BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7065_g1_i1 len=1583 path=[334:0-331 666:332-1582]

Length=1583
                                                                      Score     E

ref|XP_009618741.1|  PREDICTED: chalcone synthase                       619   0.0      
ref|XP_009785374.1|  PREDICTED: chalcone synthase                       617   0.0      
ref|XP_008375736.1|  PREDICTED: chalcone synthase                       613   0.0      
ref|XP_007052226.1|  Chalcone and stilbene synthase family protein      612   0.0      
gb|AGO05924.1|  anther-specific protein                                 609   0.0      
gb|KDP28845.1|  hypothetical protein JCGZ_14616                         608   0.0      
emb|CAA74847.1|  anther-specific protein                                606   0.0      Nicotiana sylvestris
ref|XP_002276642.1|  PREDICTED: chalcone synthase isoform X2            604   0.0      Vitis vinifera
emb|CBI16627.3|  unnamed protein product                                605   0.0      
ref|XP_006347928.1|  PREDICTED: octaketide synthase 3-like              599   0.0      
ref|XP_011017423.1|  PREDICTED: chalcone synthase-like                  601   0.0      
ref|XP_002302511.1|  chalcone and stilbene synthase family protein      598   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006445367.1|  hypothetical protein CICLE_v10020530mg             597   0.0      
ref|XP_006375238.1|  chalcone and stilbene synthase family protein      597   0.0      
ref|XP_007140778.1|  hypothetical protein PHAVU_008G141200g             595   0.0      
emb|CDP09465.1|  unnamed protein product                                595   0.0      
ref|XP_010474834.1|  PREDICTED: chalcone synthase isoform X1            595   0.0      
ref|XP_004229766.1|  PREDICTED: chalcone synthase 6-4                   594   0.0      
ref|XP_010474836.1|  PREDICTED: chalcone synthase isoform X2            593   0.0      
ref|XP_010692112.1|  PREDICTED: chalcone synthase                       593   0.0      
emb|CAN83038.1|  hypothetical protein VITISV_034337                     592   0.0      Vitis vinifera
gb|KHF97528.1|  Chalcone synthase 9                                     592   0.0      
ref|XP_003516799.1|  PREDICTED: chalcone synthase-like                  592   0.0      
ref|XP_010540240.1|  PREDICTED: chalcone synthase                       591   0.0      
emb|CDX93339.1|  BnaC04g45570D                                          591   0.0      
ref|XP_010107936.1|  Chalcone synthase A                                591   0.0      
ref|XP_011094451.1|  PREDICTED: LOW QUALITY PROTEIN: chalcone syn...    590   0.0      
ref|XP_006418482.1|  hypothetical protein EUTSA_v10007831mg             590   0.0      
ref|XP_007219350.1|  hypothetical protein PRUPE_ppa019432mg             588   0.0      
ref|XP_009141701.1|  PREDICTED: chalcone synthase                       589   0.0      
ref|XP_010258840.1|  PREDICTED: chalcone synthase-like                  589   0.0      
gb|ADF43044.1|  chalcone synthase 3 protein                             587   0.0      
emb|CDY18415.1|  BnaA04g21720D                                          587   0.0      
gb|EYU31920.1|  hypothetical protein MIMGU_mgv1a007619mg                587   0.0      
gb|AEE69028.1|  polyketide synthase                                     586   0.0      
ref|XP_004492184.1|  PREDICTED: chalcone synthase-like                  585   0.0      
gb|ABP98922.1|  polyketide synthase                                     584   0.0      Hypericum perforatum
gb|AFN26935.1|  polyketide synthase                                     584   0.0      
ref|XP_003607498.1|  Chalcone synthase                                  581   0.0      
ref|XP_004308525.1|  PREDICTED: pentatricopeptide repeat-containi...    606   0.0      
ref|XP_010501268.1|  PREDICTED: pentatricopeptide repeat-containi...    602   0.0      
gb|AAY96720.1|  chalcone synthase family protein                        574   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAY96721.1|  chalcone synthase family protein                        573   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81860.1|  chalcone synthase family protein                        573   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_002889339.1|  chalcone synthase family protein                   573   0.0      
ref|XP_010456329.1|  PREDICTED: chalcone synthase-like isoform X1       573   0.0      
ref|NP_171707.1|  polyketide synthase A                                 573   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAY96741.1|  chalcone synthase family protein                        573   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010456330.1|  PREDICTED: chalcone synthase-like isoform X2       573   0.0      
gb|AAZ81859.1|  chalcone synthase family protein                        573   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ81863.1|  chalcone synthase family protein                        573   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ81867.1|  chalcone synthase family protein                        573   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAY96729.1|  chalcone synthase family protein                        573   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAY96717.1|  chalcone synthase family protein                        573   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|ACY74337.1|  putative chalcone synthase                              572   0.0      Artemisia annua [sweet Annie]
ref|XP_008232397.1|  PREDICTED: pentatricopeptide repeat-containi...    599   0.0      
gb|AAY96719.1|  chalcone synthase family protein                        572   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAY96723.1|  chalcone synthase family protein                        572   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAY96725.1|  chalcone synthase family protein                        572   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81870.1|  chalcone synthase family protein                        572   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ81868.1|  chalcone synthase family protein                        572   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAZ81872.1|  chalcone synthase family protein                        571   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAY96745.1|  chalcone synthase family protein                        571   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAY96728.1|  chalcone synthase family protein                        570   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81873.1|  chalcone synthase family protein                        570   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_011042452.1|  PREDICTED: pentatricopeptide repeat-containi...    597   0.0      
gb|AAZ81862.1|  chalcone synthase family protein                        568   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAY96748.1|  chalcone synthase family protein                        568   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81871.1|  chalcone synthase family protein                        568   0.0      Arabidopsis halleri subsp. gemmifera
gb|AAY96746.1|  chalcone synthase family protein                        566   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAZ81861.1|  chalcone synthase family protein                        566   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_002511627.1|  pentatricopeptide repeat-containing protein,...    591   0.0      Ricinus communis
ref|XP_008444217.1|  PREDICTED: chalcone synthase                       563   0.0      
ref|XP_002875049.1|  hypothetical protein ARALYDRAFT_490563             563   0.0      
ref|XP_006290098.1|  hypothetical protein CARUB_v10003743mg             562   0.0      
ref|XP_004142644.1|  PREDICTED: chalcone synthase J-like                560   0.0      
gb|AAM63363.1|  putative chalcone synthase                              559   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX83215.1|  BnaA03g22910D                                          559   0.0      
ref|XP_006396202.1|  hypothetical protein EUTSA_v10028565mg             559   0.0      
ref|NP_191915.1|  Chalcone and stilbene synthase family protein         558   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133969.1|  PREDICTED: chalcone synthase                       556   0.0      
gb|ADF43043.1|  chalcone synthase 2 protein                             556   0.0      
emb|CDY21499.1|  BnaC03g26980D                                          555   0.0      
ref|XP_006396200.1|  hypothetical protein EUTSA_v10028565mg             560   0.0      
gb|AAZ81869.1|  chalcone synthase family protein                        553   0.0      Arabidopsis halleri subsp. gemmifera
ref|XP_006837297.1|  hypothetical protein AMTR_s00111p00033190          550   0.0      
ref|XP_010053966.1|  PREDICTED: chalcone synthase-like                  550   0.0      
gb|EPS63204.1|  hypothetical protein M569_11580                         523   8e-180   
ref|XP_010661353.1|  PREDICTED: chalcone synthase isoform X1            521   1e-178   
ref|XP_010934708.1|  PREDICTED: chalcone synthase-like                  507   2e-174   
emb|CDO96957.1|  unnamed protein product                                498   9e-170   
gb|AAZ23686.1|  chalcone synthase family protein                        498   1e-169   Arabidopsis halleri subsp. gemmifera
gb|AAZ23702.1|  chalcone synthase family protein                        497   1e-169   Arabidopsis thaliana [mouse-ear cress]
gb|ABK28665.1|  unknown                                                 497   2e-169   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23704.1|  chalcone synthase family protein                        497   2e-169   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567971.1|  protein LESS ADHESIVE POLLEN 5                        497   2e-169   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23717.1|  chalcone synthase family protein                        497   2e-169   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092869.1|  PREDICTED: chalcone synthase                       496   3e-169   
ref|XP_002869122.1|  chalcone synthase family protein                   496   3e-169   
gb|AAB80804.1|  chalcone synthase homolog PrChS1                        496   4e-169   Pinus radiata
gb|AAZ23682.1|  chalcone synthase family protein                        496   4e-169   Arabidopsis halleri subsp. gemmifera
ref|XP_010088676.1|  Chalcone synthase 9                                496   5e-169   
ref|XP_010437562.1|  PREDICTED: chalcone synthase-like                  496   7e-169   
gb|AAZ23683.1|  chalcone synthase family protein                        496   7e-169   Arabidopsis halleri subsp. gemmifera
gb|AAZ23705.1|  chalcone synthase family protein                        495   1e-168   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ23721.1|  chalcone synthase family protein                        495   1e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007041944.1|  Chalcone and stilbene synthase family protein      495   1e-168   
gb|AAZ23684.1|  chalcone synthase family protein                        494   1e-168   Arabidopsis halleri subsp. gemmifera
ref|XP_006285956.1|  hypothetical protein CARUB_v10007475mg             495   2e-168   
ref|XP_006423581.1|  hypothetical protein CICLE_v10028633mg             494   2e-168   
gb|AAZ23699.1|  chalcone synthase family protein                        494   2e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268693.1|  PREDICTED: chalcone synthase                       494   2e-168   
ref|XP_002529257.1|  Chalcone synthase, putative                        494   2e-168   Ricinus communis
