BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7071_g1_i2 len=563 path=[1:0-14 16:15-562]

Length=563
                                                                      Score     E

ref|XP_010462845.1|  PREDICTED: uncharacterized protein LOC104743463  60.5    1e-07   
ref|XP_010414407.1|  PREDICTED: uncharacterized protein LOC104700...  58.9    3e-07   
ref|XP_010414406.1|  PREDICTED: uncharacterized protein LOC104700...  58.5    5e-07   
ref|XP_010490457.1|  PREDICTED: uncharacterized protein LOC104768231  57.4    1e-06   
ref|XP_010461582.1|  PREDICTED: uncharacterized protein LOC104742...  54.7    1e-06   
ref|XP_010480765.1|  PREDICTED: uncharacterized protein LOC104759556  57.4    1e-06   
emb|CAN74819.1|  hypothetical protein VITISV_034590                   57.4    1e-06   Vitis vinifera
ref|XP_010461580.1|  PREDICTED: uncharacterized protein LOC104742...  54.3    2e-06   
gb|AAD15368.1|  putative retroelement pol polyprotein                 56.2    2e-06   Arabidopsis thaliana [mouse-ear cress]
emb|CAB10526.1|  retrotransposon like protein                         57.0    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAF69161.1|AC007915_13  F27F5.19                                   56.6    2e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79879.1|AC000348_32  T7N9.5                                     56.6    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010520621.1|  PREDICTED: uncharacterized protein LOC104799678  55.8    3e-06   
ref|XP_010480766.1|  PREDICTED: uncharacterized protein LOC104759557  56.2    3e-06   
ref|XP_006575837.1|  PREDICTED: uncharacterized protein LOC102664271  55.5    4e-06   
ref|XP_006575821.1|  PREDICTED: uncharacterized protein LOC102670485  55.5    6e-06   
ref|XP_010520325.1|  PREDICTED: uncharacterized protein LOC104799478  54.7    7e-06   
ref|XP_010525445.1|  PREDICTED: uncharacterized protein LOC104803...  54.7    9e-06   
ref|XP_009142130.1|  PREDICTED: uncharacterized protein LOC103866013  55.1    9e-06   
ref|XP_004170089.1|  PREDICTED: uncharacterized protein LOC101223363  54.3    1e-05   
ref|XP_004147195.1|  PREDICTED: uncharacterized protein LOC101216505  54.7    1e-05   
ref|XP_010552464.1|  PREDICTED: uncharacterized protein LOC104822813  53.9    1e-05   
emb|CAN65182.1|  hypothetical protein VITISV_029570                   54.3    2e-05   Vitis vinifera
ref|XP_010496117.1|  PREDICTED: uncharacterized protein LOC104773234  53.9    2e-05   
gb|KHN08377.1|  Succinate-semialdehyde dehydrogenase, mitochondrial   53.5    2e-05   
ref|XP_010471196.1|  PREDICTED: uncharacterized protein LOC104751022  53.9    2e-05   
ref|XP_010665851.1|  PREDICTED: uncharacterized protein LOC104883096  53.5    2e-05   
ref|XP_004149623.1|  PREDICTED: uncharacterized protein LOC101211618  53.9    2e-05   
ref|XP_006301596.1|  hypothetical protein CARUB_v10022035mg           50.8    3e-05   
ref|XP_010519642.1|  PREDICTED: uncharacterized protein LOC104799038  51.6    3e-05   
ref|XP_006579313.1|  PREDICTED: uncharacterized protein LOC102665903  52.8    3e-05   
ref|XP_008775575.1|  PREDICTED: hydroquinone glucosyltransferase-...  52.8    4e-05   
ref|XP_004153578.1|  PREDICTED: uncharacterized protein LOC101215164  52.8    4e-05   
ref|XP_010662801.1|  PREDICTED: uncharacterized protein LOC104882222  52.8    4e-05   
ref|XP_004141415.1|  PREDICTED: uncharacterized protein LOC101212632  52.8    4e-05   
ref|XP_009144636.1|  PREDICTED: uncharacterized protein LOC103868285  52.4    5e-05   
ref|XP_010696214.1|  PREDICTED: uncharacterized protein LOC104908764  52.8    5e-05   
ref|XP_010507241.1|  PREDICTED: uncharacterized protein LOC104783837  52.0    5e-05   
ref|XP_008779879.1|  PREDICTED: uncharacterized protein LOC103699645  52.4    5e-05   
ref|XP_010424680.1|  PREDICTED: uncharacterized protein LOC104709822  52.4    6e-05   
gb|KFK31542.1|  hypothetical protein AALP_AA6G125900                  52.4    6e-05   
ref|XP_004161031.1|  PREDICTED: uncharacterized protein LOC101230271  52.4    6e-05   
ref|XP_010525446.1|  PREDICTED: uncharacterized protein LOC104803...  52.0    6e-05   
ref|XP_006603194.1|  PREDICTED: uncharacterized protein LOC102665260  52.4    6e-05   
gb|KHN34461.1|  hypothetical protein glysoja_037939                   52.0    6e-05   
ref|XP_010495376.1|  PREDICTED: uncharacterized protein LOC104772464  52.4    7e-05   
ref|XP_010430794.1|  PREDICTED: uncharacterized protein LOC104715037  52.4    7e-05   
ref|XP_010678775.1|  PREDICTED: uncharacterized protein LOC104894279  52.0    8e-05   
ref|XP_010542100.1|  PREDICTED: uncharacterized protein LOC104815417  52.0    8e-05   
gb|AER13167.1|  putative retrovirus-like polyprotein                  52.0    8e-05   
ref|XP_010542101.1|  PREDICTED: uncharacterized protein LOC104815418  51.6    8e-05   
ref|XP_010462670.1|  PREDICTED: uncharacterized protein LOC104743263  52.0    9e-05   
ref|XP_006606864.1|  PREDICTED: uncharacterized protein LOC102669025  51.6    9e-05   
ref|XP_010664930.1|  PREDICTED: uncharacterized protein LOC100853407  51.6    9e-05   
emb|CAN65540.1|  hypothetical protein VITISV_029946                   51.6    1e-04   Vitis vinifera
ref|XP_010556441.1|  PREDICTED: uncharacterized protein LOC104825...  51.2    1e-04   
ref|XP_010518645.1|  PREDICTED: uncharacterized protein LOC104793922  51.6    1e-04   
ref|XP_008797608.1|  PREDICTED: uncharacterized protein LOC103712765  51.2    1e-04   
emb|CAN64225.1|  hypothetical protein VITISV_016222                   51.6    1e-04   Vitis vinifera
ref|XP_006576049.1|  PREDICTED: uncharacterized protein LOC102660724  51.2    1e-04   
ref|XP_010489520.1|  PREDICTED: uncharacterized protein LOC104767178  51.2    1e-04   
ref|XP_009107622.1|  PREDICTED: uncharacterized protein LOC103833282  51.2    1e-04   
ref|XP_010535249.1|  PREDICTED: uncharacterized protein LOC104810602  51.2    1e-04   
ref|XP_010556407.1|  PREDICTED: uncharacterized protein LOC104825734  51.2    1e-04   
ref|XP_010544634.1|  PREDICTED: uncharacterized protein LOC104817234  50.8    2e-04   
gb|KHN37653.1|  hypothetical protein glysoja_007356                   50.8    2e-04   
ref|XP_006596754.1|  PREDICTED: uncharacterized protein LOC102663057  50.8    2e-04   
emb|CAN59936.1|  hypothetical protein VITISV_001878                   51.2    2e-04   Vitis vinifera
ref|XP_010513189.1|  PREDICTED: uncharacterized protein LOC104789148  51.2    2e-04   
ref|XP_009103821.1|  PREDICTED: uncharacterized protein LOC103829886  50.8    2e-04   
emb|CAN61743.1|  hypothetical protein VITISV_038639                   50.8    2e-04   Vitis vinifera
gb|KHN35391.1|  hypothetical protein glysoja_029021                   50.1    2e-04   
ref|XP_006293416.1|  hypothetical protein CARUB_v10025083mg           49.3    2e-04   
ref|XP_006575768.1|  PREDICTED: uncharacterized protein LOC102663845  50.4    2e-04   
emb|CAB10225.1|  retrovirus-related like polyprotein                  50.8    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010539135.1|  PREDICTED: uncharacterized protein LOC104813264  50.4    2e-04   
ref|XP_008219719.1|  PREDICTED: uncharacterized protein LOC103319904  50.1    2e-04   
ref|XP_009117178.1|  PREDICTED: uncharacterized protein LOC103842315  50.4    2e-04   
ref|XP_006598406.1|  PREDICTED: uncharacterized protein LOC100778389  50.1    3e-04   
gb|AAD25646.1|  putative retroelement pol polyprotein                 50.4    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010419217.1|  PREDICTED: uncharacterized protein LOC104704907  50.1    3e-04   
ref|XP_006596243.1|  PREDICTED: uncharacterized protein LOC102667110  49.3    3e-04   
ref|XP_010525521.1|  PREDICTED: uncharacterized protein LOC104803299  50.1    3e-04   
ref|XP_010419216.1|  PREDICTED: uncharacterized protein LOC104704906  50.1    3e-04   
gb|AAC62795.1|  contains similarity to retroviral aspartyl protea...  50.1    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010513698.1|  PREDICTED: uncharacterized protein LOC104789749  50.1    4e-04   
ref|XP_006595224.1|  PREDICTED: uncharacterized protein LOC102660371  49.7    4e-04   
ref|XP_006580020.1|  PREDICTED: uncharacterized protein LOC100820...  49.3    5e-04   
ref|XP_003524766.2|  PREDICTED: uncharacterized protein LOC100820...  49.3    5e-04   
gb|KHN16144.1|  hypothetical protein glysoja_012120                   49.3    5e-04   
ref|XP_010655082.1|  PREDICTED: uncharacterized protein LOC104880371  48.9    6e-04   
ref|XP_009108242.1|  PREDICTED: uncharacterized protein LOC103833949  49.3    6e-04   
ref|XP_003597218.1|  Beta-galactosidase                               49.7    6e-04   
gb|KHN43622.1|  hypothetical protein glysoja_045377                   49.3    6e-04   
ref|XP_006603149.1|  PREDICTED: uncharacterized protein LOC102663081  48.9    7e-04   
ref|XP_010412414.1|  PREDICTED: uncharacterized protein LOC104698703  48.9    7e-04   
ref|XP_006582455.1|  PREDICTED: uncharacterized protein LOC102662632  48.9    7e-04   
ref|XP_010542220.1|  PREDICTED: uncharacterized protein LOC104815...  48.9    8e-04   
dbj|BAF00783.1|  hypothetical protein                                 48.9    8e-04   Arabidopsis thaliana [mouse-ear cress]
gb|KHN13718.1|  hypothetical protein glysoja_047572                   48.1    8e-04   
gb|KHN35823.1|  hypothetical protein glysoja_013248                   48.9    8e-04   
ref|XP_010527535.1|  PREDICTED: uncharacterized protein LOC104804870  47.8    8e-04   
ref|XP_006588116.1|  PREDICTED: uncharacterized protein LOC102665476  48.5    0.001   
emb|CAN80285.1|  hypothetical protein VITISV_026753                   48.9    0.001   Vitis vinifera



