref|XP_002273624.2| PREDICTED: valencene synthase [Vitis vinifera]
 emb|CBI31268.3| unnamed protein product [Vitis vinifera]
Length=561

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L  I+A+Q LG+ +HF+ +I   LQ  Y+ +  +   N +L++ ++ FRLLRQ G++I  
Sbjct  78   LKFIDAVQRLGVAYHFEKEIEEALQNTYDNYHCIDDINDDLYDVALRFRLLRQQGFNISC  137

Query  363  DVFTKFINDKGKFKEELSKD  422
            D+F ++ ++KG+FKE L  D
Sbjct  138  DIFNRYTDEKGRFKESLIND  157



>gb|ADK73619.1| terpene synthase 3 [Origanum vulgare]
Length=563

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 38/97 (39%), Positives = 56/97 (58%), Gaps = 2/97 (2%)
 Frame = +3

Query  144  NFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILF--RDNKELFETS  317
            N L Q   D    + +I+AIQ LG  +HF++ I   L   Y+++ +     D  E+   S
Sbjct  63   NLLDQTPNDSTLKIELIDAIQRLGFGYHFEEVIDESLGEVYDRYEMPSGKDDEDEIRVRS  122

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            + FRLLRQ GY +P DVF K ++DKG FK+ L  D++
Sbjct  123  LRFRLLRQQGYRVPCDVFEKLLDDKGNFKDSLITDVE  159



>ref|NP_001268215.1| valencene synthase [Vitis vinifera]
 gb|ACO36239.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ   N F      + +L+  ++ FRLLRQ GY I
Sbjct  72   QLLNFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYTI  131

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
              D+F KF +++G+FKE L  D++
Sbjct  132  SCDIFNKFTDERGRFKEALISDVR  155



>gb|AAG24640.2|AF304444_1 sesquiterpene cyclase [Artemisia annua]
Length=573

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/84 (39%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            +++H+I+++Q LG+ +HF+ +I   LQ  Y   G  +     L  TS  FR+LRQ G+++
Sbjct  87   KLIHLIDSVQRLGVSYHFEQEIEEALQHVYATHGDQWIGKDNLKSTSQWFRILRQQGFNV  146

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
             S +F   ++DKGKFKE LS D++
Sbjct  147  SSGIFENHMDDKGKFKEHLSDDVQ  170



>gb|KGN64586.1| hypothetical protein Csa_1G066550 [Cucumis sativus]
Length=598

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/87 (44%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query  174  LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGI--LFRDNKELFETSILFRLLRQDG  347
            L+VL++I+ IQ LGIDH F+++I +IL+ QY        F     L E ++ FRLLRQ G
Sbjct  111  LEVLNMIDGIQRLGIDHCFKEEIEAILKEQYTIMATHHYFDTKCSLHEVALRFRLLRQHG  170

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            Y IPSDVF  F    G+  +++ +DI+
Sbjct  171  YFIPSDVFESFTAKNGELNKKVFEDIE  197



>gb|AGV54642.1| nerol synthase [Phaseolus vulgaris]
Length=496

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 61/96 (64%), Gaps = 6/96 (6%)
 Frame = +3

Query  159  IQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGI------LFRDNKELFETSI  320
            I+E+ ++ LH+I+ IQ LGI+HHF+ +I  +LQ+Q             F  + +L+E ++
Sbjct  82   IRENPMESLHMIDIIQRLGIEHHFEQEIQLVLQKQQLILSNHPCDFDFFSSHDQLYEVAL  141

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY++ +D+F    N+K KFKE   +D+K
Sbjct  142  AFRLLRQGGYYVNADLFDILKNEKRKFKEIYGEDVK  177



>sp|Q6Q3H2.1|TPSVS_VITVI RecName: Full=Valencene synthase; Short=VvVal; AltName: Full=7-epi-alpha-selinene 
synthase [Vitis vinifera]
 gb|AAS66358.1| (+)-valencene synthase [Vitis vinifera]
Length=556

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ   N F      + +L+  ++ FRLLRQ GY I
Sbjct  72   QLLNFIDAVQRLGVAYHFEQEIEEALQHICNSFHDCNDMDGDLYNIALGFRLLRQQGYTI  131

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
              D+F KF +++G+FKE L  D++
Sbjct  132  SCDIFNKFTDERGRFKEALISDVR  155



>ref|XP_007148288.1| hypothetical protein PHAVU_006G195700g [Phaseolus vulgaris]
 gb|ESW20282.1| hypothetical protein PHAVU_006G195700g [Phaseolus vulgaris]
Length=581

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 61/96 (64%), Gaps = 6/96 (6%)
 Frame = +3

Query  159  IQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGI------LFRDNKELFETSI  320
            I+E+ ++ LH+I+ IQ LGI+HHF+ +I  +LQ+Q             F  + +L+E ++
Sbjct  82   IRENPMESLHMIDIIQRLGIEHHFEQEIQLVLQKQQLILSNHPCDFDFFSSHDQLYEVAL  141