ref|XP_010432375.1|  PREDICTED: chalcone synthase-like                  494   3e-168   
ref|XP_006487398.1|  PREDICTED: chalcone synthase 6-like                494   3e-168   
gb|AAZ23685.1|  chalcone synthase family protein                        494   4e-168   Arabidopsis halleri subsp. gemmifera
ref|XP_008775196.1|  PREDICTED: chalcone synthase-like                  491   5e-168   
ref|XP_006396201.1|  hypothetical protein EUTSA_v10028565mg             492   5e-168   
ref|XP_009799363.1|  PREDICTED: chalcone synthase                       493   5e-168   
gb|AAZ23693.1|  chalcone synthase family protein                        493   6e-168   Arabidopsis halleri subsp. gemmifera
gb|AAZ23692.1|  chalcone synthase family protein                        493   9e-168   Arabidopsis halleri subsp. gemmifera
ref|XP_007199914.1|  hypothetical protein PRUPE_ppa006852mg             492   1e-167   
ref|XP_010447028.1|  PREDICTED: chalcone synthase                       492   2e-167   
ref|XP_006379273.1|  chalcone and stilbene synthase family protein      491   3e-167   
ref|XP_010690460.1|  PREDICTED: chalcone synthase                       492   3e-167   
gb|AAZ23688.1|  chalcone synthase family protein                        491   3e-167   Arabidopsis halleri subsp. gemmifera
emb|CDX69091.1|  BnaC01g03620D                                          490   9e-167   
ref|XP_009350954.1|  PREDICTED: chalcone synthase                       490   1e-166   
ref|XP_007131762.1|  hypothetical protein PHAVU_011G039700g             490   1e-166   
ref|XP_004505681.1|  PREDICTED: chalcone synthase-like                  489   2e-166   
ref|XP_004230925.1|  PREDICTED: chalcone synthase                       489   2e-166   
ref|XP_008344150.1|  PREDICTED: LOW QUALITY PROTEIN: pentatricope...    515   2e-166   
gb|ADF43047.1|  chalcone synthase 6 protein                             489   3e-166   
ref|XP_008236187.1|  PREDICTED: chalcone synthase                       489   4e-166   
emb|CDX75466.1|  BnaA01g02360D                                          488   5e-166   
ref|XP_009108697.1|  PREDICTED: chalcone synthase-like                  488   5e-166   
emb|CDY40656.1|  BnaA03g53070D                                          488   6e-166   
ref|XP_006359643.1|  PREDICTED: chalcone synthase 2-like                488   6e-166   
ref|XP_002305482.1|  hypothetical protein POPTR_0004s17460g             488   8e-166   Populus trichocarpa [western balsam poplar]
ref|XP_011046865.1|  PREDICTED: chalcone synthase-like                  488   8e-166   
ref|XP_009108194.1|  PREDICTED: chalcone synthase-like                  488   9e-166   
ref|XP_008372871.1|  PREDICTED: chalcone synthase                       487   2e-165   
ref|XP_003537759.1|  PREDICTED: chalcone synthase-like                  486   3e-165   
ref|XP_009621338.1|  PREDICTED: chalcone synthase                       486   4e-165   
ref|XP_006412179.1|  hypothetical protein EUTSA_v10025417mg             486   5e-165   
emb|CDX72506.1|  BnaC07g45280D                                          485   7e-165   
gb|KDP27594.1|  hypothetical protein JCGZ_19599                         485   8e-165   
ref|XP_002276653.1|  PREDICTED: chalcone synthase                       485   8e-165   Vitis vinifera
emb|CDY58814.1|  BnaAnng15370D                                          485   9e-165   
gb|KFK30118.1|  hypothetical protein AALP_AA7G219100                    485   1e-164   
emb|CDY34811.1|  BnaA09g41780D                                          485   1e-164   
emb|CDY17490.1|  BnaC03g65730D                                          485   1e-164   
ref|XP_004138289.1|  PREDICTED: chalcone synthase A-like                484   1e-164   
ref|XP_009138330.1|  PREDICTED: chalcone synthase-like                  484   3e-164   
gb|KEH30597.1|  chalcone synthase family protein                        482   1e-163   
ref|XP_008453147.1|  PREDICTED: chalcone synthase                       482   2e-163   
ref|XP_004289833.1|  PREDICTED: chalcone synthase-like                  482   2e-163   
ref|XP_010028685.1|  PREDICTED: chalcone synthase                       481   2e-163   
ref|XP_010530789.1|  PREDICTED: chalcone synthase                       481   3e-163   
gb|EYU40405.1|  hypothetical protein MIMGU_mgv1a008045mg                479   1e-162   
gb|EPS66734.1|  hypothetical protein M569_08037                         474   1e-160   
ref|XP_003574084.1|  PREDICTED: chalcone synthase-like                  471   2e-159   
emb|CAB45446.1|  chalcone synthase-like protein                         467   8e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006664811.1|  PREDICTED: chalcone synthase LF2-like              467   2e-157   
gb|EEC81903.1|  hypothetical protein OsI_25733                          467   2e-157   Oryza sativa Indica Group [Indian rice]
ref|NP_001059449.2|  Os07g0411300                                       467   2e-157   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG32254.1|  chalcone synthase                                      463   1e-156   Raphanus sativus
ref|NP_001150611.1|  chalcone synthase G                                461   1e-155   Zea mays [maize]
dbj|BAE80096.1|  Chalcone synthase                                      461   2e-155   Silene latifolia
ref|XP_004982809.1|  PREDICTED: stilbene synthase 4-like                458   2e-154   
gb|KHN32314.1|  Chalcone synthase                                       456   5e-154   
ref|XP_008678397.1|  PREDICTED: chalcone synthase G isoform X1          457   6e-154   
ref|XP_006661875.1|  PREDICTED: stilbene synthase 4-like                457   7e-154   
ref|NP_001064891.1|  Os10g0484800                                       456   3e-153   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008780014.1|  PREDICTED: chalcone synthase                       454   3e-153   
emb|CAJ15412.1|  unnamed protein product                                456   5e-153   Triticum aestivum [Canadian hard winter wheat]
emb|CAJ13966.1|  unnamed protein product                                455   1e-152   Aegilops tauschii
gb|EAY78973.1|  hypothetical protein OsI_34081                          454   2e-152   Oryza sativa Indica Group [Indian rice]
gb|AAV49989.1|  putative chalcone synthase                              455   3e-152   Hordeum vulgare subsp. vulgare [barley]
ref|XP_002467058.1|  hypothetical protein SORBIDRAFT_01g018950          453   3e-152   Sorghum bicolor [broomcorn]
dbj|BAJ95097.1|  predicted protein                                      454   5e-152   
emb|CAJ13548.1|  unnamed protein product                                452   1e-151   Triticum turgidum [cone wheat]
gb|ACB38748.1|  chalcone synthase-like protein                          450   4e-151   Triticum aestivum [Canadian hard winter wheat]
gb|ACJ22498.1|  chalcone synthase                                       451   5e-151   Triticum aestivum [Canadian hard winter wheat]
gb|EMS57002.1|  Stilbene synthase 4                                     450   5e-151   
ref|NP_001131211.1|  uncharacterized protein LOC100192519               449   1e-150   Zea mays [maize]
ref|XP_004956033.1|  PREDICTED: chalcone synthase 1-like                449   2e-150   
ref|XP_007131590.1|  hypothetical protein PHAVU_011G026000g             447   3e-150   
gb|AFW68541.1|  hypothetical protein ZEAMMB73_283153                    449   3e-150   
ref|XP_002461886.1|  hypothetical protein SORBIDRAFT_02g009850          449   4e-150   Sorghum bicolor [broomcorn]
ref|XP_010933363.1|  PREDICTED: chalcone synthase                       446   6e-150   
tpg|DAA60357.1|  TPA: hypothetical protein ZEAMMB73_750242              446   2e-149   
ref|NP_001149508.1|  chalcone synthase                                  447   2e-149   Zea mays [maize]
tpg|DAA60355.1|  TPA: chalcone synthase                                 447   3e-149   
ref|XP_003557301.2|  PREDICTED: probable inorganic phosphate tran...    462   7e-149   
emb|CAA62921.1|  chalcone synthase-like                                 444   1e-148   Oryza sativa [red rice]
ref|XP_009401221.1|  PREDICTED: chalcone synthase                       433   7e-145   
ref|XP_001781520.1|  predicted protein                                  434   3e-144   
ref|XP_006854881.1|  hypothetical protein AMTR_s00182p00053650          418   1e-139   
ref|XP_002985571.1|  hypothetical protein SELMODRAFT_122361             419   5e-139   
gb|EMT21347.1|  hypothetical protein F775_52323                         404   7e-133   
ref|XP_010466554.1|  PREDICTED: chalcone synthase-like                  369   7e-121   
gb|EAZ39507.1|  hypothetical protein OsJ_23944                          369   2e-119   Oryza sativa Japonica Group [Japonica rice]
gb|ACN35784.1|  unknown                                                 365   1e-118   Zea mays [maize]
ref|XP_010462511.1|  PREDICTED: chalcone synthase-like                  354   1e-115   
gb|AEN80624.1|  AT1G02050-like protein                                  334   1e-108   
gb|ADG37724.1|  AT1G02050-like protein                                  332   4e-108   
gb|ADG37730.1|  AT1G02050-like protein                                  331   8e-108   
gb|ADG38688.1|  AT4G00040-like protein                                  331   3e-107   
gb|ADG37727.1|  AT1G02050-like protein                                  329   7e-107   
gb|ADG38683.1|  AT4G00040-like protein                                  328   3e-106   
gb|ADG38685.1|  AT4G00040-like protein                                  327   1e-105   
gb|AEN82337.1|  AT4G00040-like protein                                  326   2e-105   
gb|AAB23817.1|  chalcone synthase homolog {C-terminal}                  324   2e-104   
gb|AGR67381.1|  chalcone synthase-like protein                          308   1e-98    
gb|AHY39238.1|  stilbenecarboxylate synthase 2                          299   4e-92    
gb|AIV42295.1|  chalcone synthase                                       299   6e-92    
gb|AAW30010.1|  stilbenecarboxylate synthase 2                          298   9e-92    Marchantia polymorpha
ref|XP_002271371.1|  PREDICTED: stilbene synthase 2                     295   1e-90    Vitis vinifera
gb|AFN21537.1|  stilbene synthase                                       294   2e-90    
gb|AFN21530.1|  stilbene synthase                                       294   2e-90    
ref|XP_010662505.1|  PREDICTED: stilbene synthase 4-like                294   3e-90    
ref|XP_002263722.1|  PREDICTED: stilbene synthase 3                     293   4e-90    Vitis vinifera
gb|ABJ97068.1|  stilbene synthase                                       293   4e-90    Vitis vinifera
ref|XP_002272129.2|  PREDICTED: stilbene synthase 2-like                293   4e-90    Vitis vinifera
ref|XP_009393403.1|  PREDICTED: chalcone synthase 6-4-like              294   5e-90    
pdb|2P0U|A  Chain A, Crystal Structure Of Marchantia Polymorpha S...    293   6e-90    
gb|AAM21772.1|  stilbene synthase                                       293   8e-90    Cissus rhombifolia [grape-ivy]
ref|XP_003634076.1|  PREDICTED: stilbene synthase 4-like isoform X1     293   9e-90    
ref|XP_002264989.1|  PREDICTED: stilbene synthase 4                     292   1e-89    Vitis vinifera
ref|XP_002263881.1|  PREDICTED: stilbene synthase 1                     292   1e-89    Vitis vinifera
gb|AFN21506.1|  stilbene synthase                                       292   1e-89    
ref|XP_002263807.1|  PREDICTED: stilbene synthase 6                     292   1e-89    Vitis vinifera
gb|AFN21500.1|  stilbene synthase                                       292   1e-89    
gb|AFN21548.1|  stilbene synthase                                       292   1e-89    
