BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c70831_g1_i1 len=124 path=[1:0-123]

Length=124
                                                                      Score     E

emb|CDO76041.1|  hypothetical protein BN946_scf184948.g1              63.2    5e-10   
emb|CDO77864.1|  hypothetical protein BN946_scf184612.g1              63.2    5e-10   
emb|CAN83506.1|  hypothetical protein VITISV_027576                   63.2    6e-10   Vitis vinifera
emb|CDO75804.1|  hypothetical protein BN946_scf184951.g2              63.2    7e-10   
emb|CDO76042.1|  hypothetical protein BN946_scf184948.g2              62.4    8e-10   
ref|XP_010266970.1|  PREDICTED: uncharacterized protein LOC104604368  60.5    1e-09   
ref|XP_008222569.1|  PREDICTED: uncharacterized protein LOC103322432  61.6    1e-09   
emb|CDO74230.1|  hypothetical protein BN946_scf184886.g1              62.4    1e-09   
ref|XP_006596648.1|  PREDICTED: uncharacterized protein DDB_G0271...  61.2    2e-09   
ref|XP_009344163.1|  PREDICTED: uncharacterized protein LOC103936058  59.3    2e-09   
emb|CAN80123.1|  hypothetical protein VITISV_009646                   59.7    5e-09   Vitis vinifera
ref|XP_008358877.1|  PREDICTED: uncharacterized protein LOC103422594  57.8    7e-09   
emb|CAN59941.1|  hypothetical protein VITISV_017227                   59.3    8e-09   Vitis vinifera
ref|XP_009341541.1|  PREDICTED: uncharacterized protein LOC103933571  57.4    1e-08   
gb|AAT38758.1|  Putative gag-pol polyprotein, identical               59.3    1e-08   Solanum demissum
ref|XP_008350379.1|  PREDICTED: uncharacterized protein LOC103413717  57.4    1e-08   
gb|AAF63122.1|AC009526_7  Hypothetical protein                        58.9    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004305316.1|  PREDICTED: uncharacterized protein LOC101302857  58.5    1e-08   
ref|XP_008380799.1|  PREDICTED: uncharacterized protein LOC103443689  58.9    2e-08   
ref|XP_011081378.1|  PREDICTED: uncharacterized protein LOC105164425  58.9    2e-08   
emb|CAN76473.1|  hypothetical protein VITISV_016007                   58.9    2e-08   Vitis vinifera
ref|XP_004146265.1|  PREDICTED: uncharacterized mitochondrial pro...  57.8    2e-08   
ref|XP_007019438.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  58.2    2e-08   
gb|AAL66754.1|AF464738_5  putative copia-like retrotransposon Hop...  58.5    3e-08   Zea mays [maize]
gb|ABA99232.1|  retrotransposon protein, putative, Ty1-copia subc...  57.0    3e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009592499.1|  PREDICTED: uncharacterized protein LOC104089338  57.0    3e-08   
ref|XP_010243265.1|  PREDICTED: uncharacterized protein LOC104587377  55.1    3e-08   
emb|CAN70361.1|  hypothetical protein VITISV_033646                   58.2    3e-08   Vitis vinifera
emb|CAN68711.1|  hypothetical protein VITISV_015847                   58.2    4e-08   Vitis vinifera
gb|AAP94600.1|  putative copia-like retrotransposon Hopscotch pol...  58.2    4e-08   Zea mays [maize]
gb|AAV44026.1|  hypothetical protein                                  57.8    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004972302.1|  PREDICTED: uncharacterized protein LOC101778040  57.4    4e-08   
ref|XP_008378632.1|  PREDICTED: uncharacterized protein LOC103441708  58.2    4e-08   
ref|XP_010539104.1|  PREDICTED: uncharacterized protein LOC104813235  57.0    4e-08   
ref|XP_008228040.1|  PREDICTED: uncharacterized protein LOC103327479  57.8    4e-08   
emb|CAN74430.1|  hypothetical protein VITISV_010987                   58.2    4e-08   Vitis vinifera
ref|XP_004980642.1|  PREDICTED: uncharacterized protein LOC101772525  57.4    4e-08   
ref|XP_008347066.1|  PREDICTED: uncharacterized protein LOC103410073  57.8    4e-08   
emb|CAC95126.1|  gag-pol polyprotein                                  57.8    5e-08   Populus deltoides
emb|CAN78876.1|  hypothetical protein VITISV_033245                   57.0    5e-08   Vitis vinifera
emb|CAN74984.1|  hypothetical protein VITISV_035210                   57.8    5e-08   Vitis vinifera
emb|CAN64816.1|  hypothetical protein VITISV_010668                   57.8    5e-08   Vitis vinifera
ref|XP_008392735.1|  PREDICTED: uncharacterized protein DDB_G0271...  57.4    5e-08   
emb|CAN82537.1|  hypothetical protein VITISV_013040                   57.0    6e-08   Vitis vinifera
emb|CAN71250.1|  hypothetical protein VITISV_027849                   56.6    6e-08   Vitis vinifera
ref|XP_008369700.1|  PREDICTED: uncharacterized protein LOC103433244  57.4    6e-08   
ref|XP_011093964.1|  PREDICTED: uncharacterized protein LOC105173784  55.5    6e-08   
ref|XP_008238972.1|  PREDICTED: uncharacterized protein LOC103337585  57.4    6e-08   
ref|XP_010531643.1|  PREDICTED: uncharacterized protein LOC104807900  57.4    6e-08   
emb|CAN63098.1|  hypothetical protein VITISV_009456                   56.2    6e-08   Vitis vinifera
gb|AAX95627.1|  Reverse transcriptase (RNA-dependent DNA polymera...  56.2    7e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007027564.1|  Uncharacterized protein TCM_022381               56.2    7e-08   
ref|YP_514636.1|  hypothetical protein OrsaiPp07                      56.6    7e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_008357351.1|  PREDICTED: uncharacterized protein LOC103421092  57.0    7e-08   
ref|YP_002000554.1|  orf490                                           56.6    7e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CAN71108.1|  hypothetical protein VITISV_001478                   57.4    7e-08   Vitis vinifera
ref|XP_008361163.1|  PREDICTED: uncharacterized protein LOC103424851  57.4    7e-08   
emb|CAB10380.1|  reverse transcriptase like protein                   57.4    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004958843.1|  PREDICTED: uncharacterized protein LOC101772504  56.6    7e-08   
gb|AAP53968.1|  retrotransposon protein, putative, Ty1-copia subc...  57.0    8e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CAN72201.1|  hypothetical protein VITISV_014985                   56.2    8e-08   Vitis vinifera
gb|AAW56918.1|  putative polyprotein                                  57.0    8e-08   Oryza sativa Japonica Group [Japonica rice]
gb|ACY72569.1|  unknown                                               57.0    8e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008387250.1|  PREDICTED: uncharacterized protein LOC103449699  57.0    8e-08   
ref|XP_007387068.1|  hypothetical protein PUNSTDRAFT_16937            53.1    9e-08   
ref|XP_004972082.1|  PREDICTED: uncharacterized protein LOC101752886  56.6    9e-08   
ref|XP_008351905.1|  PREDICTED: uncharacterized protein LOC103415342  55.5    1e-07   
ref|XP_010659203.1|  PREDICTED: uncharacterized protein LOC104881291  56.2    1e-07   
emb|CAN73392.1|  hypothetical protein VITISV_022526                   56.6    1e-07   Vitis vinifera
gb|AAB82754.1|  retrofit                                              57.0    1e-07   Oryza longistaminata [long-staminate rice]
gb|AAG12528.1|AC015446_9  Hypothetical Protein                        56.2    1e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN71823.1|  hypothetical protein VITISV_007329                   56.2    1e-07   Vitis vinifera
ref|XP_008357860.1|  PREDICTED: uncharacterized protein LOC103421593  56.6    1e-07   
ref|XP_002442174.1|  hypothetical protein SORBIDRAFT_08g015513        56.2    1e-07   Sorghum bicolor [broomcorn]
emb|CAN65591.1|  hypothetical protein VITISV_042091                   56.6    1e-07   Vitis vinifera
gb|AAK53852.1|AC016781_6  Putative retroelement                       56.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010277969.1|  PREDICTED: uncharacterized protein LOC104612285  55.8    1e-07   
ref|XP_008365969.1|  PREDICTED: uncharacterized protein LOC103429605  56.6    1e-07   
gb|AAT69582.1|  putative polyprotein                                  56.6    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007043677.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  53.5    1e-07   
gb|KFL89552.1|  hypothetical protein AmDm5_1575                       56.6    1e-07   
emb|CAN80084.1|  hypothetical protein VITISV_011294                   53.5    1e-07   Vitis vinifera
ref|XP_011078646.1|  PREDICTED: uncharacterized protein LOC105162338  56.2    1e-07   
emb|CAN79517.1|  hypothetical protein VITISV_026065                   53.5    1e-07   Vitis vinifera
ref|XP_008354245.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...  56.2    2e-07   
emb|CAN78269.1|  hypothetical protein VITISV_006711                   55.1    2e-07   Vitis vinifera
ref|XP_008390439.1|  PREDICTED: uncharacterized protein LOC103452682  56.2    2e-07   
gb|AAD22155.1|AF061282_8  polyprotein                                 56.2    2e-07   Sorghum bicolor [broomcorn]
ref|XP_009359358.1|  PREDICTED: uncharacterized protein LOC103949948  55.8    2e-07   
ref|NP_001175678.1|  Os08g0544300                                     55.8    2e-07   
gb|EMT19664.1|  Putative LRR receptor-like serine/threonine-prote...  55.8    2e-07   
ref|XP_010065142.1|  PREDICTED: uncharacterized protein LOC104452376  55.8    2e-07   
emb|CAN76493.1|  hypothetical protein VITISV_007584                   55.8    2e-07   Vitis vinifera
ref|XP_004310176.1|  PREDICTED: uncharacterized protein LOC101315202  55.8    2e-07   
ref|XP_009378158.1|  PREDICTED: uncharacterized protein LOC103966690  55.8    2e-07   
gb|AAX96193.1|  retrotransposon protein, putative, Ty1-copia sub-...  55.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|AAR88589.1|  putative copia-like retrotransposon protein           55.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ABA98049.1|  retrotransposon protein, putative, Ty1-copia subc...  55.8    2e-07   Oryza sativa Japonica Group [Japonica rice]
gb|KHN05629.1|  Retrovirus-related Pol polyprotein from transposo...  55.8    3e-07   
emb|CAN68059.1|  hypothetical protein VITISV_008424                   55.1    3e-07   Vitis vinifera
ref|XP_007014689.1|  Uncharacterized protein TCM_040047               55.5    3e-07   
gb|KHN45997.1|  Retrovirus-related Pol polyprotein from transposo...  55.5    3e-07   
gb|KHN30958.1|  Retrovirus-related Pol polyprotein from transposo...  55.5    3e-07   
gb|ABH07409.1|  putative pol polyprotein                              55.5    3e-07   Brassica oleracea var. botrytis [cauliflower]
emb|CCI55333.1|  PH01B019A14.2                                        52.8    3e-07   
gb|KHN17953.1|  Retrovirus-related Pol polyprotein from transposo...  55.5    3e-07   
gb|EGO04786.1|  hypothetical protein SERLA73DRAFT_82501               55.1    3e-07   
gb|ABA98286.2|  retrotransposon protein, putative, Ty1-copia subc...  55.5    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010240794.1|  PREDICTED: uncharacterized protein LOC104585563  54.3    3e-07   
gb|ABF95616.1|  retrotransposon protein, putative, Ty1-copia subc...  55.5    3e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011014816.1|  PREDICTED: uncharacterized protein LOC105118536  55.5    3e-07   
emb|CDO72947.1|  hypothetical protein BN946_scf185002.g132            55.1    3e-07   
ref|XP_010669336.1|  PREDICTED: copia protein isoform X2              55.1    3e-07   
ref|XP_010669333.1|  PREDICTED: copia protein isoform X1              55.1    4e-07   
ref|XP_008392161.1|  PREDICTED: uncharacterized protein LOC103454341  54.7    4e-07   
dbj|BAB11447.1|  polyprotein-like                                     54.7    4e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CAN67506.1|  hypothetical protein VITISV_026948                   55.1    4e-07   Vitis vinifera
emb|CAN61660.1|  hypothetical protein VITISV_000260                   55.1    4e-07   Vitis vinifera
ref|XP_010531095.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    4e-07   
emb|CAN72257.1|  hypothetical protein VITISV_034188                   55.1    4e-07   Vitis vinifera
ref|XP_006606948.1|  PREDICTED: uncharacterized protein LOC102661023  54.7    4e-07   
ref|XP_010446079.1|  PREDICTED: uncharacterized protein LOC104728846  53.1    4e-07   
ref|XP_008460736.1|  PREDICTED: uncharacterized protein LOC103499498  54.7    4e-07   
emb|CAN62086.1|  hypothetical protein VITISV_035123                   55.1    4e-07   Vitis vinifera
gb|AAT07563.1|  putative polyprotein                                  55.1    4e-07   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90546.1|  putative rice retrotransposon retrofit gag/pol p...  55.1    5e-07   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94335.1|  retrotransposon protein, putative, Ty1-copia subc...  54.3    5e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAN79949.1|  hypothetical protein VITISV_044422                   55.1    5e-07   Vitis vinifera
emb|CAE04319.3|  OSJNBb0016D16.10                                     54.7    5e-07   Oryza sativa [red rice]
ref|XP_008375643.1|  PREDICTED: uncharacterized protein LOC103438878  54.7    5e-07   
gb|ACV42639.1|  gag/pol                                               55.1    5e-07   
ref|XP_009601766.1|  PREDICTED: uncharacterized protein LOC104096990  53.1    5e-07   
ref|XP_010265038.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.7    5e-07   
emb|CAN75730.1|  hypothetical protein VITISV_031410                   54.7    5e-07   Vitis vinifera
gb|AEP40947.1|  cysteine-rich-receptor-like protein kinase 8          51.6    5e-07   
emb|CAN63276.1|  hypothetical protein VITISV_000400                   54.7    5e-07   Vitis vinifera
gb|AAU90288.2|  Polyprotein, putative                                 54.7    5e-07   Solanum demissum
emb|CAN79977.1|  hypothetical protein VITISV_029183                   54.7    6e-07   Vitis vinifera
emb|CAN72188.1|  hypothetical protein VITISV_020673                   54.7    6e-07   Vitis vinifera
ref|XP_010513698.1|  PREDICTED: uncharacterized protein LOC104789749  54.7    6e-07   
emb|CAN64770.1|  hypothetical protein VITISV_004450                   54.7    6e-07   Vitis vinifera
emb|CAN74499.1|  hypothetical protein VITISV_013001                   54.7    6e-07   Vitis vinifera
emb|CAN59936.1|  hypothetical protein VITISV_001878                   54.7    6e-07   Vitis vinifera
gb|ABA97008.1|  retrotransposon protein, putative, Ty1-copia subc...  54.7    6e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009366628.1|  PREDICTED: uncharacterized protein LOC103956384  53.5    6e-07   
ref|XP_010659200.1|  PREDICTED: uncharacterized protein LOC104881290  53.9    6e-07   
ref|XP_010526684.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    6e-07   
emb|CAN80320.1|  hypothetical protein VITISV_034560                   54.7    6e-07   Vitis vinifera
emb|CAN61929.1|  hypothetical protein VITISV_014855                   54.7    6e-07   Vitis vinifera
gb|ABF99203.1|  retrotransposon protein, putative, Ty1-copia subc...  54.7    6e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAN83332.1|  hypothetical protein VITISV_025235                   54.3    6e-07   Vitis vinifera
ref|XP_010279665.1|  PREDICTED: cysteine-rich repeat secretory pr...  53.5    6e-07   
gb|AAL31076.1|AC091749_5  putaive copia-like retrotransposon poly...  53.9    6e-07   Oryza sativa [red rice]
emb|CAN75041.1|  hypothetical protein VITISV_027174                   54.7    6e-07   Vitis vinifera
ref|XP_008240661.1|  PREDICTED: uncharacterized protein LOC103339149  54.3    6e-07   
ref|XP_010526683.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    6e-07   
ref|XP_008342226.1|  PREDICTED: uncharacterized protein LOC103405031  54.3    6e-07   