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ GY++ +D+F    N+K KFKE   +D+K
Sbjct  142  AFRLLRQGGYYVNADLFDILKNEKRKFKEIYGEDVK  177



>ref|XP_009785131.1| PREDICTED: (E,E)-germacrene B synthase-like [Nicotiana sylvestris]
Length=619

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 59/96 (61%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +I ++ +Q L +I+ IQ LG+ +HF++ I + ++   +       ++  L+  ++
Sbjct  117  RQMLVEIPDNSIQKLELIDTIQRLGVAYHFKNDIKTSIRNISHASQQSENEDDNLYAVAL  176

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRLLRQ  +H+  DVF KF N  GKFKE L+KDI+
Sbjct  177  RFRLLRQQRHHMSYDVFKKFTNKDGKFKETLTKDIQ  212



>ref|XP_006467943.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X1 [Citrus sinensis]
 ref|XP_006467944.1| PREDICTED: (3S,6E)-nerolidol synthase 1, chloroplastic-like isoform 
X2 [Citrus sinensis]
 gb|KDO75633.1| hypothetical protein CISIN_1g007889mg [Citrus sinensis]
Length=586

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 62/96 (65%), Gaps = 1/96 (1%)
 Frame = +3

Query  141  RNFLYQIQEDD-LQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETS  317
            ++ L ++ +DD  + L +I+ +Q LGID++FQD+I  ILQRQ   F      + +L E +
Sbjct  84   KHILIRVGDDDPFEGLAMIDTVQRLGIDYYFQDEIEQILQRQSIVFSNHGDRHNDLQEVA  143

Query  318  ILFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            + FRLLRQ GY++  DVF  F N +GK K+ +S DI
Sbjct  144  LRFRLLRQQGYYVSPDVFNNFRNKEGKSKQNISGDI  179



>gb|ADR74194.1| (E)-beta-caryophyllene synthase [Vitis vinifera]
Length=555

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/84 (40%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHI  356
            Q+L+ I+A+Q LG+ +HF+ +I   LQ  Y++F      N +L+  ++ FRLLRQ GY+I
Sbjct  71   QLLNFIDAVQRLGVAYHFEREIEESLQHIYDRFHDADDTNDDLYNIALRFRLLRQQGYNI  130

Query  357  PSDVFTKFINDKGKFKEELSKDIK  428
               +F KF +++G FKE+L  +I+
Sbjct  131  SCGIFNKFKDEEGSFKEDLISNIQ  154



>gb|KDP31579.1| hypothetical protein JCGZ_14804 [Jatropha curcas]
Length=594

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 36/82 (44%), Positives = 57/82 (70%), Gaps = 1/82 (1%)
 Frame = +3

Query  183  LHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFRLLRQDGYHIPS  362
            L++I+AIQ LGI +HF+ QI   L++ Y  +  L  D+ +L+  ++ FRLLRQ+G ++ +
Sbjct  66   LNLIDAIQRLGIAYHFEGQIEEALKQIYTTYQNL-NDDDDLYTVALRFRLLRQEGSNVST  124

Query  363  DVFTKFINDKGKFKEELSKDIK  428
            DVF KF + +G FKE L KD++
Sbjct  125  DVFNKFKDSEGNFKEYLIKDVQ  146



>sp|B1B1U3.1|ZSS1_ZINZE RecName: Full=Alpha-humulene synthase [Zingiber zerumbet]
 dbj|BAG12020.1| alpha-humulene synthase [Zingiber zerumbet]
 dbj|BAG12315.1| alpha-humulene synthase [Zingiber zerumbet]
Length=548

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 38/93 (41%), Positives = 60/93 (65%), Gaps = 4/93 (4%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            L++   D LQ++ ++++IQ LG+D+HF+ +I + L+  Y        +N  L+E S+ FR
Sbjct  59   LFEETHDVLQIMILVDSIQLLGLDYHFEKEITAALRLIYEAD----VENYGLYEVSLRFR  114

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            LLRQ GY++  DVF KF +DKG+F   L+ D K
Sbjct  115  LLRQHGYNLSPDVFNKFKDDKGRFLPTLNGDAK  147



>ref|NP_001234766.1| caryophyllene/alpha-humulene synthase [Solanum lycopersicum]
 gb|ADD96698.1| caryophyllene/alpha-humulene synthase [Solanum lycopersicum]
 gb|AEP82783.1| beta caryophyllene/humulene synthase [Solanum lycopersicum]
Length=548

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/96 (38%), Positives = 60/96 (63%), Gaps = 0/96 (0%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L +  E   Q L +I+A+Q LG+ +HF ++I + +Q  ++       ++  L+  S+
Sbjct  47   RKMLVEAPEGSEQKLVLIDAMQRLGVAYHFDNEIETSIQNIFDASSKQNDNDNNLYVVSL  106