gb|AFM22751.1|  stilbene synthase                                       292   1e-89    
ref|XP_010662506.1|  PREDICTED: stilbene synthase 4-like isoform X2     292   1e-89    
gb|ABV82966.1|  stilbene synthase                                       292   1e-89    Vitis vinifera
gb|AFM56656.1|  stilbene synthase                                       292   1e-89    
gb|AFN21517.1|  stilbene synthase                                       292   1e-89    
gb|AFM56666.1|  stilbene synthase                                       292   1e-89    
gb|AFM56643.1|  stilbene synthase                                       292   2e-89    
gb|AFM56658.1|  stilbene synthase                                       292   2e-89    
gb|AFM56664.1|  stilbene synthase                                       292   2e-89    
dbj|BAA32733.1|  coumaroyl triacetic acid synthase                      292   2e-89    Hydrangea macrophylla
gb|AFN21544.1|  stilbene synthase                                       292   2e-89    
gb|AFN21535.1|  stilbene synthase                                       291   2e-89    
sp|P51075.2|CHSY_BETPN  RecName: Full=Chalcone synthase; AltName:...    291   2e-89    Betula pendula [white birch]
gb|AFN21542.1|  stilbene synthase                                       291   2e-89    
ref|XP_002268756.1|  PREDICTED: stilbene synthase 5                     291   2e-89    Vitis vinifera
ref|XP_002269386.2|  PREDICTED: stilbene synthase 5-like                291   2e-89    Vitis vinifera
gb|AFN21541.1|  stilbene synthase                                       291   2e-89    
ref|XP_010662500.1|  PREDICTED: stilbene synthase 5                     291   2e-89    
gb|AFN21499.1|  stilbene synthase                                       291   2e-89    
ref|XP_003634070.1|  PREDICTED: stilbene synthase 4-like isoform X1     291   2e-89    
gb|AFN21509.1|  stilbene synthase                                       291   2e-89    
gb|AFM56653.1|  stilbene synthase                                       291   2e-89    
gb|AFN21513.1|  stilbene synthase                                       291   2e-89    
gb|ACO59457.1|  stilbene synthase 2                                     291   2e-89    Vitis vinifera
gb|AFN21521.1|  stilbene synthase                                       291   2e-89    
gb|AFM56644.1|  stilbene synthase                                       291   2e-89    
gb|AFM56636.1|  stilbene synthase                                       291   2e-89    
ref|XP_002278354.1|  PREDICTED: stilbene synthase 5                     291   2e-89    Vitis vinifera
ref|NP_001268046.1|  stilbene synthase 3                                291   2e-89    
gb|ABF06885.1|  stilbene synthase                                       291   3e-89    Vitis pseudoreticulata
gb|ACO59459.1|  stilbene synthase 2                                     291   3e-89    Vitis vinifera
emb|CAN72348.1|  hypothetical protein VITISV_020801                     291   3e-89    Vitis vinifera
gb|AFM56638.1|  stilbene synthase                                       291   3e-89    
gb|AFM56671.1|  stilbene synthase                                       291   3e-89    
gb|AFM56663.1|  stilbene synthase                                       291   3e-89    
gb|AFM56673.1|  stilbene synthase                                       291   3e-89    
ref|XP_003634072.1|  PREDICTED: stilbene synthase 4-like isoform X5     291   3e-89    
ref|XP_002278385.1|  PREDICTED: stilbene synthase 3                     291   3e-89    Vitis vinifera
gb|AFM56640.1|  stilbene synthase                                       291   3e-89    
gb|ABM30193.1|  stilbene synthase                                       291   3e-89    Vitis quinquangularis
gb|ABF06882.1|  stilbene synthase                                       291   3e-89    Vitis pseudoreticulata
sp|P51071.2|THS3_VITVI  RecName: Full=Stilbene synthase 3; AltNam...    291   3e-89    Vitis vinifera
gb|AFM56657.1|  stilbene synthase                                       291   3e-89    
gb|ABJ97071.1|  stilbene synthase 1                                     291   3e-89    Vitis vinifera
gb|AAU93767.1|  chalcone synthase                                       291   3e-89    
gb|AFN21524.1|  stilbene synthase                                       291   4e-89    
gb|ABK96920.1|  stilbene synthase                                       291   4e-89    
gb|AFM56639.1|  stilbene synthase                                       291   4e-89    
emb|CAR64527.1|  chalcone synthase                                      291   4e-89    
gb|ABE68894.1|  resveratrol synthase                                    291   4e-89    
emb|CAA54221.1|  Stilbene synthase                                      291   4e-89    
gb|AFM56650.1|  stilbene synthase                                       291   4e-89    
emb|CAN74316.1|  hypothetical protein VITISV_005184                     291   4e-89    
ref|XP_003634068.1|  PREDICTED: stilbene synthase 2                     291   4e-89    
gb|AFM56637.1|  stilbene synthase                                       291   4e-89    
gb|AFC88472.1|  resveratrol synthase                                    291   4e-89    
gb|AFM56652.1|  stilbene synthase                                       291   5e-89    
gb|ABL09496.1|  stilbene synthase 2                                     291   5e-89    
ref|XP_002268842.2|  PREDICTED: stilbene synthase 2                     290   5e-89    
gb|AEB00550.1|  stilbene synthase 1                                     290   5e-89    
gb|AEB00549.1|  stilbene synthase                                       290   5e-89    
gb|AFN21536.1|  stilbene synthase                                       290   5e-89    
gb|AFN21539.1|  stilbene synthase                                       290   6e-89    
gb|AFM56646.1|  stilbene synthase                                       290   6e-89    
emb|CAN61161.1|  hypothetical protein VITISV_040889                     290   6e-89    
gb|AFN21523.1|  stilbene synthase                                       290   6e-89    
ref|XP_003634071.1|  PREDICTED: stilbene synthase 4-like                290   6e-89    
gb|AFN21497.1|  stilbene synthase                                       290   6e-89    
gb|AFN21508.1|  stilbene synthase                                       290   6e-89    
gb|AFN21534.1|  stilbene synthase                                       290   7e-89    
gb|ACO59456.1|  stilbene synthase 1                                     290   7e-89    
gb|AAM21771.1|  stilbene synthase                                       290   7e-89    
gb|ABF06883.1|  stilbene synthase                                       290   7e-89    
gb|ACO59912.1|  stilbene synthase 1                                     290   8e-89    
gb|AFN21512.1|  stilbene synthase                                       290   8e-89    
gb|ABF06884.1|  stilbene synthase                                       290   8e-89    
dbj|BAA87922.1|  chalcone synthase                                      290   8e-89    
gb|AFN21532.1|  stilbene synthase                                       290   8e-89    
ref|XP_003634065.1|  PREDICTED: stilbene synthase 1-like                290   1e-88    
gb|AFN21518.1|  stilbene synthase                                       290   1e-88    
gb|AFN21525.1|  stilbene synthase                                       290   1e-88    
ref|XP_002278483.1|  PREDICTED: stilbene synthase 2                     290   1e-88    
gb|ACO59458.1|  stilbene synthase 1                                     290   1e-88    
gb|AFM56662.1|  stilbene synthase                                       289   1e-88    
ref|XP_004504355.1|  PREDICTED: chalcone synthase 1-like                289   1e-88    
gb|AFN21543.1|  stilbene synthase                                       289   1e-88    
emb|CAN72347.1|  hypothetical protein VITISV_020800                     289   1e-88    
gb|ABD64685.1|  stilbene synthase                                       289   2e-88    
gb|AFM56665.1|  stilbene synthase                                       289   2e-88    
gb|AFN21538.1|  stilbene synthase                                       289   2e-88    
gb|AFN21531.1|  stilbene synthase                                       289   2e-88    
gb|AFX68804.1|  stilbene synthase                                       289   2e-88    
gb|AAF00586.1|  stilbene synthase                                       289   2e-88    
gb|ADB44077.1|  chalcone synthase                                       289   2e-88    
gb|AFN21520.1|  stilbene synthase                                       289   2e-88    
gb|AFN21514.1|  stilbene synthase                                       289   2e-88    
gb|ABC84859.1|  resveratrol synthase                                    289   2e-88    
ref|XP_003634075.1|  PREDICTED: stilbene synthase 4-like                289   2e-88    
ref|XP_010662501.1|  PREDICTED: stilbene synthase 4-like isoform X2     289   2e-88    
gb|AIA22214.1|  chalcone synthase                                       289   2e-88    
gb|AEB00551.1|  stilbene synthase 2                                     289   2e-88    
emb|CAM32716.1|  chalcone synthase enzyme                               289   2e-88    
gb|KEH35361.1|  chalcone and stilbene synthase family protein           289   3e-88    
gb|AAN76182.1|AF456445_1  stilbenecarboxylate synthase                  289   3e-88    
ref|XP_010662547.1|  PREDICTED: stilbene synthase 4                     289   3e-88    
sp|C4NF91.1|PKS5_ALOAR  RecName: Full=Octaketide synthase 3; Shor...    289   3e-88    
gb|AEX32789.1|  resveratrol synthase                                    288   3e-88    
gb|AFN21533.1|  stilbene synthase                                       288   3e-88    
gb|ABD64686.1|  stilbene synthase                                       288   3e-88    
gb|AAL09047.1|AF418567_1  stilbene synthase 2                           288   4e-88    
gb|AFM56645.1|  stilbene synthase                                       288   4e-88    
gb|AFM56659.1|  stilbene synthase                                       288   5e-88    
pir||S53313  stilbene synthase - grape                                  288   5e-88 
gb|AFN21498.1|  stilbene synthase                                       288   5e-88    
gb|AFM56651.1|  stilbene synthase                                       288   5e-88    
ref|XP_003634069.1|  PREDICTED: stilbene synthase 4-like                288   5e-88    
pir||S16206  stilbene synthase (EC 2.3.1.-) - grape                     288   5e-88 
gb|AFM56635.1|  stilbene synthase                                       288   5e-88    
ref|XP_011006130.1|  PREDICTED: chalcone synthase                       288   5e-88    
gb|AFN21528.1|  stilbene synthase                                       288   6e-88    
gb|ABC84860.1|  resveratrol synthase                                    288   6e-88    
gb|ACM47246.1|  resveratrol synthase                                    288   6e-88    
gb|AAY83389.1|  chalcone synthase                                       288   6e-88    
gb|AFN21501.1|  stilbene synthase                                       288   6e-88    
gb|AFN21504.1|  stilbene synthase                                       288   7e-88    
gb|AAN76183.1|AF456446_1  stilbenecarboxylate synthase                  288   7e-88    
ref|NP_001267934.1|  stilbene synthase 6                                288   7e-88    
gb|ABJ97072.1|  stilbene synthase 2                                     288   7e-88    
emb|CBI31800.3|  unnamed protein product                                288   7e-88    
gb|AFM56661.1|  stilbene synthase                                       287   7e-88    
gb|ABF06881.1|  stilbene synthase                                       287   8e-88    