ref|XP_011016404.1|  PREDICTED: uncharacterized protein LOC105119910  54.3    6e-07   
ref|XP_010526682.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    6e-07   
emb|CAN75777.1|  hypothetical protein VITISV_031053                   54.3    7e-07   Vitis vinifera
gb|ABF81417.1|  TIR-NBS-LRR type disease resistance protein           54.7    7e-07   Populus trichocarpa [western balsam poplar]
gb|AAK09230.1|AC084320_17  putative copia-like retrotransposon Ho...  54.3    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008350549.1|  PREDICTED: uncharacterized protein LOC103413885  54.7    7e-07   
ref|XP_008807811.1|  PREDICTED: uncharacterized protein LOC103720061  53.9    7e-07   
ref|XP_010541762.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    7e-07   
gb|ABG00000.1|  retrotransposon protein, putative, Ty1-copia subc...  54.7    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010526681.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    7e-07   
ref|XP_010526680.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    7e-07   
ref|XP_010526678.1|  PREDICTED: retrovirus-related Pol polyprotei...  54.3    7e-07   
emb|CAH66819.1|  OSIGBa0093K19.6                                      53.9    7e-07   Oryza sativa [red rice]
emb|CAE04381.1|  OSJNBa0027G07.23                                     53.9    7e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010058883.1|  PREDICTED: uncharacterized protein LOC104446775  53.9    8e-07   
dbj|BAB08717.1|  unnamed protein product                              53.9    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501996.1|  PREDICTED: uncharacterized protein LOC104779340  53.9    8e-07   
gb|ABA95721.1|  retrotransposon protein, putative, Ty1-copia subc...  53.9    8e-07   Oryza sativa Japonica Group [Japonica rice]
emb|CAN60445.1|  hypothetical protein VITISV_032468                   54.3    8e-07   Vitis vinifera
ref|XP_008223145.1|  PREDICTED: uncharacterized protein LOC103322965  54.3    8e-07   
ref|XP_008372631.1|  PREDICTED: uncharacterized protein LOC103435981  53.9    9e-07   
ref|XP_007046012.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  53.1    9e-07   
gb|ABA94354.1|  retrotransposon protein, putative, unclassified       53.9    9e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338880.1|  PREDICTED: uncharacterized protein LOC103931184  53.9    9e-07   
ref|XP_010273170.1|  PREDICTED: uncharacterized protein LOC104608783  53.9    9e-07   
emb|CAN69647.1|  hypothetical protein VITISV_022133                   53.9    1e-06   Vitis vinifera
gb|KFK29521.1|  hypothetical protein AALP_AA7G145400                  53.5    1e-06   
emb|CAN77807.1|  hypothetical protein VITISV_036095                   53.9    1e-06   Vitis vinifera
gb|AAK55460.1|AC069300_15  putative gag-pol polyprotein               53.9    1e-06   Oryza sativa Japonica Group [Japonica rice]
emb|CDO78104.1|  hypothetical protein BN946_scf184683.g1              53.1    1e-06   
gb|AAN04167.1|  Putative copia-like retrotransposon polyprotein       53.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002388175.1|  hypothetical protein MPER_12841                  53.5    1e-06   Moniliophthora perniciosa FA553
emb|CAN61420.1|  hypothetical protein VITISV_023544                   53.9    1e-06   Vitis vinifera
emb|CDO77867.1|  hypothetical protein BN946_scf184612.g4              53.1    1e-06   
ref|XP_008386299.1|  PREDICTED: uncharacterized protein LOC103448812  53.9    1e-06   
ref|XP_008340360.1|  PREDICTED: uncharacterized protein LOC103403325  53.5    1e-06   
emb|CAN74381.1|  hypothetical protein VITISV_007944                   53.9    1e-06   Vitis vinifera
ref|XP_008382206.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.5    1e-06   
gb|AAK02020.2|AC074283_1  Putative gag-pol polyprotein                53.5    1e-06   Oryza sativa [red rice]
gb|AAN06870.1|  Putative gag-pol polyprotein                          53.5    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AAF69172.1|AC007915_24  F27F5.11                                   53.5    1e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008356535.1|  PREDICTED: uncharacterized protein LOC103420252  53.5    1e-06   
ref|XP_010419640.1|  PREDICTED: uncharacterized protein LOC104705350  52.0    1e-06   
emb|CAN65502.1|  hypothetical protein VITISV_014793                   53.5    1e-06   Vitis vinifera
ref|XP_010525654.1|  PREDICTED: uncharacterized protein LOC104803422  53.1    1e-06   
emb|CAN71173.1|  hypothetical protein VITISV_037664                   53.1    1e-06   Vitis vinifera
emb|CAN61827.1|  hypothetical protein VITISV_027629                   53.1    2e-06   Vitis vinifera
ref|XP_010064294.1|  PREDICTED: uncharacterized protein LOC104451296  52.8    2e-06   
emb|CAN77798.1|  hypothetical protein VITISV_040894                   52.8    2e-06   Vitis vinifera
emb|CAN61322.1|  hypothetical protein VITISV_012106                   53.5    2e-06   Vitis vinifera
gb|AAF02855.1|AC009324_4  Similar to retrotransposon proteins         53.5    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010644735.1|  PREDICTED: uncharacterized protein LOC104877663  52.4    2e-06   
emb|CAN78434.1|  hypothetical protein VITISV_003804                   53.1    2e-06   Vitis vinifera
gb|AAU43956.1|  unknown protein                                       53.5    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008385226.1|  PREDICTED: uncharacterized protein LOC103447800  53.1    2e-06   
emb|CAN71759.1|  hypothetical protein VITISV_020777                   53.5    2e-06   Vitis vinifera
emb|CAN69753.1|  hypothetical protein VITISV_024937                   53.1    2e-06   Vitis vinifera
ref|XP_008341155.1|  PREDICTED: uncharacterized protein LOC103404078  53.1    2e-06   
gb|AAC95173.1|  putative retroelement pol polyprotein                 53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAB40067.1|  putative retrotransposon polyprotein                 53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006485859.1|  PREDICTED: uncharacterized protein LOC102626627  53.1    2e-06   
emb|CAN61340.1|  hypothetical protein VITISV_007301                   53.1    2e-06   Vitis vinifera
emb|CAN61640.1|  hypothetical protein VITISV_021909                   53.1    2e-06   Vitis vinifera
emb|CAN67566.1|  hypothetical protein VITISV_020485                   52.4    2e-06   Vitis vinifera
emb|CAN77664.1|  hypothetical protein VITISV_007221                   53.1    2e-06   Vitis vinifera
ref|XP_010430787.1|  PREDICTED: uncharacterized protein LOC104715028  53.1    2e-06   
emb|CAN60238.1|  hypothetical protein VITISV_032906                   53.1    2e-06   Vitis vinifera
ref|XP_010051209.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  53.1    2e-06   
ref|XP_008355505.1|  PREDICTED: probable E3 ubiquitin-protein lig...  52.4    2e-06   
ref|XP_004163499.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  52.8    2e-06   
emb|CAN67963.1|  hypothetical protein VITISV_027812                   52.4    2e-06   Vitis vinifera
ref|XP_008362654.1|  PREDICTED: phosphatidylinositol 4-kinase gam...  52.0    2e-06   
ref|XP_008389560.1|  PREDICTED: uncharacterized protein LOC103451895  53.1    2e-06   
gb|AAC33963.1|  contains similarity to reverse transcriptases (Pf...  53.1    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAN60930.1|  hypothetical protein VITISV_012765                   53.1    2e-06   Vitis vinifera
emb|CAN67986.1|  hypothetical protein VITISV_010770                   52.8    2e-06   Vitis vinifera
emb|CAN68148.1|  hypothetical protein VITISV_035665                   53.1    2e-06   Vitis vinifera
emb|CAN79733.1|  hypothetical protein VITISV_016615                   52.8    2e-06   Vitis vinifera
emb|CAN64822.1|  hypothetical protein VITISV_025364                   52.8    2e-06   Vitis vinifera
ref|XP_008344799.1|  PREDICTED: uncharacterized protein LOC103407689  53.1    2e-06   
emb|CAN63182.1|  hypothetical protein VITISV_029266                   52.4    2e-06   Vitis vinifera
emb|CAN83721.1|  hypothetical protein VITISV_003961                   52.8    2e-06   Vitis vinifera
emb|CAN82201.1|  hypothetical protein VITISV_011128                   52.8    2e-06   Vitis vinifera
emb|CAN67762.1|  hypothetical protein VITISV_040650                   52.8    2e-06   Vitis vinifera
emb|CAN60366.1|  hypothetical protein VITISV_031870                   52.8    2e-06   Vitis vinifera
ref|XP_007043089.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  52.8    2e-06   
emb|CAN72554.1|  hypothetical protein VITISV_015792                   52.8    2e-06   Vitis vinifera
emb|CAN69281.1|  hypothetical protein VITISV_023276                   52.4    2e-06   Vitis vinifera
emb|CAD40155.1|  OSJNBb0069N01.8                                      51.6    2e-06   Oryza sativa Japonica Group [Japonica rice]
gb|EMS48645.1|  Glutamate-rich WD repeat-containing protein 1         52.4    2e-06   
gb|AFP55537.1|  retrotransposon polyprotein                           52.8    2e-06   
emb|CAN60152.1|  hypothetical protein VITISV_021503                   52.8    2e-06   Vitis vinifera
emb|CAN62921.1|  hypothetical protein VITISV_032126                   52.8    3e-06   Vitis vinifera
ref|XP_008340383.1|  PREDICTED: uncharacterized protein LOC103403351  52.8    3e-06   
emb|CAN65233.1|  hypothetical protein VITISV_022975                   52.8    3e-06   Vitis vinifera
gb|AAA33448.1|  reverse transcriptase                                 52.4    3e-06   
pir||S27768  RNA-directed DNA polymerase (EC 2.7.7.49) - maize tr...  52.4    3e-06
emb|CAN72527.1|  hypothetical protein VITISV_009255                   52.8    3e-06   Vitis vinifera
emb|CAN79529.1|  hypothetical protein VITISV_026262                   52.4    3e-06   Vitis vinifera
gb|ABA97707.2|  retrotransposon protein, putative, Ty1-copia subc...  52.8    3e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AGJ83729.1|  gag-pol polyprotein                                   52.4    3e-06   
ref|XP_009587426.1|  PREDICTED: uncharacterized protein LOC104085156  52.4    3e-06   
gb|KHN21230.1|  Retrovirus-related Pol polyprotein from transposo...  52.8    3e-06   
emb|CAN79884.1|  hypothetical protein VITISV_002539                   52.8    3e-06   Vitis vinifera
emb|CAN82041.1|  hypothetical protein VITISV_033522                   52.4    3e-06   Vitis vinifera
emb|CAN74290.1|  hypothetical protein VITISV_036414                   52.4    3e-06   Vitis vinifera
emb|CAN82206.1|  hypothetical protein VITISV_000176                   52.4    3e-06   Vitis vinifera
ref|XP_010436786.1|  PREDICTED: uncharacterized protein LOC104720600  52.4    3e-06   
ref|XP_008646486.1|  PREDICTED: uncharacterized protein LOC103627967  52.4    3e-06   
ref|XP_010068692.1|  PREDICTED: uncharacterized protein LOC104455629  52.4    3e-06   
ref|XP_011100172.1|  PREDICTED: uncharacterized protein LOC105178407  52.0    3e-06   
ref|XP_008390627.1|  PREDICTED: uncharacterized protein LOC103452871  52.4    3e-06   
ref|XP_007335052.1|  hypothetical protein AGABI1DRAFT_48233           52.0    3e-06   
ref|XP_008369089.1|  PREDICTED: uncharacterized protein LOC103432662  52.4    3e-06   
ref|XP_006574082.1|  PREDICTED: uncharacterized protein LOC102670255  52.0    3e-06   
ref|XP_004499989.1|  PREDICTED: uncharacterized mitochondrial pro...  49.3    3e-06   
emb|CAN83340.1|  hypothetical protein VITISV_021483                   52.0    3e-06   Vitis vinifera
emb|CAN62906.1|  hypothetical protein VITISV_043610                   52.4    3e-06   Vitis vinifera
ref|XP_008777490.1|  PREDICTED: uncharacterized protein LOC103697418  51.2    3e-06   
emb|CAN68480.1|  hypothetical protein VITISV_007280                   52.0    4e-06   Vitis vinifera
emb|CAN79930.1|  hypothetical protein VITISV_007488                   52.4    4e-06   Vitis vinifera
emb|CAN63295.1|  hypothetical protein VITISV_032981                   52.0    4e-06   Vitis vinifera
gb|AEP40962.1|  RNA-dependent DNA polymerase                          50.8    4e-06   
emb|CAN77556.1|  hypothetical protein VITISV_039374                   52.0    4e-06   
emb|CAN82452.1|  hypothetical protein VITISV_003326                   52.4    4e-06   
gb|AAT38797.2|  Polyprotein, putative                                 52.4    4e-06   
ref|XP_008342064.1|  PREDICTED: uncharacterized protein LOC103404876  50.8    4e-06   
ref|XP_004147195.1|  PREDICTED: uncharacterized protein LOC101216505  52.0    4e-06   
ref|XP_008352218.1|  PREDICTED: uncharacterized protein LOC103415694  52.0    4e-06   
ref|XP_006596772.1|  PREDICTED: uncharacterized mitochondrial pro...  49.3    4e-06   
ref|XP_011014171.1|  PREDICTED: uncharacterized protein LOC105118030  50.8    4e-06   
dbj|BAA97099.1|  retroelement pol polyprotein-like                    52.0    4e-06   
ref|XP_006653153.1|  PREDICTED: uncharacterized protein LOC102713624  52.4    4e-06   
ref|XP_010038745.1|  PREDICTED: uncharacterized protein LOC104427339  52.0    4e-06   
ref|XP_010662546.1|  PREDICTED: uncharacterized protein LOC104882159  52.0    4e-06   
ref|XP_008342448.1|  PREDICTED: uncharacterized protein LOC103405249  52.0    4e-06   
ref|XP_010647148.1|  PREDICTED: uncharacterized protein LOC104878438  52.0    4e-06   
gb|AAT85031.1|  putative polyprotein                                  52.0    4e-06   
dbj|BAA19417.1|  reverse transcriptase                                48.9    4e-06   
emb|CCH50966.1|  T4.5                                                 52.0    4e-06   
ref|XP_008352732.1|  PREDICTED: uncharacterized protein LOC103416253  52.0    4e-06   
ref|XP_008377446.1|  PREDICTED: uncharacterized protein LOC103440529  52.0    4e-06   
ref|XP_008393396.1|  PREDICTED: uncharacterized protein LOC103455594  51.6    5e-06   
emb|CAN76367.1|  hypothetical protein VITISV_024583                   52.0    5e-06   
ref|XP_010670304.1|  PREDICTED: uncharacterized protein LOC104887387  52.0    5e-06   
emb|CAN60452.1|  hypothetical protein VITISV_011348                   52.0    5e-06   
ref|XP_010058987.1|  PREDICTED: uncharacterized protein LOC104446890  52.0    5e-06   
ref|XP_011045946.1|  PREDICTED: uncharacterized protein LOC105140704  50.8    5e-06   
ref|XP_004980528.1|  PREDICTED: uncharacterized mitochondrial pro...  48.9    5e-06   
ref|XP_007024187.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  52.0    5e-06   
ref|XP_008342970.1|  PREDICTED: uncharacterized protein LOC103405720  51.6    5e-06   
emb|CAN74243.1|  hypothetical protein VITISV_037117                   51.6    5e-06   
ref|XP_008237389.1|  PREDICTED: uncharacterized protein LOC103336134  51.6    5e-06   
emb|CAN64541.1|  hypothetical protein VITISV_006447                   51.6    5e-06   
ref|XP_006579236.1|  PREDICTED: uncharacterized protein LOC102665202  51.6    6e-06   
emb|CAN82468.1|  hypothetical protein VITISV_039784                   51.6    6e-06   
ref|XP_006367551.1|  PREDICTED: uncharacterized protein LOC102604059  51.6    6e-06   
emb|CAN71225.1|  hypothetical protein VITISV_006367                   51.6    6e-06   
gb|ACN78973.1|  copia-type polyprotein                                51.6    6e-06   
emb|CAN75946.1|  hypothetical protein VITISV_012979                   51.2    6e-06   
ref|XP_008360633.1|  PREDICTED: uncharacterized protein LOC103424318  51.6    6e-06   
emb|CAN80438.1|  hypothetical protein VITISV_029932                   48.5    6e-06   
ref|XP_008350712.1|  PREDICTED: uncharacterized protein LOC103414077  50.1    6e-06   
