BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c70713_g1_i1 len=128 path=[1:0-127]

Length=128
                                                                      Score     E

ref|XP_009602128.1|  PREDICTED: phosphate transporter PHO1 homolo...  70.1    2e-12   
ref|XP_009775849.1|  PREDICTED: phosphate transporter PHO1 homolo...  69.7    3e-12   
ref|XP_009775850.1|  PREDICTED: phosphate transporter PHO1 homolo...  68.6    6e-12   
ref|XP_009776849.1|  PREDICTED: phosphate transporter PHO1 homolo...  68.6    8e-12   
ref|XP_009775848.1|  PREDICTED: phosphate transporter PHO1 homolo...  68.6    8e-12   
ref|XP_009606931.1|  PREDICTED: phosphate transporter PHO1 homolo...  68.2    8e-12   
ref|XP_009602127.1|  PREDICTED: phosphate transporter PHO1 homolo...  68.2    1e-11   
ref|XP_004232209.1|  PREDICTED: phosphate transporter PHO1 homolog 9  68.2    1e-11   
ref|XP_009606930.1|  PREDICTED: phosphate transporter PHO1 homolo...  68.2    1e-11   
ref|XP_006338425.1|  PREDICTED: phosphate transporter PHO1 homolo...  67.4    2e-11   
ref|XP_004232205.1|  PREDICTED: phosphate transporter PHO1 homolo...  66.2    4e-11   
ref|XP_006338427.1|  PREDICTED: phosphate transporter PHO1 homolo...  66.2    4e-11   
ref|XP_004232204.1|  PREDICTED: phosphate transporter PHO1 homolog 3  65.9    6e-11   
ref|XP_011085740.1|  PREDICTED: phosphate transporter PHO1 homolog 9  65.1    1e-10   
ref|XP_011098656.1|  PREDICTED: phosphate transporter PHO1 homolo...  65.1    1e-10   
ref|XP_006338426.1|  PREDICTED: phosphate transporter PHO1 homolo...  64.3    2e-10   
ref|XP_010088128.1|  Phosphate transporter PHO1-3-like protein        63.9    3e-10   
gb|KCW56220.1|  hypothetical protein EUGRSUZ_I01970                   63.2    6e-10   
gb|EYU34640.1|  hypothetical protein MIMGU_mgv1a001525mg              63.2    6e-10   
ref|XP_010661084.1|  PREDICTED: phosphate transporter PHO1 homolo...  63.2    7e-10   
ref|XP_010029318.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.8    7e-10   
gb|EYU28791.1|  hypothetical protein MIMGU_mgv1a023085mg              62.8    8e-10   
ref|XP_010511984.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.8    8e-10   
emb|CDP20242.1|  unnamed protein product                              62.4    9e-10   
ref|XP_010470934.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.4    1e-09   
ref|XP_010511979.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.4    1e-09   
ref|XP_010511976.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.4    1e-09   
ref|XP_010511980.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.4    1e-09   
ref|XP_010511982.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.4    1e-09   
ref|XP_010511981.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.4    1e-09   
ref|XP_010274011.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.0    1e-09   
ref|XP_010274010.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.0    1e-09   
ref|XP_010274009.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.0    1e-09   
ref|XP_010274008.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.0    1e-09   
gb|AAG60105.1|AC073178_16  hypothetical protein                       62.0    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177107.2|  EXS (ERD1/XPR1/SYG1) family protein                 62.0    1e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003552542.1|  PREDICTED: phosphate transporter PHO1 homolo...  62.0    2e-09   
ref|XP_006482631.1|  PREDICTED: phosphate transporter PHO1 homolo...  61.6    2e-09   
emb|CDP02256.1|  unnamed protein product                              61.6    2e-09   
ref|XP_006431206.1|  hypothetical protein CICLE_v10011127mg           61.6    2e-09   
ref|XP_010661085.1|  PREDICTED: phosphate transporter PHO1 homolo...  61.2    2e-09   
ref|XP_007157707.1|  hypothetical protein PHAVU_002G091500g           61.2    3e-09   
gb|KDO72640.1|  hypothetical protein CISIN_1g0051592mg                58.2    3e-09   
ref|XP_003621279.1|  Putative small molecule transporter              60.8    4e-09   
ref|XP_010525585.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  60.5    4e-09   
gb|KDO72639.1|  hypothetical protein CISIN_1g0051592mg                58.5    4e-09   
gb|AES77497.2|  phosphate transporter PHO1-like protein               60.5    5e-09   
emb|CBI22248.3|  unnamed protein product                              59.7    5e-09   
gb|ABD32751.1|  SPX, N-terminal; EXS, C-terminal                      60.5    5e-09   Medicago truncatula
ref|XP_004491838.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  60.1    6e-09   
ref|XP_006602927.1|  PREDICTED: phosphate transporter PHO1 homolo...  59.7    6e-09   
emb|CDX92696.1|  BnaC07g39540D                                        59.7    8e-09   
ref|XP_010029316.1|  PREDICTED: phosphate transporter PHO1 homolo...  59.7    8e-09   
gb|KCW56217.1|  hypothetical protein EUGRSUZ_I01967                   59.7    8e-09   
ref|XP_011075648.1|  PREDICTED: phosphate transporter PHO1 homolo...  59.7    9e-09   
ref|XP_011017762.1|  PREDICTED: phosphate transporter PHO1 homolo...  59.7    9e-09   
ref|XP_006587737.1|  PREDICTED: phosphate transporter PHO1 homolo...  59.7    1e-08   
gb|KHN11629.1|  Phosphate transporter PHO1 like 9                     59.3    1e-08   
emb|CDY08975.1|  BnaC08g12050D                                        59.3    1e-08   
ref|XP_008230797.1|  PREDICTED: phosphate transporter PHO1 homolo...  59.3    1e-08   
gb|KDP41236.1|  hypothetical protein JCGZ_15643                       59.3    1e-08   
ref|XP_010433652.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.9    1e-08   
ref|XP_008230798.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.9    2e-08   
ref|XP_011035797.1|  PREDICTED: phosphate transporter PHO1 homolog 9  58.9    2e-08   
ref|XP_009109217.1|  PREDICTED: phosphate transporter PHO1 homolog 4  58.5    2e-08   
ref|XP_010448445.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.5    2e-08   
ref|XP_011017746.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.5    2e-08   
emb|CDY52351.1|  BnaA08g30860D                                        58.5    2e-08   
ref|XP_010433650.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.5    2e-08   
ref|XP_010438891.1|  PREDICTED: phosphate transporter PHO1 homolog 4  58.5    2e-08   
ref|XP_007139537.1|  hypothetical protein PHAVU_008G038300g           58.5    2e-08   
ref|XP_002530002.1|  xenotropic and polytropic murine leukemia vi...  58.2    3e-08   Ricinus communis
ref|XP_008230799.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.2    3e-08   
ref|XP_004298411.1|  PREDICTED: phosphate transporter PHO1 homolo...  58.2    3e-08   
ref|XP_006283191.1|  hypothetical protein CARUB_v10004221mg           58.2    3e-08   
ref|XP_002324071.2|  EXS family protein                               58.2    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_002312260.1|  EXS family protein                               58.2    3e-08   Populus trichocarpa [western balsam poplar]
emb|CDY40927.1|  BnaC06g30650D                                        58.2    3e-08   
ref|XP_006379673.1|  EXS family protein                               58.2    4e-08   
ref|XP_011017775.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  58.2    4e-08   
ref|XP_007032606.1|  EXS family protein isoform 2                     57.8    4e-08   
ref|XP_006587740.1|  PREDICTED: phosphate transporter PHO1 homolo...  57.4    5e-08   
ref|XP_010029312.1|  PREDICTED: phosphate transporter PHO1 homolo...  57.4    5e-08   
ref|XP_007217031.1|  hypothetical protein PRUPE_ppa001662mg           57.4    5e-08   
ref|XP_007032605.1|  EXS family protein isoform 1                     57.4    5e-08   
ref|NP_194265.2|  protein SHORT HYPOCOTYL UNDER BLUE1                 57.4    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008341597.1|  PREDICTED: phosphate transporter PHO1 homolog 9  57.4    6e-08   
emb|CAB45511.1|  putative protein                                     57.0    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004304282.1|  PREDICTED: phosphate transporter PHO1 homolo...  57.0    7e-08   
ref|XP_006413315.1|  hypothetical protein EUTSA_v10024522mg           57.0    7e-08   
ref|XP_009105490.1|  PREDICTED: phosphate transporter PHO1 homolo...  57.0    7e-08   
emb|CDX95933.1|  BnaA07g27980D                                        57.0    7e-08   
ref|XP_009360602.1|  PREDICTED: phosphate transporter PHO1 homolog 9  57.0    9e-08   
emb|CBI25905.3|  unnamed protein product                              56.6    9e-08   
ref|XP_003635556.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.6    9e-08   
ref|XP_006574915.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.6    1e-07   
gb|KHN01982.1|  Phosphate transporter PHO1 like 10                    56.6    1e-07   
ref|XP_006574913.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.6    1e-07   
ref|XP_006574912.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.6    1e-07   
gb|KCW86568.1|  hypothetical protein EUGRSUZ_B03203                   56.6    1e-07   
ref|XP_010044479.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.6    1e-07   
ref|XP_004297095.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.2    1e-07   
gb|KGN51946.1|  hypothetical protein Csa_5G606370                     56.2    2e-07   
ref|XP_010258276.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.2    2e-07   
ref|XP_004135446.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.2    2e-07   
ref|XP_009356328.1|  PREDICTED: phosphate transporter PHO1 homolo...  56.2    2e-07   
gb|AES77499.2|  phosphate transporter PHO1-like protein               55.8    2e-07   
ref|XP_006391011.1|  hypothetical protein EUTSA_v10018151mg           55.8    2e-07   
gb|EYU44133.1|  hypothetical protein MIMGU_mgv1a002044mg              55.8    2e-07   
ref|XP_003621281.1|  Xenotropic and polytropic retrovirus recepto...  55.8    2e-07   
ref|XP_008446395.1|  PREDICTED: phosphate transporter PHO1 homolo...  55.8    2e-07   
ref|XP_006396863.1|  hypothetical protein EUTSA_v10028451mg           55.5    2e-07   
ref|XP_010258279.1|  PREDICTED: phosphate transporter PHO1 homolo...  55.5    3e-07   
ref|XP_010258277.1|  PREDICTED: phosphate transporter PHO1 homolo...  55.5    3e-07   
gb|KCW56215.1|  hypothetical protein EUGRSUZ_I01964                   54.7    3e-07   
ref|XP_008379379.1|  PREDICTED: phosphate transporter PHO1 homolo...  55.5    3e-07   
ref|XP_010258281.1|  PREDICTED: phosphate transporter PHO1 homolo...  55.1    3e-07   
ref|XP_008350915.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.4    3e-07   
ref|XP_010551414.1|  PREDICTED: phosphate transporter PHO1 homolo...  55.1    3e-07   
ref|XP_007226142.1|  hypothetical protein PRUPE_ppa014810mg           55.1    4e-07   
gb|KHG00426.1|  Phosphate transporter PHO1 -like protein              54.7    5e-07   
gb|KHN33988.1|  Phosphate transporter PHO1 like 3                     54.7    5e-07   
ref|XP_003556778.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.7    5e-07   
ref|XP_009592876.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.7    5e-07   
ref|XP_004490097.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.7    5e-07   
ref|XP_010525588.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.7    5e-07   
ref|XP_010525586.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.7    5e-07   
ref|XP_008221580.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.3    6e-07   
gb|KDO53652.1|  hypothetical protein CISIN_1g004804mg                 54.3    6e-07   
ref|XP_010525590.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.3    6e-07   
ref|XP_006482049.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.3    6e-07   
ref|XP_010653893.1|  PREDICTED: phosphate transporter PHO1 homolog 3  54.3    7e-07   
ref|XP_010525589.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.3    7e-07   
ref|XP_006583960.1|  PREDICTED: phosphate transporter PHO1 homolo...  54.3    7e-07   
emb|CBI35053.3|  unnamed protein product                              53.9    8e-07   
ref|XP_008446393.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.9    9e-07   
ref|XP_006430515.1|  hypothetical protein CICLE_v10011324mg           53.9    9e-07   
ref|XP_004171231.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.9    9e-07   
ref|XP_002522477.1|  xenotropic and polytropic murine leukemia vi...  53.9    1e-06   Ricinus communis
ref|XP_010653877.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.9    1e-06   
ref|XP_002267154.2|  PREDICTED: phosphate transporter PHO1 homolo...  53.9    1e-06   Vitis vinifera
ref|XP_010551415.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.5    1e-06   
emb|CAN73334.1|  hypothetical protein VITISV_035136                   53.9    1e-06   Vitis vinifera
ref|XP_010029314.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.5    1e-06   
gb|KCW56213.1|  hypothetical protein EUGRSUZ_I01962                   53.5    1e-06   
ref|XP_010258275.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.5    1e-06   
emb|CBI35050.3|  unnamed protein product                              53.5    1e-06   
ref|XP_010653880.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.5    1e-06   
gb|KGN51948.1|  hypothetical protein Csa_5G606390                     53.5    1e-06   
ref|XP_004135162.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.5    1e-06   
gb|ABD32747.1|  EXS, C-terminal                                       52.8    1e-06   Medicago truncatula
ref|XP_011012915.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.1    2e-06   
gb|KHG14521.1|  Phosphate transporter PHO1 -like protein              53.1    2e-06   
ref|XP_006348756.1|  PREDICTED: phosphate transporter PHO1 homolo...  53.1    2e-06   
ref|XP_003621277.1|  Putative small molecule transporter              52.4    2e-06   
ref|XP_010320921.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    2e-06   
ref|XP_004239111.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    2e-06   
gb|KHN33987.1|  Phosphate transporter PHO1 like 3                     52.8    2e-06   
ref|XP_002315034.1|  hypothetical protein POPTR_0010s17220g           52.8    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003556779.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    2e-06   
ref|XP_004298410.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    2e-06   
ref|XP_003556780.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    2e-06   
ref|XP_009792492.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    2e-06   
ref|XP_004141448.1|  PREDICTED: phosphate transporter PHO1 homolo...  52.8    3e-06   
gb|KGN52480.1|  hypothetical protein Csa_5G637700                     52.8    3e-06   
ref|XP_004165523.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  52.8    3e-06   
gb|KDP27174.1|  hypothetical protein JCGZ_19873                       52.0    4e-06   
gb|KHG03629.1|  Phosphate transporter PHO1 -like protein              52.0    5e-06   
ref|XP_006827326.1|  hypothetical protein AMTR_s00010p00267530        52.0    5e-06   
gb|KHG04568.1|  Phosphate transporter PHO1 -like protein              51.6    5e-06   
ref|XP_010108703.1|  Phosphate transporter PHO1-10-like protein       51.6    6e-06   
ref|XP_006827325.1|  hypothetical protein AMTR_s00010p00267470        51.6    6e-06   
ref|XP_006482378.1|  PREDICTED: phosphate transporter PHO1 homolo...  51.6    6e-06   
gb|KFK29040.1|  hypothetical protein AALP_AA7G080800                  51.6    6e-06   
ref|XP_006415951.1|  hypothetical protein EUTSA_v10006900mg           51.2    7e-06   
gb|KHG22308.1|  Phosphate transporter PHO1 -like protein              51.6    7e-06   
ref|XP_007046013.1|  EXS (ERD1/XPR1/SYG1) family protein              51.2    8e-06   
ref|XP_010683125.1|  PREDICTED: phosphate transporter PHO1 homolo...  51.2    8e-06   
ref|XP_009356534.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  50.4    8e-06   
ref|XP_002323224.2|  EXS family protein                               51.2    8e-06   Populus trichocarpa [western balsam poplar]
ref|XP_007032396.1|  EXS (ERD1/XPR1/SYG1) family protein, putative    50.8    9e-06   
ref|XP_006430514.1|  hypothetical protein CICLE_v10013608mg           50.8    9e-06   
ref|XP_002522478.1|  xenotropic and polytropic murine leukemia vi...  50.4    1e-05   Ricinus communis
ref|XP_010108705.1|  Phosphate transporter PHO1-3-like protein        50.4    2e-05   
ref|XP_007046010.1|  EXS (ERD1/XPR1/SYG1) family protein              50.4    2e-05   
ref|XP_011075530.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
ref|XP_011075529.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
emb|CBI35052.3|  unnamed protein product                              50.1    2e-05   
ref|XP_011041394.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
ref|XP_002266671.2|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   Vitis vinifera
ref|XP_010500027.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
ref|XP_010500026.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
ref|NP_174768.2|  phosphate transporter PHO1-8                        50.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51461.1|AC069160_7  unknown protein                             50.1    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011075528.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
ref|XP_011075527.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
gb|KEH37711.1|  phosphate transporter PHO1-like protein               50.1    2e-05   
ref|XP_010461306.1|  PREDICTED: phosphate transporter PHO1 homolo...  50.1    2e-05   
gb|KDO37266.1|  hypothetical protein CISIN_1g041540mg                 49.7    2e-05   
gb|KEH37710.1|  phosphate transporter PHO1-like protein               49.7    2e-05   
ref|XP_010258335.1|  PREDICTED: phosphate transporter PHO1 homolog 3  49.7    2e-05   
ref|XP_004141577.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.7    3e-05   
ref|NP_173995.1|  phosphate transporter PHO1-7                        49.7    3e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008459340.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.7    3e-05   
gb|AAF87029.1|AC006535_7  T24P13.11                                   49.7    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KGN52478.1|  hypothetical protein Csa_5G637680                     49.7    3e-05   
ref|XP_004171216.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.7    3e-05   
ref|XP_008459342.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.7    3e-05   
ref|XP_002315035.2|  hypothetical protein POPTR_0010s17260g           49.7    3e-05   Populus trichocarpa [western balsam poplar]
gb|KFK43653.1|  hypothetical protein AALP_AA1G155200                  49.7    3e-05   
ref|XP_006430513.1|  hypothetical protein CICLE_v10013830mg           49.3    3e-05   
gb|KEH25753.1|  phosphate transporter PHO1-like protein               47.4    3e-05   
ref|XP_009110032.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.3    3e-05   
emb|CDY46445.1|  BnaA08g19850D                                        49.3    3e-05   
ref|XP_008221577.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.3    3e-05   
ref|XP_007227001.1|  hypothetical protein PRUPE_ppa001513mg           49.3    3e-05   
ref|XP_008350917.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  49.3    3e-05   
ref|XP_008389440.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.3    3e-05   
ref|XP_004297283.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.3    4e-05   
ref|XP_006605562.1|  PREDICTED: phosphate transporter PHO1 homolo...  49.3    4e-05   
ref|NP_172857.2|  phosphate transporter PHO1-3                        49.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDX82870.1|  BnaC01g13200D                                        49.3    4e-05   
ref|XP_009115405.1|  PREDICTED: phosphate transporter PHO1 homolog 8  49.3    4e-05   
ref|XP_008459343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  49.3    4e-05   
gb|AAR99485.1|  PHO1-like protein                                     49.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79407.1|AC068197_17  F16A14.26                                  49.3    4e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDY00103.1|  BnaC09g01980D                                        48.9    4e-05   
ref|XP_008221578.1|  PREDICTED: phosphate transporter PHO1 homolo...  48.9    4e-05   
ref|XP_003613881.1|  Xenotropic and polytropic retrovirus recepto...  48.9    4e-05   
ref|XP_009111779.1|  PREDICTED: phosphate transporter PHO1 homolo...  48.9    4e-05   
gb|AES96839.2|  phosphate transporter PHO1-like protein               48.9    4e-05   
emb|CDY19999.1|  BnaA09g02520D                                        48.9    5e-05   
emb|CBI35054.3|  unnamed protein product                              48.9    5e-05   
emb|CDY58396.1|  BnaCnng33210D                                        48.5    6e-05   
gb|KFK43650.1|  hypothetical protein AALP_AA1G154600                  48.5    6e-05   
ref|XP_002264904.1|  PREDICTED: phosphate transporter PHO1 homolo...  48.5    6e-05   Vitis vinifera
emb|CDY16184.1|  BnaA09g29180D                                        48.5    6e-05   
ref|XP_007158639.1|  hypothetical protein PHAVU_002G169700g           48.5    8e-05   
ref|XP_003556776.1|  PREDICTED: phosphate transporter PHO1 homolo...  48.1    8e-05   
gb|KHN33989.1|  Phosphate transporter PHO1 like 3                     48.1    9e-05   
gb|KHG26693.1|  PHO1,H3: Phosphate transporter PHO1 3                 45.8    9e-05   
gb|EYU28795.1|  hypothetical protein MIMGU_mgv1a001431mg              48.1    9e-05   
gb|KFK33778.1|  hypothetical protein AALP_AA5G058900                  48.1    9e-05   
ref|XP_006290617.1|  hypothetical protein CARUB_v10016708mg           48.1    9e-05   
gb|KFK33490.1|  hypothetical protein AALP_AA5G019500                  47.8    1e-04   
ref|XP_007227298.1|  hypothetical protein PRUPE_ppa016990mg           47.4    1e-04   
ref|XP_007158638.1|  hypothetical protein PHAVU_002G169600g           47.8    1e-04   
ref|XP_010458876.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.4    2e-04   
ref|XP_006305938.1|  hypothetical protein CARUB_v10011174mg           47.4    2e-04   
ref|XP_009356333.1|  PREDICTED: LOW QUALITY PROTEIN: phosphate tr...  47.4    2e-04   
ref|XP_009356322.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.4    2e-04   
ref|XP_010495726.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.4    2e-04   
gb|AAR99491.1|  PHO1-like protein                                     47.4    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189549.2|  EXS (ERD1/XPR1/SYG1) family protein                 47.0    2e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010325278.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_010502927.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_009356324.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_010495862.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_009356326.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_010425708.1|  PREDICTED: phosphate transporter PHO1 homolog 9  47.0    2e-04   
ref|XP_009356327.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_009356325.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    2e-04   
ref|XP_006395311.1|  hypothetical protein EUTSA_v10005314mg           47.0    2e-04   
ref|XP_010527936.1|  PREDICTED: phosphate transporter PHO1 homolog 3  47.0    2e-04   
ref|XP_007022478.1|  EXS (ERD1/XPR1/SYG1) family protein, putative    47.0    2e-04   
ref|XP_004297282.1|  PREDICTED: phosphate transporter PHO1 homolo...  47.0    3e-04   
ref|XP_006356664.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.6    3e-04   
ref|XP_006305850.1|  hypothetical protein CARUB_v10010925mg           46.6    3e-04   
ref|XP_008465732.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.6    3e-04   
ref|XP_010478930.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.6    3e-04   
ref|XP_010258274.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.6    3e-04   
ref|XP_008246100.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.2    3e-04   
emb|CAN71962.1|  hypothetical protein VITISV_004673                   46.6    3e-04   Vitis vinifera
ref|XP_009114171.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.6    3e-04   
gb|EYU28793.1|  hypothetical protein MIMGU_mgv1a0022682mg             45.1    3e-04   
emb|CDY60937.1|  BnaC09g52490D                                        46.6    3e-04   
ref|XP_010258273.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.2    3e-04   
ref|XP_008340316.1|  PREDICTED: phosphate transporter PHO1 homolog 3  46.2    4e-04   
ref|XP_010528986.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.2    4e-04   
ref|XP_010478931.1|  PREDICTED: phosphate transporter PHO1 homolo...  45.8    5e-04   
ref|XP_004143782.1|  PREDICTED: phosphate transporter PHO1 homolo...  46.2    5e-04   
gb|AAR99487.1|  PHO1-like protein                                     45.4    7e-04   
ref|NP_178423.5|  EXS (ERD1/XPR1/SYG1) family protein                 45.4    7e-04   
gb|AAC34478.1|  unknown protein                                       45.4    7e-04   
ref|XP_010460271.1|  PREDICTED: phosphate transporter PHO1 homolo...  45.4    8e-04   
emb|CDY44412.1|  BnaA02g29650D                                        45.4    8e-04   
gb|ABX46616.1|  PHO1-5                                                45.4    8e-04   
ref|XP_009129333.1|  PREDICTED: phosphate transporter PHO1 homolog 9  45.1    9e-04   
ref|XP_010460272.1|  PREDICTED: phosphate transporter PHO1 homolo...  45.1    0.001   