gb|AFM56668.1|  stilbene synthase                                       287   8e-88    
ref|XP_003634063.1|  PREDICTED: stilbene synthase 1-like                287   8e-88    
sp|Q9FSB8.1|CHS2_RUTGR  RecName: Full=Chalcone synthase 2; AltNam...    287   9e-88    
ref|NP_001267939.1|  stilbene synthase 1                                287   9e-88    
gb|AIC75908.1|  chalcone synthase                                       287   9e-88    
ref|XP_003634073.1|  PREDICTED: stilbene synthase 4                     287   1e-87    
sp|P48385.2|CHSY_CALCH  RecName: Full=Chalcone synthase; AltName:...    287   1e-87    
ref|XP_010662504.1|  PREDICTED: stilbene synthase 2                     287   1e-87    
gb|AFN21526.1|  stilbene synthase                                       287   1e-87    
ref|XP_002264455.1|  PREDICTED: stilbene synthase 1                     287   1e-87    
emb|CAN60215.1|  hypothetical protein VITISV_035301                     287   1e-87    
dbj|BAB92996.1|  chalcone synthase                                      287   1e-87    
emb|CAN76086.1|  hypothetical protein VITISV_021148                     287   1e-87    
gb|KDP20327.1|  hypothetical protein JCGZ_06413                         287   1e-87    
gb|AFN21545.1|  stilbene synthase                                       287   1e-87    
gb|AFN21502.1|  stilbene synthase                                       287   1e-87    
ref|XP_007161599.1|  hypothetical protein PHAVU_001G083000g             287   1e-87    
gb|AAB19887.2|  stilbene synthase                                       287   1e-87    
gb|AIS35912.1|  chalcone synthase                                       287   1e-87    
gb|AAM21773.1|  stilbene synthase                                       287   1e-87    
ref|XP_004502226.1|  PREDICTED: chalcone synthase 1B-like               286   1e-87    
ref|XP_003634066.1|  PREDICTED: stilbene synthase 1-like                287   1e-87    
gb|ABM30194.1|  stilbene synthase                                       286   1e-87    
ref|XP_010692195.1|  PREDICTED: chalcone synthase-like                  286   2e-87    
gb|AFN21503.1|  stilbene synthase                                       286   2e-87    
gb|AFM56674.1|  stilbene synthase                                       286   2e-87    
gb|AFN21540.1|  stilbene synthase                                       286   2e-87    
pir||S53314  stilbene synthase - grape                                  286   2e-87 
ref|XP_010692193.1|  PREDICTED: chalcone synthase 3-like                286   2e-87    
gb|ACN81821.1|  resveratrol synthase                                    286   2e-87    
gb|AFM56669.1|  stilbene synthase                                       286   2e-87    
gb|AHL83549.1|  chalcone synthase                                       286   2e-87    
gb|AFM56667.1|  stilbene synthase                                       286   2e-87    
gb|ABB89213.1|  chalcone synthase                                       286   2e-87    
dbj|BAB20979.1|  stilbene synthase                                      286   2e-87    
dbj|BAB20978.1|  stilbene synthase                                      286   2e-87    
ref|XP_009376347.1|  PREDICTED: polyketide synthase 5                   286   2e-87    
ref|XP_003634067.1|  PREDICTED: stilbene synthase 4-like                286   2e-87    
ref|XP_010662502.1|  PREDICTED: stilbene synthase 4-like isoform X3     286   2e-87    
gb|AFN21519.1|  stilbene synthase                                       286   3e-87    
gb|AAL09046.1|AF418566_1  stilbene synthase 1                           286   3e-87    
gb|AFN21546.1|  stilbene synthase                                       286   3e-87    
gb|ABI94386.1|  chalcone synthase-like polyketide synthase              286   3e-87    
gb|AFM56649.1|  stilbene synthase                                       286   3e-87    
gb|AFM56660.1|  stilbene synthase                                       286   3e-87    
gb|AFM56655.1|  stilbene synthase                                       286   3e-87    
sp|Q9FSB9.1|CHS1_RUTGR  RecName: Full=Chalcone synthase 1; AltNam...    286   3e-87    
ref|XP_007032052.1|  Chalcone and stilbene synthase family protein      286   3e-87    
gb|AAM90652.1|AF400567_1  chalcone synthase 6                           286   3e-87    
dbj|BAH16615.1|  chalcone synthase                                      286   3e-87    
ref|XP_008380609.1|  PREDICTED: polyketide synthase 5                   286   3e-87    
ref|XP_010929491.1|  PREDICTED: chalcone synthase 2                     286   3e-87    
gb|AAD49353.1|AF169798_1  chalcone synthase                             286   3e-87    
gb|KHG25969.1|  Chalcone synthase 1                                     286   3e-87    
gb|AFN21529.1|  stilbene synthase                                       286   3e-87    
gb|ACO59913.1|  stilbene synthase 2                                     286   3e-87    
dbj|BAM28981.1|  chalcone synthase C                                    286   4e-87    
gb|AFN21507.1|  stilbene synthase                                       286   4e-87    
sp|P48392.1|CHS3_GERHY  RecName: Full=Chalcone synthase 3; AltNam...    286   4e-87    
ref|XP_003634064.1|  PREDICTED: stilbene synthase 6-like                285   4e-87    
gb|AAM90651.1|AF400566_1  chalcone synthase 11                          285   5e-87    
gb|ACZ48699.1|  chalcone synthase                                       285   5e-87    
gb|AEC13058.1|  chalcone synthase protein                               285   5e-87    
dbj|BAC66467.1|  chalcone synthase                                      285   5e-87    
emb|CAN64419.1|  hypothetical protein VITISV_026018                     285   6e-87    
ref|XP_003601648.1|  Chalcone synthase                                  285   6e-87    
gb|ACS34990.1|  stilbene synthase                                       285   6e-87    
ref|XP_003517529.1|  PREDICTED: chalcone synthase 7                     285   6e-87    
gb|AFK33946.1|  unknown                                                 285   6e-87    
gb|AFM56648.1|  stilbene synthase                                       285   6e-87    
ref|XP_003634074.1|  PREDICTED: stilbene synthase 4-like                285   6e-87    
gb|AGJ50587.1|  CHS1                                                    285   6e-87    
gb|ABC86919.1|  chalcone synthase                                       285   7e-87    
dbj|BAA31259.1|  chalcone synthase                                      285   7e-87    
gb|AGW24283.1|  chalcone synthase                                       285   7e-87    
ref|XP_008797107.1|  PREDICTED: chalcone synthase 1                     285   7e-87    
ref|XP_007157043.1|  hypothetical protein PHAVU_002G038700g             285   7e-87    
dbj|BAJ17656.1|  chalcone synthase                                      285   7e-87    
gb|AEB96143.1|  chalcone synthase                                       285   8e-87    
gb|AFH68066.1|  chalcone synthase                                       285   8e-87    
gb|AAM00230.1|AF358430_1  root-specific chalcone synthase               285   8e-87    
ref|XP_010692194.1|  PREDICTED: chalcone synthase 3-like                285   8e-87    
gb|ABD24222.1|  chalcone synthase                                       285   8e-87    
dbj|BAE79201.1|  chalcon synthase                                       285   8e-87    
gb|ACC76753.1|  STS                                                     285   8e-87    
gb|AFU90824.1|  chalcone synthase                                       285   8e-87    
gb|AFM56642.1|  stilbene synthase                                       285   8e-87    
gb|ACT32034.1|  chalcone synthase                                       285   9e-87    
gb|KHN25612.1|  Chalcone synthase 7                                     285   9e-87    
sp|P23569.1|CHSY_PUEML  RecName: Full=Chalcone synthase; AltName:...    285   9e-87    
ref|XP_008224578.1|  PREDICTED: polyketide synthase 5                   285   1e-86    
gb|AFQ92052.1|  chalcone synthase                                       285   1e-86    
ref|NP_001267973.1|  resveratrol synthase                               285   1e-86    
dbj|BAE17123.1|  chalcone synthase                                      284   1e-86    
gb|AGE10597.1|  chalcone synthase                                       285   1e-86    
gb|AEW12813.1|  chalcone synthase                                       284   1e-86    
gb|ABM63466.1|  aromatic polyketide synthase                            284   1e-86    
gb|AEO96985.1|  chalcone synthase                                       284   1e-86    
gb|AAM00232.1|AF358432_1  root-specific chalcone synthase               284   1e-86    
ref|XP_010249317.1|  PREDICTED: chalcone synthase                       284   1e-86    
gb|ACM62742.1|  chalcone synthase                                       284   1e-86    
gb|ABE77392.2|  chalcone synthase                                       284   1e-86    
gb|AFC37244.1|  chalcone synthase 3                                     284   2e-86    
gb|ABF59867.1|  chalcone synthase                                       283   2e-86    
gb|AHA61354.1|  chalcone synthase                                       284   2e-86    
gb|AFU52909.1|  chalcone synthase                                       284   2e-86    
gb|AAK39111.1|AF358655_1  chalcone synthase                             284   2e-86    
dbj|BAB84112.1|  chalcone synthase                                      284   2e-86    
gb|AEF14414.1|  chalcone synthase                                       284   2e-86    
emb|CAH61575.1|  chalcone synthase                                      284   2e-86    
dbj|BAF99253.1|  chalcone synthase                                      284   2e-86    
gb|AAM90650.1|AF400565_1  chalcone synthase 5                           284   2e-86    
ref|NP_001267879.1|  chalcone synthase                                  284   2e-86    
gb|AAK49457.1|  chalcone synthase                                       283   2e-86    
gb|ABM73434.1|  chalcone synthase                                       284   2e-86    
ref|NP_001068009.1|  Os11g0530600                                       284   2e-86    
gb|AEO36981.1|  chalcone synthase                                       283   2e-86    
sp|Q9AU11.1|PKS1_RUBID  RecName: Full=Polyketide synthase 1; Shor...    283   2e-86    
sp|O23730.1|CHS4_BROFI  RecName: Full=Chalcone synthase 4; AltNam...    283   3e-86    
gb|ACZ51475.1|  chalcone synthase                                       283   3e-86    
gb|AFC37242.1|  chalcone synthase 1                                     283   3e-86    
gb|AEO96987.1|  chalcone synthase                                       283   3e-86    
gb|ACS36661.1|  CHS4                                                    283   3e-86    
sp|O23729.1|CHS3_BROFI  RecName: Full=Chalcone synthase 3; AltNam...    283   3e-86    
gb|ADU05554.1|  chalcone synthase                                       283   3e-86    
ref|XP_006468926.1|  PREDICTED: chalcone synthase 2-like                283   3e-86    
gb|ADZ45294.1|  chalcone synthase 3                                     283   3e-86    
gb|ACZ51476.1|  chalcone synthase                                       283   3e-86    
pdb|4WUM|A  Chain A, X-ray Crystal Structure Of Chalcone Synthase...    283   3e-86    
ref|XP_009421181.1|  PREDICTED: chalcone synthase 2-like                283   3e-86    
gb|ADZ45296.1|  chalcone synthase 2                                     283   3e-86    
ref|XP_009616637.1|  PREDICTED: chalcone synthase 2                     283   3e-86    
gb|AAX16494.1|  chalcone synthase                                       283   4e-86    
dbj|BAI66465.1|  chalcone synthase                                      283   4e-86    