>ref|XP_010462845.1| PREDICTED: uncharacterized protein LOC104743463 [Camelina sativa]
Length=462

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 34/62 (55%), Gaps = 8/62 (13%)
 Frame = -1

Query  395  AAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*  216
            AA+ N  R RS            CTHCGM+GH V KC+K HGY PG IPGY S  +  Q 
Sbjct  248  AAVQNNFRPRS--------SRPLCTHCGMTGHVVQKCFKLHGYPPGYIPGYKSTYQSSQR  299

Query  215  GQ  210
             Q
Sbjct  300  PQ  301



>ref|XP_010414407.1| PREDICTED: uncharacterized protein LOC104700576 isoform X2 [Camelina 
sativa]
Length=319

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ  219
            CTHCGM+GH + KC+K HGY PG IPGY S G   Q
Sbjct  63   CTHCGMAGHVIQKCFKLHGYPPGYIPGYKSNGGYSQ  98



>ref|XP_010414406.1| PREDICTED: uncharacterized protein LOC104700576 isoform X1 [Camelina 
sativa]
Length=473

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ  219
            CTHCGM+GH + KC+K HGY PG IPGY S G   Q
Sbjct  63   CTHCGMAGHVIQKCFKLHGYPPGYIPGYKSNGGYSQ  98



>ref|XP_010490457.1| PREDICTED: uncharacterized protein LOC104768231 [Camelina sativa]
Length=580

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 37/69 (54%), Gaps = 8/69 (12%)
 Frame = -1

Query  413  ANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSK  234
            ++ ++ AA+ N  R RS            CTH GM+GH V KCYK HGY PG IPGY   
Sbjct  185  SDNEVYAAVQNTFRPRS--------SRPLCTHYGMTGHVVQKCYKLHGYPPGYIPGYKIT  236

Query  233  GKQHQ*GQS  207
             +  Q  QS
Sbjct  237  YQSSQRPQS  245



>ref|XP_010461582.1| PREDICTED: uncharacterized protein LOC104742287 isoform X2 [Camelina 
sativa]
Length=146

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDANIS-AEQ  150
            CT+CGM+GHTVDKCYK HG+ PG  P  + +   +Q   S A+  +  T + + I   +Q
Sbjct  22   CTNCGMNGHTVDKCYKIHGFPPGWKPK-SQRPNSNQKFLSPASTNLTITDSVSEIDKGDQ  80

Query  149  IQKLISLL  126
            IQ L+S L
Sbjct  81   IQHLVSYL  88



>ref|XP_010480765.1| PREDICTED: uncharacterized protein LOC104759556 [Camelina sativa]
Length=582

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = -1

Query  434  QASSITTANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGC  255
            Q S+ T  N   +A  +N+      N+ +       CTHCG +GH V KC+K HGY PG 
Sbjct  236  QTSAPTQDNVVYLAPFDNVTFAAIQNTYHPRGSRPLCTHCGQTGHVVQKCFKLHGYPPGY  295

Query  254  IPGYNSKGKQHQ  219
            IPG+ S    +Q
Sbjct  296  IPGFKSTFANYQ  307



>emb|CAN74819.1| hypothetical protein VITISV_034590 [Vitis vinifera]
Length=970

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 43/140 (31%), Positives = 68/140 (49%), Gaps = 18/140 (13%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+  + ERQ ++        +   AN   ++   +A     A +N+  +K       
Sbjct  221  KVFSLVAQDERQCSINYGLYTPPDSVAANDSNSTVAISA-----ARLNSKPKK-------  268

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDA  168
                   C+HCG+ GHTVDKCYK +GY PG      +   + Q  Q+++  T  S   D+
Sbjct  269  ---DRPTCSHCGILGHTVDKCYKLYGYPPGYKFKSKNPHAKAQANQTSSRTTEASATADS  325

Query  167  ---NISAEQIQKLISLL*TQ  117
               ++S  Q Q+LI+LL +Q
Sbjct  326  PLVSLSPAQCQQLIALLSSQ  345



>ref|XP_010461580.1| PREDICTED: uncharacterized protein LOC104742287 isoform X1 [Camelina 
sativa]
 ref|XP_010461581.1| PREDICTED: uncharacterized protein LOC104742287 isoform X1 [Camelina 
sativa]
Length=163

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDANIS-AEQ  150
            CT+CGM+GHTVDKCYK HG+ PG  P  + +   +Q   S A+  +  T + + I   +Q
Sbjct  39   CTNCGMNGHTVDKCYKIHGFPPGWKPK-SQRPNSNQKFLSPASTNLTITDSVSEIDKGDQ  97

Query  149  IQKLISLL  126
            IQ L+S L
Sbjct  98   IQHLVSYL  105



>gb|AAD15368.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AAL32811.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
 gb|AAM47977.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=411

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 45/88 (51%), Gaps = 20/88 (23%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDA  168
            GN K  KCTHC   GHTVDKCYK HGY PG     + +  Q    QS+   + N T  D 
Sbjct  306  GNFKKPKCTHCNRIGHTVDKCYKVHGYPPG-----HPRANQ----QSSCVGSTNLTSIDQ  356

Query  167  N-----------ISAEQIQKLISLL*TQ  117
            +           +S + IQ+LIS L T+
Sbjct  357  SENQAPVMQDEIMSKDHIQQLISYLSTK  384



>emb|CAB10526.1| retrotransposon like protein [Arabidopsis thaliana]
 emb|CAB78748.1| retrotransposon like protein [Arabidopsis thaliana]
Length=1433

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 38/90 (42%), Positives = 47/90 (52%), Gaps = 14/90 (16%)
 Frame = -1

Query  359  NSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVT----  192
            N   G+ K  KC++C   GH VDKCYKKHGY PG     +   K    G +  A T    
Sbjct  288  NMAQGSYKKPKCSYCNKLGHLVDKCYKKHGYPPG-----SKWTKGQTIGSTNLASTQLQP  342

Query  191  VNSTP---TDA--NISAEQIQKLISLL*TQ  117
            VN TP   TD+    S +QIQ +IS L T+
Sbjct  343  VNETPNEKTDSYEEFSTDQIQTMISYLSTK  372



>gb|AAF69161.1|AC007915_13 F27F5.19 [Arabidopsis thaliana]
Length=1309

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 37/90 (41%), Positives = 45/90 (50%), Gaps = 14/90 (16%)
 Frame = -1

Query  359  NSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVT----  192
            N   G+ K  KC+ C   GH VDKCYKKHGY PG     +   K    G +  A T    
Sbjct  302  NMAQGSYKKPKCSFCNKLGHLVDKCYKKHGYPPG-----SKWTKAQTIGSTNLASTQLQP  356

Query  191  VNSTPTDANISAE-----QIQKLISLL*TQ  117
            VN TP++   S E     QIQ +IS L T+
Sbjct  357  VNETPSEKTDSCEEFSTDQIQTMISYLSTK  386



>gb|AAF79879.1|AC000348_32 T7N9.5 [Arabidopsis thaliana]
Length=1436

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 34/87 (39%), Positives = 44/87 (51%), Gaps = 15/87 (17%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDA  168
            GN K  KCTHC   GHTVDKCYK HGY PG     + + K++    S    + +   T A
Sbjct  264  GNFKKPKCTHCNRIGHTVDKCYKVHGYPPG-----HPRAKENTYVGSTNLASTDQIETQA  318

Query  167  ----------NISAEQIQKLISLL*TQ  117
                       +S + IQ+LIS L T+
Sbjct  319  PPTMSATGHETMSNDHIQQLISYLSTK  345