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
             FRL+RQ G+++ SDVF +FIN  GKFKE L+ D++
Sbjct  107  RFRLVRQQGHYMSSDVFKQFINQDGKFKETLTNDVQ  142



>ref|XP_010694308.1| PREDICTED: (-)-germacrene D synthase-like [Beta vulgaris subsp. 
vulgaris]
Length=325

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 61/92 (66%), Gaps = 1/92 (1%)
 Frame = +3

Query  150  LYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSILFR  329
            L + + + L+ L  I+AI+ LG+ +HF++QI   L++ Y+ F     ++ +L+  S  FR
Sbjct  57   LLETKGNPLEQLTFIDAIERLGVAYHFEEQIEEALKQVYDNFHDQCAED-DLYHVSTRFR  115

Query  330  LLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
            +LRQ G+ +P DVF KF ++KG F+E L+KD+
Sbjct  116  ILRQHGFLVPCDVFNKFKDEKGSFEESLTKDV  147



>gb|AGS16741.1| sesquiterpene synthase [Panax ginseng]
Length=568

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/86 (43%), Positives = 59/86 (69%), Gaps = 2/86 (2%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFG--ILFRDNKELFETSILFRLLRQDGY  350
            ++L++I+ IQ LG+ +HF+ +I + LQ     F   +  + + +L   S+ FRLLRQDG+
Sbjct  79   KLLNLISDIQLLGVAYHFEAEIDAALQHVNATFHEYVASKKDHDLHFVSLCFRLLRQDGH  138

Query  351  HIPSDVFTKFINDKGKFKEELSKDIK  428
            H+ SDVF KF ++ GKFKE L+KD++
Sbjct  139  HVSSDVFCKFKDNDGKFKECLTKDVR  164



>ref|NP_001268167.1| (+)-alpha-phellandrene synthase [Vitis vinifera]
 gb|ADR74203.1| (+)-alpha-pinene synthase [Vitis vinifera]
Length=593

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 7/91 (8%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD----NKELFETSILFRLL  335
            + L  L +I+ +Q LGI +HF ++I  IL   YN +    R+    N +L+ T++ FRLL
Sbjct  101  EPLHQLELIDTLQRLGIHYHFGEEIKRILHSIYNNYN---RNDTWKNGDLYATALEFRLL  157

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GYH+P DVF  FIN  G     L++DIK
Sbjct  158  RQHGYHVPQDVFHIFINKMGTVNPWLNEDIK  188



>emb|CDP12283.1| unnamed protein product [Coffea canephora]
Length=568

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/95 (38%), Positives = 59/95 (62%), Gaps = 1/95 (1%)
 Frame = +3

Query  141  RNFLYQIQEDDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRDNKELFETSI  320
            R  L+    +  Q L +I+AIQ L I +HF+++IG  LQ+ + K    +  N  ++  ++
Sbjct  65   RTELHATASNPSQQLQLIDAIQRLCIAYHFEEEIGQALQKMHEKHQN-WEGNDHIYTAAL  123

Query  321  LFRLLRQDGYHIPSDVFTKFINDKGKFKEELSKDI  425
             FR+LRQ+G+ I S++F KF+N +GKF E L  D+
Sbjct  124  CFRILRQEGFRISSEIFKKFMNAEGKFGECLVNDV  158



>emb|CAN64943.1| hypothetical protein VITISV_001721 [Vitis vinifera]
Length=593

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 39/91 (43%), Positives = 55/91 (60%), Gaps = 7/91 (8%)
 Frame = +3

Query  168  DDLQVLHVINAIQHLGIDHHFQDQIGSILQRQYNKFGILFRD----NKELFETSILFRLL  335
            + L  L +I+ +Q LGI +HF ++I  IL   YN +    R+    N +L+ T++ FRLL
Sbjct  101  EPLHQLELIDTLQRLGIHYHFGEEIKRILHSIYNNYN---RNDTWKNGDLYATALEFRLL  157

Query  336  RQDGYHIPSDVFTKFINDKGKFKEELSKDIK  428
            RQ GYH+P DVF  FIN  G     L++DIK
Sbjct  158  RQHGYHVPQDVFHIFINKMGTVNPWLNEDIK  188



>ref|XP_006478794.1| PREDICTED: (-)-germacrene D synthase-like isoform X1 [Citrus 
sinensis]
Length=559

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = +3

Query  177  QVLHVINAIQHLGIDHHFQDQIGSIL---QRQYNKFGILFRDNKELFETSILFRLLRQDG  347
              L +I+AIQ LG+ +HF+ +I  IL    + Y    +   +N EL+  S+ FRL RQ+G
Sbjct  72   HTLELIDAIQRLGVSYHFESEIDEILGKMHKTYRDCDLCDNENDELYYISLQFRLFRQNG  131

Query  348  YHIPSDVFTKFINDKGKFKEELSKDIK  428
            Y I +DVF  F    GKFK  L+KD++
Sbjct  132  YRISADVFNTFEGSDGKFKASLAKDVR  158



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 509248079690