>ref|XP_009602128.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Nicotiana 
tomentosiformis]
Length=768

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ K+G   R++AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  626  VMRTLYDQKRGTFWRVMAASSSGITTVANTYWDIVIDWGLLQ  667



>ref|XP_009775849.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X1 [Nicotiana sylvestris]
Length=774

 Score = 69.7 bits (169),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ ++G   RI+AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  632  VMRTLYDQRRGTFWRIMAASTSGITTVANTYWDIVIDWGLLQ  673



>ref|XP_009775850.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X2 [Nicotiana sylvestris]
Length=633

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ ++G   RI+AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  491  VMRTLYDQRRGTFWRIMAASTSGITTVANTYWDIVIDWGLLQ  532



>ref|XP_009776849.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Nicotiana 
sylvestris]
Length=738

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY  K+G   R++AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  596  VMRTLYAQKRGTFWRVMAASTSGITTVANTYWDIVIDWGLLQ  637



>ref|XP_009775848.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Nicotiana 
sylvestris]
Length=768

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ K+G   +++AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  626  VMRTLYDQKRGTFWKVMAASTSGITTVANTYWDIVIDWGLLQ  667



>ref|XP_009606931.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X2 [Nicotiana tomentosiformis]
Length=673

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY  K+G   R++AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  599  VMRTLYAQKRGTFWRVMAASSSGITTVANTYWDIVIDWGLLQ  640



>ref|XP_009602127.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Nicotiana 
tomentosiformis]
Length=764

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ K+G   +++AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  622  VMRTLYDQKRGTFWKVMAASTSGITTVANTYWDIVIDWGLLQ  663



>ref|XP_004232209.1| PREDICTED: phosphate transporter PHO1 homolog 9 [Solanum lycopersicum]
Length=777

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ K+G   +++AA  SGITTIANTYWD+VIDWGLLQ
Sbjct  635  VMRTLYDQKRGTFWKVMAASTSGITTIANTYWDLVIDWGLLQ  676



>ref|XP_009606930.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X1 [Nicotiana tomentosiformis]
Length=741

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY  K+G   R++AA  SGITT+ANTYWDIVIDWGLLQ
Sbjct  599  VMRTLYAQKRGTFWRVMAASSSGITTVANTYWDIVIDWGLLQ  640



>ref|XP_006338425.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Solanum 
tuberosum]
Length=795

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ K+G   +++AA  SGITT+ANTYWD+V+DWGLLQ
Sbjct  653  VMRTLYDQKRGTFWKVMAASTSGITTVANTYWDLVVDWGLLQ  694