>ref|XP_009618741.1| PREDICTED: chalcone synthase [Nicotiana tomentosiformis]
Length=395

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/380 (81%), Positives = 340/380 (89%), Gaps = 10/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP+QLVPQDCLVEGYIRDT C DLAIKEKLERLCKTTTVKTRYTVM K+
Sbjct  26    GKATILAMGKAFPAQLVPQDCLVEGYIRDTNCQDLAIKEKLERLCKTTTVKTRYTVMSKE  85

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEG+PTI QRLE+ANPAV+ MAK+AS ACIK+WGR  EEITH+VYVSSSEI
Sbjct  86    ILDKYPELATEGTPTIRQRLEIANPAVVEMAKQASQACIKEWGRSAEEITHIVYVSSSEI  145

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGL++D+ RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  146   RLPGGDLYLATELGLRNDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  205

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGAAAVI+G  P    E+PFMEL+FA QQFLPGT +VID
Sbjct  206   LGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIVGKESPFMELNFATQQFLPGTNNVID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLPEKI++NIE+FCKKL+ KA+       YN+LFWAVHPGGPAILN
Sbjct  266   GRLTEEGINFKLGRDLPEKIQDNIEEFCKKLMAKADLKETK--YNDLFWAVHPGGPAILN  323

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L+SEKLDCSRRALMDFGNVSSNTIFYV+EYMR+EL  K+ +G+        EW
Sbjct  324   RLENTLKLQSEKLDCSRRALMDFGNVSSNTIFYVMEYMREELKNKKDEGE--------EW  375

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  376   GLALAFGPGITFEGILLRSL  395



>ref|XP_009785374.1| PREDICTED: chalcone synthase [Nicotiana sylvestris]
Length=395

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/380 (81%), Positives = 339/380 (89%), Gaps = 10/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP+QLVPQDCLVEGYIRDT C DLAIKEKLERLCKTTTVKTRYTVM K+
Sbjct  26    GKATILAMGKAFPAQLVPQDCLVEGYIRDTNCQDLAIKEKLERLCKTTTVKTRYTVMSKE  85

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEG+PTI QRLE+ANPAV+ MAK+AS ACIK+WGR  EEITH+VYVSSSEI
Sbjct  86    ILDKYPELATEGTPTIKQRLEIANPAVVEMAKQASQACIKEWGRSAEEITHIVYVSSSEI  145

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGL++D+ RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  146   RLPGGDLYLATELGLRNDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  205

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGAAAVI+G  P    E+PFMEL+FA QQFLPGT +VID
Sbjct  206   LGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIMGKESPFMELNFATQQFLPGTNNVID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLPEKI++NIE+FCKK+I KA+       YN+LFWAVHPGGPAILN
Sbjct  266   GRLTEEGINFKLGRDLPEKIQDNIEEFCKKIIAKADLREAK--YNDLFWAVHPGGPAILN  323

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L+SEKLDCSRRALMD+GNVSSNTIFYV+EYMR+EL  K+  G+        EW
Sbjct  324   RLENTLKLQSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKKNGGE--------EW  375

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  376   GLALAFGPGITFEGILLRSL  395



>ref|XP_008375736.1| PREDICTED: chalcone synthase [Malus domestica]
Length=398

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/380 (80%), Positives = 342/380 (90%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQL+PQDCLVEGYIRDTKC+D AIKEKLERLCKTTTVKTRYTVM K+
Sbjct  27    GKATVLALGKAFPSQLIPQDCLVEGYIRDTKCEDAAIKEKLERLCKTTTVKTRYTVMSKE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEG+ TI QRLE+ANPAV+ MA EASLACIK+WGRPVE+ITH+VYVSSSEI
Sbjct  87    ILDKYPELATEGTATIKQRLEIANPAVVEMALEASLACIKEWGRPVEDITHIVYVSSSEI  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  147   RLPGGDLYLSSKLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+G+NP    E+PFMEL++A QQFLPGT +VID
Sbjct  207   LGFRPPNKARPYDLVGAALFGDGAAAVIIGSNPIAGQESPFMELNYAVQQFLPGTHNVID  266

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KI+ NIE+FCKKL   A        +NELFWAVHPGGPAILN
Sbjct  267   GRLSEEGINFKLGRDLPQKIDENIEEFCKKLTVPAKAELK--NFNELFWAVHPGGPAILN  324

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             ++E TL L S+KL+CSRRALMD+GNVSSNTIFYV+E MR+EL +K+K+G+        EW
Sbjct  325   KMESTLKLSSDKLECSRRALMDYGNVSSNTIFYVMENMREELKLKKKEGR------DEEW  378

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  379   GLALAFGPGITFEGILLRSL  398



>ref|XP_007052226.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOX96383.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=386

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/381 (80%), Positives = 344/381 (90%), Gaps = 14/381 (4%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
              GKAT+LA+GKAFPSQL+PQ+CLVEGYIRDTKC+D +IKEKLERLCKTTTVKTRYTVMCK
Sbjct  20    SGKATVLAMGKAFPSQLIPQECLVEGYIRDTKCEDASIKEKLERLCKTTTVKTRYTVMCK  79

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDKYPELATEGS TI QRLE+ANPAV+ MA EASLACIK+WGRP  +ITH++YVSSSE
Sbjct  80    EILDKYPELATEGSSTIKQRLEIANPAVVEMALEASLACIKEWGRPATDITHIIYVSSSE  139

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             IRLPGGDLYLA++LGLK+DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSR+LLTTSETT
Sbjct  140   IRLPGGDLYLASQLGLKNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRILLTTSETT  199

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             ILGFRPPNKARPYDLVGAALFGDGAAAVI+G +P  + E+PFMEL++A QQFLPGTQ+VI
Sbjct  200   ILGFRPPNKARPYDLVGAALFGDGAAAVIIGTDPITNSESPFMELNYAVQQFLPGTQNVI  259

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ KAN       +N+LFWAVHPGGPAIL
Sbjct  260   DGRLSEEGINFKLGRDLPQKIEDNIEEFCRKLVSKANLTE----FNDLFWAVHPGGPAIL  315

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE TL L + KL+CSRRALMD+GNVSSNTIFYV+EYMR+EL  K + G+        E
Sbjct  316   NRLENTLKLNNGKLECSRRALMDYGNVSSNTIFYVMEYMREEL--KAEGGE--------E  365

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGLALAFGPGITFEGILLR+L
Sbjct  366   WGLALAFGPGITFEGILLRSL  386



>gb|AGO05924.1| anther-specific protein [Capsicum annuum]
Length=396

 Score =   609 bits (1570),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 337/380 (89%), Gaps = 9/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFPSQLVPQDCLVEGY+RDT C D+AIKEKLERLCKTTTVKTRYTVM K+
Sbjct  26    GKATILAMGKAFPSQLVPQDCLVEGYMRDTNCQDMAIKEKLERLCKTTTVKTRYTVMSKE  85

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELA EG+PTI QRLE+ANPAV+ MAK+ASLACIK+WGR  +EITH+VYVSSSEI
Sbjct  86    ILDKYPELAVEGTPTINQRLEIANPAVVEMAKQASLACIKEWGRSTDEITHIVYVSSSEI  145

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA ELGL+SD+ RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  146   RLPGGDLHLATELGLRSDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  205