emb|CAN77529.1|  hypothetical protein VITISV_041425                   51.6    6e-06   
gb|AAC67200.1|  putative retroelement pol polyprotein                 51.6    6e-06   
ref|XP_007019044.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.4    6e-06   
ref|XP_010412906.1|  PREDICTED: uncharacterized protein LOC104699278  51.2    6e-06   
emb|CAN73795.1|  hypothetical protein VITISV_036649                   51.6    6e-06   
ref|XP_009623362.1|  PREDICTED: uncharacterized protein LOC104114592  50.4    7e-06   
emb|CAN78241.1|  hypothetical protein VITISV_011536                   50.4    7e-06   
ref|XP_008228903.1|  PREDICTED: uncharacterized protein LOC103328294  51.6    7e-06   
emb|CAN79116.1|  hypothetical protein VITISV_002093                   51.6    7e-06   
emb|CCA27885.1|  hypothetical protein ALNC14_140290                   48.5    7e-06   
emb|CAN83798.1|  hypothetical protein VITISV_039072                   51.2    7e-06   
ref|XP_008387762.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.6    7e-06   
ref|XP_008348733.1|  PREDICTED: uncharacterized protein LOC103411898  51.2    7e-06   
emb|CAN67418.1|  hypothetical protein VITISV_005919                   51.2    7e-06   
ref|XP_008341769.1|  PREDICTED: uncharacterized protein LOC103404622  50.1    8e-06   
emb|CAN66966.1|  hypothetical protein VITISV_043228                   51.2    8e-06   
ref|XP_008657901.1|  PREDICTED: eukaryotic translation initiation...  49.7    8e-06   
ref|XP_008680471.1|  PREDICTED: uncharacterized protein LOC103655505  50.4    8e-06   
ref|XP_008345130.1|  PREDICTED: uncharacterized protein LOC103408038  51.2    8e-06   
ref|XP_007017134.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.8    8e-06   
emb|CAN67580.1|  hypothetical protein VITISV_022637                   51.2    8e-06   
emb|CAN77372.1|  hypothetical protein VITISV_026174                   50.8    8e-06   
emb|CAN64075.1|  hypothetical protein VITISV_017997                   50.8    8e-06   
emb|CAN59979.1|  hypothetical protein VITISV_015228                   51.2    8e-06   
emb|CAN78864.1|  hypothetical protein VITISV_007439                   51.2    8e-06   
gb|ABA98728.2|  retrotransposon protein, putative, Ty1-copia subc...  51.2    8e-06   
emb|CAN80274.1|  hypothetical protein VITISV_012854                   50.8    8e-06   
ref|XP_008349120.1|  PREDICTED: uncharacterized protein LOC103412315  51.2    8e-06   
emb|CAN74166.1|  hypothetical protein VITISV_007721                   50.8    9e-06   
gb|ABA95230.1|  retrotransposon protein, putative, unclassified       51.2    9e-06   
ref|XP_010069795.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.2    9e-06   
emb|CAH67225.1|  OSIGBa0145M07.7                                      51.2    9e-06   
emb|CAN64509.1|  hypothetical protein VITISV_041217                   51.2    9e-06   
emb|CDO74719.1|  hypothetical protein BN946_scf184593.g1              50.8    9e-06   
emb|CAN70473.1|  hypothetical protein VITISV_037490                   50.8    9e-06   
ref|XP_010683797.1|  PREDICTED: uncharacterized protein LOC104898410  51.2    9e-06   
ref|XP_008356279.1|  PREDICTED: uncharacterized protein LOC103419980  50.8    1e-05   
emb|CAE75905.1|  OSJNBa0088I22.18                                     50.8    1e-05   
ref|XP_009613298.1|  PREDICTED: uncharacterized protein LOC104106454  50.4    1e-05   
ref|XP_004986808.1|  PREDICTED: uncharacterized protein LOC101773259  51.2    1e-05   
emb|CAN61815.1|  hypothetical protein VITISV_009920                   50.8    1e-05   
ref|XP_008390959.1|  PREDICTED: uncharacterized protein LOC103453183  50.8    1e-05   
ref|XP_010270824.1|  PREDICTED: uncharacterized protein LOC104607033  50.4    1e-05   
gb|KFK30733.1|  hypothetical protein AALP_AA6G020200                  51.2    1e-05   
gb|AAF67366.1|  Hypothetical protein T32B20.i                         50.8    1e-05   
ref|XP_006595312.1|  PREDICTED: uncharacterized protein LOC102668660  50.4    1e-05   
emb|CAN71214.1|  hypothetical protein VITISV_039504                   50.8    1e-05   
ref|XP_010656794.1|  PREDICTED: uncharacterized protein LOC104880778  50.8    1e-05   
gb|ACZ04926.1|  polyprotein                                           50.8    1e-05   
emb|CAN66772.1|  hypothetical protein VITISV_006774                   50.8    1e-05   
ref|XP_010412990.1|  PREDICTED: uncharacterized protein LOC104699374  50.8    1e-05   
emb|CAN75776.1|  hypothetical protein VITISV_027125                   49.7    1e-05   
emb|CAN77072.1|  hypothetical protein VITISV_006213                   50.8    1e-05   
gb|ACB45089.1|  putative polyprotein                                  50.8    1e-05   
ref|XP_007047887.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  50.4    1e-05   
emb|CAH67640.1|  H0102C09.1                                           50.8    1e-05   
ref|XP_008374297.1|  PREDICTED: uncharacterized protein LOC103437591  50.8    1e-05   
emb|CAN62863.1|  hypothetical protein VITISV_030334                   50.8    1e-05   
gb|ABF96081.1|  retrotransposon protein, putative, Ty1-copia subc...  50.8    1e-05   
gb|AGH20670.1|  reverse transcriptase                                 49.7    1e-05   
emb|CAN71586.1|  hypothetical protein VITISV_009568                   50.8    1e-05   
emb|CAN72398.1|  hypothetical protein VITISV_041202                   50.8    1e-05   
emb|CAN68496.1|  hypothetical protein VITISV_010947                   50.8    1e-05   
emb|CAN74229.1|  hypothetical protein VITISV_000584                   50.8    1e-05   
ref|XP_011005534.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.8    1e-05   
emb|CAN67511.1|  hypothetical protein VITISV_026953                   49.7    1e-05   
ref|XP_004300921.1|  PREDICTED: uncharacterized protein LOC101301876  50.4    1e-05   
gb|AAF69161.1|AC007915_13  F27F5.19                                   50.8    1e-05   
gb|ABE88097.1|  Reverse transcriptase (RNA-dependent DNA polymerase)  49.7    1e-05   
emb|CAB10526.1|  retrotransposon like protein                         50.8    1e-05   
emb|CAN67526.1|  hypothetical protein VITISV_011686                   47.8    1e-05   
emb|CAN67546.1|  hypothetical protein VITISV_027734                   50.8    1e-05   
emb|CAH66946.1|  B0809H07.1                                           50.4    1e-05   
gb|ABB47203.2|  retrotransposon protein, putative, unclassified       50.4    1e-05   
gb|EPZ33092.1|  hypothetical protein O9G_005962                       48.1    1e-05   
ref|XP_010039830.1|  PREDICTED: uncharacterized protein LOC104428559  50.4    1e-05   
emb|CAB10225.1|  retrovirus-related like polyprotein                  50.4    1e-05   
ref|XP_008665822.1|  PREDICTED: uncharacterized protein LOC103644390  50.4    1e-05   
emb|CDO76034.1|  hypothetical protein BN946_scf184818.g2              50.4    1e-05   
gb|KHG11829.1|  hypothetical protein F383_08138                       47.8    1e-05   
emb|CAN60617.1|  hypothetical protein VITISV_003256                   50.1    1e-05   
ref|XP_008657522.1|  PREDICTED: F-box protein At1g70590-like          49.7    1e-05   
ref|XP_008351324.1|  PREDICTED: uncharacterized protein LOC103414737  50.4    1e-05   
ref|XP_008344228.1|  PREDICTED: uncharacterized protein LOC103407048  49.7    1e-05   
gb|EMT21953.1|  ABC transporter C family member 10                    50.4    2e-05   
emb|CAN63649.1|  hypothetical protein VITISV_037657                   50.4    2e-05   
ref|XP_009772047.1|  PREDICTED: uncharacterized protein LOC104222514  48.5    2e-05   
ref|XP_010059409.1|  PREDICTED: uncharacterized protein LOC104447361  50.1    2e-05   
gb|AAO20078.1|  putative polyprotein                                  50.4    2e-05   
dbj|BAK64102.1|  gag-pol polyprotein                                  50.4    2e-05   
gb|AAD23883.1|  putative retroelement pol polyprotein                 50.4    2e-05   
gb|AAM74347.1|AC115686_14  Putative retroelement                      50.4    2e-05   
emb|CAN76631.1|  hypothetical protein VITISV_032335                   50.1    2e-05   
emb|CAN77295.1|  hypothetical protein VITISV_005638                   50.4    2e-05   
gb|ABA94365.1|  retrotransposon protein, putative, unclassified       50.4    2e-05   
ref|XP_004293019.1|  PREDICTED: L-type lectin-domain containing r...  50.1    2e-05   
ref|XP_008385557.1|  PREDICTED: uncharacterized protein LOC103448098  49.3    2e-05   
ref|XP_010650252.1|  PREDICTED: uncharacterized protein LOC104879339  50.1    2e-05   
gb|AAD14478.1|  Strong similarity to gb|AF039376 Evelknievel retr...  50.4    2e-05   
emb|CAN75363.1|  hypothetical protein VITISV_026292                   50.4    2e-05   
ref|XP_008361413.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.1    2e-05   
emb|CAN75319.1|  hypothetical protein VITISV_034031                   50.1    2e-05   
ref|XP_008349844.1|  PREDICTED: uncharacterized protein LOC103413131  49.7    2e-05   
emb|CAN71619.1|  hypothetical protein VITISV_042294                   47.4    2e-05   
ref|XP_009622798.1|  PREDICTED: uncharacterized protein LOC104114126  50.1    2e-05   
ref|XP_008376990.1|  PREDICTED: uncharacterized protein LOC103440084  50.1    2e-05   
ref|XP_008363069.1|  PREDICTED: TMV resistance protein N-like         49.7    2e-05   
emb|CAN60502.1|  hypothetical protein VITISV_031514                   50.1    2e-05   
emb|CAN60829.1|  hypothetical protein VITISV_012059                   50.1    2e-05   
gb|AAN34944.1|  Putative retroelement                                 50.1    2e-05   
gb|EPZ36003.1|  Reverse transcriptase, RNA-dependent DNA polymera...  49.7    2e-05   
emb|CAN72951.1|  hypothetical protein VITISV_020157                   50.1    2e-05   
emb|CAN83877.1|  hypothetical protein VITISV_014760                   50.1    2e-05   
ref|XP_010490071.1|  PREDICTED: uncharacterized protein LOC104767790  50.1    2e-05   
emb|CAN73613.1|  hypothetical protein VITISV_023299                   50.1    2e-05   
ref|XP_008392761.1|  PREDICTED: uncharacterized protein LOC103454946  50.1    2e-05   
ref|XP_008379771.1|  PREDICTED: uncharacterized protein LOC103442736  50.1    2e-05   
ref|XP_009605462.1|  PREDICTED: uncharacterized protein LOC104100012  50.1    2e-05   
ref|XP_010682503.1|  PREDICTED: uncharacterized protein LOC104897342  49.7    2e-05   
ref|XP_010495906.1|  PREDICTED: uncharacterized protein LOC104773055  49.7    2e-05   
emb|CAN69851.1|  hypothetical protein VITISV_009554                   50.1    2e-05   
emb|CAN68175.1|  hypothetical protein VITISV_010332                   49.7    2e-05   
emb|CAN63908.1|  hypothetical protein VITISV_044218                   50.1    2e-05   
emb|CAN67821.1|  hypothetical protein VITISV_025855                   50.1    2e-05   
emb|CAN82769.1|  hypothetical protein VITISV_037882                   50.1    2e-05   
gb|AAD32898.1|  putative retroelement pol polyprotein                 50.1    2e-05   
ref|XP_004295380.1|  PREDICTED: uncharacterized protein LOC101310880  50.1    2e-05   
ref|XP_009629549.1|  PREDICTED: uncharacterized protein LOC104119680  49.3    2e-05   
emb|CAN71553.1|  hypothetical protein VITISV_034738                   50.1    2e-05   
ref|XP_008358405.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  50.1    2e-05   
emb|CAN62431.1|  hypothetical protein VITISV_015835                   50.1    2e-05   
emb|CAN59963.1|  hypothetical protein VITISV_022756                   49.7    2e-05   
ref|XP_010319957.1|  PREDICTED: uncharacterized protein LOC104647082  50.1    2e-05   
pir||T02087  gag/pol polyprotein - maize retrotransposon Hopscotch    50.1    2e-05
emb|CAN81238.1|  hypothetical protein VITISV_031073                   50.1    2e-05   
ref|XP_008392961.1|  PREDICTED: embryonic protein DC-8                49.7    2e-05   
gb|KDR64888.1|  hypothetical protein GALMADRAFT_82558                 49.7    2e-05   
emb|CAN71812.1|  hypothetical protein VITISV_037409                   49.7    2e-05   
emb|CAN79734.1|  hypothetical protein VITISV_039266                   48.9    2e-05   
ref|XP_009610589.1|  PREDICTED: uncharacterized protein LOC104104263  49.7    3e-05   
ref|XP_006589958.1|  PREDICTED: uncharacterized mitochondrial pro...  48.5    3e-05   
emb|CAN65808.1|  hypothetical protein VITISV_033389                   49.7    3e-05   
emb|CAN71684.1|  hypothetical protein VITISV_013362                   49.7    3e-05   
gb|ABA94875.1|  retrotransposon protein, putative, Ty1-copia subc...  49.7    3e-05   
emb|CAN75274.1|  hypothetical protein VITISV_043735                   49.7    3e-05   
ref|XP_009614297.1|  PREDICTED: uncharacterized protein LOC104107258  48.9    3e-05   
ref|XP_010667912.1|  PREDICTED: uncharacterized protein LOC104884908  49.7    3e-05   
dbj|BAD34493.1|  Gag-Pol                                              49.7    3e-05   
ref|XP_008343016.1|  PREDICTED: uncharacterized protein LOC103405779  49.3    3e-05   
ref|XP_004308668.1|  PREDICTED: uncharacterized protein LOC101303284  49.7    3e-05   
ref|XP_010917818.1|  PREDICTED: uncharacterized protein LOC105042345  49.3    3e-05   
ref|XP_006494841.1|  PREDICTED: uncharacterized protein LOC102608996  49.7    3e-05   
emb|CAN78154.1|  hypothetical protein VITISV_032622                   49.7    3e-05   
emb|CAN60019.1|  hypothetical protein VITISV_007668                   49.7    3e-05   
emb|CAN80212.1|  hypothetical protein VITISV_005117                   49.7    3e-05   
gb|AAD15372.1|  putative retroelement pol polyprotein                 49.3    3e-05   
ref|XP_008363538.1|  PREDICTED: L-type lectin-domain containing r...  49.3    3e-05   
emb|CAN70156.1|  hypothetical protein VITISV_016168                   49.7    3e-05   
gb|ABH07899.1|  putative polyprotein                                  49.7    3e-05   
ref|XP_009796454.1|  PREDICTED: uncharacterized protein LOC104243030  49.7    3e-05   
ref|XP_010688568.1|  PREDICTED: uncharacterized protein LOC104902479  49.7    3e-05   
emb|CAN60139.1|  hypothetical protein VITISV_024746                   49.7    3e-05   
ref|XP_008371748.1|  PREDICTED: uncharacterized protein LOC103435137  47.4    3e-05   
ref|XP_006663342.1|  PREDICTED: uncharacterized protein LOC102709321  49.3    3e-05   
ref|XP_010059512.1|  PREDICTED: uncharacterized protein LOC104447480  49.7    3e-05   
ref|XP_009354183.1|  PREDICTED: uncharacterized protein LOC103945350  49.7    3e-05   
gb|EMT13235.1|  Oligopeptide transporter 1                            49.3    3e-05   
emb|CAN72171.1|  hypothetical protein VITISV_036207                   49.7    3e-05   
ref|XP_007044444.1|  Cysteine-rich RLK (RECEPTOR-like protein kin...  49.3    3e-05   
ref|XP_008238300.1|  PREDICTED: uncharacterized protein LOC103336939  49.3    3e-05   
emb|CAN64963.1|  hypothetical protein VITISV_002891                   49.7    3e-05   
ref|XP_010103877.1|  C2 domain-containing protein                     49.3    3e-05   
emb|CAN74819.1|  hypothetical protein VITISV_034590                   49.3    3e-05   
ref|XP_006477890.1|  PREDICTED: uncharacterized protein LOC102616497  49.3    3e-05   
ref|XP_008355233.1|  PREDICTED: uncharacterized protein LOC103418904  49.3    3e-05   
ref|XP_009792623.1|  PREDICTED: uncharacterized protein LOC104239641  48.5    3e-05   
emb|CAN68682.1|  hypothetical protein VITISV_024814                   49.7    3e-05   
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647  49.3    3e-05   
ref|XP_010039234.1|  PREDICTED: uncharacterized protein LOC104427926  49.3    3e-05   
ref|XP_006493639.1|  PREDICTED: LRR receptor-like serine/threonin...  49.7    3e-05   