>ref|XP_004232205.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Solanum 
lycopersicum]
Length=792

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY+ K+G   R++AA  SGITT+ NTYWD+V+DWGLLQ
Sbjct  650  VMRTLYDQKRGTFWRVMAASTSGITTVGNTYWDLVVDWGLLQ  691



>ref|XP_006338427.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X1 [Solanum tuberosum]
Length=780

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY  K G   R++AA  SG+TT+ANTYWD+VIDWGLLQ
Sbjct  638  VMRTLYSQKGGTFWRVMAASTSGVTTVANTYWDLVIDWGLLQ  679



>ref|XP_004232204.1| PREDICTED: phosphate transporter PHO1 homolog 3 [Solanum lycopersicum]
Length=770

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RTLY  K G   R++AA  SG+TT+ANTYWD+VIDWGLLQ
Sbjct  628  VMRTLYSQKGGTFWRVMAASTSGVTTVANTYWDLVIDWGLLQ  669



>ref|XP_011085740.1| PREDICTED: phosphate transporter PHO1 homolog 9 [Sesamum indicum]
Length=768

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT+Y+L++    RI+AA  SG+TT+ NTYWDIVIDWGLLQ
Sbjct  627  VLRTIYDLRRQTFWRIMAATSSGVTTVYNTYWDIVIDWGLLQ  668



>ref|XP_011098656.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Sesamum 
indicum]
Length=777

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT+Y+L++G   +++AA  SG+TT+ NTYWDIVIDWGLLQ
Sbjct  635  VMRTIYDLRRGPFWKVMAASTSGVTTVYNTYWDIVIDWGLLQ  676



>ref|XP_006338426.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Solanum 
tuberosum]
Length=776

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V++TLY  K G   R++AA  SG+TT+ANTYWD+VIDWGLLQ
Sbjct  634  VMKTLYSQKGGTFWRVMAASTSGVTTVANTYWDLVIDWGLLQ  675



>ref|XP_010088128.1| Phosphate transporter PHO1-3-like protein [Morus notabilis]
 gb|EXB31940.1| Phosphate transporter PHO1-3-like protein [Morus notabilis]
Length=751

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RTLYE KKG    ILAA  SGI TI  TYWD+VIDWGLLQ
Sbjct  611  MRTLYEQKKGTIFLILAAATSGIATIGATYWDLVIDWGLLQ  651



>gb|KCW56220.1| hypothetical protein EUGRSUZ_I01970 [Eucalyptus grandis]
Length=757

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT ++L++G T +I+AA  SG+ T+ANTYWD+VIDWGLL+
Sbjct  620  VMRTGHDLRRGVTWKIIAAASSGVATVANTYWDLVIDWGLLR  661



>gb|EYU34640.1| hypothetical protein MIMGU_mgv1a001525mg [Erythranthe guttata]
Length=803

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT++EL++    R++AA  SGITTI NTYWDIV+DWGL Q
Sbjct  661  VMRTMFELRRQTFWRVMAASTSGITTIYNTYWDIVMDWGLFQ  702



>ref|XP_010661084.1| PREDICTED: phosphate transporter PHO1 homolog 9 isoform X1 [Vitis 
vinifera]
Length=787

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  EL+ G   +I+AA  SGI TIANTYWDIVIDWGLL+
Sbjct  642  VLRTANELQGGMIWKIMAAASSGIATIANTYWDIVIDWGLLR  683



>ref|XP_010029318.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Eucalyptus 
grandis]
Length=793

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 36/42 (86%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT ++L++G T +I+AA  SG+ T+ANTYWD+VIDWGLL+
Sbjct  656  VMRTGHDLRRGVTWKIIAAASSGVATVANTYWDLVIDWGLLR  697



>gb|EYU28791.1| hypothetical protein MIMGU_mgv1a023085mg [Erythranthe guttata]
Length=745

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT YEL+KG   ++LA V S I TIANTYWDI +DWGLLQ
Sbjct  592  VIRTAYELRKGTLWKVLALVSSVIATIANTYWDIFVDWGLLQ  633



>ref|XP_010511984.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X9 [Camelina sativa]
Length=775

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  642  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  683



>emb|CDP20242.1| unnamed protein product [Coffea canephora]
Length=779

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT +EL+KG T +ILA   S I TI NTYWDIV+DWGLL 
Sbjct  631  VIRTAFELRKGLTWKILAIASSAIATIMNTYWDIVVDWGLLH  672



>ref|XP_010470934.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Camelina sativa]
 ref|XP_010470935.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Camelina sativa]
Length=778

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  633  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  674



>ref|XP_010511979.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X4 [Camelina sativa]
Length=785

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  640  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  681



>ref|XP_010511976.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X1 [Camelina sativa]
 ref|XP_010511977.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X2 [Camelina sativa]
 ref|XP_010511978.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X3 [Camelina sativa]
Length=787

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  642  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  683



>ref|XP_010511980.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X5 [Camelina sativa]
Length=783

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  638  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  679



>ref|XP_010511982.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X7 [Camelina sativa]
 ref|XP_010511983.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X8 [Camelina sativa]
Length=779

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  634  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  675



>ref|XP_010511981.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X6 [Camelina sativa]
Length=783

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  638  IIRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  679



>ref|XP_010274011.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X4 [Nelumbo nucifera]
Length=763

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT YELKKG   R++AA+   I T  NTYWDIV+DWGLL+
Sbjct  619  VLRTAYELKKGINWRVMAAISYAIATSLNTYWDIVMDWGLLR  660



>ref|XP_010274010.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X3 [Nelumbo nucifera]
Length=765

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT YELKKG   R++AA+   I T  NTYWDIV+DWGLL+
Sbjct  634  VLRTAYELKKGINWRVMAAISYAIATSLNTYWDIVMDWGLLR  675



>ref|XP_010274009.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X2 [Nelumbo nucifera]
Length=772

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT YELKKG   R++AA+   I T  NTYWDIV+DWGLL+
Sbjct  628  VLRTAYELKKGINWRVMAAISYAIATSLNTYWDIVMDWGLLR  669



>ref|XP_010274008.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X1 [Nelumbo nucifera]
Length=778

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT YELKKG   R++AA+   I T  NTYWDIV+DWGLL+
Sbjct  634  VLRTAYELKKGINWRVMAAISYAIATSLNTYWDIVMDWGLLR  675



>gb|AAG60105.1|AC073178_16 hypothetical protein [Arabidopsis thaliana]
Length=777

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  632  IVRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  673



>ref|NP_177107.2| EXS (ERD1/XPR1/SYG1) family protein [Arabidopsis thaliana]
 sp|Q6R8G0.1|PHO1A_ARATH RecName: Full=Phosphate transporter PHO1 homolog 10; AltName: 
Full=Protein PHO1 homolog 10; Short=AtPHO1;H10 [Arabidopsis 
thaliana]
 gb|AAR99492.1| PHO1-like protein [Arabidopsis thaliana]
 gb|AEE34930.1| EXS (ERD1/XPR1/SYG1) family protein [Arabidopsis thaliana]
Length=777

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  ILA V SG+ T  NT+WDIVIDWGLL+
Sbjct  632  IVRTAYELKKGRTWMILALVSSGVATGMNTFWDIVIDWGLLR  673



>ref|XP_003552542.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X1 [Glycine max]
 ref|XP_006602926.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X2 [Glycine max]
Length=776

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  E ++G   +ILAA  SGI TI NTYWDIVIDWGLL+
Sbjct  631  VLRTTNEFQRGMVWKILAATSSGIATIVNTYWDIVIDWGLLR  672



>ref|XP_006482631.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Citrus 
sinensis]
Length=766

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT+Y L+ G T+ I+AA  SG+ TIANTYWDI IDWGLL+
Sbjct  624  RTIYSLRAGKTLLIVAAASSGVATIANTYWDIAIDWGLLR  663



>emb|CDP02256.1| unnamed protein product [Coffea canephora]
Length=769

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT+Y+L++G   +I+AA  SG+TTI + YWDIV+DWGLL+
Sbjct  621  VMRTIYDLRRGTFWKIMAAASSGVTTIGSAYWDIVMDWGLLR  662



>ref|XP_006431206.1| hypothetical protein CICLE_v10011127mg [Citrus clementina]
 gb|ESR44446.1| hypothetical protein CICLE_v10011127mg [Citrus clementina]
Length=766

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT+Y L+ G T+ I+AA  SG+ TIANTYWDI IDWGLL 
Sbjct  624  RTIYSLRAGKTLLIVAAASSGVATIANTYWDIAIDWGLLH  663



>ref|XP_010661085.1| PREDICTED: phosphate transporter PHO1 homolog 9 isoform X2 [Vitis 
vinifera]
Length=647

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  EL+ G   +I+AA  SGI TIANTYWDIVIDWGLL+
Sbjct  502  VLRTANELQGGMIWKIMAAASSGIATIANTYWDIVIDWGLLR  543



>ref|XP_007157707.1| hypothetical protein PHAVU_002G091500g [Phaseolus vulgaris]
 gb|ESW29701.1| hypothetical protein PHAVU_002G091500g [Phaseolus vulgaris]
Length=756

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +ELKKG++ ++LA V S I  + NTYWDIV DWGLLQ
Sbjct  612  VFRTAFELKKGSSWKVLALVTSAIAVLQNTYWDIVKDWGLLQ  653



>gb|KDO72640.1| hypothetical protein CISIN_1g0051592mg, partial [Citrus sinensis]
Length=205

 Score = 58.2 bits (139),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT+Y L+ G T+ I+AA  SG+ TIANTYWDI IDWGLL+
Sbjct  95   RTIYSLRAGKTLLIVAAASSGVATIANTYWDIAIDWGLLR  134



>ref|XP_003621279.1| Putative small molecule transporter [Medicago truncatula]
Length=796

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT  E  KG   +ILAA  SGI TI NTYWDIVIDWGLL+
Sbjct  649  VMRTTNEFHKGMGWKILAASSSGIATIVNTYWDIVIDWGLLR  690



>ref|XP_010525585.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
10-like [Tarenaya hassleriana]
Length=777

 Score = 60.5 bits (145),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT +ELKKG    ILA + SGI T+ NT+WDI+IDWGLL+
Sbjct  632  VIRTAFELKKGRKWMILALISSGIATVMNTFWDIIIDWGLLR  673



>gb|KDO72639.1| hypothetical protein CISIN_1g0051592mg, partial [Citrus sinensis]
Length=237

 Score = 58.5 bits (140),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT+Y L+ G T+ I+AA  SG+ TIANTYWDI IDWGLL+
Sbjct  95   RTIYSLRAGKTLLIVAAASSGVATIANTYWDIAIDWGLLR  134



>gb|AES77497.2| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=783

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT  E  KG   +ILAA  SGI TI NTYWDIVIDWGLL+
Sbjct  636  VMRTTNEFHKGMGWKILAASSSGIATIVNTYWDIVIDWGLLR  677



>emb|CBI22248.3| unnamed protein product [Vitis vinifera]
Length=436

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  EL+ G   +I+AA  SGI TIANTYWDIVIDWGLL+
Sbjct  291  VLRTANELQGGMIWKIMAAASSGIATIANTYWDIVIDWGLLR  332



>gb|ABD32751.1| SPX, N-terminal; EXS, C-terminal [Medicago truncatula]
 gb|KEH21626.1| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=780

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT  E  KG   +ILAA  SGI TI NTYWDIVIDWGLL+
Sbjct  633  VMRTTNEFHKGMGWKILAASSSGIATIVNTYWDIVIDWGLLR  674



>ref|XP_004491838.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
9-like [Cicer arietinum]
Length=793

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  E  KG    ILAA FS I TI NTYWDIVIDWGLL+
Sbjct  649  MRTTNEFHKGMVWTILAATFSSIATIVNTYWDIVIDWGLLR  689



>ref|XP_006602927.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X3 [Glycine max]
Length=455

 Score = 59.7 bits (143),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 28/42 (67%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  E ++G   +ILAA  SGI TI NTYWDIVIDWGLL+
Sbjct  310  VLRTTNEFQRGMVWKILAATSSGIATIVNTYWDIVIDWGLLR  351



>emb|CDX92696.1| BnaC07g39540D [Brassica napus]
Length=726

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +GAT  I A VFSG+ T+  TYWDIV+DWGLLQ
Sbjct  584  LRTAYTLNRGATWNIAAWVFSGVATLYATYWDIVVDWGLLQ  624



>ref|XP_010029316.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Eucalyptus 
grandis]
Length=786

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +EL++G T +I+AA  SG+  ++NTYWD+VIDWGLL+
Sbjct  649  VARTGHELRRGVTWKIIAAASSGVAMVSNTYWDLVIDWGLLR  690



>gb|KCW56217.1| hypothetical protein EUGRSUZ_I01967 [Eucalyptus grandis]
Length=770

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +EL++G T +I+AA  SG+  ++NTYWD+VIDWGLL+
Sbjct  633  VARTGHELRRGVTWKIIAAASSGVAMVSNTYWDLVIDWGLLR  674



>ref|XP_011075648.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Sesamum indicum]
Length=795

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT +EL+K    ++ A V S I  IANTYWDIV+DWGLLQ
Sbjct  646  VIRTAFELRKKVAWKLFALVSSAIAAIANTYWDIVVDWGLLQ  687



>ref|XP_011017762.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X2 [Populus euphratica]
Length=701

 Score = 59.7 bits (143),  Expect = 9e-09, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG + R +A VFS I TI +TYWD+V DWGLLQ
Sbjct  559  LRTAYSLNKGVSWRAIAWVFSAIATIFSTYWDLVFDWGLLQ  599