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGA AVIVG  P    E+PFMEL+FA QQFLPGT++VID
Sbjct  206   LGFRPPNNARPYDLVGAALFGDGAGAVIVGTEPIVGTESPFMELNFALQQFLPGTKNVID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLPEKI++NIE+FCKKLI K +       YN+LFWAVHPGGPAIL+
Sbjct  266   GRLTEEGINFKLGRDLPEKIQDNIEEFCKKLIEKGDQLKET-KYNDLFWAVHPGGPAILD  324

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLERTL L+S KLDCSRRALMD+GNVSSNTIFYV+EYMR EL  K+  G+        EW
Sbjct  325   RLERTLKLQSGKLDCSRRALMDYGNVSSNTIFYVIEYMRQELQNKKDGGE--------EW  376

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  377   GLALAFGPGITFEGILLRSL  396



>gb|KDP28845.1| hypothetical protein JCGZ_14616 [Jatropha curcas]
Length=392

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/380 (80%), Positives = 343/380 (90%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QL+PQDCLVEGYIRDTKCDD++IKEKLERLCKTTTVK RYTVM K+
Sbjct  27    GKATILAIGKAFPKQLIPQDCLVEGYIRDTKCDDVSIKEKLERLCKTTTVKKRYTVMSKE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEG+PTI QRLE+ANPAV+ MAKEASLACIK+WGRPVE+ITH+VYVSSSEI
Sbjct  87    ILEKYPELATEGTPTIKQRLEIANPAVVEMAKEASLACIKEWGRPVEDITHIVYVSSSEI  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA +LGL+SDV+RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  147   RLPGGDLHLATQLGLRSDVSRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GANP    E+PF+EL++A QQ LPGTQ+VID
Sbjct  207   LGFRPPNKARPYDLVGAALFGDGAAAVIIGANPVIDKESPFLELNYAVQQSLPGTQNVID  266

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G +SEEGINFKLGRDLP++IE+NIE+FCKKL+ KA        +N+LFWAVHPGGPAILN
Sbjct  267   GCLSEEGINFKLGRDLPQRIEDNIEEFCKKLMSKAGLTE----FNDLFWAVHPGGPAILN  322

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L +EKL+CSRRALMD+GNVSSNT+FYV++YMR+E  MKR  G+        EW
Sbjct  323   RLESTLKLNTEKLECSRRALMDYGNVSSNTVFYVIDYMREE--MKRDGGE--------EW  372

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  373   GLALAFGPGITFEGILLRSL  392



>emb|CAA74847.1| anther-specific protein [Nicotiana sylvestris]
 emb|CAA74846.1| anther-specific protein [Nicotiana sylvestris]
Length=363

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/373 (81%), Positives = 333/373 (89%), Gaps = 10/373 (3%)
 Frame = +2

Query  221   LGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPE  400
             +GKAFP+QLVPQDCLVEGYIRDT C DLAIKEKLERLCKTTTVKTRYTVM K++LDKYPE
Sbjct  1     MGKAFPAQLVPQDCLVEGYIRDTNCQDLAIKEKLERLCKTTTVKTRYTVMSKEILDKYPE  60

Query  401   LATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDL  580
             LATEG+PTI QRLE+ANPAV+ MAK+AS ACIK+WGR  EEITH+VYVSSSEIRLPGGDL
Sbjct  61    LATEGTPTIKQRLEIANPAVVEMAKQASQACIKEWGRSAEEITHIVYVSSSEIRLPGGDL  120

Query  581   YLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN  760
             YLA ELGL++D+ RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN
Sbjct  121   YLATELGLRNDIGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN  180

Query  761   KARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEG  940
             KARPYDLVGAALFGDGAAAVI+G  P    E+PFMEL+FA QQFLPGT +VIDGR++EEG
Sbjct  181   KARPYDLVGAALFGDGAAAVIIGTEPIMGKESPFMELNFATQQFLPGTNNVIDGRLTEEG  240

Query  941   INFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLG  1120
             INFKLGRDLPEKI++NIE+FCKK+I KA+       YN+LFWAVHPGGPAILNRLE TL 
Sbjct  241   INFKLGRDLPEKIQDNIEEFCKKIIAKADLREAK--YNDLFWAVHPGGPAILNRLENTLK  298

Query  1121  LRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFG  1300
             L+SEKLDCSRRALMD+GNVSSNTIFYV+EYMR+EL  K+  G+        EWGLALAFG
Sbjct  299   LQSEKLDCSRRALMDYGNVSSNTIFYVMEYMREELKNKKNGGE--------EWGLALAFG  350

Query  1301  PGITFEGILLRNL  1339
             PGITFEGILLR+L
Sbjct  351   PGITFEGILLRSL  363



>ref|XP_002276642.1| PREDICTED: chalcone synthase isoform X2 [Vitis vinifera]
Length=389

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 338/380 (89%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQL+PQ+CLVEGY RDTKC DLAIKEKLERLCKTTTVKTRYTVM K+
Sbjct  24    GKATVLAMGKAFPSQLIPQECLVEGYFRDTKCQDLAIKEKLERLCKTTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEGSPTI Q+LE+ANPAV+ MA EASLACI++WGRPV +ITH+VYVSSSEI
Sbjct  84    ILEKYPELATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRPVGDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL+SDV R+MLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNK RPYDLVGAALFGDGAAAVIVG +P    E PFMEL+ A QQFLPGT +VID
Sbjct  204   LGFRPPNKERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELNHAVQQFLPGTHNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N+LFWAVHPGGPAILN
Sbjct  264   GRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKA----GLVEFNDLFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KRK G+        EW
Sbjct  320   RLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KRKGGE--------EW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGIL+R+L
Sbjct  370   GLALAFGPGITFEGILIRSL  389



>emb|CBI16627.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 338/380 (89%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQL+PQ+CLVEGY RDTKC DLAIKEKLERLCKTTTVKTRYTVM K+
Sbjct  24    GKATVLAMGKAFPSQLIPQECLVEGYFRDTKCQDLAIKEKLERLCKTTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEGSPTI Q+LE+ANPAV+ MA EASLACI++WGRPV +ITH+VYVSSSEI
Sbjct  84    ILEKYPELATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRPVGDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL+SDV R+MLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNK RPYDLVGAALFGDGAAAVIVG +P    E PFMEL+ A QQFLPGT +VID
Sbjct  204   LGFRPPNKERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELNHAVQQFLPGTHNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N+LFWAVHPGGPAILN
Sbjct  264   GRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKA----GLVEFNDLFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KRK G+        EW
Sbjct  320   RLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KRKGGE--------EW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGIL+R+L
Sbjct  370   GLALAFGPGITFEGILIRSL  389



>ref|XP_006347928.1| PREDICTED: octaketide synthase 3-like [Solanum tuberosum]
Length=396

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 339/380 (89%), Gaps = 9/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKA P QLVPQDCLVEGY+RDT C DL IKEKLERLCKTTTVKTRYTVM K+
Sbjct  26    GKATILAMGKALPPQLVPQDCLVEGYMRDTNCKDLRIKEKLERLCKTTTVKTRYTVMSKE  85

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEG+PTI QRLE+ANPAV+ MAKEASLACIK+WGR V+EITH+VYVSSSEI
Sbjct  86    ILEKYPELATEGTPTINQRLEIANPAVVEMAKEASLACIKEWGRTVDEITHIVYVSSSEI  145

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+L+ ELGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  146   RLPGGDLHLSTELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  205

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGAAAVI+G  P    E+PF+EL+FA QQFLPGT++VID
Sbjct  206   LGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIVGTESPFIELNFAMQQFLPGTKNVID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+++EGINFKLGRDLPEKI++NIE+FCKKLI K +    +  YN+LFWAVHPGGPAIL+
Sbjct  266   GRLTDEGINFKLGRDLPEKIQDNIEEFCKKLIAKNDELKGS-NYNDLFWAVHPGGPAILD  324

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+T+ L++EKL+CSR+ALMDFGNVSSNTIFYV+E MR+EL  K+  G+        EW
Sbjct  325   RLEKTMKLQNEKLNCSRKALMDFGNVSSNTIFYVMENMREELKNKKDGGE--------EW  376

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  377   GLALAFGPGITFEGILLRSL  396



>ref|XP_011017423.1| PREDICTED: chalcone synthase-like [Populus euphratica]
Length=451

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/380 (79%), Positives = 337/380 (89%), Gaps = 15/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQL+PQ+CLVEGYIRDTKCDD +IKEKLERLCKTTTVKTRYTVM K+
Sbjct  87    GKATLLAIGKAFPSQLIPQECLVEGYIRDTKCDDASIKEKLERLCKTTTVKTRYTVMSKE  146

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEG+PTI QRLE+ANPAV+ MA +AS+ACI +WG  VE+ITH+VYVSSSE+
Sbjct  147   ILDKYPELATEGTPTIRQRLEIANPAVVEMALKASMACINEWGGLVEDITHIVYVSSSEV  206

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  207   RLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  266

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPP+KARPYDLVGAALFGDGAAAVI+GANP    E+PFMEL+++ QQFLPGTQ+VID
Sbjct  267   LGFRPPSKARPYDLVGAALFGDGAAAVIIGANPVMGKESPFMELNYSVQQFLPGTQNVID  326

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE+NIE+FC KL+ KA        +NELFWAVHPGGPAILN
Sbjct  327   GRLSEEGINFKLGRDLPQKIEDNIEEFCNKLMSKAGLT----DFNELFWAVHPGGPAILN  382

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+CSRRALMD+GNVSSNTI YVLEYMRDEL  KR  G+         W
Sbjct  383   RLESKLKLNEEKLECSRRALMDYGNVSSNTIVYVLEYMRDEL--KRGGGE---------W  431

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  432   GLALAFGPGITFEGILLRSL  451



>ref|XP_002302511.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 ref|XP_006387497.1| hypothetical protein POPTR_0955s00200g [Populus trichocarpa]
 gb|EEE81784.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP46411.1| hypothetical protein POPTR_0955s00200g [Populus trichocarpa]
Length=388