>ref|XP_010520621.1| PREDICTED: uncharacterized protein LOC104799678 [Tarenaya hassleriana]
Length=342

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 14/69 (20%)
 Frame = -1

Query  455  ISGANSIQASSITTANEDIVAAI---NNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKC  285
            ++  NS+ +S  T+ N  IVAA+   N+  R+R             CTHCG+ GHTV KC
Sbjct  234  VALQNSVTSSVPTSVNPSIVAAVVGGNSKPRQRPL-----------CTHCGLYGHTVQKC  282

Query  284  YKKHGYLPG  258
            YK HGY PG
Sbjct  283  YKLHGYPPG  291



>ref|XP_010480766.1| PREDICTED: uncharacterized protein LOC104759557 [Camelina sativa]
Length=663

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 28/72 (39%), Positives = 38/72 (53%), Gaps = 0/72 (0%)
 Frame = -1

Query  434  QASSITTANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGC  255
            Q S+ T  N   +A  +N+      N+ +       CTHCG +GH V KC+K HGY PG 
Sbjct  244  QTSAPTQDNVVYLAPFDNVAFAAIQNTYHPRGSRPLCTHCGQTGHVVQKCFKLHGYPPGY  303

Query  254  IPGYNSKGKQHQ  219
            IPG+ S    +Q
Sbjct  304  IPGFKSTFANYQ  315



>ref|XP_006575837.1| PREDICTED: uncharacterized protein LOC102664271 [Glycine max]
Length=395

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 43/89 (48%), Gaps = 22/89 (25%)
 Frame = -1

Query  353  NNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAA--AVTVNST  180
            N G      CTHCG  GHTVD CY+KHGY PG  P YN        G+S     VT++S 
Sbjct  275  NKGTSGRKSCTHCGRMGHTVDVCYRKHGYPPGYKP-YN--------GRSTVNNVVTMDSQ  325

Query  179  PTD-----------ANISAEQIQKLISLL  126
            P +              S EQ + L++L+
Sbjct  326  PMEDQNQHRESQDVVRFSPEQYKALLALI  354



>ref|XP_006575821.1| PREDICTED: uncharacterized protein LOC102670485 [Glycine max]
Length=697

 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 45/88 (51%), Gaps = 21/88 (24%)
 Frame = -1

Query  356  SNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTP  177
            SNNG  KT  CTHCG  GHTVD CY+KHGY PG  P Y+ +   +        VTV S  
Sbjct  277  SNNGR-KT--CTHCGKLGHTVDVCYRKHGYPPGYKP-YDERTTMNN------VVTVESKA  326

Query  176  TD-----------ANISAEQIQKLISLL  126
            TD              S EQ + L++L+
Sbjct  327  TDDQAQHHESHEFVRFSPEQYKALLALI  354



>ref|XP_010520325.1| PREDICTED: uncharacterized protein LOC104799478 [Tarenaya hassleriana]
Length=394

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 39/126 (31%), Positives = 59/126 (47%), Gaps = 33/126 (26%)
 Frame = -1

Query  440  SIQASSITTANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLP  261
            + Q S+  +   D++AA++  + K              CTHCGM GHT+ KCYK HGY  
Sbjct  249  TFQVSAQASKPSDLIAAVSGTLFKPK--------SKPLCTHCGMYGHTIHKCYKLHGY--  298

Query  260  GCIPGYNSKGKQ---------------HQ*GQSAAAVTVN-----STPTDANI-SAEQIQ  144
               PGY S  +                +Q   + AAV  +     S+P+D ++ S +Q+Q
Sbjct  299  --PPGYRSNSRNSDYKSVSATPLPKNLNQSKGTVAAVQSDSGLNSSSPSDNDLFSPQQLQ  356

Query  143  KLISLL  126
            KL  +L
Sbjct  357  KLYQML  362



>ref|XP_010525445.1| PREDICTED: uncharacterized protein LOC104803241 isoform X1 [Tarenaya 
hassleriana]
Length=388

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 45/86 (52%), Gaps = 22/86 (26%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNST-----------  180
            CTHCGM GHTV+KCYK HGY PG    +NSK  + +  Q A +  VNS            
Sbjct  270  CTHCGMYGHTVNKCYKLHGYPPGY--KFNSKTSEPK-QQFATSKVVNSAKGPVANVQNVT  326

Query  179  --------PTDANISAEQIQKLISLL  126
                    P ++ +SAE +++L  +L
Sbjct  327  GTKPQSNIPGNSLLSAEHLKQLYMML  352



>ref|XP_009142130.1| PREDICTED: uncharacterized protein LOC103866013 [Brassica rapa]
Length=1076

 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 67/142 (47%), Gaps = 28/142 (20%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVF++  + ERQ ++ +        + A +   S   + ++ IVAA NN   K       
Sbjct  238  KVFNLVSQEERQRSMKS--------TSAVAFNISQTASPDDSIVAAYNNGYAK-------  282

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDA  168
             N     C+HCG++GHT+ +CYK HGY  G  P  N +G+     QS+ + T N  P   
Sbjct  283  -NKNRPICSHCGIAGHTIQRCYKLHGYPQGYKPQNNYRGQ----AQSSKS-TQNWPPRKE  336

Query  167  NISAEQIQKLISLL*TQGGRSM  102
            N++   +Q         GG SM
Sbjct  337  NVANLIVQD-------SGGISM  351



>ref|XP_004170089.1| PREDICTED: uncharacterized protein LOC101223363, partial [Cucumis 
sativus]
Length=428

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 30/46 (65%), Gaps = 4/46 (9%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTV  189
            CTHC + GHTVDKCYK HGY     PGY +K +Q +   +  +VT+
Sbjct  274  CTHCNLPGHTVDKCYKIHGY----PPGYRTKQQQQRNNNAVNSVTI  315



>ref|XP_004147195.1| PREDICTED: uncharacterized protein LOC101216505 [Cucumis sativus]
Length=907

 Score = 54.7 bits (130),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 10/67 (15%)
 Frame = -1

Query  365  SFNSNNGNV--KTTK----CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSA  204
            S NS+ GN   K+ K    CTHC + GHTVDKCYK HGY     PGY +K +Q +   + 
Sbjct  255  SSNSSKGNPTNKSRKERPMCTHCNLPGHTVDKCYKIHGY----PPGYRTKQQQQRNNNAV  310

Query  203  AAVTVNS  183
             +VT+ +
Sbjct  311  NSVTIQN  317



>ref|XP_010552464.1| PREDICTED: uncharacterized protein LOC104822813 [Tarenaya hassleriana]
Length=292

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 34/54 (63%), Gaps = 10/54 (19%)
 Frame = -1

Query  416  TANEDIVAAIN-NIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            T + D+VAAI+ N +R +         +   CTHCGM GHTV+KCYK HGY PG
Sbjct  156  TKSSDVVAAISGNQLRPK---------QKPLCTHCGMYGHTVNKCYKLHGYPPG  200



>emb|CAN65182.1| hypothetical protein VITISV_029570 [Vitis vinifera]
Length=1002

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 39/124 (31%), Positives = 65/124 (52%), Gaps = 18/124 (15%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLE-ISGANSIQASSITTANEDIVAAINNIVRKRSFNSN  351
            KVF++ L+ ERQ ++     + L+ ++  +S QAS+ T         I +   K  F   
Sbjct  129  KVFALVLQEERQRSINQGFSSLLQPLALGDSSQASANT--------HIGSSASKPKF---  177

Query  350  NGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTD  171
                +  +CTHCG+ GH +D+CYK HGY  G  P   S+  Q Q  Q+++ V+  + P  
Sbjct  178  ----ERPQCTHCGLQGHAMDRCYKLHGYPLGYKPKSKSQLGQVQANQTSSLVS--NEPAA  231

Query  170  ANIS  159
            A+++
Sbjct  232  ADLT  235



>ref|XP_010496117.1| PREDICTED: uncharacterized protein LOC104773234 [Camelina sativa]
Length=610

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNS  237
            CTHCG+SGH V KC+K HGY PG IPG+ S
Sbjct  246  CTHCGISGHVVQKCFKLHGYPPGYIPGFKS  275



>gb|KHN08377.1| Succinate-semialdehyde dehydrogenase, mitochondrial [Glycine 
soja]
Length=387

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 27/39 (69%), Gaps = 2/39 (5%)
 Frame = -1

Query  365  SFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIP  249
            S N NNG  KT  CTHCG  GHTVD CY+KHGY PG  P
Sbjct  174  SRNKNNGGRKT--CTHCGKIGHTVDICYQKHGYPPGYKP  210



>ref|XP_010471196.1| PREDICTED: uncharacterized protein LOC104751022 [Camelina sativa]
Length=520

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ  219
            CTHCG +GH ++KC+K HGY PG IPG+ S    +Q
Sbjct  280  CTHCGQNGHVINKCFKLHGYPPGYIPGFKSSLSNYQ  315



>ref|XP_010665851.1| PREDICTED: uncharacterized protein LOC104883096 [Beta vulgaris 
subsp. vulgaris]
Length=373

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 43/90 (48%), Gaps = 17/90 (19%)
 Frame = -1

Query  371  KRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVT  192
            K  +N  NG  +   C HC MSGHT+D+CYK HG+     P     GK    G+  AA+ 
Sbjct  288  KGGYNGYNGVRRNFYCEHCKMSGHTIDRCYKIHGH-----PSAFKNGK----GKRIAAIV  338