>emb|CDO76041.1| hypothetical protein BN946_scf184948.g1 [Trametes cinnabarina]
Length=597

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LV   PG   +G +WVFRVKRNADGSIER+K RLVA
Sbjct  109  NQTFELVQLPPGRKAIGSRWVFRVKRNADGSIERYKGRLVA  149



>emb|CDO77864.1| hypothetical protein BN946_scf184612.g1, partial [Trametes cinnabarina]
Length=660

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LV   PG   +G +WVFRVKRNADGSIER+K RLVA
Sbjct  172  NQTFELVQLPPGRKAIGSRWVFRVKRNADGSIERYKGRLVA  212



>emb|CAN83506.1| hypothetical protein VITISV_027576 [Vitis vinifera]
Length=1172

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP  P  NVVG KW+FR KRN+DGSI+R KARLVA
Sbjct  682  NGTWELVPSNPSQNVVGCKWIFRTKRNSDGSIDRFKARLVA  722



>emb|CDO75804.1| hypothetical protein BN946_scf184951.g2 [Trametes cinnabarina]
Length=1205

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LV   PG   +G +WVFRVKRNADGSIER+K RLVA
Sbjct  765  NQTFELVQLPPGRKAIGSRWVFRVKRNADGSIERYKGRLVA  805



>emb|CDO76042.1| hypothetical protein BN946_scf184948.g2 [Trametes cinnabarina]
Length=658

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +L+   PG   +G +WVFRVKRNADGSIER+K RLVA
Sbjct  189  NQTFELIQLPPGRKAIGSRWVFRVKRNADGSIERYKGRLVA  229



>ref|XP_010266970.1| PREDICTED: uncharacterized protein LOC104604368 [Nelumbo nucifera]
Length=278

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T QLVP    MNVVG KWV+++KR  DGS+ER+KARLVA
Sbjct  231  NGTWQLVPYDSSMNVVGSKWVYKIKRKPDGSVERYKARLVA  271



>ref|XP_008222569.1| PREDICTED: uncharacterized protein LOC103322432 [Prunus mume]
Length=465

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  LVP T  MN+VG KWVF+VKR ADGSI+R+KA L+A
Sbjct  357  NQTWSLVPATSSMNIVGCKWVFKVKRKADGSIDRYKALLIA  397



>emb|CDO74230.1| hypothetical protein BN946_scf184886.g1 [Trametes cinnabarina]
Length=1427

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LV   PG   +G +WVFRVKRNADGSIER+K RLVA
Sbjct  940  NQTFELVQLPPGRKAIGSRWVFRVKRNADGSIERYKGRLVA  980



>ref|XP_006596648.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=444

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G   +GYKWVFR+K NADGSI R+KARLVA
Sbjct  250  NRTWDLVPLPAGRQAIGYKWVFRIKENADGSINRYKARLVA  290



>ref|XP_009344163.1| PREDICTED: uncharacterized protein LOC103936058 [Pyrus x bretschneideri]
 ref|XP_009344170.1| PREDICTED: uncharacterized protein LOC103936065 [Pyrus x bretschneideri]
Length=230

 Score = 59.3 bits (142),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T +LVP  P  N+VG KWVF+VK  ADGSIER+KARLVA
Sbjct  13   TWELVPSHPSYNLVGCKWVFKVKHKADGSIERYKARLVA  51



>emb|CAN80123.1| hypothetical protein VITISV_009646 [Vitis vinifera]
Length=478

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  P  +V+G KW+FR+K+N DGSI+RHK RLVA
Sbjct  185  NNTWSLVPLPPNQSVIGCKWIFRLKKNPDGSIQRHKTRLVA  225



>ref|XP_008358877.1| PREDICTED: uncharacterized protein LOC103422594 [Malus domestica]
Length=227

 Score = 57.8 bits (138),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP TP MNV+  KWVFR KR  DGSI+R KARLVA
Sbjct  13   TWSLVPYTPTMNVLPNKWVFRJKRKXDGSIDRFKARLVA  51



>emb|CAN59941.1| hypothetical protein VITISV_017227 [Vitis vinifera]
Length=479

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  P MNV+  KW+FRVK N+DG+I+R+KARLVA
Sbjct  169  NNTWTLVPFHPSMNVIXSKWIFRVKYNSDGTIQRYKARLVA  209



>ref|XP_009341541.1| PREDICTED: uncharacterized protein LOC103933571 [Pyrus x bretschneideri]
Length=227

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP  P  N+VG KWVFR KR  DGS++R+KARLVA
Sbjct  16   LVPSNPSQNLVGCKWVFRTKRKPDGSVDRYKARLVA  51



>gb|AAT38758.1| Putative gag-pol polyprotein, identical [Solanum demissum]
Length=1333

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LV    G NV+G KWVFR K NADGSI++HKARLVA
Sbjct  845  NSTWELVDAPEGKNVIGLKWVFRTKYNADGSIQKHKARLVA  885



>ref|XP_008350379.1| PREDICTED: uncharacterized protein LOC103413717 [Malus domestica]
Length=252

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG   +G KWV+++K N+DGSIER+KARLVA
Sbjct  161  NNTWTLVPLPPGHKPIGCKWVYKIKYNSDGSIERYKARLVA  201



>gb|AAF63122.1|AC009526_7 Hypothetical protein [Arabidopsis thaliana]
Length=559

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            QT  LVP TP MNV+G KWVF+ K NADGS+++ KARLVA
Sbjct  185  QTWSLVPYTPDMNVLGSKWVFQTKLNADGSLDKLKARLVA  224



>ref|XP_004305316.1| PREDICTED: uncharacterized protein LOC101302857 [Fragaria vesca 
subsp. vesca]
Length=459

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVPC    N+VG KW+F+VK+N DGSI R+KARLVA
Sbjct  146  LVPCPSNRNIVGSKWIFKVKKNPDGSISRYKARLVA  181



>ref|XP_008380799.1| PREDICTED: uncharacterized protein LOC103443689 [Malus domestica]
Length=896

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            T  LVP  P  N+VGYKWVF++K+NADGSI R+KARLV
Sbjct  715  TWSLVPLPPHKNLVGYKWVFKIKKNADGSIGRYKARLV  752



>ref|XP_011081378.1| PREDICTED: uncharacterized protein LOC105164425 [Sesamum indicum]
Length=767

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  L P  PG   +G KWVF+VK  ADGSIER+KARLVA
Sbjct  640  NQTWTLTPLPPGKRAIGSKWVFKVKLRADGSIERYKARLVA  680



>emb|CAN76473.1| hypothetical protein VITISV_016007 [Vitis vinifera]
Length=1002

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  P MNV+  KW+FRVK N+DG+I+R+KARLVA
Sbjct  518  NNTWTLVPFHPSMNVIDSKWIFRVKYNSDGTIQRYKARLVA  558



>ref|XP_004146265.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cucumis sativus]
 ref|XP_004163850.1| PREDICTED: uncharacterized mitochondrial protein AtMg00810-like 
[Cucumis sativus]
Length=310

 Score = 57.8 bits (138),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            +T  LVP +P  N+VG KWVFR+KRN+D SI+R+KA+LVA
Sbjct  12   KTWHLVPSSPYQNIVGNKWVFRLKRNSDCSIQRYKAQLVA  51



>ref|XP_007019438.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOY16663.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=579

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LVP  P   +VGYKW+F +KR+ DGSI R+KARLVA
Sbjct  55   NETWELVPPLPDKTIVGYKWIFCIKRHLDGSISRYKARLVA  95



>gb|AAL66754.1|AF464738_5 putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=1313

 Score = 58.5 bits (140),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+G KWV+++KR ADGS++R+KARLVA
Sbjct  831  NKTWHLVPPKKGRNVIGCKWVYKIKRKADGSLDRYKARLVA  871



>gb|ABA99232.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=308

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP T G N++  KWV+++KR ADG+I+R+KARLVA
Sbjct  11   NNTWHLVPATQGRNLIDCKWVYKIKRKADGTIDRYKARLVA  51



>ref|XP_009592499.1| PREDICTED: uncharacterized protein LOC104089338 [Nicotiana tomentosiformis]
Length=330

 Score = 57.0 bits (136),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  PGMN+VG +WVF+ K  + GSI+R+KARLVA
Sbjct  11   NKTWTLVPKAPGMNIVGSRWVFKTKLKSIGSIDRYKARLVA  51



>ref|XP_010243265.1| PREDICTED: uncharacterized protein LOC104587377 [Nelumbo nucifera]
Length=175

 Score = 55.1 bits (131),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  P  N+VG KW+F++KRN+DGS+  +KARLVA
Sbjct  130  NGTWSLVPVPPNANIVGCKWIFKLKRNSDGSLAHYKARLVA  170



>emb|CAN70361.1| hypothetical protein VITISV_033646 [Vitis vinifera]
Length=1013

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  533  NHTWDLVPLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  573



>emb|CAN68711.1| hypothetical protein VITISV_015847 [Vitis vinifera]
Length=1168

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  688  NHTWDLVPLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  728



>gb|AAP94600.1| putative copia-like retrotransposon Hopscotch polyprotein [Zea 
mays]
Length=969

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+G KWV+++KR ADGS++R+KARLVA
Sbjct  831  NKTWHLVPPKKGRNVIGCKWVYKIKRKADGSLDRYKARLVA  871



>gb|AAV44026.1| hypothetical protein [Oryza sativa Japonica Group]
Length=760

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP T G N++  KWV+++K+ ADGSI+R+KARLVA
Sbjct  568  NKTWHLVPSTSGKNIIDCKWVYKIKKKADGSIDRYKARLVA  608



>ref|XP_004972302.1| PREDICTED: uncharacterized protein LOC101778040 [Setaria italica]
Length=446

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G+NV+  KW+F++KR ADGSI+R+KARLVA
Sbjct  200  NKTWHLVPPHAGLNVINCKWIFKLKRKADGSIDRYKARLVA  240



>ref|XP_008378632.1| PREDICTED: uncharacterized protein LOC103441708 [Malus domestica]
Length=1328

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP  P  N+VG KWVF+VK+++DGSI RHKARLVA
Sbjct  860  TWSLVPLPPQXNLVGCKWVFKVKKHSDGSIARHKARLVA  898



>ref|XP_010539104.1| PREDICTED: uncharacterized protein LOC104813235 [Tarenaya hassleriana]
Length=363

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP     NVVG KWVFR KR++DGSI+R+KARLVA
Sbjct  98   NGTWTLVPSRSSYNVVGCKWVFRTKRHSDGSIDRYKARLVA  138



>ref|XP_008228040.1| PREDICTED: uncharacterized protein LOC103327479 [Prunus mume]
Length=1047

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP  P  N+VG KW+F++K++ADGSI RHKARLVA
Sbjct  637  TWSLVPLPPDKNLVGCKWIFKIKKHADGSIARHKARLVA  675



>emb|CAN74430.1| hypothetical protein VITISV_010987 [Vitis vinifera]
Length=2471

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T  LVP  PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  1148  NHTWDLVPLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  1188



>ref|XP_004980642.1| PREDICTED: uncharacterized protein LOC101772525 [Setaria italica]
Length=469

 Score = 57.4 bits (137),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LVP   G N++  KWV+++KR ADGS++R+KARLVA
Sbjct  375  NQTWRLVPSKSGQNIIDCKWVYKIKRKADGSLDRYKARLVA  415



>ref|XP_008347066.1| PREDICTED: uncharacterized protein LOC103410073 [Malus domestica]
Length=923

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP +P  N+VG KWVFR+KR  DG+I+R+KARLVA
Sbjct  472  LVPSSPHQNLVGCKWVFRIKRKPDGTIDRYKARLVA  507



>emb|CAC95126.1| gag-pol polyprotein [Populus deltoides]
Length=1382

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP  PG +VVG +WV+++K N+DGSIER+KARLVA
Sbjct  903  TWDLVPLPPGKSVVGCRWVYKIKTNSDGSIERYKARLVA  941



>emb|CAN78876.1| hypothetical protein VITISV_033245 [Vitis vinifera]
Length=361

 Score = 57.0 bits (136),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  11   NHTWDLVPLPPGQSVVGCKWIYKIKTCSDGSVERYKARLVA  51



>emb|CAN74984.1| hypothetical protein VITISV_035210 [Vitis vinifera]
Length=2408

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T  LVP  PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  1995  NHTWDLVPLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  2035



>emb|CAN64816.1| hypothetical protein VITISV_010668 [Vitis vinifera]
Length=1212

 Score = 57.8 bits (138),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVPC    N+VGY+W+F+ K   DGSIE HKARLVA
Sbjct  760  NDTWVLVPCPTNHNMVGYRWIFKTKLQLDGSIEHHKARLVA  800



>ref|XP_008392735.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=612

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP  P  NVVG KWVF++ +N DG+I RHKARLVA
Sbjct  570  TWSLVPSHPSQNVVGCKWVFQINKNPDGTINRHKARLVA  608