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 337/380 (89%), Gaps = 15/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQL+PQ+CLVEGYIRDTKCDD +IKEKLERLCKTTTVKTRYTVM ++
Sbjct  24    GKATLLAIGKAFPSQLIPQECLVEGYIRDTKCDDASIKEKLERLCKTTTVKTRYTVMSRE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEG+PTI QRLE+ANPAV+ MA +AS+ACI +WG  VE+ITH+VYVSSSE+
Sbjct  84    ILDKYPELATEGTPTIRQRLEIANPAVVEMALKASMACINEWGGSVEDITHIVYVSSSEV  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPP+KARPYDLVGAALFGDGAAAVI+GANP    E+PFMEL+++ QQFLPGTQ+VID
Sbjct  204   LGFRPPSKARPYDLVGAALFGDGAAAVIIGANPVIGKESPFMELNYSVQQFLPGTQNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGI+FKLGRDLP+KIE+NIE+FC KL+ KA        +NELFWAVHPGGPAILN
Sbjct  264   GRLSEEGIHFKLGRDLPQKIEDNIEEFCNKLMSKAGLT----DFNELFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+CSRRALMD+GNVSSNTI YVLEYMRDEL  KR  G+         W
Sbjct  320   RLESKLKLNEEKLECSRRALMDYGNVSSNTIVYVLEYMRDEL--KRGGGE---------W  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  369   GLALAFGPGITFEGILLRSL  388



>ref|XP_006445367.1| hypothetical protein CICLE_v10020530mg [Citrus clementina]
 ref|XP_006464463.1| PREDICTED: stilbene synthase 3-like [Citrus sinensis]
 gb|ESR58607.1| hypothetical protein CICLE_v10020530mg [Citrus clementina]
 gb|KDO85610.1| hypothetical protein CISIN_1g016361mg [Citrus sinensis]
Length=390

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/383 (79%), Positives = 340/383 (89%), Gaps = 19/383 (5%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQL+PQ+CLVEGY+RDTKC+D +IKEKLERLCKTTTVKTRYTVM K 
Sbjct  24    GKATVLAIGKAFPSQLIPQECLVEGYLRDTKCEDESIKEKLERLCKTTTVKTRYTVMSKA  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGS TI QRLE+ANPAV+ MA EASLACIK+WGRP E+ITH+VYVSSSEI
Sbjct  84    ILDKYPELTTEGSATIKQRLEIANPAVVEMALEASLACIKEWGRPAEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+++LGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLSSKLGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANP---RESLENPFMELSFAAQQFLPGTQS  910
             LGFRPPNK+RPYDLVGAALFGDGAAAVIVGA+P   +ES  +PFMEL++A QQFLPGTQ+
Sbjct  204   LGFRPPNKSRPYDLVGAALFGDGAAAVIVGADPFLDKES--SPFMELNYAVQQFLPGTQN  261

Query  911   VIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPA  1090
             VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+ KA        +N+LFWAVHPGGPA
Sbjct  262   VIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLMAKAGLQ----DFNDLFWAVHPGGPA  317

Query  1091  ILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegg  1270
             ILNRLE  L L ++KL+CSRRALMD+GNVSSNTIFYV++YMR+EL  KRK  +       
Sbjct  318   ILNRLESNLKLNNQKLECSRRALMDYGNVSSNTIFYVMDYMREEL--KRKGDE-------  368

Query  1271  lewglalaFGPGITFEGILLRNL  1339
              EWGLALAFGPGITFEGILLR L
Sbjct  369   -EWGLALAFGPGITFEGILLRGL  390



>ref|XP_006375238.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP53035.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
Length=389

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 340/380 (89%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA GKAFPSQLVPQ+CLVEGY+RDTKCDD +IKEKLERLCKTTTVKTRYTVM K+
Sbjct  24    GKATILATGKAFPSQLVPQECLVEGYMRDTKCDDASIKEKLERLCKTTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEGSPTI QRLE+ANPAV+ MA +AS+ACI +WG  V++ITHVVYVSSSEI
Sbjct  84    ILEKYPELATEGSPTIKQRLEIANPAVVEMALKASIACINEWGGSVKDITHVVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSR+LLTTSETTI
Sbjct  144   RLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRILLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P    E+PFMELS+A QQFLPGTQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPVIGKESPFMELSYAVQQFLPGTQNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ KA        +N+LFWAVHPGGPAILN
Sbjct  264   GRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMSKAGLTE----FNDLFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L +EKL+CSRRAL+++GNVSSNTI YVLEYM++EL  KR+ G+        EW
Sbjct  320   RLESNLKLNTEKLECSRRALINYGNVSSNTIVYVLEYMKEEL--KREGGE--------EW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  370   GLALAFGPGITFEGILLRSL  389



>ref|XP_007140778.1| hypothetical protein PHAVU_008G141200g [Phaseolus vulgaris]
 gb|ESW12772.1| hypothetical protein PHAVU_008G141200g [Phaseolus vulgaris]
Length=391

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 334/380 (88%), Gaps = 15/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFPSQ++PQ+CLVEGYIRDTKC D  IKEKLERLCK TTVKTRYTVM K+
Sbjct  27    GKATILAIGKAFPSQIIPQECLVEGYIRDTKCVDAYIKEKLERLCKNTTVKTRYTVMSKE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEGSPTI Q+LE+ANPAV+ MA +ASL CIK+WGRP E+ITH+VYVSSSEI
Sbjct  87    ILDKYPELATEGSPTIKQKLEIANPAVVEMATKASLCCIKEWGRPAEDITHIVYVSSSEI  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVL+TTSETTI
Sbjct  147   RLPGGDLYLANELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLVTTSETTI  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVIVGANP    E+PFMELS+A Q+FLP T SVID
Sbjct  207   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPMVGQESPFMELSYAVQKFLPDTHSVID  266

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE NIEDFC+KL+ K++       +N+LFWAVHPGGPAILN
Sbjct  267   GRLSEEGINFKLGRDLPQKIEENIEDFCRKLMAKSSVKE----FNDLFWAVHPGGPAILN  322

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE +L L ++KL+CSR+ALMD+GNVSSNTIFYV+EYMR+ L   +  G+        EW
Sbjct  323   KLESSLKLSTDKLECSRKALMDYGNVSSNTIFYVMEYMREYL---KDDGE--------EW  371

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGILLR+L
Sbjct  372   GLGLAFGPGITFEGILLRSL  391



>emb|CDP09465.1| unnamed protein product [Coffea canephora]
Length=382

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/380 (79%), Positives = 336/380 (88%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+L++GKAFP Q+VPQDCLVEGY+RDTKC D AIKEKLERLCKTTTVKTRYTVM ++
Sbjct  17    GKATVLSIGKAFPRQVVPQDCLVEGYVRDTKCVDPAIKEKLERLCKTTTVKTRYTVMSRE  76

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD+YPEL TEGSPTI QRLE+ANPAV+ MAKEASLACIK+WGRP ++ITHVVYVSSSEI
Sbjct  77    ILDQYPELTTEGSPTIKQRLEIANPAVVEMAKEASLACIKEWGRPADDITHVVYVSSSEI  136

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLL TSETTI
Sbjct  137   RLPGGDLYLATELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLATSETTI  196

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPP+KARPYDLVGAALFGDGAAAVI+GA+P    E+PFMEL++A QQFLPGT +VID
Sbjct  197   LGFRPPSKARPYDLVGAALFGDGAAAVIIGADPIIGTESPFMELNYAVQQFLPGTNNVID  256

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINF+LGRDLP+KIE+NIE FCKKL+ KA        +N+LFWAVHPGGPAILN
Sbjct  257   GRLSEEGINFRLGRDLPQKIEDNIEAFCKKLMAKAGLG----DFNDLFWAVHPGGPAILN  312

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L+  KL+CSRR LMDFGNVSSNTI YV+EYMR+EL   +K+G       G EW
Sbjct  313   RLESTLKLKPGKLECSRRTLMDFGNVSSNTILYVMEYMREEL---QKEG-------GEEW  362

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGIL+R+L
Sbjct  363   GLALAFGPGITFEGILVRSL  382



>ref|XP_010474834.1| PREDICTED: chalcone synthase isoform X1 [Camelina sativa]
 ref|XP_010474835.1| PREDICTED: chalcone synthase isoform X1 [Camelina sativa]
Length=392

 Score =   595 bits (1533),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/408 (74%), Positives = 349/408 (86%), Gaps = 22/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +ST+            +   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSTRR-----------VANPGKATVLALGKAFPSQVVPQENLVEGFLRDTKC  52

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++LDKYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  53    DDAYIKEKLEHLCKTTTVKTRYTVLSREILDKYPELTTEGSPTIKQRLEIANEAVVEMAL  112

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  113   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  172

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GAN
Sbjct  173   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAN  232

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             P+E  E PFMEL +A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  233   PKEC-EAPFMELHYAVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKLM  291

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+++GNVSSNTI 
Sbjct  292   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEREKLESSRRALVNYGNVSSNTIL  349

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G+        EWGL LAFGPGITFEG+L+R+L
Sbjct  350   YVMEYMRDEL---KKKGE-----AAQEWGLGLAFGPGITFEGLLIRSL  389



>ref|XP_004229766.1| PREDICTED: chalcone synthase 6-4 [Solanum lycopersicum]
Length=394

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 337/380 (89%), Gaps = 9/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKA P QLVPQDCLVEGY+RDT C DL IKEKLERLCKTTTVKTRYTVM K+
Sbjct  22    GKATILAIGKALPPQLVPQDCLVEGYMRDTNCKDLRIKEKLERLCKTTTVKTRYTVMSKE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEG+PTI QRLE+AN AV+ MAKEASLACIK+WGR V+EI+H+VYVSSSEI
Sbjct  82    ILEKYPELATEGTPTINQRLEIANEAVVEMAKEASLACIKEWGRSVDEISHIVYVSSSEI  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+L+ ELGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  142   RLPGGDLHLSTELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGAAAVI+G  P    E+PF+EL+FA QQFLPGT++VID
Sbjct  202   LGFRPPNNARPYDLVGAALFGDGAAAVIIGTEPIIGTESPFIELNFAMQQFLPGTKNVID  261

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+++EGINFKLGRDLPEKI+ NIE+FCKKLI K +    +  YN+LFWAVHPGGPAIL+
Sbjct  262   GRLTDEGINFKLGRDLPEKIQENIEEFCKKLIAKRDELQGS-NYNDLFWAVHPGGPAILD  320