Query  191  VNSTPTD--------ANISAEQIQKLISLL  126
                  D        A ++AEQ  KL+ L+
Sbjct  339  YGDDDEDEGGTTTEPAQLTAEQYHKLVQLV  368



>ref|XP_004149623.1| PREDICTED: uncharacterized protein LOC101211618 [Cucumis sativus]
Length=2085

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 24/92 (26%)
 Frame = -1

Query  527   KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
             +VFS+ ++ ERQ +          I  + SI++ ++   +E            R F+S+ 
Sbjct  1508  RVFSLIIQEERQRS----------IGSSPSIESITLMANSE------------RRFSSDK  1545

Query  347   GNVKTTK--CTHCGMSGHTVDKCYKKHGYLPG  258
                K T+  C++CG  GHT DKCYK HGY PG
Sbjct  1546  SKKKDTRPICSNCGYKGHTADKCYKLHGYPPG  1577



>ref|XP_006301596.1| hypothetical protein CARUB_v10022035mg [Capsella rubella]
 gb|EOA34494.1| hypothetical protein CARUB_v10022035mg [Capsella rubella]
Length=155

 Score = 50.8 bits (120),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 47/89 (53%), Gaps = 15/89 (17%)
 Frame = -1

Query  362  FNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ-*GQSAAAVTVN  186
            F ++NG+ K  KC+HC   GHT DKCYK HGY     PG+ SK K+ Q  G +  A T  
Sbjct  42   FLAHNGSQKP-KCSHCHKIGHTADKCYKLHGY----PPGFTSKWKKPQTIGTTNLAATQC  96

Query  185  STPTDA---------NISAEQIQKLISLL  126
             +  D           +S +QIQ +IS L
Sbjct  97   QSSLDQKENMEYSCDEMSTDQIQTVISYL  125



>ref|XP_010519642.1| PREDICTED: uncharacterized protein LOC104799038 [Tarenaya hassleriana]
Length=186

 Score = 51.6 bits (122),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 35/58 (60%), Gaps = 10/58 (17%)
 Frame = -1

Query  428  SSITTANEDIVAAIN-NIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            S+ ++ + D+VA I+ N  R +         +   CTHCGM GHTV+KCYK HGY PG
Sbjct  46   SAQSSKSSDVVATISGNQFRPK---------QKPLCTHCGMYGHTVNKCYKLHGYPPG  94



>ref|XP_006579313.1| PREDICTED: uncharacterized protein LOC102665903 [Glycine max]
Length=395

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 23/35 (66%), Gaps = 0/35 (0%)
 Frame = -1

Query  353  NNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIP  249
            N  N+    CTHCG  GHTVD CY+KHGY PG  P
Sbjct  275  NKSNIGRKTCTHCGKIGHTVDFCYRKHGYPPGYKP  309



>ref|XP_008775575.1| PREDICTED: hydroquinone glucosyltransferase-like [Phoenix dactylifera]
Length=550

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 13/96 (14%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAA---INNIVRKRSFN  357
            KVFS+ L+ E+Q           E+S A +  A S+    +    +    N   R  + +
Sbjct  382  KVFSLILQEEKQR----------EVSDALTQNAKSVALLGKSFNTSGHPSNGFTRVFNRS  431

Query  356  SNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIP  249
            S+    K   C+HCG+ GHTVD+CYK H Y PG  P
Sbjct  432  SSYNERKRPLCSHCGVLGHTVDRCYKIHDYPPGYKP  467



>ref|XP_004153578.1| PREDICTED: uncharacterized protein LOC101215164, partial [Cucumis 
sativus]
Length=403

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 24/92 (26%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            +VFS+ ++ ERQ +          I  + SI++ ++   +E            R F+S+ 
Sbjct  223  RVFSLIIQEERQRS----------IGSSPSIESITLMANSE------------RRFSSDK  260

Query  347  GNVKTTK--CTHCGMSGHTVDKCYKKHGYLPG  258
               K T+  C++CG  GHT DKCYK HGY PG
Sbjct  261  SKKKDTRPICSNCGYKGHTADKCYKLHGYPPG  292



>ref|XP_010662801.1| PREDICTED: uncharacterized protein LOC104882222 [Vitis vinifera]
Length=693

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 51/144 (35%), Positives = 71/144 (49%), Gaps = 26/144 (18%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+  + ERQ ++        +   AN    S+ T A   I+AA          NS  
Sbjct  221  KVFSLVAQDERQRSINYGLYTPPDSVAAND---SNSTIA---ILAA--------RLNSKP  266

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGK----QHQ*GQSAAAVTVNST  180
               + T C+H G+ GHTVDKCYK +GY     P Y  K K    + Q  Q+++  T  ST
Sbjct  267  KKDQPT-CSHYGILGHTVDKCYKLYGY----PPRYKFKSKNPHAKAQANQTSSRTTEAST  321

Query  179  PTD---ANISAEQIQKLISLL*TQ  117
              D   A++S  Q Q+LI+LL +Q
Sbjct  322  TADSPLASLSPAQCQQLIALLSSQ  345



>ref|XP_004141415.1| PREDICTED: uncharacterized protein LOC101212632 [Cucumis sativus]
 ref|XP_004142687.1| PREDICTED: uncharacterized protein LOC101213831 [Cucumis sativus]
Length=440

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 24/92 (26%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            +VFS+ ++ ERQ +          I  + SI++ ++   +E            R F+S+ 
Sbjct  164  RVFSLIIQEERQRS----------IGSSPSIESIALMANSE------------RRFSSDK  201

Query  347  GNVKTTK--CTHCGMSGHTVDKCYKKHGYLPG  258
               K T+  C++CG  GHT DKCYK HGY PG
Sbjct  202  SKKKDTRPICSNCGYKGHTADKCYKLHGYPPG  233



>ref|XP_009144636.1| PREDICTED: uncharacterized protein LOC103868285 [Brassica rapa]
Length=392

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 50/90 (56%), Gaps = 16/90 (18%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVF++  + ERQ ++ +        SG  + QAS +T++ + +VAA   +  K+      
Sbjct  233  KVFNIVSQEERQRSMKST-------SGV-AFQASQMTSSPDSVVAAYAGVYNKQR-----  279

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
                   C+HCG++GHTV++CYK HGY  G
Sbjct  280  ---PRPICSHCGLAGHTVNRCYKLHGYPQG  306



>ref|XP_010696214.1| PREDICTED: uncharacterized protein LOC104908764 [Beta vulgaris 
subsp. vulgaris]
Length=775

 Score = 52.8 bits (125),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 11/78 (14%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVN--STPTDANISAE  153
            CTHC + GH+VD+C+K HGY     PGY  K K     + AA+VTV+  +  T   IS +
Sbjct  232  CTHCKVPGHSVDRCFKLHGY----PPGYKPKDK-----KIAASVTVSHGTNVTPEMISVD  282

Query  152  QIQKLISLL*TQGGRSMF  99
            Q   L+SLL  Q   + F
Sbjct  283  QYNHLVSLLNNQQPSTPF  300



>ref|XP_010507241.1| PREDICTED: uncharacterized protein LOC104783837 [Camelina sativa]
Length=286

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            GN +  +C+HC + GHT DKCYK H YLPG
Sbjct  149  GNFQKPRCSHCSLVGHTADKCYKIHKYLPG  178



>ref|XP_008779879.1| PREDICTED: uncharacterized protein LOC103699645, partial [Phoenix 
dactylifera]
Length=521

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            GN +T  CTHC M+GH V+KCYK HGY PG
Sbjct  170  GNAETPFCTHCKMTGHVVEKCYKIHGYPPG  199



>ref|XP_010424680.1| PREDICTED: uncharacterized protein LOC104709822 [Camelina sativa]
Length=1185

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 39/79 (49%), Gaps = 9/79 (11%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDA-------  168
            C+ C   GH VD+CY+KHG+ PG  P      K  +    AA V++  TP          
Sbjct  295  CSFCNRVGHIVDRCYRKHGFPPGFTPKGKFTDKIQKPPVVAAQVSLPPTPEKTSTNMETL  354

Query  167  --NISAEQIQKLISLL*TQ  117
              N+S + +Q +I+L  TQ
Sbjct  355  IGNLSPDPLQNIIALFNTQ  373



>gb|KFK31542.1| hypothetical protein AALP_AA6G125900 [Arabis alpina]
Length=796

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 34/88 (39%), Positives = 45/88 (51%), Gaps = 12/88 (14%)
 Frame = -1

Query  365  SFNSNNGNVKTTK--CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVT  192
            SFN ++G  +  +  C+ CG  GH VD CYKKHGY  G  P    K +  +   S A +T
Sbjct  238  SFNQSSGYQRKERPMCSFCGRVGHVVDLCYKKHGYPTGFKP----KQRFEKQSSSMANIT  293

Query  191  V------NSTPTDANISAEQIQKLISLL  126
            V       ST +   +S  QIQ L+S L
Sbjct  294  VGNYSTETSTASADELSNAQIQHLVSFL  321



>ref|XP_004161031.1| PREDICTED: uncharacterized protein LOC101230271 [Cucumis sativus]
Length=457

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 47/92 (51%), Gaps = 24/92 (26%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            +VFS+ ++ ERQ +          I  + SI++ ++   +E            R F+S+ 
Sbjct  223  RVFSLIIQEERQRS----------IGSSPSIESITLMANSE------------RRFSSDK  260