>emb|CAN82537.1| hypothetical protein VITISV_013040 [Vitis vinifera]
Length=680

 Score = 57.0 bits (136),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N+T +LV C PG N+VG +W++ VK  ADGSIER KARLV
Sbjct  269  NETWELVECPPGKNLVGCRWIYTVKYKADGSIERFKARLV  308



>emb|CAN71250.1| hypothetical protein VITISV_027849 [Vitis vinifera]
Length=445

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP     N+VG KW+FR KR++DGS++RHKA LVA
Sbjct  24   NGTWELVPSBSSHNIVGCKWIFRTKRHSDGSVDRHKAXLVA  64



>ref|XP_008369700.1| PREDICTED: uncharacterized protein LOC103433244 [Malus domestica]
Length=765

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            QT +LVP  P  N+VG KW++++K+N DGS+ R+KARLVA
Sbjct  474  QTWKLVPLPPNKNLVGCKWIYKIKKNVDGSVARYKARLVA  513



>ref|XP_011093964.1| PREDICTED: uncharacterized protein LOC105173784 [Sesamum indicum]
Length=238

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N T +LVP +PG   +G KWVF+ K N DGS+ER+KARLV
Sbjct  160  NNTWKLVPLSPGKCAIGCKWVFKTKLNTDGSVERYKARLV  199



>ref|XP_008238972.1| PREDICTED: uncharacterized protein LOC103337585 [Prunus mume]
Length=789

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            L+P  P +NV+  KWVFR+KRN+DGS++R+KARLVA
Sbjct  568  LIPPKPTLNVLPNKWVFRIKRNSDGSVQRYKARLVA  603



>ref|XP_010531643.1| PREDICTED: uncharacterized protein LOC104807900 [Tarenaya hassleriana]
Length=1047

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP +   NVVG +WVFR+KR  DGS++R+KARLVA
Sbjct  619  NNTWDLVPSSDASNVVGCRWVFRIKRKPDGSVDRYKARLVA  659



>emb|CAN63098.1| hypothetical protein VITISV_009456 [Vitis vinifera]
Length=335

 Score = 56.2 bits (134),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG   +GYKWVF+VK N +GSI++ KARLVA
Sbjct  11   NNTWSLVPLPPGRTPIGYKWVFKVKENPNGSIQKCKARLVA  51



>gb|AAX95627.1| Reverse transcriptase (RNA-dependent DNA polymerase), putative 
[Oryza sativa Japonica Group]
 gb|ABF97135.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=330

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G+NV+  KWV+++KR ADGS++R+KARLVA
Sbjct  71   NKTWHLVPPKRGLNVIDCKWVYKIKRKADGSLDRYKARLVA  111



>ref|XP_007027564.1| Uncharacterized protein TCM_022381 [Theobroma cacao]
 gb|EOY08066.1| Uncharacterized protein TCM_022381 [Theobroma cacao]
Length=331

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N T  +VP     NV+GYKWV++VK NADG++ER+KARLV
Sbjct  11   NGTWSIVPLPSNCNVIGYKWVYKVKLNADGNVERYKARLV  50



>ref|YP_514636.1| hypothetical protein OrsaiPp07 [Oryza sativa Indica Group]
 ref|YP_003433855.1| hypothetical protein OrrupM_p18 [Oryza rufipogon]
 gb|AAZ99275.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AAZ99329.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 gb|AAZ99382.1| hypothetical protein (mitochondrion) [Oryza sativa Japonica Group]
 dbj|BAI67959.1| hypothetical protein [Oryza rufipogon]
 dbj|BAI67987.1| hypothetical protein [Oryza sativa Indica Group]
 gb|AER12982.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AER13050.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03755.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 gb|AEZ03764.1| hypothetical protein (mitochondrion) [Oryza sativa Indica Group]
 dbj|BAN67511.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
 dbj|BAN67513.1| hypothetical protein (mitochondrion) [Oryza rufipogon]
Length=490

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP T G N++  KWV+++KR ADG+I+R+KARLVA
Sbjct  11   NNTWHLVPATQGRNLIDCKWVYKIKRKADGTIDRYKARLVA  51



>ref|XP_008357351.1| PREDICTED: uncharacterized protein LOC103421092 [Malus domestica]
Length=536

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG   +G KWV+++K N+DGSIER+KARLVA
Sbjct  11   NNTWTLVPLPPGHKPIGCKWVYKIKYNSDGSIERYKARLVA  51



>ref|YP_002000554.1| orf490 [Oryza sativa Japonica Group]
 dbj|BAC19858.1| orf490 [Oryza sativa Japonica Group]
Length=490

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP T G N++  KWV+++KR ADG+I+R+KARLVA
Sbjct  11   NNTWHLVPATQGRNLIDCKWVYKIKRKADGTIDRYKARLVA  51



>emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera]
Length=1354

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP     N+VG KW+FR+KRN+DGSI+R+KARLVA
Sbjct  872  NGTWELVPPEDITNLVGCKWIFRIKRNSDGSIDRYKARLVA  912



>ref|XP_008361163.1| PREDICTED: uncharacterized protein LOC103424851 [Malus domestica]
Length=1091

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            +T  LV   P  N+VG KW+F+VKR+ADGSI RHKARLVA
Sbjct  801  KTWSLVALPPNKNLVGCKWIFKVKRHADGSIARHKARLVA  840



>emb|CAB10380.1| reverse transcriptase like protein [Arabidopsis thaliana]
 emb|CAB78643.1| reverse transcriptase like protein [Arabidopsis thaliana]
Length=1942

 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            QT  LVP T  MNV+G KWVFR K NADGS+++ KARLVA
Sbjct  835  QTWSLVPYTSDMNVLGSKWVFRTKLNADGSLDKLKARLVA  874


 Score = 57.4 bits (137),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5     QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             QT  LVP T  MNV+G KWVFR K NADGS+++ KARLVA
Sbjct  1735  QTWSLVPYTSDMNVLGSKWVFRTKLNADGSLDKLKARLVA  1774



>ref|XP_004958843.1| PREDICTED: uncharacterized protein LOC101772504 [Setaria italica]
Length=515

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LVP   G N++  KWV+++KR ADGS++R+KARLVA
Sbjct  425  NQTWRLVPSKSGQNIIDCKWVYKIKRKADGSLDRYKARLVA  465



>gb|AAP53968.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=932

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP T G N++  KW++++KR ADGSI+R+KARLVA
Sbjct  452  NKTWHLVPPTQGKNIIDCKWMYKIKRKADGSIDRYKARLVA  492



>emb|CAN72201.1| hypothetical protein VITISV_014985 [Vitis vinifera]
Length=398

 Score = 56.2 bits (134),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP T   N+VG KWVFR+KR  DGSI+R+KA+LVA
Sbjct  11   NGTWELVPSTSMQNLVGCKWVFRIKRLPDGSIDRYKAKLVA  51



>gb|AAW56918.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1018

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  LVP   G N++  KWV++VKR ADGS++R+KARLVA
Sbjct  584  NQTWHLVPPQQGRNIIDCKWVYKVKRKADGSLDRYKARLVA  624



>gb|ACY72569.1| unknown [Oryza sativa Japonica Group]
Length=1436

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP   G NV+G KWV+++KR ADG+++R+KARLVA
Sbjct  954  NDTWHLVPYEKGQNVIGCKWVYKIKRKADGTLDRYKARLVA  994



>ref|XP_008387250.1| PREDICTED: uncharacterized protein LOC103449699 [Malus domestica]
Length=1313

 Score = 57.0 bits (136),  Expect = 8e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            +T  LV   P  N+VG KW+F+VKR+ADGSI RHKARLVA
Sbjct  827  KTWSLVDLPPNKNLVGCKWIFKVKRHADGSIARHKARLVA  866



>ref|XP_007387068.1| hypothetical protein PUNSTDRAFT_16937, partial [Punctularia strigosozonata 
HHB-11173 SS5]
 gb|EIN05879.1| hypothetical protein PUNSTDRAFT_16937, partial [Punctularia strigosozonata 
HHB-11173 SS5]
Length=73

 Score = 53.1 bits (126),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N T +LV   PG   +G +WVF++KR ADGS+ER+KARLV
Sbjct  30   NGTWELVQLPPGRKAIGSRWVFKIKRKADGSVERYKARLV  69



>ref|XP_004972082.1| PREDICTED: uncharacterized protein LOC101752886 [Setaria italica]
Length=687

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  LVP   G+N++  KWV+++KR ADGS++R+KARLVA
Sbjct  482  NQTWHLVPPRKGINIIDCKWVYKIKRKADGSLDRYKARLVA  522



>ref|XP_008351905.1| PREDICTED: uncharacterized protein LOC103415342 [Malus domestica]
Length=308

 Score = 55.5 bits (132),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP  P  N++G KWVFR+K + DG+I+R+KARLVA
Sbjct  11   NGTWELVPSLPSQNLIGCKWVFRIKWHPDGTIDRYKARLVA  51



>ref|XP_010659203.1| PREDICTED: uncharacterized protein LOC104881291 [Vitis vinifera]
Length=409

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP     N+VG KWVFR+KRN DGSI R+KAR VA
Sbjct  310  NRTWVLVPPPSNHNIVGCKWVFRIKRNLDGSISRYKARFVA  350



>emb|CAN73392.1| hypothetical protein VITISV_022526 [Vitis vinifera]
Length=1020

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +L+ C PG N VG +W++ VK  ADGSIER KARLVA
Sbjct  546  NETWELIECPPGKNPVGCRWIYTVKYKADGSIERFKARLVA  586



>gb|AAB82754.1| retrofit [Oryza longistaminata]
Length=1445

 Score = 57.0 bits (136),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T  LVP   G N++G KWV+++KR ADG+++R+KARLVA
Sbjct  963   NDTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVA  1003



>gb|AAG12528.1|AC015446_9 Hypothetical Protein [Arabidopsis thaliana]
Length=690

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            QT  L+P TP M+V+G KWVFR K NADGS+++ KAR+VA
Sbjct  245  QTWSLIPYTPDMHVLGCKWVFRTKLNADGSLDKLKARIVA  284



>emb|CAN71823.1| hypothetical protein VITISV_007329 [Vitis vinifera]
Length=678

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVPC    NVVG  W+F+ K +A+GSIERHKARLVA
Sbjct  265  NDTWDLVPCPVNHNVVGCCWIFKTKLHANGSIERHKARLVA  305



>ref|XP_008357860.1| PREDICTED: uncharacterized protein LOC103421593 [Malus domestica]
Length=1018

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             T  LVP   G N+VG KWV+RVK+N DGSI R+KARLVA
Sbjct  610  HTWDLVPLPSGKNLVGCKWVYRVKKNPDGSIARYKARLVA  649



>ref|XP_002442174.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
 gb|EES16012.1| hypothetical protein SORBIDRAFT_08g015513 [Sorghum bicolor]
Length=757

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LVP   G N++G KW+++VKR ADGS++R+KARLVA
Sbjct  283  NKTWKLVPRPRGENIIGCKWLYKVKRRADGSVDRYKARLVA  323



>emb|CAN65591.1| hypothetical protein VITISV_042091 [Vitis vinifera]
Length=1427

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP     N+VG KWVFR+KRN DGSI R+KARLVA
Sbjct  923  NCTWVLVPPPSNHNIVGCKWVFRIKRNPDGSISRYKARLVA  963



>gb|AAK53852.1|AC016781_6 Putative retroelement [Oryza sativa Japonica Group]
Length=920

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G+NV+  KWV+++KR ADGS++R+KARLVA
Sbjct  632  NKTWHLVPPKRGLNVIDCKWVYKIKRKADGSLDRYKARLVA  672



>ref|XP_010277969.1| PREDICTED: uncharacterized protein LOC104612285 [Nelumbo nucifera]
Length=381

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  P  N+   KWVF++KR +DGS+ER KARLVA
Sbjct  128  NKTWTLVPAPPDKNITRNKWVFKIKRKSDGSVERFKARLVA  168



>ref|XP_008365969.1| PREDICTED: uncharacterized protein LOC103429605 [Malus domestica]
Length=1188

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP +  MNV+  KWVF++KR ADG+IERHKARLVA
Sbjct  692  TWSLVPYSSQMNVLPNKWVFKIKRRADGTIERHKARLVA  730



>gb|AAT69582.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAU44112.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1256

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++ YKWV+++KR  DGS++R+KARLVA
Sbjct  774  NKTWHLVPPQKGRNIIDYKWVYKIKRKQDGSLDRYKARLVA  814



>ref|XP_007043677.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOX99508.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=137

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  +VP  P  + +G KWV++VK NA+GS+ER+KARLVA
Sbjct  11   NGTWSIVPLPPNSHAIGSKWVYKVKMNANGSVERYKARLVA  51



>gb|KFL89552.1| hypothetical protein AmDm5_1575 [Acetobacter malorum]
Length=1375

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5     QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
              T  LVP   G N+VG KWV+RVK+N DGSI R+KARLVA
Sbjct  1036  HTWDLVPLPSGKNLVGCKWVYRVKKNPDGSIARYKARLVA  1075



>emb|CAN80084.1| hypothetical protein VITISV_011294 [Vitis vinifera]
Length=180

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  86   NHTWDLVTLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  126



>ref|XP_011078646.1| PREDICTED: uncharacterized protein LOC105162338 [Sesamum indicum]
Length=782

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT ++VP   G N +G KWVF+ K   DGS+ERHKARLVA
Sbjct  380  NQTWKVVPLPAGKNPIGCKWVFKTKLREDGSVERHKARLVA  420



>emb|CAN79517.1| hypothetical protein VITISV_026065 [Vitis vinifera]
Length=196

 Score = 53.5 bits (127),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            + T QLVP     N+VG KWVF++KR+ DGS++R KARLVA
Sbjct  11   HNTWQLVPSPNDCNIVGCKWVFQIKRHVDGSVDRFKARLVA  51



>ref|XP_008354245.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At3g62470, mitochondrial-like [Malus domestica]
Length=909

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP +   N VG KWVFR+KR  DGSI+R+KARLVA
Sbjct  11   NGTWSLVPYSXSQNXVGCKWVFRIKRKPDGSIDRYKARLVA  51



>emb|CAN78269.1| hypothetical protein VITISV_006711 [Vitis vinifera]
Length=344

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  L PC P  NVV  KWVF+ KR  DGSIER K RLVA
Sbjct  11   NETWTLCPCPPDKNVVPSKWVFKSKRRLDGSIERLKPRLVA  51



>ref|XP_008390439.1| PREDICTED: uncharacterized protein LOC103452682 [Malus domestica]
Length=1098

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP T  MN++  KWVFR+K+N+DGSI+R+KARLVA
Sbjct  669  LVPRTASMNILPNKWVFRIKQNSDGSIQRYKARLVA  704



>gb|AAD22155.1|AF061282_8 polyprotein [Sorghum bicolor]
Length=1012

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP   G NV+G KWV+++K+ ADG +ER+KARLVA
Sbjct  620  NHTWHLVPPPRGKNVIGCKWVYKIKKRADGQVERYKARLVA  660



>ref|XP_009359358.1| PREDICTED: uncharacterized protein LOC103949948 [Pyrus x bretschneideri]
Length=1243

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP    MN++  KWVF+VKR ADGS+ERHKARLVA
Sbjct  559  LVPYHSKMNLLPNKWVFKVKRRADGSVERHKARLVA  594



>ref|NP_001175678.1| Os08g0544300 [Oryza sativa Japonica Group]
 dbj|BAH94406.1| Os08g0544300 [Oryza sativa Japonica Group]
Length=821

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+  KWV++VKR ADGS++R+KARLVA
Sbjct  333  NKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLDRYKARLVA  373



>gb|EMT19664.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=963

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP    +N++  KWVF+VK++ADGSIER+KARLVA
Sbjct  20   NKTWTLVPPPSRVNIIDSKWVFKVKKHADGSIERYKARLVA  60