>ref|XP_006587737.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X1 [Glycine max]
 ref|XP_006587738.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X2 [Glycine max]
Length=759

 Score = 59.7 bits (143),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  E ++G   +ILAA  S I TI NTYWDIVIDWGLL+
Sbjct  614  VLRTTNEFRRGMVWQILAATSSSIATIVNTYWDIVIDWGLLR  655



>gb|KHN11629.1| Phosphate transporter PHO1 like 9 [Glycine soja]
Length=759

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  E ++G   +ILAA  S I TI NTYWDIVIDWGLL+
Sbjct  614  VLRTTNEFRRGMVWQILAATSSSIATIVNTYWDIVIDWGLLR  655



>emb|CDY08975.1| BnaC08g12050D [Brassica napus]
Length=730

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/41 (66%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A VFSG+ T+  TYWDIVIDWGLLQ
Sbjct  588  LRTAYTLNRGTTWNITAWVFSGVATLYATYWDIVIDWGLLQ  628



>ref|XP_008230797.1| PREDICTED: phosphate transporter PHO1 homolog 9 isoform X1 [Prunus 
mume]
Length=818

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT ++LKKG T +ILA   S + TI +TYWDIVIDWGLL+
Sbjct  675  MRTSFDLKKGMTWKILAITSSAVATIVSTYWDIVIDWGLLR  715



>gb|KDP41236.1| hypothetical protein JCGZ_15643 [Jatropha curcas]
Length=798

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG + +++A VFS I  I +TYWD+VIDWGLLQ
Sbjct  656  LRTAYSLNKGISWKVIAWVFSAIAAIVSTYWDLVIDWGLLQ  696



>ref|XP_010433652.1| PREDICTED: phosphate transporter PHO1 homolog 4-like isoform 
X2 [Camelina sativa]
Length=677

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  603  LRTAYTLNRGTTWNITAWVFSGVATFYGTYWDIVVDWGLLQ  643



>ref|XP_008230798.1| PREDICTED: phosphate transporter PHO1 homolog 9 isoform X2 [Prunus 
mume]
Length=784

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT ++LKKG T +ILA   S + TI +TYWDIVIDWGLL+
Sbjct  641  MRTSFDLKKGMTWKILAITSSAVATIVSTYWDIVIDWGLLR  681



>ref|XP_011035797.1| PREDICTED: phosphate transporter PHO1 homolog 9 [Populus euphratica]
Length=786

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y+L+ G T++I AA  SG  TI  TYWDIV+DWGLLQ
Sbjct  647  RTAYDLRMGMTLKIFAAATSGAATIMATYWDIVVDWGLLQ  686



>ref|XP_009109217.1| PREDICTED: phosphate transporter PHO1 homolog 4 [Brassica rapa]
Length=730

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A +FSG+ T+  TYWDIVIDWGLLQ
Sbjct  588  LRTAYTLNRGTTWNITAWIFSGVATLYATYWDIVIDWGLLQ  628



>ref|XP_010448445.1| PREDICTED: phosphate transporter PHO1 homolog 4-like [Camelina 
sativa]
Length=746

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  604  LRTAYTLNRGTTWNITAWVFSGVATFYGTYWDIVVDWGLLQ  644



>ref|XP_011017746.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X1 [Populus euphratica]
 ref|XP_011017754.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X1 [Populus euphratica]
Length=795

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG + R +A VFS I TI +TYWD+V DWGLLQ
Sbjct  653  LRTAYSLNKGVSWRAIAWVFSAIATIFSTYWDLVFDWGLLQ  693



>emb|CDY52351.1| BnaA08g30860D [Brassica napus]
Length=718

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A +FSG+ T+  TYWDIVIDWGLLQ
Sbjct  576  LRTAYTLNRGTTWNITAWIFSGVATLYATYWDIVIDWGLLQ  616



>ref|XP_010433650.1| PREDICTED: phosphate transporter PHO1 homolog 4-like isoform 
X1 [Camelina sativa]
Length=745

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  603  LRTAYTLNRGTTWNITAWVFSGVATFYGTYWDIVVDWGLLQ  643



>ref|XP_010438891.1| PREDICTED: phosphate transporter PHO1 homolog 4 [Camelina sativa]
Length=745

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  603  LRTAYTLNRGTTWNITAWVFSGVATFYGTYWDIVVDWGLLQ  643



>ref|XP_007139537.1| hypothetical protein PHAVU_008G038300g [Phaseolus vulgaris]
 gb|ESW11531.1| hypothetical protein PHAVU_008G038300g [Phaseolus vulgaris]
Length=774

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT  E  KG   +ILAA+ S I TI NTYWD+VIDWGLL+
Sbjct  631  VMRTTNEFHKGIVWKILAAISSSIATIFNTYWDVVIDWGLLR  672



>ref|XP_002530002.1| xenotropic and polytropic murine leukemia virus receptor pho1, 
putative [Ricinus communis]
 gb|EEF32364.1| xenotropic and polytropic murine leukemia virus receptor pho1, 
putative [Ricinus communis]
Length=668

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/40 (65%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            +RTLYEL++G   +I AA  SG  TI  TYWDIVIDWGLL
Sbjct  524  MRTLYELRRGMFWKIFAAATSGTATIIATYWDIVIDWGLL  563



>ref|XP_008230799.1| PREDICTED: phosphate transporter PHO1 homolog 9 isoform X3 [Prunus 
mume]
Length=608

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT ++LKKG T +ILA   S + TI +TYWDIVIDWGLL+
Sbjct  465  MRTSFDLKKGMTWKILAITSSAVATIVSTYWDIVIDWGLLR  505



>ref|XP_004298411.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Fragaria 
vesca subsp. vesca]
Length=777

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    VLRTLYELKKGAT-MRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT+YEL KG T   +LA + S + T+ NTYWDIV+DWGLLQ
Sbjct  632  IVRTVYELHKGKTSWMVLALISSAVATMMNTYWDIVVDWGLLQ  674



>ref|XP_006283191.1| hypothetical protein CARUB_v10004221mg [Capsella rubella]
 gb|EOA16089.1| hypothetical protein CARUB_v10004221mg [Capsella rubella]
Length=744

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G T  I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  602  LRTAYTLNRGITWNITAWVFSGVATFYGTYWDIVVDWGLLQ  642



>ref|XP_002324071.2| EXS family protein [Populus trichocarpa]
 gb|EEF04204.2| EXS family protein [Populus trichocarpa]
Length=792

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y+L+ G T++I AA  SG  TI  TYWDIV+DWGLLQ
Sbjct  653  RTAYDLRVGMTLKIFAAATSGAATIMATYWDIVVDWGLLQ  692



>ref|XP_002312260.1| EXS family protein [Populus trichocarpa]
 gb|EEE89627.1| EXS family protein [Populus trichocarpa]
Length=795

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG + R +A +FS I TI +TYWD+V DWGLLQ
Sbjct  653  LRTAYSLNKGVSWRAIAWIFSAIATIFSTYWDLVFDWGLLQ  693



>emb|CDY40927.1| BnaC06g30650D [Brassica napus]
Length=783

 Score = 58.2 bits (139),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELKKG    ILA V SG+    NT+WDIVIDWGLL+
Sbjct  637  IIRTAFELKKGRNWMILALVSSGVAICMNTFWDIVIDWGLLR  678



>ref|XP_006379673.1| EXS family protein [Populus trichocarpa]
 gb|ERP57470.1| EXS family protein [Populus trichocarpa]
Length=769

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  + A + S +  I NTYWDI +DWGLL+
Sbjct  644  LIRTAYELKKGRTWMVFALISSAVAVIVNTYWDIAVDWGLLR  685



>ref|XP_011017775.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
10 [Populus euphratica]
Length=813

 Score = 58.2 bits (139),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T  + A + S +  I NTYWDI +DWGLL+
Sbjct  669  LIRTAYELKKGRTWMVFALISSAVAVIVNTYWDIAVDWGLLR  710



>ref|XP_007032606.1| EXS family protein isoform 2 [Theobroma cacao]
 gb|EOY03532.1| EXS family protein isoform 2 [Theobroma cacao]
Length=741

 Score = 57.8 bits (138),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = +3

Query  6    LRTLYELKKGATMR--ILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT+Y+ +K  T    +LAA  SGI TIANTYWDIVIDWGLL+
Sbjct  641  IRTIYQFQKQKTTPWLVLAAATSGIATIANTYWDIVIDWGLLR  683



>ref|XP_006587740.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X4 [Glycine max]
Length=455

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT  E ++G   +ILAA  S I TI NTYWDIVIDWGLL+
Sbjct  310  VLRTTNEFRRGMVWQILAATSSSIATIVNTYWDIVIDWGLLR  351



>ref|XP_010029312.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Eucalyptus 
grandis]
Length=789

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +EL++G T +I+AA  SG+  + NTYWD+VIDWGLL+
Sbjct  652  VARTGHELRRGFTWKIIAATSSGVAMVINTYWDLVIDWGLLR  693



>ref|XP_007217031.1| hypothetical protein PRUPE_ppa001662mg [Prunus persica]
 gb|EMJ18230.1| hypothetical protein PRUPE_ppa001662mg [Prunus persica]
Length=784

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT +++KKG T ++LA   S + TI +TYWDIVIDWGLL+
Sbjct  641  MRTSFDMKKGMTWKVLAITSSAVATIVSTYWDIVIDWGLLR  681



>ref|XP_007032605.1| EXS family protein isoform 1 [Theobroma cacao]
 gb|EOY03531.1| EXS family protein isoform 1 [Theobroma cacao]
Length=786

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 33/43 (77%), Gaps = 2/43 (5%)
 Frame = +3

Query  6    LRTLYELKKGATMR--ILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT+Y+ +K  T    +LAA  SGI TIANTYWDIVIDWGLL+
Sbjct  641  IRTIYQFQKQKTTPWLVLAAATSGIATIANTYWDIVIDWGLLR  683



>ref|NP_194265.2| protein SHORT HYPOCOTYL UNDER BLUE1 [Arabidopsis thaliana]
 sp|Q6R8G6.1|PHO14_ARATH RecName: Full=Phosphate transporter PHO1 homolog 4; AltName: 
Full=Protein PHO1 homolog 4; Short=AtPHO1;H4 [Arabidopsis thaliana]
 gb|AAR99486.1| PHO1-like protein [Arabidopsis thaliana]
 gb|AEE85045.1| protein SHORT HYPOCOTYL UNDER BLUE1 [Arabidopsis thaliana]
Length=745

 Score = 57.4 bits (137),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G+   I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  602  LRTAYTLNRGSNWNITAWVFSGVATFYGTYWDIVLDWGLLQ  642



>ref|XP_008341597.1| PREDICTED: phosphate transporter PHO1 homolog 9 [Malus domestica]
 ref|XP_008362157.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Malus domestica]
Length=780

 Score = 57.4 bits (137),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y LK+G T +ILA V S + T+  TYWDIVIDWGLLQ
Sbjct  637  MRTSYGLKEGMTSKILAIVSSVVATVVGTYWDIVIDWGLLQ  677



>emb|CAB45511.1| putative protein [Arabidopsis thaliana]
 emb|CAB81346.1| putative protein [Arabidopsis thaliana]
Length=710

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G+   I A VFSG+ T   TYWDIV+DWGLLQ
Sbjct  567  LRTAYTLNRGSNWNITAWVFSGVATFYGTYWDIVLDWGLLQ  607



>ref|XP_004304282.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Fragaria 
vesca subsp. vesca]
Length=762

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT +++KKG T +ILA   S + T+ +TYWDIVIDWGLLQ
Sbjct  619  MRTSFDMKKGMTWKILAMTSSIVATLVSTYWDIVIDWGLLQ  659



>ref|XP_006413315.1| hypothetical protein EUTSA_v10024522mg [Eutrema salsugineum]
 gb|ESQ54768.1| hypothetical protein EUTSA_v10024522mg [Eutrema salsugineum]
Length=732

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT + L +G T  I A VFSG+ T+  TYWDIV+DWGLLQ
Sbjct  590  LRTAFTLNRGVTWNITAWVFSGVATLYATYWDIVVDWGLLQ  630



>ref|XP_009105490.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Brassica rapa]
Length=783

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELKKG    I+A V SG+    NT+WDIVIDWGLL+
Sbjct  637  IIRTAFELKKGRNWMIMALVSSGVAICMNTFWDIVIDWGLLR  678



>emb|CDX95933.1| BnaA07g27980D [Brassica napus]
Length=784

 Score = 57.0 bits (136),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELKKG    I+A V SG+    NT+WDIVIDWGLL+
Sbjct  638  IIRTAFELKKGRNWMIMALVSSGVAICMNTFWDIVIDWGLLR  679



>ref|XP_009360602.1| PREDICTED: phosphate transporter PHO1 homolog 9 [Pyrus x bretschneideri]
Length=779

 Score = 57.0 bits (136),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y+LK G T +ILA V S + T   TYWDIVIDWGLLQ
Sbjct  636  MRTSYDLKAGMTSKILAIVSSVVATAVGTYWDIVIDWGLLQ  676



>emb|CBI25905.3| unnamed protein product [Vitis vinifera]
Length=737

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG   RI+A V S I  IA+TYWD+V DWGLLQ
Sbjct  595  LRTAYSLNKGMRWRIVAWVSSAIAAIASTYWDLVFDWGLLQ  635



>ref|XP_003635556.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Vitis vinifera]
Length=797