Query  347  GNVKTTK--CTHCGMSGHTVDKCYKKHGYLPG  258
               K T+  C++CG  GHT DKCYK HGY PG
Sbjct  261  SKKKDTRPICSNCGYKGHTADKCYKLHGYPPG  292



>ref|XP_010525446.1| PREDICTED: uncharacterized protein LOC104803241 isoform X2 [Tarenaya 
hassleriana]
Length=350

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNS  183
            CTHCGM GHTV+KCYK HGY PG    +NSK  + +  Q A +  VNS
Sbjct  270  CTHCGMYGHTVNKCYKLHGYPPGY--KFNSKTSEPK-QQFATSKVVNS  314



>ref|XP_006603194.1| PREDICTED: uncharacterized protein LOC102665260 [Glycine max]
Length=741

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 45/84 (54%), Gaps = 6/84 (7%)
 Frame = -1

Query  374  RKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAV  195
            R++++N  NG +    CTHCG  GHT+D CYKKHGY PG   G +        G++A+  
Sbjct  275  RRKTYN-RNGKM----CTHCGKIGHTIDVCYKKHGYPPGYKFGNSKVVNNIMEGKAASDQ  329

Query  194  TVNSTPTD-ANISAEQIQKLISLL  126
                   D    S EQ Q L++L+
Sbjct  330  MQRQESHDLVRFSPEQYQALLALI  353



>gb|KHN34461.1| hypothetical protein glysoja_037939, partial [Glycine soja]
Length=393

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 25/37 (68%), Gaps = 2/37 (5%)
 Frame = -1

Query  359  NSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIP  249
            N NN   KT  CTHCG  GHTVD CY+KHGY PG  P
Sbjct  263  NKNNNGRKT--CTHCGKIGHTVDVCYRKHGYPPGYKP  297



>ref|XP_010495376.1| PREDICTED: uncharacterized protein LOC104772464 [Camelina sativa]
Length=1032

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 31/74 (42%), Positives = 37/74 (50%), Gaps = 9/74 (12%)
 Frame = -1

Query  452  SGANSIQASSITTANED--IVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYK  279
            S  NS Q SS    + D    AA+ N  R +  +          CTHCG  GH V KC+K
Sbjct  252  STVNSHQPSSSFDGSYDHAAFAAMQNYFRPKQSSR-------PLCTHCGQLGHVVQKCFK  304

Query  278  KHGYLPGCIPGYNS  237
             HGY PG IPGY +
Sbjct  305  LHGYPPGYIPGYKT  318



>ref|XP_010430794.1| PREDICTED: uncharacterized protein LOC104715037 [Camelina sativa]
Length=1336

 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            GN +  KC+HC   GHTVDKCYK HGY PG
Sbjct  148  GNFQKPKCSHCSRLGHTVDKCYKVHGYPPG  177


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            GN +  KC+HC   GHTVDKCYK HGY PG
Sbjct  401  GNFQKPKCSHCSRLGHTVDKCYKVHGYPPG  430



>ref|XP_010678775.1| PREDICTED: uncharacterized protein LOC104894279 [Beta vulgaris 
subsp. vulgaris]
Length=550

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 15/102 (15%)
 Frame = -1

Query  386  NNIVRKRSFNSNNGNVK----------TTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNS  237
            NN   K+S NS+  +V+             CTHC + GH++DKC+K HGY P    G+  
Sbjct  269  NNNYFKKSINSSKNSVRGGSKNPKPGSKYYCTHCEIPGHSIDKCFKVHGY-PANFQGFRD  327

Query  236  KGKQHQ*GQSAAAVTVNSTPTDA---NISAEQIQKLISLL*T  120
            K         A  + ++ TP DA   ++S EQ  +L+ +L T
Sbjct  328  KKVADVSSSEAVHMDIDHTP-DAPGPSLSMEQYTQLMDMLKT  368



>ref|XP_010542100.1| PREDICTED: uncharacterized protein LOC104815417 [Tarenaya hassleriana]
 ref|XP_010552828.1| PREDICTED: uncharacterized protein LOC104823102 [Tarenaya hassleriana]
Length=614

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIP  249
            CTHCG+ GHTV KCYK HGY PG IP
Sbjct  221  CTHCGLYGHTVHKCYKLHGYPPGYIP  246



>gb|AER13167.1| putative retrovirus-like polyprotein [Phaseolus vulgaris]
Length=1009

 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 3/43 (7%)
 Frame = -1

Query  353  NNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQ  225
            NNGN K   CTHCG +GHT++ CYKKHGY PG    Y SK  Q
Sbjct  495  NNGNKKM--CTHCGRNGHTIETCYKKHGYPPG-YKFYGSKTNQ  534



>ref|XP_010542101.1| PREDICTED: uncharacterized protein LOC104815418 [Tarenaya hassleriana]
Length=368

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 21/26 (81%), Gaps = 0/26 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIP  249
            CTHCG+ GHTV KCYK HGY PG IP
Sbjct  221  CTHCGLYGHTVHKCYKLHGYPPGYIP  246



>ref|XP_010462670.1| PREDICTED: uncharacterized protein LOC104743263 [Camelina sativa]
Length=1069

 Score = 52.0 bits (123),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            GN +  KC+HC   GHTVDKCYK HGY PG
Sbjct  305  GNFQKPKCSHCSRLGHTVDKCYKVHGYPPG  334



>ref|XP_006606864.1| PREDICTED: uncharacterized protein LOC102669025 [Glycine max]
Length=355

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 36/68 (53%), Gaps = 11/68 (16%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAA--AVTVNSTPTDANISAE  153
            CTHCG  GHTVD CY+KHGY PG  P YN        G+S     VT++S P +      
Sbjct  284  CTHCGKMGHTVDVCYRKHGYPPGYKP-YN--------GRSTVNNVVTMDSQPVEDQNQHR  334

Query  152  QIQKLISL  129
            + Q ++  
Sbjct  335  ESQDVVRF  342



>ref|XP_010664930.1| PREDICTED: uncharacterized protein LOC100853407 [Vitis vinifera]
Length=382

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 46/96 (48%), Gaps = 27/96 (28%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANED-IVAAINNIVRKRSFNSN  351
            KVFS+ ++ ERQ                      S+TT+N     A +++  +  S  S+
Sbjct  217  KVFSLVVQEERQR---------------------SLTTSNSPAFTAPVSSRFQAASRASS  255

Query  350  NGNVKTTK-----CTHCGMSGHTVDKCYKKHGYLPG  258
              N   ++     CTHC + GHTVD+CYK HGY PG
Sbjct  256  PTNASRSRNDRPLCTHCNILGHTVDRCYKIHGYPPG  291



>emb|CAN65540.1| hypothetical protein VITISV_029946 [Vitis vinifera]
Length=1240

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 42/90 (47%), Gaps = 15/90 (17%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+ ++ ERQ +L            ++  QA+S  ++                 NS+ 
Sbjct  217  KVFSLVVQEERQRSLTISNSPAFTAPVSSRFQAASRASSPT---------------NSSR  261

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
                   CTHC + GHTVD+CYK HGY PG
Sbjct  262  SRKDRPLCTHCNILGHTVDRCYKIHGYPPG  291



>ref|XP_010556441.1| PREDICTED: uncharacterized protein LOC104825771 isoform X1 [Tarenaya 
hassleriana]
Length=406

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 45/84 (54%), Gaps = 13/84 (15%)
 Frame = -1

Query  329  KCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKG-KQHQ*GQS----AAAVTVNSTPTDAN  165
            +CTHCG+ GHTV++C+K +GY  G  P ++SK  K+ Q  QS      A   +   TD N
Sbjct  292  QCTHCGLIGHTVNRCFKIYGYPQGHKPAWSSKTQKKFQPLQSHVNMVGAPGFDGNTTDFN  351

Query  164  --------ISAEQIQKLISLL*TQ  117
                     S EQ Q LIS L TQ
Sbjct  352  SASGIVSKTSFEQAQNLISQLSTQ  375



>ref|XP_010518645.1| PREDICTED: uncharacterized protein LOC104793922 [Camelina sativa]
Length=539

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/30 (67%), Positives = 23/30 (77%), Gaps = 0/30 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNS  237
            CT CGM+GH V KC+K HGY PG IPG+ S
Sbjct  275  CTCCGMTGHVVQKCFKLHGYPPGYIPGFKS  304



>ref|XP_008797608.1| PREDICTED: uncharacterized protein LOC103712765 [Phoenix dactylifera]
Length=351

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 48/153 (31%), Positives = 72/153 (47%), Gaps = 24/153 (16%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITT---ANEDI--VAAINNIVRKRS  363
            KVF++ L+ ERQ  +A    N+ E++ A     S+  +    N+      A N   R   
Sbjct  153  KVFALVLQEERQREVAATTQNS-EVTAAAFTSKSTFNSNPLGNQSFHNPTAFNYPSRPIQ  211

Query  362  FNSNNGN-VKTTK--CTHCGMSGHTVDKCYKKHGYLP--------GCIPGYNSKGKQHQ*  216
              SN G  +K  +  C HCG  GHT DKCY+ HG+ P        G IP  N        
Sbjct  212  KQSNVGQMLKKNRPICNHCGKPGHTRDKCYRLHGFPPGFNFTKNKGIIPTVNQIS-----  266