>ref|XP_010065142.1| PREDICTED: uncharacterized protein LOC104452376 [Eucalyptus grandis]
Length=1169

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LVP T  MNV+G KWVF+ K  ADG ++R KARLVA
Sbjct  420  NQTWELVPQTDHMNVIGCKWVFKTKLTADGKLDRLKARLVA  460



>emb|CAN76493.1| hypothetical protein VITISV_007584 [Vitis vinifera]
Length=1120

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T +LVP TPG N+VG K+VFR KRN DG+I ++KARLVA
Sbjct  766  TWELVPPTPGQNLVGCKFVFRKKRNPDGTISQYKARLVA  804



>ref|XP_004310176.1| PREDICTED: uncharacterized protein LOC101315202 [Fragaria vesca 
subsp. vesca]
Length=1149

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  +VP  PG   +G KWV+++K +ADGSIER+KARLVA
Sbjct  443  NHTWSMVPLPPGHRPIGCKWVYKIKYHADGSIERYKARLVA  483



>ref|XP_009378158.1| PREDICTED: uncharacterized protein LOC103966690 [Pyrus x bretschneideri]
Length=1459

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            +T  L    P  N+VG KW+F+VKR+ADGSI RHKARLVA
Sbjct  689  KTWSLAALPPNKNLVGCKWIFKVKRHADGSIARHKARLVA  728



>gb|AAX96193.1| retrotransposon protein, putative, Ty1-copia sub-class [Oryza 
sativa Japonica Group]
Length=1621

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++G KWV+++KR ADG+++R+KARLVA
Sbjct  693  NKTWHLVPPQRGRNIIGCKWVYKIKRKADGTLDRYKARLVA  733



>gb|AAR88589.1| putative copia-like retrotransposon protein [Oryza sativa Japonica 
Group]
Length=1399

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+  KWV++VKR ADGS++R+KARLVA
Sbjct  911  NKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLDRYKARLVA  951



>gb|ABA98049.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1460

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N+T  LVP   G N++G KWV+++KR ADG+++R+KARLVA
Sbjct  971   NKTWHLVPPQRGRNIIGCKWVYKIKRKADGTLDRYKARLVA  1011



>gb|KHN05629.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1248

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV  +   N+VG KWVFR+KRN DGSI+R+KARLVA
Sbjct  791  NNTWDLVSRSSDQNLVGCKWVFRIKRNPDGSIDRYKARLVA  831



>emb|CAN68059.1| hypothetical protein VITISV_008424 [Vitis vinifera]
Length=507

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  125  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARLVA  165



>ref|XP_007014689.1| Uncharacterized protein TCM_040047 [Theobroma cacao]
 gb|EOY32308.1| Uncharacterized protein TCM_040047 [Theobroma cacao]
Length=678

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  LVP +    V+G KWVF++KR  DGSI+R+KARLVA
Sbjct  485  NQTWVLVPPSSKQTVIGCKWVFKIKRKPDGSIDRYKARLVA  525



>gb|KHN45997.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1235

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV  +   N+VG KWVFR+KRN DGSI+R+KARLVA
Sbjct  789  NNTWDLVSRSSDQNLVGCKWVFRIKRNPDGSIDRYKARLVA  829



>gb|KHN30958.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94, 
partial [Glycine soja]
Length=1237

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV  +   N+VG KWVFR+KRN DGSI+R+KARLVA
Sbjct  791  NNTWDLVSRSSDQNLVGCKWVFRIKRNPDGSIDRYKARLVA  831



>gb|ABH07409.1| putative pol polyprotein [Brassica oleracea var. botrytis]
Length=1239

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LV    G+ V+G KW+F++KRNADGSI + KARLVA
Sbjct  746  NQTWKLVDKPHGVKVIGLKWIFKIKRNADGSINKFKARLVA  786



>emb|CCI55333.1| PH01B019A14.2 [Phyllostachys edulis]
Length=190

 Score = 52.8 bits (125),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+  KWVF++KR ADGSI+ +KARLVA
Sbjct  146  NETWHLVPPDRGQNVIDCKWVFKLKRKADGSIDCYKARLVA  186



>gb|KHN17953.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Glycine 
soja]
Length=1294

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV  +   N+VG KWVFR+KRN DGSI+R+KARLVA
Sbjct  802  NNTWDLVSRSSDQNLVGCKWVFRIKRNPDGSIDRYKARLVA  842



>gb|EGO04786.1| hypothetical protein SERLA73DRAFT_82501 [Serpula lacrymans var. 
lacrymans S7.3]
Length=455

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG+  +G KWVF++KRN+DG++ER+KAR VA
Sbjct  127  NGTWSLVELPPGVKAIGGKWVFKIKRNSDGTVERYKARYVA  167



>gb|ABA98286.2| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1478

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N+T  LVP   G N++G KWV+++KR ADG+++R+KARLVA
Sbjct  964   NKTWHLVPPQRGRNIIGCKWVYKIKRKADGTLDRYKARLVA  1004



>ref|XP_010240794.1| PREDICTED: uncharacterized protein LOC104585563 [Brachypodium 
distachyon]
Length=295

 Score = 54.3 bits (129),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++  KWV+R+KR A+G+I+R+KARLVA
Sbjct  199  NKTWHLVPTNQGKNIIDCKWVYRIKRKANGTIDRYKARLVA  239



>gb|ABF95616.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1241

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+  KWV++VKR ADGS++R+KARLVA
Sbjct  857  NKTWHLVPPQKGRNVIDCKWVYKVKRKADGSLDRYKARLVA  897



>ref|XP_011014816.1| PREDICTED: uncharacterized protein LOC105118536 [Populus euphratica]
Length=1202

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP  PG +VV  +WV+++K N+DGSIER+KARLVA
Sbjct  435  TWDLVPLPPGKSVVSCRWVYKIKTNSDGSIERYKARLVA  473



>emb|CDO72947.1| hypothetical protein BN946_scf185002.g132 [Trametes cinnabarina]
Length=618

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVPC P    +G KWVFR+KR+ADG I +HKARLVA
Sbjct  398  LVPCPPDRKPIGCKWVFRLKRDADGRIIKHKARLVA  433



>ref|XP_010669336.1| PREDICTED: copia protein isoform X2 [Beta vulgaris subsp. vulgaris]
Length=953

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LVP  PG+NV+   W+F  K N+DGS ERHKARLV 
Sbjct  489  NKTWELVPRPPGVNVIRSMWIFAHKHNSDGSFERHKARLVG  529



>ref|XP_010669333.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669334.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010669335.1| PREDICTED: copia protein isoform X1 [Beta vulgaris subsp. vulgaris]
Length=977

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LVP  PG+NV+   W+F  K N+DGS ERHKARLV 
Sbjct  489  NKTWELVPRPPGVNVIRSMWIFAHKHNSDGSFERHKARLVG  529



>ref|XP_008392161.1| PREDICTED: uncharacterized protein LOC103454341 [Malus domestica]
Length=483

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            QT  LVP     N+VG KWVF++K N++GSI RHKARLVA
Sbjct  153  QTWSLVPLPSNKNLVGCKWVFKLKXNSNGSIARHKARLVA  192



>dbj|BAB11447.1| polyprotein-like [Arabidopsis thaliana]
Length=509

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  +V   P  NVVG KWV+ ++ NADGSIER+KARLVA
Sbjct  13   NKTWSVVSLPPNKNVVGCKWVYTIEYNADGSIERYKARLVA  53



>emb|CAN67506.1| hypothetical protein VITISV_026948 [Vitis vinifera]
Length=1063

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  600  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARLVA  640



>emb|CAN61660.1| hypothetical protein VITISV_000260 [Vitis vinifera]
Length=1087

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  645  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARLVA  685



>ref|XP_010531095.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=435

 Score = 54.3 bits (129),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP     N VG KWVFR+K+N DG+I+R KARLVA
Sbjct  142  NGTWELVPSVTASNTVGCKWVFRIKKNPDGTIDRFKARLVA  182



>emb|CAN72257.1| hypothetical protein VITISV_034188 [Vitis vinifera]
Length=1259

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LV      NVVG KW+FR KRN+DGSI R KARLVA
Sbjct  460  NGTWELVSFNSSQNVVGCKWIFRTKRNSDGSINRFKARLVA  500



>ref|XP_006606948.1| PREDICTED: uncharacterized protein LOC102661023 [Glycine max]
Length=592

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV  +   N+VG KWVFR+KRN DGSI+R+KARLVA
Sbjct  517  NNTWDLVSRSSDQNLVGCKWVFRIKRNPDGSIDRYKARLVA  557



>ref|XP_010446079.1| PREDICTED: uncharacterized protein LOC104728846 [Camelina sativa]
Length=249

 Score = 53.1 bits (126),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  L P T  MNV+G KWVFR KRNADGS+++ KA LVA
Sbjct  13   TWDLTPSTLDMNVLGSKWVFRTKRNADGSLQKLKALLVA  51



>ref|XP_008460736.1| PREDICTED: uncharacterized protein LOC103499498 [Cucumis melo]
Length=695

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  +VP   G N +G +WV+++K   DGSIER+KARLVA
Sbjct  483  NQTWSIVPLPKGKNSIGCRWVYKIKHKVDGSIERYKARLVA  523



>emb|CAN62086.1| hypothetical protein VITISV_035123 [Vitis vinifera]
Length=1151

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  665  NETWELVECPPGKKPVGCRWIYTVKYQADGSIERFKARLVA  705



>gb|AAT07563.1| putative polyprotein [Oryza sativa Japonica Group]
 gb|AAT07631.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1431

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++  KWV++VKR ADGS++R+KAR+VA
Sbjct  950  NKTWHLVPSKKGQNIIDCKWVYKVKRKADGSLDRYKARVVA  990



>dbj|BAB90546.1| putative rice retrotransposon retrofit gag/pol polyprotein [Oryza 
sativa Japonica Group]
Length=1448

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T  LVP   G N++G KWV++VKR ADG+++R+K RL+A
Sbjct  966   NDTWHLVPYEKGQNIIGCKWVYKVKRKADGTLDRYKTRLIA  1006



>gb|ABA94335.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=404

 Score = 54.3 bits (129),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++G KWV+ +KR +DG+++R+KARLVA
Sbjct  135  NKTWHLVPPCKGHNIIGCKWVYEIKRKSDGTLDRYKARLVA  175



>emb|CAN79949.1| hypothetical protein VITISV_044422 [Vitis vinifera]
Length=1176

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  690  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARLVA  730



>emb|CAE04319.3| OSJNBb0016D16.10 [Oryza sativa Japonica Group]
Length=950

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP   G N++G KWV+++KR ADG+++R+KARLVA
Sbjct  31   NNTWHLVPYEKGQNIIGCKWVYKIKRKADGTLDRYKARLVA  71



>ref|XP_008375643.1| PREDICTED: uncharacterized protein LOC103438878 [Malus domestica]
Length=634

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            QT  LVP     N+VG KWVF++K++ADG+I R+KARLVA
Sbjct  342  QTWSLVPLPSNRNLVGCKWVFKIKKHADGTISRYKARLVA  381



>gb|ACV42639.1| gag/pol [Oryza sativa Japonica Group]
Length=1448

 Score = 55.1 bits (131),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T  LVP   G N++G KWV++VKR ADG+++R+K RL+A
Sbjct  966   NDTWHLVPYEKGQNIIGCKWVYKVKRKADGTLDRYKTRLIA  1006



>ref|XP_009601766.1| PREDICTED: uncharacterized protein LOC104096990 [Nicotiana tomentosiformis]
Length=262

 Score = 53.1 bits (126),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            NQT  +VP  PG  V+  KWV+++K+ +DGSIER+KAR+V
Sbjct  52   NQTWDIVPLPPGKKVIPCKWVYKIKQKSDGSIERYKARIV  91



>ref|XP_010265038.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104602877 
[Nelumbo nucifera]
Length=1284

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  PG   +G KWVF++K +ADG+IE +KARLVA
Sbjct  777  NKTWSLVPLPPGQRPIGCKWVFKIKYHADGTIEHYKARLVA  817



>emb|CAN75730.1| hypothetical protein VITISV_031410 [Vitis vinifera]
Length=1043

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG  +VG +W++ VK  ADGSI+R KARLVA
Sbjct  624  NETWELVECPPGKKLVGCRWIYTVKYKADGSIKRFKARLVA  664



>gb|AEP40947.1| cysteine-rich-receptor-like protein kinase 8 [Posidonia oceanica]
Length=135

 Score = 51.6 bits (122),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  P MN++G+KW +R+K N+DGS+  +K RLVA
Sbjct  74   NETWVLVPRQPHMNILGHKWFYRIKYNSDGSLAHYKVRLVA  114



>emb|CAN63276.1| hypothetical protein VITISV_000400 [Vitis vinifera]
Length=1030

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  643  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARLVA  683



>gb|AAU90288.2| Polyprotein, putative [Solanum demissum]
Length=1017

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP +P  N++G KWVF+ K  +DGS++R+KARLVA
Sbjct  662  NGTWELVPLSPSQNIIGCKWVFKRKLKSDGSLDRYKARLVA  702



>emb|CAN79977.1| hypothetical protein VITISV_029183 [Vitis vinifera]
Length=1572

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLVA
Sbjct  554  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARLVA  594



>emb|CAN72188.1| hypothetical protein VITISV_020673 [Vitis vinifera]
Length=988

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  A+GSIER KARLVA
Sbjct  563  NETWELVECPPGKKPVGCRWIYTVKYKABGSIERFKARLVA  603



>ref|XP_010513698.1| PREDICTED: uncharacterized protein LOC104789749 [Camelina sativa]
Length=1375

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  +    PG NVVG KWVF +K ++DGSIER+KARLVA
Sbjct  741  NNTFSVTSLPPGKNVVGCKWVFTIKYHSDGSIERYKARLVA  781



>emb|CAN64770.1| hypothetical protein VITISV_004450 [Vitis vinifera]
Length=1117

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  A+GSIER KARLVA
Sbjct  643  NETWELVECPPGKKPVGCRWIYTVKYKABGSIERFKARLVA  683



>emb|CAN74499.1| hypothetical protein VITISV_013001 [Vitis vinifera]
Length=993

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  513  NHTWDLVTLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  553



>emb|CAN59936.1| hypothetical protein VITISV_001878 [Vitis vinifera]
Length=1031

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  L    PG   VGYKW++RVK +ADG IER+KARLVA
Sbjct  559  NNTWSLCTLPPGKTTVGYKWLYRVKYHADGFIERYKARLVA  599



>gb|ABA97008.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1202

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++  KWV++VK+ ADGS++R+KARLVA
Sbjct  812  NKTWHLVPSKKGQNIIDCKWVYKVKQKADGSLDRYKARLVA  852



>ref|XP_009366628.1| PREDICTED: uncharacterized protein LOC103956384 [Pyrus x bretschneideri]
Length=304

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP +P  NVVG KW FR+K+  DGSI R KA+LVA
Sbjct  13   TWSLVPSSPSQNVVGCKWAFRIKKKPDGSIGRSKAQLVA  51



>ref|XP_010659200.1| PREDICTED: uncharacterized protein LOC104881290 [Vitis vinifera]
Length=496

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP     N+VG KWVF +KRN DGSI R+KAR VA
Sbjct  304  NRTWVLVPPPSNHNIVGCKWVFHIKRNLDGSISRYKARFVA  344



>ref|XP_010526684.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X6 [Tarenaya hassleriana]
Length=789

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  35   GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            G N VG KWVF+ K NADGSIERHKARLVA
Sbjct  544  GKNAVGCKWVFKTKYNADGSIERHKARLVA  573



>emb|CAN80320.1| hypothetical protein VITISV_034560 [Vitis vinifera]
Length=1261

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  811  NHTWDLVTLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  851