 Score = 56.6 bits (135),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/41 (63%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG   RI+A V S I  IA+TYWD+V DWGLLQ
Sbjct  655  LRTAYSLNKGMRWRIVAWVSSAIAAIASTYWDLVFDWGLLQ  695



>ref|XP_006574915.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X4 [Glycine max]
Length=738

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            + RT +ELKKG + ++LA V S +  + NTYWDIV DWGLL+
Sbjct  594  IFRTTFELKKGLSWKVLALVTSALAVLQNTYWDIVRDWGLLR  635



>gb|KHN01982.1| Phosphate transporter PHO1 like 10 [Glycine soja]
Length=756

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            + RT +ELKKG + ++LA V S +  + NTYWDIV DWGLL+
Sbjct  612  IFRTTFELKKGLSWKVLALVTSALAVLQNTYWDIVRDWGLLR  653



>ref|XP_006574913.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X2 [Glycine max]
 ref|XP_006574914.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X3 [Glycine max]
Length=756

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            + RT +ELKKG + ++LA V S +  + NTYWDIV DWGLL+
Sbjct  612  IFRTTFELKKGLSWKVLALVTSALAVLQNTYWDIVRDWGLLR  653



>ref|XP_006574912.1| PREDICTED: phosphate transporter PHO1 homolog 10-like isoform 
X1 [Glycine max]
Length=771

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            + RT +ELKKG + ++LA V S +  + NTYWDIV DWGLL+
Sbjct  627  IFRTTFELKKGLSWKVLALVTSALAVLQNTYWDIVRDWGLLR  668



>gb|KCW86568.1| hypothetical protein EUGRSUZ_B03203 [Eucalyptus grandis]
Length=748

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT  ELKKG    +LA + S I TI NTYWDIV+DWGLL+
Sbjct  599  LVRTACELKKGHAWLVLAFISSAIATIMNTYWDIVVDWGLLR  640



>ref|XP_010044479.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Eucalyptus 
grandis]
Length=753

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT  ELKKG    +LA + S I TI NTYWDIV+DWGLL+
Sbjct  604  LVRTACELKKGHAWLVLAFISSAIATIMNTYWDIVVDWGLLR  645



>ref|XP_004297095.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Fragaria 
vesca subsp. vesca]
Length=806

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L K    +ILA VFS I  ++ TYWD+VIDWGLLQ
Sbjct  664  MRTAYSLNKDVKWKILAGVFSVIAAVSGTYWDLVIDWGLLQ  704



>gb|KGN51946.1| hypothetical protein Csa_5G606370 [Cucumis sativus]
Length=705

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT  EL+KGAT  +LA + S +  + NTYWDIV+DWGLL+
Sbjct  636  LIRTACELRKGATWMVLALISSVVAVLVNTYWDIVVDWGLLR  677



>ref|XP_010258276.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Nelumbo 
nucifera]
Length=794

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT Y L KG   R++A + S I  I +TYWD+V+DWGLLQ
Sbjct  646  VMRTAYGLDKGKGWRVMAGITSAIAAITSTYWDLVVDWGLLQ  687



>ref|XP_004135446.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Cucumis 
sativus]
Length=780

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT  EL+KGAT  +LA + S +  + NTYWDIV+DWGLL+
Sbjct  636  LIRTACELRKGATWMVLALISSVVAVLVNTYWDIVVDWGLLR  677



>ref|XP_009356328.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Pyrus 
x bretschneideri]
Length=784

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    VLRTLYELKKGAT-MRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT+YE+KKG T   +LA + S + T  NTYWDIV+DWGLL+
Sbjct  639  IIRTVYEMKKGKTSWMMLALISSAVATTMNTYWDIVMDWGLLR  681



>gb|AES77499.2| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=780

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT+ +   G   ++LAA  SGI T+ NTYWDIVIDWGLL+
Sbjct  635  MRTIDQFSPGTVWKVLAASSSGIATVVNTYWDIVIDWGLLR  675



>ref|XP_006391011.1| hypothetical protein EUTSA_v10018151mg [Eutrema salsugineum]
 gb|ESQ28297.1| hypothetical protein EUTSA_v10018151mg [Eutrema salsugineum]
Length=780

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELKKG    ILA + SG+    NT+WDIVIDWGLL+
Sbjct  634  IIRTAFELKKGRNWMILALISSGVAAGMNTFWDIVIDWGLLR  675



>gb|EYU44133.1| hypothetical protein MIMGU_mgv1a002044mg [Erythranthe guttata]
Length=723

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 27/44 (61%), Positives = 33/44 (75%), Gaps = 2/44 (5%)
 Frame = +3

Query  3    VLRTLYEL--KKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT+Y L  +K    RI+AA  SG TT+ NTYWDIVIDWGLL+
Sbjct  579  VMRTMYSLNLRKPMFWRIMAASTSGFTTVYNTYWDIVIDWGLLR  622



>ref|XP_003621281.1| Xenotropic and polytropic retrovirus receptor-like protein [Medicago 
truncatula]
Length=929

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT+ +   G   ++LAA  SGI T+ NTYWDIVIDWGLL+
Sbjct  628  MRTIDQFSPGTVWKVLAASSSGIATVVNTYWDIVIDWGLLR  668



>ref|XP_008446395.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Cucumis melo]
Length=783

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT  EL+KGAT  +LA + S +  + NTYWDIV+DWGLL+
Sbjct  639  LVRTACELRKGATWMVLALISSVVAVLVNTYWDIVVDWGLLR  680



>ref|XP_006396863.1| hypothetical protein EUTSA_v10028451mg [Eutrema salsugineum]
 gb|ESQ38316.1| hypothetical protein EUTSA_v10028451mg [Eutrema salsugineum]
Length=770

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG  ++I A VFS + T  +TYWDIV DWGLL 
Sbjct  630  LRTAYSLNKGKVLKIAAWVFSALATFCSTYWDIVFDWGLLH  670



>ref|XP_010258279.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X2 [Nelumbo nucifera]
Length=800

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT Y L+K    +ILA   S I+T+ +TYWDI+IDWGLLQ
Sbjct  657  IMRTAYNLQKVEIWKILAITTSAISTVGSTYWDIIIDWGLLQ  698



>ref|XP_010258277.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X1 [Nelumbo nucifera]
Length=801

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT Y L+K    +ILA   S I+T+ +TYWDI+IDWGLLQ
Sbjct  658  IMRTAYNLQKVEIWKILAITTSAISTVGSTYWDIIIDWGLLQ  699



>gb|KCW56215.1| hypothetical protein EUGRSUZ_I01964 [Eucalyptus grandis]
Length=343

 Score = 54.7 bits (130),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +EL++G T +I+AA  SG+  + NTYWD+VIDWGLL+
Sbjct  206  VARTGHELRRGFTWKIIAATSSGVAMVINTYWDLVIDWGLLR  247



>ref|XP_008379379.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Malus domestica]
Length=783

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT +++K G T +ILA V S + T+  TYWDIVIDWGLLQ
Sbjct  640  MRTSFDMKAGMTWKILAIVSSVVATVFGTYWDIVIDWGLLQ  680



>ref|XP_010258281.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Nelumbo 
nucifera]
Length=810

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT Y L +G T RI+A   S ++ I +TYWD+V DWGLLQ
Sbjct  667  VMRTAYSLSEGMTWRIMAVATSIVSAIVSTYWDLVFDWGLLQ  708



>ref|XP_008350915.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Malus 
domestica]
Length=178

 Score = 52.4 bits (124),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 33/43 (77%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    VLRTLYELKKGATM-RILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT+YE+KKG T   +LA + S + T  NTYWDIV+DWGLL+
Sbjct  33   IIRTVYEMKKGKTSWMVLALISSAVATTMNTYWDIVMDWGLLR  75



>ref|XP_010551414.1| PREDICTED: phosphate transporter PHO1 homolog 10 isoform X1 [Tarenaya 
hassleriana]
Length=778

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELKKG T  +LA + +G+ T  N +WDIV+DWGLL+
Sbjct  633  LIRTAFELKKGGTWMMLALISTGVATAMNLFWDIVLDWGLLR  674



>ref|XP_007226142.1| hypothetical protein PRUPE_ppa014810mg [Prunus persica]
 gb|EMJ27341.1| hypothetical protein PRUPE_ppa014810mg [Prunus persica]
Length=777

 Score = 55.1 bits (131),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    VLRTLYELKKGAT-MRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T   +LA + S + T  N YWDIV+DWGLL+
Sbjct  632  IIRTAYELKKGKTSWMVLALICSAVATTMNMYWDIVVDWGLLR  674



>gb|KHG00426.1| Phosphate transporter PHO1 -like protein [Gossypium arboreum]
Length=775

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 2/43 (5%)
 Frame = +3

Query  6    LRTLYELKKGATMR--ILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT+Y+ +K  T    +LAA  SG+ TI NTYWDIVIDWGLL+
Sbjct  630  LRTIYQFQKQKTTAWLVLAAATSGMATIFNTYWDIVIDWGLLR  672



>gb|KHN33988.1| Phosphate transporter PHO1 like 3 [Glycine soja]
Length=772

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L K     +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  630  LRTAYSLNKSTAWNVLAWIFSIFAAVASTYWDLVIDWGLLQ  670



>ref|XP_003556778.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Glycine 
max]
Length=796

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L K     +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  654  LRTAYSLNKSTAWNVLAWIFSIFAAVASTYWDLVIDWGLLQ  694



>ref|XP_009592876.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Nicotiana tomentosiformis]
Length=781

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V++T Y L+K  T  +LA + S +TT+ NTYWDIV+DWGLL+
Sbjct  636  VIKTAYSLRKSLTWEVLAILSSLVTTLFNTYWDIVVDWGLLR  677



>ref|XP_004490097.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Cicer 
arietinum]
Length=730

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT +E KKG T ++LA + S +  + NTYWDIV DW LLQ
Sbjct  585  VIRTTFETKKGMTWKLLALLTSAVAILLNTYWDIVKDWSLLQ  626



>ref|XP_010525588.1| PREDICTED: phosphate transporter PHO1 homolog 7 isoform X2 [Tarenaya 
hassleriana]
Length=808

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   ++ A VFS I T   TYWDIV+DWGLLQ
Sbjct  638  VRTAYSLDKGIKWKVTAWVFSAIATFYGTYWDIVVDWGLLQ  678



>ref|XP_010525586.1| PREDICTED: phosphate transporter PHO1 homolog 7 isoform X1 [Tarenaya 
hassleriana]
Length=831

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   ++ A VFS I T   TYWDIV+DWGLLQ
Sbjct  661  VRTAYSLDKGIKWKVTAWVFSAIATFYGTYWDIVVDWGLLQ  701



>ref|XP_008221580.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Prunus mume]
Length=767

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 31/43 (72%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    VLRTLYELKKGAT-MRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT YELKKG T   +LA + S + T  N YWDIV+DWGLL+
Sbjct  622  IIRTAYELKKGKTSWMLLALICSAVATTMNMYWDIVVDWGLLR  664



>gb|KDO53652.1| hypothetical protein CISIN_1g004804mg [Citrus sinensis]
Length=729

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L  G + +I++ +FS I TI  TYWD+V+DWGLLQ
Sbjct  587  RTAYSLYMGFSWKIISGIFSAIATIYGTYWDLVVDWGLLQ  626



>ref|XP_010525590.1| PREDICTED: phosphate transporter PHO1 homolog 7 isoform X4 [Tarenaya 
hassleriana]
Length=778

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   ++ A VFS I T   TYWDIV+DWGLLQ
Sbjct  638  VRTAYSLDKGIKWKVTAWVFSAIATFYGTYWDIVVDWGLLQ  678



>ref|XP_006482049.1| PREDICTED: phosphate transporter PHO1 homolog 7-like [Citrus 
sinensis]
Length=729

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L  G + +I++ +FS I TI  TYWD+V+DWGLLQ
Sbjct  587  RTAYSLYMGFSWKIISGIFSAIATIYGTYWDLVVDWGLLQ  626



>ref|XP_010653893.1| PREDICTED: phosphate transporter PHO1 homolog 3 [Vitis vinifera]
Length=797

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   R++A V S I  I++TYWD+VIDWGLLQ
Sbjct  655  VRTAYSLDKGMGWRVIAWVSSIIAAISSTYWDLVIDWGLLQ  695



>ref|XP_010525589.1| PREDICTED: phosphate transporter PHO1 homolog 7 isoform X3 [Tarenaya 
hassleriana]
Length=801

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   ++ A VFS I T   TYWDIV+DWGLLQ
Sbjct  661  VRTAYSLDKGIKWKVTAWVFSAIATFYGTYWDIVVDWGLLQ  701



>ref|XP_006583960.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Glycine 
max]
 gb|KHN42920.1| Phosphate transporter PHO1 like 3 [Glycine soja]
Length=803

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G  ++++A +FS  T I +TYWD+V+DWGLLQ
Sbjct  661  LRTAYTLHQGMGLKVMAWIFSISTAIFSTYWDLVLDWGLLQ  701



>emb|CBI35053.3| unnamed protein product [Vitis vinifera]
Length=773

 Score = 53.9 bits (128),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   R++A V S I  I++TYWD+VIDWGLLQ
Sbjct  631  VRTAYSLDKGMGWRVIAWVSSIIAAISSTYWDLVIDWGLLQ  671



>ref|XP_008446393.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Cucumis 
melo]
Length=830

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKGA-TMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG    ++LAA+FS +  I  TYWDI IDWGLLQ
Sbjct  687  LRTAYSLNKGVIAWKVLAAIFSALAAIICTYWDIAIDWGLLQ  728