Query  215  GQSAAAVTVNSTPTDANISAEQIQKLISLL*TQ  117
            G SA  +  +   ++  I++EQ Q+++S+L  Q
Sbjct  267  GTSAPDLVQDF--SNLTITSEQCQRILSMLKPQ  297



>emb|CAN64225.1| hypothetical protein VITISV_016222 [Vitis vinifera]
Length=987

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 42/90 (47%), Gaps = 15/90 (17%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+ ++ ERQ +L            ++  QA+S  ++                 NS+ 
Sbjct  217  KVFSLVVQEERQRSLTISNSPAFTAPVSSRFQAASRASSPT---------------NSSR  261

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
                   CTHC + GHTVD+CYK HGY PG
Sbjct  262  SRKDRPLCTHCNILGHTVDRCYKIHGYPPG  291



>ref|XP_006576049.1| PREDICTED: uncharacterized protein LOC102660724 [Glycine max]
Length=454

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 49/100 (49%), Gaps = 24/100 (24%)
 Frame = -1

Query  374  RKRSFNSNNG------NVKTTK-CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*  216
            RK    SN G      N K  K CTHCG +GHTVD CY+KHG+ PG    YN+K      
Sbjct  35   RKHGIPSNYGWKNKGNNAKNGKTCTHCGRNGHTVDVCYRKHGFPPGH-RFYNAKTT----  89

Query  215  GQSAAAVTVNSTPTD----------ANISAEQIQKLISLL  126
              S   V V+S  TD           + S EQ + L++L+
Sbjct  90   --SKNIVIVDSEVTDDQTQHHESQEVHFSPEQYKALLALI  127



>ref|XP_010489520.1| PREDICTED: uncharacterized protein LOC104767178 [Camelina sativa]
Length=544

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/76 (33%), Positives = 40/76 (53%), Gaps = 9/76 (12%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDAN------  165
            C+ C   GH  ++CY+KHG+ PG  P   S  K  +    AA V+++ TP  ++      
Sbjct  230  CSFCNRVGHIAERCYRKHGFPPGFTPKGKSGEKTQKQPALAAQVSLSPTPEKSSNNVEGL  289

Query  164  ---ISAEQIQKLISLL  126
               +S +Q+Q LI+L 
Sbjct  290  IGKLSPDQLQSLIALF  305



>ref|XP_009107622.1| PREDICTED: uncharacterized protein LOC103833282 [Brassica rapa]
Length=327

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 45/90 (50%), Gaps = 16/90 (18%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVF+M  + ERQ ++ +            + QAS   T+ E I+AA       R +N   
Sbjct  224  KVFNMVSQEERQHSMKSTSNL--------TFQASQSITSPEPIIAAYG-----RGYNKQK  270

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
                   C+H G+SGHTVD+CYK HGY  G
Sbjct  271  SR---PICSHSGLSGHTVDRCYKLHGYPQG  297



>ref|XP_010535249.1| PREDICTED: uncharacterized protein LOC104810602 [Tarenaya hassleriana]
Length=486

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/45 (49%), Positives = 28/45 (62%), Gaps = 3/45 (7%)
 Frame = -1

Query  395  AAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLP  261
            A I+   R R F+S+        CTHCG+SGHT+ +CYK HGY P
Sbjct  257  ANISPTFRPRPFSSSKSR---PFCTHCGISGHTISRCYKIHGYPP  298



>ref|XP_010556407.1| PREDICTED: uncharacterized protein LOC104825734 [Tarenaya hassleriana]
Length=404

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 42/86 (49%), Gaps = 16/86 (19%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKG----KQHQ*GQSAAA-----------VT  192
            CTHCG+ GHT+ KCYK HGY PG  P   S+     K  Q G S A+             
Sbjct  287  CTHCGLYGHTIQKCYKLHGYPPGYKPSGGSRSQSQTKPSQHGSSPASGHFINLVKETNYV  346

Query  191  VNSTPTD-ANISAEQIQKLISLL*TQ  117
            V  T +D    S  Q+Q+L S L +Q
Sbjct  347  VPPTVSDMGKFSFAQLQELCSKLSSQ  372



>ref|XP_010544634.1| PREDICTED: uncharacterized protein LOC104817234 [Tarenaya hassleriana]
Length=406

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 45/93 (48%), Gaps = 15/93 (16%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            +V+++ ++ E+Q  + +       I     +  SS++  +  + A   N  + R      
Sbjct  238  RVYNLVIQQEQQRLVKSS------IPSEAVVFQSSVSPPDAKVAAVSGNSFKPR------  285

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIP  249
               +   CTHCG+ GHTV KCYK HGY PG  P
Sbjct  286  ---QHPLCTHCGLYGHTVQKCYKLHGYPPGYKP  315



>gb|KHN37653.1| hypothetical protein glysoja_007356, partial [Glycine soja]
Length=401

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 3/40 (8%)
 Frame = -1

Query  353  NNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSK  234
            +NG  KT  CTHCG  GHTVD CY+KHGY PG  P YN +
Sbjct  274  SNGGRKT--CTHCGKMGHTVDVCYRKHGYPPGYKP-YNGR  310



>ref|XP_006596754.1| PREDICTED: uncharacterized protein LOC102663057 [Glycine max]
Length=456

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 9/81 (11%)
 Frame = -1

Query  356  SNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQ-HQ*GQSAAAVTVNST  180
            S NG V    CTHCG+  HTVD+CYKKHGY PG    Y  +G   +   +    V+ + T
Sbjct  295  STNGKV----CTHCGIINHTVDECYKKHGYPPGH-KFYKPQGASINNTVKEEEKVSRSET  349

Query  179  PT---DANISAEQIQKLISLL  126
                 D  I+ +Q Q L+SLL
Sbjct  350  SDHGQDIKITQQQYQALMSLL  370



>emb|CAN59936.1| hypothetical protein VITISV_001878 [Vitis vinifera]
Length=1031

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/90 (33%), Positives = 42/90 (47%), Gaps = 15/90 (17%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+ ++ ERQ +L            ++  QA+S  ++                 NS+ 
Sbjct  203  KVFSLVVQEERQRSLTTSNSPAFTAPVSSRFQAASRASSPT---------------NSSR  247

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
                   CTHC + GHTVD+CYK HGY PG
Sbjct  248  SRKDRPLCTHCNILGHTVDQCYKIHGYPPG  277



>ref|XP_010513189.1| PREDICTED: uncharacterized protein LOC104789148 [Camelina sativa]
Length=1423

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 30/88 (34%), Positives = 45/88 (51%), Gaps = 9/88 (10%)
 Frame = -1

Query  353  NNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTV----N  186
            N  N     C+ C   GH VD+CY+KHG+ PG  P      K  +    AA V++    +
Sbjct  308  NGPNKGRPICSFCNRVGHIVDRCYRKHGFPPGFTPKGKFNEKVQKSPIVAAQVSLSPVPD  367

Query  185  STPTD-----ANISAEQIQKLISLL*TQ  117
             TPT+      N+S +Q+Q +I+L  +Q
Sbjct  368  KTPTNVESLIGNLSPDQLQNIIALFSSQ  395



>ref|XP_009103821.1| PREDICTED: uncharacterized protein LOC103829886 [Brassica rapa]
Length=442

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/79 (38%), Positives = 40/79 (51%), Gaps = 16/79 (20%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDA-------  168
            CT C   GH VD+CYKKHGY        NS     +  Q  +A+T N T  D+       
Sbjct  318  CTFCHRPGHVVDRCYKKHGYP-------NSMKPSPKSDQMVSALTANVTAIDSLQHDSHS  370

Query  167  --NISAEQIQKLISLL*TQ  117
              ++S  QIQ+L+S L T+
Sbjct  371  ADDLSPIQIQQLVSFLSTK  389



>emb|CAN61743.1| hypothetical protein VITISV_038639 [Vitis vinifera]
Length=481

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 39/74 (53%), Gaps = 13/74 (18%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYN-SKGKQHQ*GQSAAAVTVNSTPTDAN-----  165
            CTHCG +GHT+DKC++ HGY     PG+N  KGK+     + AA+T    P         
Sbjct  219  CTHCGYNGHTMDKCFQLHGY----PPGWNGPKGKRXM-ASAHAAITTPEVPNQNXXEQQK  273

Query  164  --ISAEQIQKLISL  129
               + E+  KL+ L
Sbjct  274  FCFTPEEFHKLVXL  287



>gb|KHN35391.1| hypothetical protein glysoja_029021, partial [Glycine soja]
Length=240

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 44/89 (49%), Gaps = 16/89 (18%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+ ++ E+Q  +      + E+S A +++ SS+   +     + NN           
Sbjct  165  KVFSLVVQEEKQKEVGASTSAS-EVSHAFALKTSSVARNHNRFKGSSNN-----------  212

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLP  261
                 T C HCGM GHT D+C+K HGY P
Sbjct  213  ----CTLCAHCGMLGHTQDRCFKLHGYPP  237



>ref|XP_006293416.1| hypothetical protein CARUB_v10025083mg, partial [Capsella rubella]
 gb|EOA26314.1| hypothetical protein CARUB_v10025083mg, partial [Capsella rubella]
Length=184

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIP  249
            C+HCG +GH VD+CYK HGY PG  P
Sbjct  98   CSHCGFTGHVVDRCYKLHGYPPGWKP  123