>emb|CAN61929.1| hypothetical protein VITISV_014855 [Vitis vinifera]
Length=1271

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  835  NHTWDLVTLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  875



>gb|ABF99203.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1177

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G+N++  KWV+++KR ADGS++R+K RLVA
Sbjct  850  NETWHLVPPKKGINIIDCKWVYKIKRKADGSLDRYKGRLVA  890



>emb|CAN83332.1| hypothetical protein VITISV_025235 [Vitis vinifera]
Length=801

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARL  118
            N+T +LV C PG   VGY+W++ VK  ADGSIER +ARL
Sbjct  548  NETWELVECPPGKKPVGYRWIYTVKYKADGSIERFRARL  586



>ref|XP_010279665.1| PREDICTED: cysteine-rich repeat secretory protein 38-like [Nelumbo 
nucifera]
Length=328

 Score = 53.5 bits (127),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARL  118
            N T +LVP  P MNVVG KW++++KR  +G IER+KARL
Sbjct  11   NNTWKLVPYNPIMNVVGSKWIYKIKRKLNGLIERYKARL  49



>gb|AAL31076.1|AC091749_5 putaive copia-like retrotransposon polyprotein, 5'-partial [Oryza 
sativa Japonica Group]
Length=491

 Score = 53.9 bits (128),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP     NV+  KWV+++KR ADGS++R+KARLVA
Sbjct  243  NKTWHLVPAKSDRNVIDCKWVYKIKRKADGSLDRYKARLVA  283



>emb|CAN75041.1| hypothetical protein VITISV_027174 [Vitis vinifera]
Length=1381

 Score = 54.7 bits (130),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  901  NHTWDLVTLPPGQSVVGCKWIYKIKTRSDGSVERYKARLVA  941



>ref|XP_008240661.1| PREDICTED: uncharacterized protein LOC103339149 [Prunus mume]
Length=934

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T +LVP  P MN++  KWVF++K+ ADGSIER+KARLVA
Sbjct  604  TWKLVPYHPQMNLLPNKWVFKLKQRADGSIERYKARLVA  642



>ref|XP_010526683.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X5 [Tarenaya hassleriana]
Length=886

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  35   GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            G N VG KWVF+ K NADGSIERHKARLVA
Sbjct  641  GKNAVGCKWVFKTKYNADGSIERHKARLVA  670



>ref|XP_008342226.1| PREDICTED: uncharacterized protein LOC103405031 [Malus domestica]
Length=1076

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP     N+VG KW+F++KR++DGSI RHKARLVA
Sbjct  559  TWSLVPLPANKNLVGCKWIFKLKRHSDGSIARHKARLVA  597



>ref|XP_011016404.1| PREDICTED: uncharacterized protein LOC105119910 [Populus euphratica]
Length=987

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            + T QLVP     N+VG KWVFRVKR+A+GS++R KAR VA
Sbjct  578  HNTWQLVPPPSDCNIVGCKWVFRVKRHANGSVDRFKARFVA  618



>ref|XP_010526682.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X4 [Tarenaya hassleriana]
Length=940

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  35   GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            G N VG KWVF+ K NADGSIERHKARLVA
Sbjct  695  GKNAVGCKWVFKTKYNADGSIERHKARLVA  724



>emb|CAN75777.1| hypothetical protein VITISV_031053 [Vitis vinifera]
Length=742

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  P MNV+  KW+F VK N+DG+I+ +KARLVA
Sbjct  300  NNTWTLVPFHPSMNVIDSKWIFHVKYNSDGTIQLYKARLVA  340



>gb|ABF81417.1| TIR-NBS-LRR type disease resistance protein [Populus trichocarpa]
Length=1867

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  L P  PG   +G +WV+++KR +DG+IER+KARLVA
Sbjct  458  NHTWSLTPLPPGKQPIGCRWVYKIKRRSDGTIERYKARLVA  498



>gb|AAK09230.1|AC084320_17 putative copia-like retrotransposon Hopscotch polyprotein [Oryza 
sativa Japonica Group]
 gb|AAK72882.1|AC091123_1 putative gag-pol protein [Oryza sativa Japonica Group]
Length=1219

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N+T  LVP   G+N++  KWV+++KR ADGS++R+K RLVA
Sbjct  961   NETWHLVPPKKGINIIDCKWVYKIKRKADGSLDRYKGRLVA  1001



>ref|XP_008350549.1| PREDICTED: uncharacterized protein LOC103413885 [Malus domestica]
Length=1668

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5     QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             QT  LVP   G N+VG KWV+R+K+N +GSI R+KARLVA
Sbjct  1170  QTWTLVPLPVGKNLVGCKWVYRLKKNPNGSIARYKARLVA  1209



>ref|XP_008807811.1| PREDICTED: uncharacterized protein LOC103720061 [Phoenix dactylifera]
Length=479

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            NQT  LVP  P MNVVG +WVF+ K   DGS++R KARLV
Sbjct  334  NQTWTLVPRDPSMNVVGSRWVFKTKLITDGSLQRLKARLV  373



>ref|XP_010541762.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 [Tarenaya hassleriana]
Length=813

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP     NVVG KWVFR KR +DGSI+R+KARLVA
Sbjct  11   NDTWSLVPPDFASNVVGCKWVFRTKRLSDGSIDRYKARLVA  51



>gb|ABG00000.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=2074

 Score = 54.7 bits (130),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N+T  L+P + G NV+  KWV+++KR +DGS++R+KARLVA
Sbjct  1712  NKTWHLIPPSHGKNVIDCKWVYKIKRKSDGSLDRYKARLVA  1752



>ref|XP_010526681.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X3 [Tarenaya hassleriana]
Length=1238

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  35    GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             G N VG KWVF+ K NADGSIERHKARLVA
Sbjct  1030  GKNAVGCKWVFKTKYNADGSIERHKARLVA  1059



>ref|XP_010526680.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X2 [Tarenaya hassleriana]
Length=1244

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  35    GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             G N VG KWVF+ K NADGSIERHKARLVA
Sbjct  999   GKNAVGCKWVFKTKYNADGSIERHKARLVA  1028



>ref|XP_010526678.1| PREDICTED: retrovirus-related Pol polyprotein from transposon 
TNT 1-94 isoform X1 [Tarenaya hassleriana]
Length=1275

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  35    GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             G N VG KWVF+ K NADGSIERHKARLVA
Sbjct  1030  GKNAVGCKWVFKTKYNADGSIERHKARLVA  1059



>emb|CAH66819.1| OSIGBa0093K19.6 [Oryza sativa Indica Group]
Length=472

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  LVP   G N++  KWV++VKR A GS++R+KARLVA
Sbjct  152  NQTWHLVPLQQGRNIIDCKWVYKVKRKAYGSLDRYKARLVA  192



>emb|CAE04381.1| OSJNBa0027G07.23 [Oryza sativa Japonica Group]
 emb|CAE02562.2| OSJNBa0006M15.5 [Oryza sativa Japonica Group]
Length=472

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  LVP   G N++  KWV++VKR A GS++R+KARLVA
Sbjct  152  NQTWHLVPLQQGRNIIDCKWVYKVKRKAYGSLDRYKARLVA  192



>ref|XP_010058883.1| PREDICTED: uncharacterized protein LOC104446775 [Eucalyptus grandis]
Length=766

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT ++VP  P    +G KWV++ K  ADGS+ER+KARLVA
Sbjct  210  NQTWEIVPLPPHRKAIGCKWVYKTKYRADGSVERYKARLVA  250



>dbj|BAB08717.1| unnamed protein product [Arabidopsis thaliana]
Length=813

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  35   GMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            G NVVGYKWVF +K N DG+IER+KARLVA
Sbjct  471  GKNVVGYKWVFTIKYNPDGTIERYKARLVA  500



>ref|XP_010501996.1| PREDICTED: uncharacterized protein LOC104779340 [Camelina sativa]
Length=862

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP T  M+V+G KWVFRVK NADGS+++ KARLVA
Sbjct  569  TFSLVPHTRDMHVLGSKWVFRVKLNADGSLDKFKARLVA  607



>gb|ABA95721.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=900

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G N++  KWV+++K+ ADG+I+R+KARLVA
Sbjct  410  NKTWHLVPPVKGKNIIDSKWVYKIKKKADGTIDRYKARLVA  450



>emb|CAN60445.1| hypothetical protein VITISV_032468 [Vitis vinifera]
Length=1121

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIER KAR+VA
Sbjct  687  NETWELVECPPGKKPVGCRWIYTVKYKADGSIERFKARMVA  727



>ref|XP_008223145.1| PREDICTED: uncharacterized protein LOC103322965 [Prunus mume]
Length=1031

 Score = 54.3 bits (129),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  PG   +G KW+FR+K ++DG+++R+KARLVA
Sbjct  730  NHTWSLVPLPPGHRPIGCKWIFRIKYHSDGTVDRYKARLVA  770



>ref|XP_008372631.1| PREDICTED: uncharacterized protein LOC103435981 [Malus domestica]
Length=989

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP +   NVVG KWVFR+K+  DG+IER KARLVA
Sbjct  637  LVPPSSSYNVVGCKWVFRIKKKPDGTIERFKARLVA  672



>ref|XP_007046012.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
 gb|EOY01844.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8, putative 
[Theobroma cacao]
Length=374

 Score = 53.1 bits (126),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  +VP  P  +VVG KWV++VK NA+G++ER KARLVA
Sbjct  60   NGTWSIVPLPPNCHVVGCKWVYKVKLNANGNVERSKARLVA  100



>gb|ABA94354.1| retrotransposon protein, putative, unclassified [Oryza sativa 
Japonica Group]
Length=882

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G  +V YKWV+ VK+N DG +ER+KARLVA
Sbjct  568  NKTWDLVPFPKGKKIVNYKWVYTVKQNPDGKVERYKARLVA  608



>ref|XP_009338880.1| PREDICTED: uncharacterized protein LOC103931184 [Pyrus x bretschneideri]
Length=1143

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT  +VP   G   +G KWVF++K ++DG+IER+KARLVA
Sbjct  660  NQTWSMVPLLAGHRAIGCKWVFKIKYHSDGTIERYKARLVA  700



>ref|XP_010273170.1| PREDICTED: uncharacterized protein LOC104608783 [Nelumbo nucifera]
Length=602

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP    MN+VG KWVFR+K N +GSI R+KARLVA
Sbjct  398  NDTWVLVPRQSYMNLVGCKWVFRLKHNPNGSISRYKARLVA  438



>emb|CAN69647.1| hypothetical protein VITISV_022133 [Vitis vinifera]
Length=2655

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T  LV   PG +VVG KW++++K  +DGS+ER+KARLVA
Sbjct  2192  NHTWDLVTLPPGHSVVGCKWIYKIKTRSDGSVERYKARLVA  2232



>gb|KFK29521.1| hypothetical protein AALP_AA7G145400 [Arabis alpina]
Length=506

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N T  +V   PG  V+G KWV+++K NADG IERHKARLV
Sbjct  76   NYTWDIVSLPPGKVVIGSKWVYKIKYNADGKIERHKARLV  115



>emb|CAN77807.1| hypothetical protein VITISV_036095 [Vitis vinifera]
Length=1025

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C+PG   +G +W++ +K  ADGSIER +ARLVA
Sbjct  554  NETWELVKCSPGKKPIGCRWIYTMKNKADGSIERFQARLVA  594



>gb|AAK55460.1|AC069300_15 putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|AAP54977.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1031

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T   VP   G N++  KWV++VKR ADGS++R+KARLVA
Sbjct  550  NKTWHRVPSKKGQNIIDCKWVYKVKRKADGSLDRYKARLVA  590



>emb|CDO78104.1| hypothetical protein BN946_scf184683.g1 [Trametes cinnabarina]
Length=380

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            NQT +LV    G   +G  WVFRVKRNADGSIER+K  L+
Sbjct  293  NQTFELVQLPLGRKAIGSSWVFRVKRNADGSIERYKGHLI  332



>gb|AAN04167.1| Putative copia-like retrotransposon polyprotein [Oryza sativa 
Japonica Group]
 gb|AAP53032.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1042

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP     NV+  KWV+++KR ADGS++R+KARLVA
Sbjct  794  NKTWHLVPAKSDRNVIDCKWVYKIKRKADGSLDRYKARLVA  834



>ref|XP_002388175.1| hypothetical protein MPER_12841 [Moniliophthora perniciosa FA553]
 gb|EEB89105.1| hypothetical protein MPER_12841 [Moniliophthora perniciosa FA553]
Length=606

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   PG   +G KWV+R+K  ADGSIER KARLVA
Sbjct  133  NGTWNLVELPPGQKAIGSKWVYRIKHKADGSIERFKARLVA  173



>emb|CAN61420.1| hypothetical protein VITISV_023544 [Vitis vinifera]
Length=1289

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  P  N+VG KWVF+ K   DG+I+R+KARLVA
Sbjct  323  NRTWDLVPRPPTTNIVGSKWVFKTKLKEDGTIDRYKARLVA  363



>emb|CDO77867.1| hypothetical protein BN946_scf184612.g4 [Trametes cinnabarina]
Length=380

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            NQT +LV    G   +G  WVFRVKRNADGSIER+K  L+
Sbjct  293  NQTFELVQLPLGRKAIGSSWVFRVKRNADGSIERYKGHLI  332



>ref|XP_008386299.1| PREDICTED: uncharacterized protein LOC103448812 [Malus domestica]
Length=1255

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             T  LV   P  N+VG KWVF++K+N+DG++ RHKARLVA
Sbjct  791  HTWSLVHLPPNKNLVGCKWVFKLKKNSDGTVARHKARLVA  830



>ref|XP_008340360.1| PREDICTED: uncharacterized protein LOC103403325 [Malus domestica]
Length=925

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 25/39 (64%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP     N+VG KWVF++K+NADGSI R+KARLVA
Sbjct  762  TWSLVPLPKHKNLVGCKWVFKIKKNADGSIGRYKARLVA  800



>emb|CAN74381.1| hypothetical protein VITISV_007944 [Vitis vinifera]
Length=1884

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  P  N+VG KWVF+ K   DG+I+R+KARLVA
Sbjct  947  NRTWDLVPRPPTTNIVGSKWVFKTKLKEDGTIDRYKARLVA  987



>ref|XP_008382206.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103445014, 
partial [Malus domestica]
Length=866

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  L P  PG   +  +WV+++K NADGSIER+KARLVA
Sbjct  516  NNTWTLTPLPPGKRPIDCRWVYKIKHNADGSIERYKARLVA  556



>gb|AAK02020.2|AC074283_1 Putative gag-pol polyprotein [Oryza sativa]
 gb|AAP52036.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1058

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G+N++  KWV++VKR AD SI+R+KARLVA
Sbjct  600  NKTWHLVPPQKGVNIIDCKWVYKVKRKADESIDRYKARLVA  640



>gb|AAN06870.1| Putative gag-pol polyprotein [Oryza sativa Japonica Group]
 gb|ABF94109.1| retrotransposon protein, putative, Ty1-copia subclass [Oryza 
sativa Japonica Group]
Length=1247

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP   G NV+  KWV+++KR  DGS++R+KARLVA
Sbjct  765  NKTWHLVPPQKGRNVIDCKWVYKIKRKQDGSLDRYKARLVA  805



>gb|AAF69172.1|AC007915_24 F27F5.11 [Arabidopsis thaliana]
Length=1313

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            +T  LVP TP M V+G KW+FR K NADGS+++ KARLV
Sbjct  833  ETWSLVPYTPDMLVLGSKWIFRTKLNADGSLQKLKARLV  871



>ref|XP_008356535.1| PREDICTED: uncharacterized protein LOC103420252 [Malus domestica]
Length=1312

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  L P T   N+VG KWVFRVK++ DG+I+R+KARLVA
Sbjct  821  TWSLXPFTSQQNIVGCKWVFRVKKHPDGTIDRYKARLVA  859