>ref|XP_006430515.1| hypothetical protein CICLE_v10011324mg [Citrus clementina]
 gb|ESR43755.1| hypothetical protein CICLE_v10011324mg [Citrus clementina]
Length=605

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L  G + +I++ +FS I TI  TYWD+V+DWGLLQ
Sbjct  463  RTAYSLYMGFSWKIISGIFSAIATIYGTYWDLVVDWGLLQ  502



>ref|XP_004171231.1| PREDICTED: phosphate transporter PHO1 homolog 3-like, partial 
[Cucumis sativus]
Length=760

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKGA-TMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G    ++LAA+FS +  I  TYWDI IDWGLLQ
Sbjct  687  LRTAYSLNRGVIAWKVLAAIFSALAAIICTYWDIAIDWGLLQ  728



>ref|XP_002522477.1| xenotropic and polytropic murine leukemia virus receptor pho1, 
putative [Ricinus communis]
 gb|EEF39969.1| xenotropic and polytropic murine leukemia virus receptor pho1, 
putative [Ricinus communis]
Length=784

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG + R+ A +FS I  +  TYWD+V DWGLLQ
Sbjct  642  LRTAYSLNKGTSWRVAAWIFSVIAALYGTYWDLVFDWGLLQ  682



>ref|XP_010653877.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X2 [Vitis vinifera]
Length=793

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   RI+A V S I  I  TYWD+V DWGLLQ
Sbjct  651  VRTAYSLDKGMGWRIVAWVSSAIAAITGTYWDLVFDWGLLQ  691



>ref|XP_002267154.2| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X1 [Vitis vinifera]
Length=793

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   RI+A V S I  I  TYWD+V DWGLLQ
Sbjct  651  VRTAYSLDKGMGWRIVAWVSSAIAAITGTYWDLVFDWGLLQ  691



>ref|XP_010551415.1| PREDICTED: phosphate transporter PHO1 homolog 10 isoform X2 [Tarenaya 
hassleriana]
Length=653

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELKKG T  +LA + +G+ T  N +WDIV+DWGLL+
Sbjct  508  LIRTAFELKKGGTWMMLALISTGVATAMNLFWDIVLDWGLLR  549



>emb|CAN73334.1| hypothetical protein VITISV_035136 [Vitis vinifera]
Length=793

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   RI+A V S I  I  TYWD+V DWGLLQ
Sbjct  651  VRTAYSLDKGMGWRIVAWVSSAIAAITGTYWDLVFDWGLLQ  691



>ref|XP_010029314.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Eucalyptus 
grandis]
Length=777

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +EL+ G   +I+AA  SG   + NTYWD+VIDWGLL+
Sbjct  640  VARTSHELRGGVMWKIIAAATSGAAMVINTYWDLVIDWGLLR  681



>gb|KCW56213.1| hypothetical protein EUGRSUZ_I01962 [Eucalyptus grandis]
Length=802

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT +EL+ G   +I+AA  SG   + NTYWD+VIDWGLL+
Sbjct  665  VARTSHELRGGVMWKIIAAATSGAAMVINTYWDLVIDWGLLR  706



>ref|XP_010258275.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Nelumbo 
nucifera]
Length=796

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT Y L KG    ++A V S I  I+ TYWDIV+DWGLLQ
Sbjct  654  IMRTAYNLDKGKGWWVMAWVTSAIAAISGTYWDIVVDWGLLQ  695



>emb|CBI35050.3| unnamed protein product [Vitis vinifera]
Length=813

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   RI+A V S I  I  TYWD+V DWGLLQ
Sbjct  671  VRTAYSLDKGMGWRIVAWVSSAIAAITGTYWDLVFDWGLLQ  711



>ref|XP_010653880.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X3 [Vitis vinifera]
Length=752

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG   RI+A V S I  I  TYWD+V DWGLLQ
Sbjct  610  VRTAYSLDKGMGWRIVAWVSSAIAAITGTYWDLVFDWGLLQ  650



>gb|KGN51948.1| hypothetical protein Csa_5G606390 [Cucumis sativus]
Length=830

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKGA-TMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G    ++LAA+FS +  I  TYWDI IDWGLLQ
Sbjct  687  LRTAYSLNRGVIAWKVLAAIFSALAAIICTYWDIAIDWGLLQ  728



>ref|XP_004135162.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Cucumis 
sativus]
Length=812

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKGA-TMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G    ++LAA+FS +  I  TYWDI IDWGLLQ
Sbjct  669  LRTAYSLNRGVIAWKVLAAIFSALAAIICTYWDIAIDWGLLQ  710



>gb|ABD32747.1| EXS, C-terminal [Medicago truncatula]
Length=353

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT+ +   G   ++LAA  SGI T+ NTYWDIVIDWGLL+
Sbjct  208  MRTIDQFSPGTVWKVLAASSSGIATVVNTYWDIVIDWGLLR  248



>ref|XP_011012915.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Populus 
euphratica]
Length=800

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y + KG   R +A VFS I  I  TYWD+V DWGLLQ
Sbjct  658  LRTAYSINKGNGWRAIAWVFSSIAAIFGTYWDLVFDWGLLQ  698



>gb|KHG14521.1| Phosphate transporter PHO1 -like protein [Gossypium arboreum]
Length=804

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG    ILA VFS    I  TYWD+V DWGLLQ
Sbjct  660  LRTAYSLNKGLGWEILALVFSVAAAIVGTYWDLVYDWGLLQ  700



>ref|XP_006348756.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Solanum 
tuberosum]
Length=780

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V++T Y L+K  T  +L  + S ITT+ NTYWDIV+DWGLL+
Sbjct  636  VIKTAYVLRKSLTWEVLVILSSLITTLFNTYWDIVVDWGLLR  677



>ref|XP_003621277.1| Putative small molecule transporter [Medicago truncatula]
 gb|AES77495.1| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=430

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  E +KG   +ILAA  S I T  NTYWDIV+DWGLL+
Sbjct  284  MRTTNEFRKGTVWKILAATSSSIATAFNTYWDIVMDWGLLK  324



>ref|XP_010320921.1| PREDICTED: phosphate transporter PHO1 homolog 10 isoform X2 [Solanum 
lycopersicum]
Length=774

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V++T Y L+K  T  +L  + S ITT+ NTYWDIV+DWGLL+
Sbjct  630  VIKTAYVLRKSLTWEVLVILSSLITTLFNTYWDIVVDWGLLR  671



>ref|XP_004239111.1| PREDICTED: phosphate transporter PHO1 homolog 10 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010320919.1| PREDICTED: phosphate transporter PHO1 homolog 10 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010320920.1| PREDICTED: phosphate transporter PHO1 homolog 10 isoform X1 [Solanum 
lycopersicum]
Length=776

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V++T Y L+K  T  +L  + S ITT+ NTYWDIV+DWGLL+
Sbjct  632  VIKTAYVLRKSLTWEVLVILSSLITTLFNTYWDIVVDWGLLR  673



>gb|KHN33987.1| Phosphate transporter PHO1 like 3 [Glycine soja]
Length=786

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L       +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  644  LRTAYSLNNSMVWMVLAMIFSIFAAVASTYWDLVIDWGLLQ  684



>ref|XP_002315034.1| hypothetical protein POPTR_0010s17220g [Populus trichocarpa]
 gb|EEF01205.1| hypothetical protein POPTR_0010s17220g [Populus trichocarpa]
Length=763

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y + KG   + +A VFS I  I  TYWD+V DWGLLQ
Sbjct  621  LRTAYNINKGDNWKAIAWVFSSIAAIFGTYWDLVFDWGLLQ  661



>ref|XP_003556779.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
1 [Glycine max]
Length=786

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L       +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  644  LRTAYSLNNSMVWMVLAMIFSIFAAVASTYWDLVIDWGLLQ  684



>ref|XP_004298410.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Fragaria 
vesca subsp. vesca]
Length=793

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT Y   K    +ILA +FS ++ +  TYWD+V+DWGLLQ
Sbjct  649  IMRTAYSHNKDVNFKILAGIFSIVSAVYCTYWDLVVDWGLLQ  690



>ref|XP_003556780.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
2 [Glycine max]
Length=801

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L       +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  659  LRTAYSLNNSMVWMVLAMIFSIFAAVASTYWDLVIDWGLLQ  699



>ref|XP_009792492.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Nicotiana sylvestris]
 ref|XP_009792494.1| PREDICTED: phosphate transporter PHO1 homolog 10 [Nicotiana sylvestris]
Length=781

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V++T Y L+K     +LA + S +TT+ NTYWDIV+DWGLL+
Sbjct  636  VIKTAYSLRKSLAWEVLAILSSLVTTLFNTYWDIVVDWGLLR  677



>ref|XP_004141448.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Cucumis 
sativus]
Length=790

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT ++L  G   RI+AA+ S + TI  TYWDIV DWGLLQ
Sbjct  646  MRTGHDLNMGIVWRIMAAISSAVATILGTYWDIVQDWGLLQ  686



>gb|KGN52480.1| hypothetical protein Csa_5G637700 [Cucumis sativus]
Length=784

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT ++L  G   RI+AA+ S + TI  TYWDIV DWGLLQ
Sbjct  640  MRTGHDLNMGIVWRIMAAISSAVATILGTYWDIVQDWGLLQ  680



>ref|XP_004165523.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
9-like [Cucumis sativus]
Length=790

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT ++L  G   RI+AA+ S + TI  TYWDIV DWGLLQ
Sbjct  646  MRTGHDLNMGIVWRIMAAISSAVATILGTYWDIVQDWGLLQ  686



>gb|KDP27174.1| hypothetical protein JCGZ_19873 [Jatropha curcas]
Length=772

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 5/46 (11%)
 Frame = +3

Query  6    LRTLYELKKGAT-----MRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            L+T ++LK G T      +I+ AV SG  TI  TYWDIVIDWGLLQ
Sbjct  630  LKTYHDLKVGKTNLEIIWKIMVAVTSGFATIFGTYWDIVIDWGLLQ  675



>gb|KHG03629.1| Phosphate transporter PHO1 -like protein [Gossypium arboreum]
Length=777

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 2/42 (5%)
 Frame = +3

Query  6    LRTLY--ELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            +RT+Y  + +K  T  +LAA  SGI T+A+TYWDIVIDWGLL
Sbjct  632  IRTIYSHQKQKTKTWLVLAAATSGIATMASTYWDIVIDWGLL  673



>ref|XP_006827326.1| hypothetical protein AMTR_s00010p00267530 [Amborella trichopoda]
 gb|ERM94563.1| hypothetical protein AMTR_s00010p00267530 [Amborella trichopoda]
Length=814

 Score = 52.0 bits (123),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V RT + L+K  +  ++A + S I TI +TYWDIVIDWGLLQ
Sbjct  668  VTRTAFTLQKQMSWMVMAQLSSAIATIISTYWDIVIDWGLLQ  709



>gb|KHG04568.1| Phosphate transporter PHO1 -like protein [Gossypium arboreum]
Length=752

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG + ++LA +FS    I +TYWD+V DWGLL 
Sbjct  610  LRTAYSLNKGLSWKVLAVIFSVAAAIFSTYWDLVHDWGLLH  650



>ref|XP_010108703.1| Phosphate transporter PHO1-10-like protein [Morus notabilis]
 gb|EXC20014.1| Phosphate transporter PHO1-10-like protein [Morus notabilis]
Length=754

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 28/42 (67%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT +ELK G T  + A + S +  I N YWDIV DWGLL+
Sbjct  558  LVRTAFELKGGVTWMVFALISSTVAMIVNAYWDIVFDWGLLR  599



>ref|XP_006827325.1| hypothetical protein AMTR_s00010p00267470 [Amborella trichopoda]
 gb|ERM94562.1| hypothetical protein AMTR_s00010p00267470 [Amborella trichopoda]
Length=788

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            VLRT   ++K    RILA V S + T+  TYWD+VIDWGLLQ
Sbjct  646  VLRTSLSVQKREHWRILAVVSSVVATLLGTYWDLVIDWGLLQ  687



>ref|XP_006482378.1| PREDICTED: phosphate transporter PHO1 homolog 7-like [Citrus 
sinensis]
 gb|KDO53653.1| hypothetical protein CISIN_1g046195mg [Citrus sinensis]
Length=730

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L KG + +I + +FS I TI  TYWD+++DWGLLQ
Sbjct  588  RTAYSLYKGFSWQITSWIFSIIATIYGTYWDLIMDWGLLQ  627



>gb|KFK29040.1| hypothetical protein AALP_AA7G080800 [Arabis alpina]
Length=750

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT + + +G T  I A VFS + T+  TYWDI +DWGLLQ
Sbjct  608  LRTAFTINRGNTWNITAWVFSAVATLYATYWDIFVDWGLLQ  648



>ref|XP_006415951.1| hypothetical protein EUTSA_v10006900mg [Eutrema salsugineum]
 gb|ESQ34304.1| hypothetical protein EUTSA_v10006900mg [Eutrema salsugineum]
Length=749

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G   +I A VFS + T   TYWDIV DWGLL 
Sbjct  609  LRTAYSLHRGNVWKIAAWVFSALATFYGTYWDIVFDWGLLH  649



>gb|KHG22308.1| Phosphate transporter PHO1 -like protein [Gossypium arboreum]
Length=791

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y L KG   RI+A + S I  I  TYWD+V DWGLL
Sbjct  650  LRTAYSLNKGIVWRIIAWIVSAIAAIFCTYWDLVYDWGLL  689