>ref|XP_006575768.1| PREDICTED: uncharacterized protein LOC102663845 [Glycine max]
Length=482

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 28/40 (70%), Gaps = 3/40 (8%)
 Frame = -1

Query  353  NNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSK  234
            +NG  KT  CTHCG  GHTVD CY+KHGY PG  P YN +
Sbjct  277  SNGGRKT--CTHCGKMGHTVDVCYRKHGYPPGYKP-YNGR  313



>emb|CAB10225.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
 emb|CAB78488.1| retrovirus-related like polyprotein [Arabidopsis thaliana]
Length=1489

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 32/94 (34%), Positives = 47/94 (50%), Gaps = 14/94 (15%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            + F+M  + ERQ N+         ++  +S+   + +  NED  A +       ++N+  
Sbjct  233  EAFNMVTQDERQRNVK-------PLTRVDSVAFQNTSMINEDENAYV------AAYNTVR  279

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPG  246
             N K   CTHCG  GHT+ KCYK HGY PG   G
Sbjct  280  PNQKPI-CTHCGKVGHTIQKCYKVHGYPPGMKTG  312



>ref|XP_010539135.1| PREDICTED: uncharacterized protein LOC104813264 [Tarenaya hassleriana]
Length=393

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 22/32 (69%), Gaps = 0/32 (0%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKG  231
            CTHCG+ GHT+ +CYK HGY PG  P  N  G
Sbjct  271  CTHCGLQGHTISRCYKLHGYPPGVHPSGNKSG  302



>ref|XP_008219719.1| PREDICTED: uncharacterized protein LOC103319904 [Prunus mume]
Length=315

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 44/82 (54%), Gaps = 10/82 (12%)
 Frame = -1

Query  350  NGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPT-  174
            N N K   CTHC    HT+D CYK HGY PG     +++ K+   G S++A  V + PT 
Sbjct  215  NSNRKPLHCTHCDRDHHTIDTCYKLHGYPPGHRLHKSNRNKK---GSSSSANHVQNNPTM  271

Query  173  ------DANISAEQIQKLISLL  126
                    N+S  + Q++++++
Sbjct  272  QELKSAMPNLSDSEYQQILTMM  293



>ref|XP_009117178.1| PREDICTED: uncharacterized protein LOC103842315 [Brassica rapa]
Length=1130

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 33/99 (33%), Positives = 51/99 (52%), Gaps = 18/99 (18%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVF++  + ERQ ++ +       +S  N+I+ S        +VAA N           N
Sbjct  204  KVFNLVSQEERQRSMKSTSTVAFNVS-QNNIEDS--------LVAAYNG--------GYN  246

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCI-PGYNSK  234
             N     C+HCG++GHT+++CYK HGY  G   P +N+K
Sbjct  247  KNRSRPICSHCGLAGHTINRCYKLHGYPQGYKPPSFNNK  285



>ref|XP_006598406.1| PREDICTED: uncharacterized protein LOC100778389 [Glycine max]
Length=466

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/152 (27%), Positives = 72/152 (47%), Gaps = 31/152 (20%)
 Frame = -1

Query  533  AYKVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNS  354
            A KVF++ ++ E+Q  +      + E+S A +++ SS    + D              N 
Sbjct  155  AIKVFALVVQEEKQKEVGASTSAS-EVSHAFALKTSSAARNHPD--------------NR  199

Query  353  NNGNVKTTK-CTHCGMSGHTVDKCYKKHGYLPGCI-PGYNSKGKQ--------HQ*GQSA  204
              G+ K    C H GM GHT D+C+K HGY P  +  G++S+ K+        H+  Q  
Sbjct  200  FKGSSKNRPLCAHWGMLGHTQDRCFKLHGYPPNYMRTGFSSEAKKHCSSSEPPHKVAQQV  259

Query  203  AAVTVNSTPTDAN------ISAEQIQKLISLL  126
            +    +S P+  +      ++A+Q  +L++LL
Sbjct  260  SVDMSHSQPSSGDLGSQFQLTAQQYSQLMNLL  291



>gb|AAD25646.1| putative retroelement pol polyprotein [Arabidopsis thaliana]
Length=1461

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 28/77 (36%), Positives = 38/77 (49%), Gaps = 7/77 (9%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTD-------A  168
            C+ C   GH  ++CYKKHG+ PG  P   S  K  +    AA VT++             
Sbjct  313  CSFCNRVGHIAERCYKKHGFPPGFTPKGKSSDKPPKPQAVAAQVTLSPDKMTGQLETLAG  372

Query  167  NISAEQIQKLISLL*TQ  117
            N S +QIQ LI+L  +Q
Sbjct  373  NFSPDQIQNLIALFSSQ  389



>ref|XP_010419217.1| PREDICTED: uncharacterized protein LOC104704907 [Camelina sativa]
Length=1032

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = -1

Query  332  TKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDAN----  165
            T C HCG++GHT+D CYK HG+ PG  P  N +   +Q   + AA  +  T + +     
Sbjct  230  TTCAHCGLNGHTIDVCYKIHGFPPGWKPK-NQRQNSNQRFNAPAAANLALTESGSEYDRE  288

Query  164  --ISAEQIQKLISLL  126
              +S EQ+Q L+S L
Sbjct  289  KALSPEQLQYLVSYL  303



>ref|XP_006596243.1| PREDICTED: uncharacterized protein LOC102667110 [Glycine max]
Length=213

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 43/84 (51%), Gaps = 15/84 (18%)
 Frame = -1

Query  374  RKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAA--  201
            + + +N+ NG      CT+CG  GHT+D CYKKHGY PG    +N+       G+  A  
Sbjct  93   KGKGYNTRNGKT----CTYCGKLGHTIDVCYKKHGYPPGF--KFNN-------GKVIANN  139

Query  200  AVTVNSTPTDANISAEQIQKLISL  129
             V V    TD  I  ++ Q+L+  
Sbjct  140  VVPVEGKATDDQIQRQESQELVRF  163



>ref|XP_010525521.1| PREDICTED: uncharacterized protein LOC104803299 [Tarenaya hassleriana]
Length=614

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 1/40 (3%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIP-GYNSKGKQHQ*GQ  210
            CTHCG+ GHT+ KCYK HGY PG  P G NS  +  Q  Q
Sbjct  481  CTHCGLYGHTIHKCYKLHGYPPGFKPTGQNSAPRNFQNNQ  520



>ref|XP_010419216.1| PREDICTED: uncharacterized protein LOC104704906 [Camelina sativa]
Length=973

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 7/75 (9%)
 Frame = -1

Query  332  TKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTPTDAN----  165
            T C HCG++GHT+D CYK HG+ PG  P  N +   +Q   + AA  +  T + +     
Sbjct  230  TTCAHCGLNGHTIDVCYKIHGFPPGWKPK-NQRQNSNQRFNAPAAANLALTESGSEYDRE  288

Query  164  --ISAEQIQKLISLL  126
              +S EQ+Q L+S L
Sbjct  289  KALSPEQLQYLVSYL  303



>gb|AAC62795.1| contains similarity to retroviral aspartyl proteases (Pfam: rvp.hmm, 
score: 11.80) [Arabidopsis thaliana]
Length=1244

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 30/92 (33%), Positives = 42/92 (46%), Gaps = 7/92 (8%)
 Frame = -1

Query  371  KRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVT  192
            K  +  N  N     C+ C   GH  +KCYKKHGY PG       KG + Q   +  ++ 
Sbjct  278  KICYVQNGPNKGRPICSFCNKVGHIAEKCYKKHGYPPGFKGKLPEKGTKPQPVAAQVSLL  337

Query  191  VNSTPTDA-------NISAEQIQKLISLL*TQ  117
                PT A       N+S +Q+Q  I+L  +Q
Sbjct  338  PPMVPTQATLDGLLGNLSNDQLQNFIALFSSQ  369



>ref|XP_010513698.1| PREDICTED: uncharacterized protein LOC104789749 [Camelina sativa]
Length=1375

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 6/78 (8%)
 Frame = -1

Query  410  NEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKG  231
            ++++  A  N  R R  N++N  +    CT+CG  GHTV KC+K HGY PG     N KG
Sbjct  231  DQNVFVAAYNSYRPR--NTSNRPL----CTYCGQLGHTVQKCFKIHGYPPGYKQNSNGKG  284

Query  230  KQHQ*GQSAAAVTVNSTP  177
              +  GQ  ++    S+P
Sbjct  285  SFNPRGQVNSSPQFQSSP  302



>ref|XP_006595224.1| PREDICTED: uncharacterized protein LOC102660371 [Glycine max]
Length=370

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQ-HQ*GQSAAAVTVNSTP---TDANIS  159
            CTHCG+  HTVD+CYKKHGY PG    Y  +G   +   +    V+ + T     D  I+
Sbjct  165  CTHCGIINHTVDECYKKHGYSPG-HKFYKPQGASINNTVKEEEKVSRSETSYHGQDIKIT  223

Query  158  AEQIQKLISLL  126
             +Q Q L+SLL
Sbjct  224  QQQYQALMSLL  234



>ref|XP_006580020.1| PREDICTED: uncharacterized protein LOC100820019 isoform X5 [Glycine 
max]
Length=395

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = -1

Query  359  NSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSK  234
            N + G  KT  CTHCG  GHT+D CY+KHGY PG  P YN +
Sbjct  275  NKSMGGRKT--CTHCGKIGHTIDVCYRKHGYPPGYKP-YNGR  313