>ref|XP_010419640.1| PREDICTED: uncharacterized protein LOC104705350 [Camelina sativa]
Length=277

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/39 (62%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  L P    MNV+G  WVFR+KRNADGS+++ KARLVA
Sbjct  46   TWSLTPLASYMNVLGSNWVFRMKRNADGSLQKLKARLVA  84



>emb|CAN65502.1| hypothetical protein VITISV_014793 [Vitis vinifera]
Length=962

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK   DGSIER KARLVA
Sbjct  575  NETWELVECPPGKKPVGCRWIYTVKYKVDGSIERFKARLVA  615



>ref|XP_010525654.1| PREDICTED: uncharacterized protein LOC104803422 [Tarenaya hassleriana]
Length=580

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP T   NVVG +WVFR+K   DGS++R K RLVA
Sbjct  177  NGTWTLVPATDAANVVGCRWVFRIKHKPDGSVDRFKVRLVA  217



>emb|CAN71173.1| hypothetical protein VITISV_037664 [Vitis vinifera]
Length=809

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            + T QLVP     N+VG KWVF++KR+ADGS++R K RLVA
Sbjct  375  HNTWQLVPLPNDCNIVGCKWVFQIKRHADGSVDRFKIRLVA  415



>emb|CAN61827.1| hypothetical protein VITISV_027629 [Vitis vinifera]
Length=638

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP     NVVG +W+F+ K ++DGSIERHKARLVA
Sbjct  197  NDTWVLVPRPXHHNVVGCRWIFKTKLHSDGSIERHKARLVA  237



>ref|XP_010064294.1| PREDICTED: uncharacterized protein LOC104451296 [Eucalyptus grandis]
Length=378

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LVP T  MN++G KWVF+ K   DGS++R KARLVA
Sbjct  254  NKTWELVPRTDQMNIIGCKWVFKTKLAPDGSLDRPKARLVA  294



>emb|CAN77798.1| hypothetical protein VITISV_040894 [Vitis vinifera]
Length=509

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP  P  N+VG KWVF+ K   DG+I+R+KARLVA
Sbjct  469  NRTWDLVPRPPTANIVGSKWVFKTKLQEDGTIDRYKARLVA  509



>emb|CAN61322.1| hypothetical protein VITISV_012106 [Vitis vinifera]
Length=1432

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   P +NV+G KWV+++K   DGSIER+KARLVA
Sbjct  914  NHTWDLVEQPPNVNVIGCKWVYKLKHKPDGSIERYKARLVA  954



>gb|AAF02855.1|AC009324_4 Similar to retrotransposon proteins [Arabidopsis thaliana]
Length=1522

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            +T  LVP +P MNV+G  WVFR K +ADGS+++ KARLVA
Sbjct  943  ETWTLVPYSPNMNVLGSMWVFRTKLHADGSLDKLKARLVA  982



>ref|XP_010644735.1| PREDICTED: uncharacterized protein LOC104877663 [Vitis vinifera]
Length=346

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LVP T   N+VG KWVFR+KR  DGSI ++K+RLV+
Sbjct  41   NGTWKLVPSTSMQNLVGCKWVFRIKRLPDGSINKYKSRLVS  81



>emb|CAN78434.1| hypothetical protein VITISV_003804 [Vitis vinifera]
Length=973

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ +K  ADGSIER KARLVA
Sbjct  532  NETWELVECPPGKKPVGCRWIYTMKYKADGSIERFKARLVA  572



>gb|AAU43956.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAU44069.1| putative polyprotein [Oryza sativa Japonica Group]
Length=1447

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N+T  LVP   G NV+  KWV+++KR  DGS++R+KARLVA
Sbjct  965   NKTWHLVPPKQGRNVIDCKWVYKIKRKQDGSLDRYKARLVA  1005



>ref|XP_008385226.1| PREDICTED: uncharacterized protein LOC103447800 [Malus domestica]
Length=1042

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  8    T*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            T  LVP     N+VG KWVFRVK+  DG+++R+KARLVA
Sbjct  746  TWSLVPSNSSQNIVGCKWVFRVKQKPDGTVDRYKARLVA  784



>emb|CAN71759.1| hypothetical protein VITISV_020777 [Vitis vinifera]
Length=1472

 Score = 53.5 bits (127),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV      NV+G KWVFR K  ADGSI++HKARLVA
Sbjct  774  NETWELVELPEDKNVIGVKWVFRTKYLADGSIQKHKARLVA  814



>emb|CAN69753.1| hypothetical protein VITISV_024937 [Vitis vinifera]
Length=793

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LV   P +NV+G KWV+++K   DGSIER+KARLVA
Sbjct  510  NHTWDLVEQPPDVNVIGCKWVYKLKHKPDGSIERYKARLVA  550



>ref|XP_008341155.1| PREDICTED: uncharacterized protein LOC103404078 [Malus domestica]
Length=986

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP    +N+VG KWVFR+K   DGSIER+KARLVA
Sbjct  199  LVPFQSHLNLVGCKWVFRLKHKPDGSIERYKARLVA  234



>gb|AAC95173.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1200

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LV    G+  +G KWVF++KRN+DG+I +HKARLVA
Sbjct  811  NRTWSLVSLPVGIKPIGLKWVFKIKRNSDGNITKHKARLVA  851



>emb|CAB40067.1| putative retrotransposon polyprotein [Arabidopsis thaliana]
 emb|CAB81200.1| putative retrotransposon polyprotein [Arabidopsis thaliana]
Length=1203

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  +   T G NVVG KWVF +K N DGSIER+KARLVA
Sbjct  551  NKTWIVESLTEGKNVVGCKWVFTIKYNPDGSIERYKARLVA  591



>ref|XP_006485859.1| PREDICTED: uncharacterized protein LOC102626627 [Citrus sinensis]
Length=1081

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LV   PG   VG +W++ +K  ADGSIER+KARLVA
Sbjct  637  NQTWELVDLPPGKKPVGCRWIYTIKYKADGSIERYKARLVA  677



>emb|CAN61340.1| hypothetical protein VITISV_007301 [Vitis vinifera]
Length=973

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT +LVP    +  +  KWV+++KR  DGSIERHKARLVA
Sbjct  501  NQTWELVPKPRDVEPISCKWVYKIKRRTDGSIERHKARLVA  541



>emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera]
Length=1361

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP     NVVG +W+F+ K ++DGSIERHKARLVA
Sbjct  866  NDTWVLVPRPQHHNVVGCRWIFKTKLHSDGSIERHKARLVA  906



>emb|CAN67566.1| hypothetical protein VITISV_020485 [Vitis vinifera]
Length=411

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N T  LVP  P  ++VGY+W++++K   +GS+ERHKARLV
Sbjct  311  NYTWSLVPLPPSAHIVGYRWIYKLKDRPNGSVERHKARLV  350



>emb|CAN77664.1| hypothetical protein VITISV_007221 [Vitis vinifera]
Length=958

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  +VPC P +  +G KWVF +K  +DGS++R+KARLVA
Sbjct  647  NHTWDIVPCPPIVKPIGSKWVFSIKLRSDGSLDRYKARLVA  687



>ref|XP_010430787.1| PREDICTED: uncharacterized protein LOC104715028 [Camelina sativa]
Length=1121

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            +T  +VP  P MN++G KWVFR+K NADGS+++ KA LVA
Sbjct  123  RTWHMVPPLPTMNILGCKWVFRIKLNADGSLDKFKAILVA  162



>emb|CAN60238.1| hypothetical protein VITISV_032906 [Vitis vinifera]
Length=1430

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV      NV+G KWVFR K  ADGSI++HKARLVA
Sbjct  945  NETWELVELPEDKNVIGVKWVFRTKYLADGSIQKHKARLVA  985



>ref|XP_010051209.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104439906 
[Eucalyptus grandis]
Length=2021

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             NQT  L+P T  MNV+G KWVF+ K  +DGS++R KARLVA
Sbjct  994   NQTWILIPRTTDMNVIGCKWVFKTKLASDGSLDRLKARLVA  1034



>ref|XP_008355505.1| PREDICTED: probable E3 ubiquitin-protein ligase BAH1-like 1 [Malus 
domestica]
Length=359

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            QT  LVP  P  N+VG KWV+RVK N D S+ R+KARL+
Sbjct  12   QTWSLVPLPPDKNLVGCKWVYRVKTNVDASMSRYKARLI  50



>ref|XP_004163499.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101229082 
[Cucumis sativus]
Length=802

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  +VP   G N VG +W++ +K+ ADG++ER+KARLVA
Sbjct  11   NHTWSIVPVPTGKNTVGCRWIYNIKQKADGTVERYKARLVA  51



>emb|CAN67963.1| hypothetical protein VITISV_027812 [Vitis vinifera]
Length=396

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  LVP  P  NVVG KWVF++K + DG++ +HKAR VA
Sbjct  145  NHTWDLVPYQPQYNVVGNKWVFKLKFHPDGTLNKHKARFVA  185



>ref|XP_008362654.1| PREDICTED: phosphatidylinositol 4-kinase gamma 2-like [Malus 
domestica]
Length=295

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            LVP    MNV+  KWV+R+K+N+DGSIER KARLV
Sbjct  16   LVPYKSYMNVLPNKWVYRIKKNSDGSIERFKARLV  50



>ref|XP_008389560.1| PREDICTED: uncharacterized protein LOC103451895 [Malus domestica]
Length=1300

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  5    QT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             T  LV   P  N+VG KWVF++K+N+DG++ RHKARLVA
Sbjct  808  HTWSLVHLPPHKNLVGCKWVFKLKKNSDGTVARHKARLVA  847



>gb|AAC33963.1| contains similarity to reverse transcriptases (Pfam; rvt.hmm, 
score: 11.19) [Arabidopsis thaliana]
Length=1633

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N+T  +   T G NVVG KWVF +K N DGSIER+KARLVA
Sbjct  965   NKTWIVESLTEGKNVVGCKWVFTIKYNPDGSIERYKARLVA  1005



>emb|CAN60930.1| hypothetical protein VITISV_012765 [Vitis vinifera]
Length=1201

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADG IER KARLVA
Sbjct  715  NETWELVECPPGKKPVGCRWIYTVKYKADGXIERFKARLVA  755



>emb|CAN67986.1| hypothetical protein VITISV_010770 [Vitis vinifera]
Length=674

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +L P T   N+VG KW+FR+KRN DGSI ++KA LVA
Sbjct  11   NGTWELNPSTKSQNLVGCKWIFRIKRNLDGSIAQYKAPLVA  51



>emb|CAN68148.1| hypothetical protein VITISV_035665 [Vitis vinifera]
Length=1813

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  2     NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             N T ++VP  PG   +G +WV+++K ++DG+IER+KARLVA
Sbjct  1246  NNTWEMVPLPPGHKPIGCRWVYKIKYHSDGTIERYKARLVA  1286



>emb|CAN79733.1| hypothetical protein VITISV_016615 [Vitis vinifera]
Length=807

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T +LV  T   N+VG KWVF +KRN+DGSIER KARLVA
Sbjct  414  NGTWELVSPTGITNLVGCKWVFCIKRNSDGSIERFKARLVA  454



>emb|CAN64822.1| hypothetical protein VITISV_025364 [Vitis vinifera]
Length=756

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK   DGSIER KARLVA
Sbjct  338  NETWELVECPPGKKPVGCRWIYTVKYKXDGSIERFKARLVA  378



>ref|XP_008344799.1| PREDICTED: uncharacterized protein LOC103407689 [Malus domestica]
Length=1107

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  17    LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
             LVP  P   +VG KWV++VK+N DG+I R+KARLVA
Sbjct  1068  LVPLPPDXAIVGSKWVYKVKKNXDGTISRYKARLVA  1103



>emb|CAN63182.1| hypothetical protein VITISV_029266 [Vitis vinifera]
Length=405

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV        +G KWVF+VK  ADG+IERHKARLVA
Sbjct  11   NKTWELVTLPKNKKTIGCKWVFKVKYKADGTIERHKARLVA  51



>emb|CAN83721.1| hypothetical protein VITISV_003961 [Vitis vinifera]
Length=1101

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N+T +LV C PG   VG +W++ VK  ADGSIER KARLV
Sbjct  615  NETWELVECPPGKKPVGCRWIYIVKYKADGSIERFKARLV  654



>emb|CAN82201.1| hypothetical protein VITISV_011128 [Vitis vinifera]
Length=637

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV CT G   VG +W++ VK  ADGSIER KARLVA
Sbjct  345  NETWELVECTLGKKPVGCRWIYTVKYKADGSIERFKARLVA  385



>emb|CAN67762.1| hypothetical protein VITISV_040650 [Vitis vinifera]
Length=1316

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            NQT ++V   P    +G KW++++K NADGSIER+KARLVA
Sbjct  833  NQTWKVVDLPPEKKAIGCKWIYKIKYNADGSIERYKARLVA  873



>emb|CAN60366.1| hypothetical protein VITISV_031870 [Vitis vinifera]
Length=1274

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV      NV+G KWVFR K  ADGSI++HKARLVA
Sbjct  834  NETWELVELPEDKNVIGVKWVFRTKYLADGSIQKHKARLVA  874



>ref|XP_007043089.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
 gb|EOX98920.1| Cysteine-rich RLK (RECEPTOR-like protein kinase) 8 [Theobroma 
cacao]
Length=700

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            ++T +LVP     NVVG KWV+RVK + DGS+ R+KARLVA
Sbjct  268  HKTWELVPRMSNQNVVGCKWVYRVKHHPDGSVARYKARLVA  308



>emb|CAN72554.1| hypothetical protein VITISV_015792 [Vitis vinifera]
Length=668

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LVP     N+VG KWVFR+KRN DGSI R+KA L A
Sbjct  354  NRTWVLVPPPSNHNIVGCKWVFRIKRNLDGSISRYKACLAA  394



>emb|CAN69281.1| hypothetical protein VITISV_023276 [Vitis vinifera]
Length=460

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T  LV C    N+VG KWVFR K   DGSIER KARLVA
Sbjct  83   NRTWILVSCPTNTNIVGSKWVFRTKYLPDGSIERLKARLVA  123



>emb|CAD40155.1| OSJNBb0069N01.8 [Oryza sativa Japonica Group]
Length=279

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLV  121
            N+T +L PC PG NVV  KW+FR K   DGS++R KAR +
Sbjct  11   NRTWELTPCPPGTNVVTGKWIFRHKIQVDGSLDRCKARCI  50



>gb|EMS48645.1| Glutamate-rich WD repeat-containing protein 1 [Triticum urartu]
Length=600

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N T  L+P  PG +++  KWVF VKR +DG+IER+KARL A
Sbjct  106  NNTWHLIPSHPGKSMIDCKWVFGVKRRSDGTIERYKARLFA  146



>gb|AFP55537.1| retrotransposon polyprotein [Rosa rugosa]
Length=1384

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  17   LVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            LVP +  MN++  KWVFR+K+ +DGS+ER+KARLVA
Sbjct  905  LVPPSSLMNILPNKWVFRIKKRSDGSVERYKARLVA  940



>emb|CAN60152.1| hypothetical protein VITISV_021503 [Vitis vinifera]
Length=890

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T ++V    G N+V  KW+F +K NADGS+ERHKARLVA
Sbjct  442  NKTWEIVERPKGKNIVDCKWIFTLKYNADGSLERHKARLVA  482



>emb|CAN62921.1| hypothetical protein VITISV_032126 [Vitis vinifera]
Length=1085

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  2    NQT*QLVPCTPGMNVVGYKWVFRVKRNADGSIERHKARLVA  124
            N+T +LV C PG   VG +W++ VK  ADGSIE+ KARLVA
Sbjct  642  NETWELVECPPGKKPVGCRWIYTVKYKADGSIEQFKARLVA  682



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084