>ref|XP_007046013.1| EXS (ERD1/XPR1/SYG1) family protein [Theobroma cacao]
 gb|EOY01845.1| EXS (ERD1/XPR1/SYG1) family protein [Theobroma cacao]
Length=846

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG   ++LA  FS    I  TYWD+V DWGLLQ
Sbjct  704  LRTAYSLNKGLGWKVLALTFSIAAAIVGTYWDLVYDWGLLQ  744



>ref|XP_010683125.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683126.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010683127.1| PREDICTED: phosphate transporter PHO1 homolog 10-like [Beta vulgaris 
subsp. vulgaris]
Length=755

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT+YELK G    ++A + S +    N YWDIV+DWGLL+
Sbjct  603  VMRTVYELKNGTPWLVMALLTSAMAVAYNIYWDIVMDWGLLR  644



>ref|XP_009356534.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
10-like [Pyrus x bretschneideri]
Length=375

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 32/43 (74%), Gaps = 1/43 (2%)
 Frame = +3

Query  3    VLRTLYELKKGAT-MRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            ++RT+YE+KKG T   +LA + S +    NTYWDIV+DWGLL+
Sbjct  243  IIRTVYEMKKGKTSWMVLALISSAVAMTMNTYWDIVMDWGLLR  285



>ref|XP_002323224.2| EXS family protein [Populus trichocarpa]
 gb|EEF04985.2| EXS family protein [Populus trichocarpa]
Length=774

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y  +KG    I+A +FS I  +  TYWD+V+DWGLLQ
Sbjct  632  RTAYSFEKGLGRNIIACIFSVIAAVYGTYWDLVMDWGLLQ  671



>ref|XP_007032396.1| EXS (ERD1/XPR1/SYG1) family protein, putative [Theobroma cacao]
 gb|EOY03322.1| EXS (ERD1/XPR1/SYG1) family protein, putative [Theobroma cacao]
Length=759

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L +G + + LA  FS +  I  TYWD+VIDWGLLQ
Sbjct  619  RTAYGLDRGDSWKTLAWTFSAMAAIFGTYWDLVIDWGLLQ  658



>ref|XP_006430514.1| hypothetical protein CICLE_v10013608mg [Citrus clementina]
 gb|ESR43754.1| hypothetical protein CICLE_v10013608mg [Citrus clementina]
Length=730

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L KG   +I + +FS I TI  TYWD+++DWGLLQ
Sbjct  588  RTAYSLYKGFNWQITSWIFSIIATIYGTYWDLIMDWGLLQ  627



>ref|XP_002522478.1| xenotropic and polytropic murine leukemia virus receptor pho1, 
putative [Ricinus communis]
 gb|EEF39970.1| xenotropic and polytropic murine leukemia virus receptor pho1, 
putative [Ricinus communis]
Length=779

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L KG    ++A +FS +  +  TYWD+V DWGLLQ
Sbjct  637  LRTAYSLNKGYAWGVIAVIFSVLAALFGTYWDLVFDWGLLQ  677



>ref|XP_010108705.1| Phosphate transporter PHO1-3-like protein [Morus notabilis]
 gb|EXC20016.1| Phosphate transporter PHO1-3-like protein [Morus notabilis]
Length=794

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG + +++A +FS    I +TYWD+ IDWGLLQ
Sbjct  652  VRTAYSLDKGMSWKVVAWIFSISAAIFSTYWDLFIDWGLLQ  692



>ref|XP_007046010.1| EXS (ERD1/XPR1/SYG1) family protein [Theobroma cacao]
 gb|EOY01842.1| EXS (ERD1/XPR1/SYG1) family protein [Theobroma cacao]
Length=790

 Score = 50.4 bits (119),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y + KG   RI+A V S I  I  TYWD+V DWGLL
Sbjct  649  LRTAYSINKGIGWRIIAWVVSAIAAIFCTYWDLVYDWGLL  688



>ref|XP_011075530.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X4 [Sesamum indicum]
Length=755

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L +G T +++A + S I TI +TYWDIV+DWGL Q
Sbjct  614  RTAYTLNRGDTWKLVAWIASIIATIYSTYWDIVMDWGLFQ  653



>ref|XP_011075529.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X3 [Sesamum indicum]
Length=768

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L +G T +++A + S I TI +TYWDIV+DWGL Q
Sbjct  627  RTAYTLNRGDTWKLVAWIASIIATIYSTYWDIVMDWGLFQ  666



>emb|CBI35052.3| unnamed protein product [Vitis vinifera]
Length=750

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L +G   RI+A + S    + +TYWD+V DWGLLQ
Sbjct  607  VRTAYSLNRGLAWRIVAFISSAFAAVFSTYWDLVFDWGLLQ  647



>ref|XP_011041394.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Populus 
euphratica]
Length=774

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y  +KG    I+A +FS I  +  TYWD+V+DWGLLQ
Sbjct  632  RTAYSFEKGLGRNIIAWIFSVIAAVYGTYWDLVMDWGLLQ  671



>ref|XP_002266671.2| PREDICTED: phosphate transporter PHO1 homolog 3-like [Vitis vinifera]
Length=802

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L +G   RI+A + S    + +TYWD+V DWGLLQ
Sbjct  659  VRTAYSLNRGLAWRIVAFISSAFAAVFSTYWDLVFDWGLLQ  699



>ref|XP_010500027.1| PREDICTED: phosphate transporter PHO1 homolog 8 isoform X2 [Camelina 
sativa]
Length=750

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            L+T Y L +G   RI   VFS + T   TYWDIV DWGLL 
Sbjct  609  LKTAYSLNRGNAWRIATFVFSALATFYGTYWDIVYDWGLLH  649



>ref|XP_010500026.1| PREDICTED: phosphate transporter PHO1 homolog 8 isoform X1 [Camelina 
sativa]
Length=751

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            L+T Y L +G   RI   VFS + T   TYWDIV DWGLL 
Sbjct  610  LKTAYSLNRGNAWRIATFVFSALATFYGTYWDIVYDWGLLH  650



>ref|NP_174768.2| phosphate transporter PHO1-8 [Arabidopsis thaliana]
 sp|Q6R8G2.1|PHO18_ARATH RecName: Full=Phosphate transporter PHO1 homolog 8; AltName: 
Full=Protein PHO1 homolog 8; Short=AtPHO1;H8 [Arabidopsis thaliana]
 gb|AAR99490.1| PHO1-like protein [Arabidopsis thaliana]
 gb|AEE31785.1| phosphate transporter PHO1-8 [Arabidopsis thaliana]
Length=751

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT + + +G   +I A VFSG+ T   TYWDIV DWGLL 
Sbjct  610  LRTAFSINRGNDWKIAAWVFSGLATFYGTYWDIVYDWGLLH  650



>gb|AAG51461.1|AC069160_7 unknown protein [Arabidopsis thaliana]
Length=747

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT + + +G   +I A VFSG+ T   TYWDIV DWGLL 
Sbjct  606  LRTAFSINRGNDWKIAAWVFSGLATFYGTYWDIVYDWGLLH  646



>ref|XP_011075528.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X2 [Sesamum indicum]
Length=793

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L +G T +++A + S I TI +TYWDIV+DWGL Q
Sbjct  652  RTAYTLNRGDTWKLVAWIASIIATIYSTYWDIVMDWGLFQ  691



>ref|XP_011075527.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
X1 [Sesamum indicum]
Length=793

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L +G T +++A + S I TI +TYWDIV+DWGL Q
Sbjct  652  RTAYTLNRGDTWKLVAWIASIIATIYSTYWDIVMDWGLFQ  691



>gb|KEH37711.1| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=719

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  45   RILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +ILAA  SGI T+ NTYWDIVIDWGLL+
Sbjct  666  KILAASSSGIATVVNTYWDIVIDWGLLR  693



>ref|XP_010461306.1| PREDICTED: phosphate transporter PHO1 homolog 8-like [Camelina 
sativa]
Length=750

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            L+T Y L +G   RI   VFS + T   TYWDIV DWGLL 
Sbjct  609  LKTAYSLNRGNAWRIATFVFSALATFYGTYWDIVYDWGLLH  649



>gb|KDO37266.1| hypothetical protein CISIN_1g041540mg [Citrus sinensis]
Length=456

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT   L +G   ++++ +FS I TI  TYWD+V+DWGLLQ
Sbjct  345  RTACTLYRGFRWKLISGIFSAIATIYGTYWDLVVDWGLLQ  384



>gb|KEH37710.1| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=799

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  45   RILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +ILAA  SGI T+ NTYWDIVIDWGLL+
Sbjct  666  KILAASSSGIATVVNTYWDIVIDWGLLR  693



>ref|XP_010258335.1| PREDICTED: phosphate transporter PHO1 homolog 3 [Nelumbo nucifera]
 ref|XP_010258342.1| PREDICTED: phosphate transporter PHO1 homolog 3 [Nelumbo nucifera]
 ref|XP_010258351.1| PREDICTED: phosphate transporter PHO1 homolog 3 [Nelumbo nucifera]
Length=801

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L KG     +A + S I  I++TYWDIV+DWGLLQ
Sbjct  653  MRTAYGLDKGKGWWAMAWITSSIAAISSTYWDIVVDWGLLQ  693



>ref|XP_004141577.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Cucumis 
sativus]
Length=777

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  +L  G T R LA V S I TI+ TYWDIV DWGLL+
Sbjct  637  MRTGNDLNMGMTWRTLAIVSSVIATISGTYWDIVCDWGLLR  677



>ref|NP_173995.1| phosphate transporter PHO1-7 [Arabidopsis thaliana]
 sp|Q6R8G3.1|PHO17_ARATH RecName: Full=Phosphate transporter PHO1 homolog 7; AltName: 
Full=Protein PHO1 homolog 7; Short=AtPHO1;H7 [Arabidopsis thaliana]
 gb|AAR99489.1| PHO1-like protein [Arabidopsis thaliana]
 gb|AEE30725.1| phosphate transporter PHO1-7 [Arabidopsis thaliana]
Length=750

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y   +G   +I A VFS + T   TYWDIV DWGLL 
Sbjct  609  LRTAYSFNRGNIWKISAWVFSALATFYGTYWDIVFDWGLLH  649



>ref|XP_008459340.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X1 [Cucumis melo]
 ref|XP_008459341.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X1 [Cucumis melo]
Length=778

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  +L  G T R LA V S I TI+ TYWDIV DWGLL+
Sbjct  638  MRTGNDLNMGMTWRTLAIVSSVIATISGTYWDIVCDWGLLR  678



>gb|AAF87029.1|AC006535_7 T24P13.11 [Arabidopsis thaliana]
Length=759

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y   +G   +I A VFS + T   TYWDIV DWGLL 
Sbjct  609  LRTAYSFNRGNIWKISAWVFSALATFYGTYWDIVFDWGLLH  649



>gb|KGN52478.1| hypothetical protein Csa_5G637680 [Cucumis sativus]
Length=762

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  +L  G T R LA V S I TI+ TYWDIV DWGLL+
Sbjct  622  MRTGNDLNMGMTWRTLAIVSSVIATISGTYWDIVCDWGLLR  662



>ref|XP_004171216.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Cucumis 
sativus]
Length=772

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  +L  G T R LA V S I TI+ TYWDIV DWGLL+
Sbjct  632  MRTGNDLNMGMTWRTLAIVSSVIATISGTYWDIVCDWGLLR  672



>ref|XP_008459342.1| PREDICTED: phosphate transporter PHO1 homolog 9-like isoform 
X2 [Cucumis melo]
Length=773

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  +L  G T R LA V S I TI+ TYWDIV DWGLL+
Sbjct  633  MRTGNDLNMGMTWRTLAIVSSVIATISGTYWDIVCDWGLLR  673



>ref|XP_002315035.2| hypothetical protein POPTR_0010s17260g [Populus trichocarpa]
 gb|EEF01206.2| hypothetical protein POPTR_0010s17260g [Populus trichocarpa]
Length=767

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +R  Y + KG   R  A VFS I  I  TYWD+V DWGLLQ
Sbjct  625  MRIAYNINKGDGWRATAWVFSSIAAIIGTYWDLVFDWGLLQ  665



>gb|KFK43653.1| hypothetical protein AALP_AA1G155200 [Arabis alpina]
Length=770

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y ++KG    RILAA+FS I  +  T+WD V DWGLL+
Sbjct  627  LRTAYSIQKGQVAWRILAAIFSAIAAVYCTWWDFVHDWGLLK  668



>ref|XP_006430513.1| hypothetical protein CICLE_v10013830mg, partial [Citrus clementina]
 gb|ESR43753.1| hypothetical protein CICLE_v10013830mg, partial [Citrus clementina]
Length=447

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT   L +G   ++++ +FS I TI  TYWD+V+DWGLLQ
Sbjct  330  RTACTLYRGFRWKLISGIFSAIATIYGTYWDLVVDWGLLQ  369



>gb|KEH25753.1| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=182

 Score = 47.4 bits (111),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +3

Query  45   RILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +ILAA  SGI T+ NTYWDIVIDWGLL+
Sbjct  49   KILAASSSGIATVVNTYWDIVIDWGLLR  76



>ref|XP_009110032.1| PREDICTED: phosphate transporter PHO1 homolog 8-like [Brassica 
rapa]
Length=748

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G   R+ A VFS + T   TYWDIV DWG L 
Sbjct  608  LRTAYSLNRGNNWRLAAWVFSALATFYGTYWDIVHDWGFLH  648