>ref|XP_003524766.2| PREDICTED: uncharacterized protein LOC100820019 isoform X1 [Glycine 
max]
 ref|XP_006580017.1| PREDICTED: uncharacterized protein LOC100820019 isoform X2 [Glycine 
max]
 ref|XP_006580018.1| PREDICTED: uncharacterized protein LOC100820019 isoform X3 [Glycine 
max]
 ref|XP_006580019.1| PREDICTED: uncharacterized protein LOC100820019 isoform X4 [Glycine 
max]
Length=495

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/42 (57%), Positives = 28/42 (67%), Gaps = 3/42 (7%)
 Frame = -1

Query  359  NSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSK  234
            N + G  KT  CTHCG  GHT+D CY+KHGY PG  P YN +
Sbjct  275  NKSMGGRKT--CTHCGKIGHTIDVCYRKHGYPPGYKP-YNGR  313



>gb|KHN16144.1| hypothetical protein glysoja_012120, partial [Glycine soja]
Length=279

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 24/37 (65%), Gaps = 2/37 (5%)
 Frame = -1

Query  359  NSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIP  249
            N NN   KT  CTHCG  GHTVD CY KHGY PG  P
Sbjct  234  NKNNNGRKT--CTHCGKIGHTVDVCYWKHGYPPGYKP  268



>ref|XP_010655082.1| PREDICTED: uncharacterized protein LOC104880371 [Vitis vinifera]
Length=280

 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 40/83 (48%), Gaps = 6/83 (7%)
 Frame = -1

Query  356  SNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNSTP  177
            SN    K   C HC   GHT + C+K HG L    P   S+G+  Q   S + + +N   
Sbjct  162  SNGEQRKRLWCDHCNRIGHTRNSCWKIHGKLANWTPRRQSEGRGFQAQTSTSDLNINFNK  221

Query  176  TDANISA------EQIQKLISLL  126
            ++ + SA      EQI++L  LL
Sbjct  222  SEGSESAAIRLNKEQIEQLYKLL  244



>ref|XP_009108242.1| PREDICTED: uncharacterized protein LOC103833949 [Brassica rapa]
Length=384

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = -1

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            G+ +  KC+HC   GHTVDKCYK HGY PG
Sbjct  312  GSYQKPKCSHCFRIGHTVDKCYKVHGYPPG  341



>ref|XP_003597218.1| Beta-galactosidase [Medicago truncatula]
Length=2260

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 13/74 (18%)
 Frame = -1

Query  446  ANSIQASSITTANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGY  267
            AN  +A   TT +E    A+     K+ FNSN GN    KCTHC  + HT D C+K HGY
Sbjct  730  ANRQEAMLCTTQSEGAAMAM-----KKPFNSNKGN---RKCTHCNGNNHTADTCFKIHGY  781

Query  266  LPGCIPGYNSKGKQ  225
                 P ++ KGK+
Sbjct  782  -----PQWHPKGKK  790



>gb|KHN43622.1| hypothetical protein glysoja_045377, partial [Glycine soja]
Length=397

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = -1

Query  374  RKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            R +S+N+ NG      CTHCG  GHT+D C+KKH + PG
Sbjct  264  RSKSYNTRNGKA----CTHCGKIGHTIDVCFKKHRFPPG  298



>ref|XP_006603149.1| PREDICTED: uncharacterized protein LOC102663081 [Glycine max]
Length=415

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = -1

Query  374  RKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            R +S+N+ NG      CTHCG  GHT+D C+KKH + PG
Sbjct  235  RSKSYNTRNGKA----CTHCGKIGHTIDVCFKKHRFPPG  269



>ref|XP_010412414.1| PREDICTED: uncharacterized protein LOC104698703 [Camelina sativa]
Length=365

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 19/28 (68%), Positives = 21/28 (75%), Gaps = 0/28 (0%)
 Frame = -1

Query  341  VKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            ++   CTHCG SGHTV KCYK HGY PG
Sbjct  293  IQKPFCTHCGRSGHTVQKCYKLHGYPPG  320



>ref|XP_006582455.1| PREDICTED: uncharacterized protein LOC102662632 [Glycine max]
Length=373

 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/71 (37%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = -1

Query  326  CTHCGMSGHTVDKCYKKHGYLPGCIPGYNSKGKQHQ*GQSAAAVTVNST----PTDANIS  159
            CT+CG +GHTV+ CYKK+G+ PG     NS+   +       A+T + T    P +   S
Sbjct  288  CTYCGKTGHTVEVCYKKYGFPPG-FKFSNSRSSGNSLVTRDEAITNDQTQQIEPKEIRFS  346

Query  158  AEQIQKLISLL  126
             EQ + L++L+
Sbjct  347  PEQYKALLALI  357



>ref|XP_010542220.1| PREDICTED: uncharacterized protein LOC104815505 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010542221.1| PREDICTED: uncharacterized protein LOC104815505 isoform X2 [Tarenaya 
hassleriana]
Length=751

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 36/56 (64%), Gaps = 2/56 (4%)
 Frame = -1

Query  428  SSITTANEDIV-AAINNIVR-KRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGY  267
            SSI + ++ +V  A ++  R K SF+ N  +    +CTHCG+ GHT+ +CYK HGY
Sbjct  248  SSILSPSDSVVFQASSSFPRPKHSFSLNPTSKPRPQCTHCGLLGHTISRCYKLHGY  303



>dbj|BAF00783.1| hypothetical protein [Arabidopsis thaliana]
Length=556

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/58 (40%), Positives = 32/58 (55%), Gaps = 7/58 (12%)
 Frame = -1

Query  431  ASSITTANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            A+ I +A E +  ++N          NN   +   C+HCG +GHTVD+CYK HGY  G
Sbjct  233  AAFIVSAPEQVQPSVNATF-------NNAKPQKVICSHCGYTGHTVDRCYKIHGYPLG  283



>gb|KHN13718.1| hypothetical protein glysoja_047572, partial [Glycine soja]
Length=232

 Score = 48.1 bits (113),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 47/89 (53%), Gaps = 14/89 (16%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+ ++ E+Q  +      + E+S A +++ SS+   +      IN   R    +S N
Sbjct  153  KVFSLVVQEEKQKEVGASTSAS-EVSHAFALKPSSVARNH-----PINCFKR----SSKN  202

Query  347  GNVKTTKCTHCGMSGHTVDKCYKKHGYLP  261
              +    C HCGM GHT D+C+K HGY P
Sbjct  203  RPL----CAHCGMLGHTQDRCFKLHGYPP  227



>gb|KHN35823.1| hypothetical protein glysoja_013248, partial [Glycine soja]
Length=514

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 4/39 (10%)
 Frame = -1

Query  374  RKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHGYLPG  258
            R +S+N+ NG      CTHCG  GHT+D CYKKHG+  G
Sbjct  247  RSKSYNTRNGKT----CTHCGKIGHTIDVCYKKHGFPLG  281



>ref|XP_010527535.1| PREDICTED: uncharacterized protein LOC104804870 [Tarenaya hassleriana]
Length=180

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 18/27 (67%), Positives = 20/27 (74%), Gaps = 0/27 (0%)
 Frame = -1

Query  329  KCTHCGMSGHTVDKCYKKHGYLPGCIP  249
            +CTHCGM GHTV KC+K  GY PG  P
Sbjct  62   QCTHCGMMGHTVQKCFKIFGYPPGYKP  88



>ref|XP_006588116.1| PREDICTED: uncharacterized protein LOC102665476 [Glycine max]
Length=281

 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 45/90 (50%), Gaps = 16/90 (18%)
 Frame = -1

Query  527  KVFSMTLKVERQlnlanlglnnLEISGANSIQASSITTANEDIVAAINNIVRKRSFNSNN  348
            KVFS+ ++ E+Q           E+S + S  AS ++ A        +++ R    N   
Sbjct  163  KVFSLVVQEEKQK----------EVSASTS--ASEVSHA---FAMKHSSVARNHPTNRFK  207

Query  347  GNVKTTK-CTHCGMSGHTVDKCYKKHGYLP  261
            G+ K    C HCGM GHT D+C+K HGY P
Sbjct  208  GSSKNRPLCAHCGMLGHTQDRCFKLHGYPP  237



>emb|CAN80285.1| hypothetical protein VITISV_026753 [Vitis vinifera]
Length=1387

 Score = 48.9 bits (115),  Expect = 0.001, Method: Composition-based stats.
 Identities = 34/107 (32%), Positives = 50/107 (47%), Gaps = 5/107 (5%)
 Frame = -1

Query  449  GANSIQASSITTANEDIVAAINNIVRKRSFNSNNGNVKTTKCTHCGMSGHTVDKCYKKHG  270
             A ++ AS   +  + +  A+N++     F+ +NG     KC+HCG S HT D C+K HG
Sbjct  254  AAGAVMASR--SLKQGLSTAVNSLSLNGKFSKSNGPSNDMKCSHCGNSKHTRDTCFKLHG  311

Query  269  YLPGCIPGYNSKGKQHQ*GQSAAAV--TVNSTPTDANISAEQIQKLI  135
            Y P       +K ++   G+   A     N T   A  SAE    LI
Sbjct  312  Y-PDWWHELQAKRQRDGNGKDGGASKNAANGTGKAAIASAESQLSLI  357



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 594120442748