>emb|CDY46445.1| BnaA08g19850D [Brassica napus]
Length=748

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G   R+ A VFS + T   TYWDIV DWG L 
Sbjct  608  LRTAYSLNRGNNWRLAAWVFSALATFYGTYWDIVHDWGFLH  648



>ref|XP_008221577.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Prunus 
mume]
Length=806

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = +3

Query  6    LRTLY---ELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y    LK     +ILA VFS +  I  TYWD+V+DWGLLQ
Sbjct  661  MRTAYNLESLKNEVNWKILAGVFSIVAAIYGTYWDLVVDWGLLQ  704



>ref|XP_007227001.1| hypothetical protein PRUPE_ppa001513mg [Prunus persica]
 gb|EMJ28200.1| hypothetical protein PRUPE_ppa001513mg [Prunus persica]
Length=811

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = +3

Query  6    LRTLY---ELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y    LK     +ILA VFS +  I  TYWD+V+DWGLLQ
Sbjct  666  MRTAYNLESLKNEVNWKILAGVFSIVAAIYGTYWDLVVDWGLLQ  709



>ref|XP_008350917.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
3-like [Malus domestica]
Length=794

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +R  Y   K    +ILA +FS +  I  TYWD+V+DWGLLQ
Sbjct  652  MRIAYTHNKDVNWKILAGIFSIVAAIYGTYWDLVVDWGLLQ  692



>ref|XP_008389440.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Malus domestica]
Length=794

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +R  Y   K    +ILA +FS +  I  TYWD+V+DWGLLQ
Sbjct  652  MRIAYTHNKDVNWKILAGIFSIVAAIYGTYWDLVVDWGLLQ  692



>ref|XP_004297283.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Fragaria 
vesca subsp. vesca]
Length=801

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L      +ILA +FS I  +  TYWD+V+DWGLL 
Sbjct  660  MRTAYSLNMDVNWKILAGIFSIIAALYGTYWDLVVDWGLLH  700



>ref|XP_006605562.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Glycine 
max]
 gb|KHN35286.1| Phosphate transporter PHO1 like 3 [Glycine soja]
Length=802

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT   L +G    +LA +FS  T+I +TYWD+V+DWGLLQ
Sbjct  660  LRTASTLNQGMGWTVLAWIFSISTSIFSTYWDLVLDWGLLQ  700



>ref|NP_172857.2| phosphate transporter PHO1-3 [Arabidopsis thaliana]
 sp|Q6R8G7.2|PHO13_ARATH RecName: Full=Phosphate transporter PHO1 homolog 3; AltName: 
Full=Protein PHO1 homolog 3; Short=AtPHO1;H3 [Arabidopsis thaliana]
 gb|AEE29101.1| phosphate transporter PHO1-3 [Arabidopsis thaliana]
Length=813

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y ++KG    R+LAAVFS I  I  TYWD V DWGLL
Sbjct  670  LRTAYSIQKGQVAWRVLAAVFSFIAAIFCTYWDFVHDWGLL  710



>emb|CDX82870.1| BnaC01g13200D [Brassica napus]
Length=747

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G   R+ A VFS + T   TYWDIV DWG L 
Sbjct  607  LRTAYSLNRGNNWRLAAWVFSALATFYGTYWDIVHDWGFLH  647



>ref|XP_009115405.1| PREDICTED: phosphate transporter PHO1 homolog 8 [Brassica rapa]
Length=740

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 26/41 (63%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G + R  A  FS + T+  TYWDIV DWGLL 
Sbjct  604  LRTAYSLNRGNSWRNAAWFFSALATLYGTYWDIVFDWGLLH  644



>ref|XP_008459343.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
9-like [Cucumis melo]
Length=785

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT  +L  G   +I+AA+ S + TI  TYWDIV DWGLLQ
Sbjct  640  MRTGDDLNMGIVWKIMAAISSAVATILGTYWDIVQDWGLLQ  680



>gb|AAR99485.1| PHO1-like protein [Arabidopsis thaliana]
Length=813

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y ++KG    R+LAAVFS I  I  TYWD V DWGLL
Sbjct  670  LRTAYSIQKGQVAWRVLAAVFSFIAAIFCTYWDFVHDWGLL  710



>gb|AAF79407.1|AC068197_17 F16A14.26 [Arabidopsis thaliana]
Length=841

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y ++KG    R+LAAVFS I  I  TYWD V DWGLL
Sbjct  698  LRTAYSIQKGQVAWRVLAAVFSFIAAIFCTYWDFVHDWGLL  738



>emb|CDY00103.1| BnaC09g01980D [Brassica napus]
Length=798

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            RT++E++KG  +  +A   S I T+ NTYWDI +DWGL+
Sbjct  657  RTIFEMQKGRYLLTVAVATSTIATLFNTYWDIFMDWGLM  695



>ref|XP_008221578.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Prunus 
mume]
Length=806

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = +3

Query  6    LRTLY---ELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y    LK     +ILA VFS +  I  TYWD+V+DWGLLQ
Sbjct  661  MRTAYNLESLKNEVNWKILAGVFSIVAAIYGTYWDLVVDWGLLQ  704



>ref|XP_003613881.1| Xenotropic and polytropic retrovirus receptor-like protein [Medicago 
truncatula]
Length=753

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT +E KK  T ++ A + S +  + N YWDIV DW LLQ
Sbjct  608  VIRTTFETKKAMTWKVWALISSAVAILLNIYWDIVKDWSLLQ  649



>ref|XP_009111779.1| PREDICTED: phosphate transporter PHO1 homolog 9-like [Brassica 
rapa]
Length=795

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            RT++E++KG  +  +A   S I T+ NTYWDI +DWGL+
Sbjct  654  RTIFEMQKGRYLLTVAVATSTIATLFNTYWDIFMDWGLM  692



>gb|AES96839.2| phosphate transporter PHO1-like protein [Medicago truncatula]
Length=776

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/42 (48%), Positives = 27/42 (64%), Gaps = 0/42 (0%)
 Frame = +3

Query  3    VLRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            V+RT +E KK  T ++ A + S +  + N YWDIV DW LLQ
Sbjct  631  VIRTTFETKKAMTWKVWALISSAVAILLNIYWDIVKDWSLLQ  672



>emb|CDY19999.1| BnaA09g02520D [Brassica napus]
Length=798

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/39 (49%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            RT++E++KG  +  +A   S I T+ NTYWDI +DWGL+
Sbjct  657  RTIFEMQKGRYLLTVAVATSTIATLFNTYWDIFMDWGLM  695



>emb|CBI35054.3| unnamed protein product [Vitis vinifera]
Length=813

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKGA-TMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L +G     I+A +FS I  I  TYWD+V+DWGLLQ
Sbjct  670  VRTAYSLDRGKINWNIMAWIFSVIAAICGTYWDLVVDWGLLQ  711



>emb|CDY58396.1| BnaCnng33210D [Brassica napus]
Length=738

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G + R  A  FS + T   TYWDIV DWGLL 
Sbjct  602  LRTAYSLNRGNSWRNAAWFFSALATFYGTYWDIVFDWGLLH  642



>gb|KFK43650.1| hypothetical protein AALP_AA1G154600 [Arabis alpina]
Length=805

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 29/42 (69%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y ++KG    R+LAA+FS I  +  T+WD V DWGLL+
Sbjct  662  LRTAYSIQKGQVAWRVLAAIFSAIAAVYCTWWDFVHDWGLLK  703



>ref|XP_002264904.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Vitis vinifera]
Length=796

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 28/42 (67%), Gaps = 1/42 (2%)
 Frame = +3

Query  6    LRTLYELKKGA-TMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y L +G     I+A +FS I  I  TYWD+V+DWGLLQ
Sbjct  653  VRTAYSLDRGKINWNIMAWIFSVIAAICGTYWDLVVDWGLLQ  694



>emb|CDY16184.1| BnaA09g29180D [Brassica napus]
Length=740

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT Y L +G + R  A  FS + T   TYWDIV DWGLL 
Sbjct  604  LRTAYSLNRGNSWRNAAWFFSALATFYGTYWDIVFDWGLLH  644



>ref|XP_007158639.1| hypothetical protein PHAVU_002G169700g [Phaseolus vulgaris]
 gb|ESW30633.1| hypothetical protein PHAVU_002G169700g [Phaseolus vulgaris]
Length=792

 Score = 48.5 bits (114),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 27/41 (66%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +R  Y        ++LA VFS +  +A+TYWD+VIDWGLLQ
Sbjct  650  IRIAYSRNNSMVWKVLAWVFSILAAVASTYWDLVIDWGLLQ  690



>ref|XP_003556776.1| PREDICTED: phosphate transporter PHO1 homolog 3-like isoform 
1 [Glycine max]
Length=795

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
             RT Y         +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  653  FRTAYSRNNSMAWMVLAWIFSVFAAVASTYWDLVIDWGLLQ  693



>gb|KHN33989.1| Phosphate transporter PHO1 like 3 [Glycine soja]
Length=795

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
             RT Y         +LA +FS    +A+TYWD+VIDWGLLQ
Sbjct  653  FRTAYNRNNSMAWMVLAWIFSVFAAVASTYWDLVIDWGLLQ  693



>gb|KHG26693.1| PHO1,H3: Phosphate transporter PHO1 3 [Gossypium arboreum]
Length=159

 Score = 45.8 bits (107),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 25/40 (63%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L  G   RI+A + S I  I  TYWD+V DWGLLQ
Sbjct  19   RTAYSLNAGTGWRIVAWICSAIAAIYGTYWDLVADWGLLQ  58



>gb|EYU28795.1| hypothetical protein MIMGU_mgv1a001431mg [Erythranthe guttata]
Length=820

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/40 (50%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            RT Y L KG   +I+A + S +  + +TYWDIVIDWG  Q
Sbjct  679  RTAYTLNKGIGWKIVAWIASVVAAVTSTYWDIVIDWGFFQ  718



>gb|KFK33778.1| hypothetical protein AALP_AA5G058900 [Arabis alpina]
Length=801

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            RT++E+KKG     +A   S I T+ NTYWDI  DWGL+
Sbjct  660  RTIFEVKKGTYWLTVAVTTSSIATLFNTYWDIFKDWGLM  698



>ref|XP_006290617.1| hypothetical protein CARUB_v10016708mg [Capsella rubella]
 gb|EOA23515.1| hypothetical protein CARUB_v10016708mg [Capsella rubella]
Length=789

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +3

Query  9    RTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            RT++E+KKG     +A   S I T+ NTYWDI  DWGL+
Sbjct  648  RTIFEMKKGTYWLTVAVTTSTIATLFNTYWDIFRDWGLM  686



>gb|KFK33490.1| hypothetical protein AALP_AA5G019500 [Arabis alpina]
Length=821

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 28/42 (67%), Gaps = 2/42 (5%)
 Frame = +3

Query  6    LRTLYELKKGATM--RILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y + K   +  RILA +FS I  I  TYWD+V+DWGLL
Sbjct  677  LRTTYSVDKDNELVWRILAGIFSAIAAIFCTYWDLVLDWGLL  718



>ref|XP_007227298.1| hypothetical protein PRUPE_ppa016990mg, partial [Prunus persica]
 gb|EMJ28497.1| hypothetical protein PRUPE_ppa016990mg, partial [Prunus persica]
Length=546

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 28/44 (64%), Gaps = 3/44 (7%)
 Frame = +3

Query  6    LRTLY---ELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +RT Y    LK     +ILA VFS +  I  TYWD+V+DWGLLQ
Sbjct  401  MRTAYNLESLKNEVNWKILAGVFSIVAAIYGTYWDLVVDWGLLQ  444



>ref|XP_007158638.1| hypothetical protein PHAVU_002G169600g [Phaseolus vulgaris]
 gb|ESW30632.1| hypothetical protein PHAVU_002G169600g [Phaseolus vulgaris]
Length=801

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            LRT   L  G   +++A +FS  T I +TYWD+VIDWGLLQ
Sbjct  656  LRTADSLDGGWRWKVMAWIFSISTAIFSTYWDLVIDWGLLQ  696



>ref|XP_010458876.1| PREDICTED: phosphate transporter PHO1 homolog 3-like [Camelina 
sativa]
Length=817

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y ++KG    R+LAAVFS I  I  T+WD V DWGLL
Sbjct  674  LRTAYSIQKGQVAWRVLAAVFSFIAAIFCTWWDFVHDWGLL  714



>ref|XP_006305938.1| hypothetical protein CARUB_v10011174mg [Capsella rubella]
 gb|EOA38836.1| hypothetical protein CARUB_v10011174mg [Capsella rubella]
Length=818

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 1/41 (2%)
 Frame = +3

Query  6    LRTLYELKKG-ATMRILAAVFSGITTIANTYWDIVIDWGLL  125
            LRT Y ++KG    R+LAAVFS I  +  T+WD V DWGLL
Sbjct  675  LRTAYSIQKGQVAWRVLAAVFSFIAAVYCTWWDFVHDWGLL  715



>ref|XP_009356333.1| PREDICTED: LOW QUALITY PROTEIN: phosphate transporter PHO1 homolog 
3-like [Pyrus x bretschneideri]
Length=793

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 25/41 (61%), Gaps = 0/41 (0%)
 Frame = +3

Query  6    LRTLYELKKGATMRILAAVFSGITTIANTYWDIVIDWGLLQ  128
            +R  Y        +ILA +FS +  I  TYWD+V+DWGLLQ
Sbjct  651  MRIAYTHNNDVNWKILAGIFSIVAAIYGTYWDLVVDWGLLQ  691



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 515174157784