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+T+ L++EKL+CSR+ALMDFGNVSSNTIFYV+E MR+E+  K+  G+        EW
Sbjct  321   RLEKTMKLQNEKLNCSRKALMDFGNVSSNTIFYVIENMREEMKNKKDAGE--------EW  372

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  373   GLALAFGPGITFEGILLRSL  392



>ref|XP_010474836.1| PREDICTED: chalcone synthase isoform X2 [Camelina sativa]
Length=387

 Score =   593 bits (1530),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 339/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  16    GKATVLALGKAFPSQVVPQENLVEGFLRDTKCDDAYIKEKLEHLCKTTTVKTRYTVLSRE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  76    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEI  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  136   RLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GANP+E  E PFMEL +A QQFLPGTQ+VID
Sbjct  196   LGFRPPNKARPYDLVGAALFGDGAAAVIIGANPKEC-EAPFMELHYAVQQFLPGTQNVID  254

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILN
Sbjct  255   GRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKA--GDESMEFNDMFWAVHPGGPAILN  312

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+ SRRAL+++GNVSSNTI YV+EYMRDEL   +K+G+        EW
Sbjct  313   RLETKLKLEREKLESSRRALVNYGNVSSNTILYVMEYMRDEL---KKKGE-----AAQEW  364

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+L+R+L
Sbjct  365   GLGLAFGPGITFEGLLIRSL  384



>ref|XP_010692112.1| PREDICTED: chalcone synthase [Beta vulgaris subsp. vulgaris]
Length=389

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/410 (73%), Positives = 346/410 (84%), Gaps = 21/410 (5%)
 Frame = +2

Query  110   MMSNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDT  289
             MMS  +G +  S+ ++YR++          GKAT+LALGKAFP QL+PQ+ LVEGYIRDT
Sbjct  1     MMSKNDG-NGASSDHFYRTATL--------GKATVLALGKAFPKQLIPQEHLVEGYIRDT  51

Query  290   KCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAM  469
              C DL +KEKLERLCKTTTVKTRYTVM +++L+ YPELATEG+PTI Q+LE+ANPAV+ M
Sbjct  52    NCHDLVVKEKLERLCKTTTVKTRYTVMSREILNNYPELATEGTPTIKQKLEIANPAVVEM  111

Query  470   AKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCY  649
             A EAS+ACIK+WGRP ++ITH+VYVSSSEIRLPGGDLYL+ ELGL+ DV RVMLYFLGCY
Sbjct  112   ALEASIACIKEWGRPAQDITHIVYVSSSEIRLPGGDLYLSTELGLRPDVGRVMLYFLGCY  171

Query  650   GGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVG  829
             GGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNK RPYDLVGAALFGDGAAAVI+G
Sbjct  172   GGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKDRPYDLVGAALFGDGAAAVIIG  231

Query  830   ANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKK  1009
             ++P    E PFMEL++A QQFLPGT +VIDG I+EEGINFKLGRDLP KIE+NIE+FCKK
Sbjct  232   SHPDLGREKPFMELNYAVQQFLPGTHNVIDGCITEEGINFKLGRDLPNKIEDNIEEFCKK  291

Query  1010  LIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNT  1189
             L+ KA        YNELFWAVHPGGPAILNR+E TL L+ +KL+CSRRALMD+GNVSSNT
Sbjct  292   LMSKAGLK----DYNELFWAVHPGGPAILNRVENTLKLKGDKLNCSRRALMDYGNVSSNT  347

Query  1190  IFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             +FYV+EYMRDEL  K+  G+        EWGLALAFGPGITFEGILLR+L
Sbjct  348   VFYVMEYMRDELKSKQNGGE--------EWGLALAFGPGITFEGILLRSL  389



>emb|CAN83038.1| hypothetical protein VITISV_034337 [Vitis vinifera]
Length=359

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/373 (80%), Positives = 331/373 (89%), Gaps = 14/373 (4%)
 Frame = +2

Query  221   LGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPE  400
             +GKAFPSQL+PQ+CLVEGY RDTKC DLAIKEKLERLCKTTTVKTRYTVM K++L+KYPE
Sbjct  1     MGKAFPSQLIPQECLVEGYFRDTKCQDLAIKEKLERLCKTTTVKTRYTVMSKEILEKYPE  60

Query  401   LATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDL  580
             LATEGSPTI Q+LE+ANPAV+ MA EASLACI++WGRPV +ITH+VYVSSSEIRLPGGDL
Sbjct  61    LATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRPVGDITHIVYVSSSEIRLPGGDL  120

Query  581   YLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN  760
             YLA++LGL+SDV R+MLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN
Sbjct  121   YLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPN  180

Query  761   KARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEG  940
             K RPYDLVGAALFGDGAAAVIVG +P    E PFMEL+ A QQFLPGT +VIDGR+SEEG
Sbjct  181   KERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELNHAVQQFLPGTHNVIDGRLSEEG  240

Query  941   INFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLG  1120
             INFKLGRDLP KIE NIE+FCKKL+ KA      + +N+LFWAVHPGGPAILNRLE TL 
Sbjct  241   INFKLGRDLPAKIEENIEEFCKKLMEKA----GLVEFNDLFWAVHPGGPAILNRLESTLK  296

Query  1121  LRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFG  1300
             LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  KRK G+        EWGLALAFG
Sbjct  297   LRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--KRKGGE--------EWGLALAFG  346

Query  1301  PGITFEGILLRNL  1339
             PGITFEGIL+R+L
Sbjct  347   PGITFEGILIRSL  359



>gb|KHF97528.1| Chalcone synthase 9 [Gossypium arboreum]
Length=386

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 336/380 (88%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFP QL+PQ+ LVEGYIRDT C D++IKEKLERLCKTTTVKTRYTVMCK+
Sbjct  21    GKATVLAIGKAFPRQLIPQEYLVEGYIRDTNCQDVSIKEKLERLCKTTTVKTRYTVMCKE  80

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD+YPELATEGS TI QRLE+ANPAV+ MA EASLACI++WGRP  +ITH++YVSSSEI
Sbjct  81    ILDQYPELATEGSSTIRQRLEIANPAVVEMAFEASLACIEEWGRPATDITHIIYVSSSEI  140

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ELGL++DV+RVMLYFLGCYGG TGLRVAKDIAENNPGSR+LLTTSETTI
Sbjct  141   RLPGGDLYLASELGLRNDVSRVMLYFLGCYGGATGLRVAKDIAENNPGSRILLTTSETTI  200

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+G +P    E+PFMELS+A QQFLPGTQSVID
Sbjct  201   LGFRPPNKARPYDLVGAALFGDGAAAVIIGTDPITGKESPFMELSYAVQQFLPGTQSVID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G ++EEGINFKLGRDLP+KIE+NIE+FC+KL+ KA+       +NE+FWAVHPGGPAILN
Sbjct  261   GCLTEEGINFKLGRDLPQKIEDNIEEFCRKLMSKASLT----DFNEMFWAVHPGGPAILN  316

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L   KL+CSR+AL DFGNVSSNTIFYV+EYMR+EL  KR  G+        EW
Sbjct  317   RLESTLKLNKGKLECSRKALKDFGNVSSNTIFYVMEYMREEL--KRGGGE--------EW  366

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  367   GLALAFGPGITFEGILLRSL  386



>ref|XP_003516799.1| PREDICTED: chalcone synthase-like [Glycine max]
 gb|KHN22950.1| Chalcone synthase 9 [Glycine soja]
Length=388

 Score =   592 bits (1526),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 337/380 (89%), Gaps = 15/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFPSQ++PQ+CLVEGYIRDTKC+D  IKEKLERLCK TTVKTRYTVM K+
Sbjct  24    GKATILAIGKAFPSQIIPQECLVEGYIRDTKCEDAYIKEKLERLCKNTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEGSPTI Q+LE+ANPAV+ MA +ASL CIK+WGRP ++ITH+VYVSSSEI
Sbjct  84    ILDKYPELATEGSPTIRQKLEIANPAVVEMATKASLCCIKEWGRPAQDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGL+SDV+RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLANELGLRSDVSRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GANP    E+PFMELS+A Q+FL  T +VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGANPVMGQESPFMELSYAVQKFLLDTHNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ K++       +N+LFWAVHPGGPAILN
Sbjct  264   GRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMAKSSAK----DFNDLFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L ++KL+CSR+ALMD+GNVSSNTIFYV+EYMR+ L   ++ G+        EW
Sbjct  320   RLESTLKLSNDKLECSRKALMDYGNVSSNTIFYVMEYMREYL---KEDGE--------EW  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGILLR+L
Sbjct  369   GLGLAFGPGITFEGILLRSL  388



>ref|XP_010540240.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540242.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540243.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540244.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540245.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540246.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540247.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540248.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010540249.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
Length=393

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 337/380 (89%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT++ALGKAFPSQ+VPQ+ LVEGY+RDTKCDD  IKEKL+ LCKTTTVKTRYTVM ++
Sbjct  21    GKATVMALGKAFPSQVVPQENLVEGYLRDTKCDDSFIKEKLQHLCKTTTVKTRYTVMSRE  80

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             VLDKYPEL TEGSPTI QRL++AN AV+ MA EASLACI +WGRPVE+ITHVVYVSSSEI
Sbjct  81    VLDKYPELTTEGSPTIRQRLDIANEAVVKMAFEASLACINEWGRPVEDITHVVYVSSSEI  140

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
              LPGGDL+L+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  141   CLPGGDLHLSAQLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  200

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P ES E PFMEL +A QQFLPGTQ+VID
Sbjct  201   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPTES-ETPFMELHYAVQQFLPGTQNVID  259

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE+NIE+FC+KL GKA      L  N++FWAVHPGGPAILN
Sbjct  260   GRLTEEGINFKLGRDLPQKIEDNIEEFCRKLKGKA--GGEALELNDMFWAVHPGGPAILN  317

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  + L+  KL+CSRRALMD+GNVSSNTIFYV+EY+RD+L  K  QG+        EW
Sbjct  318   RLETKMKLKPGKLECSRRALMDYGNVSSNTIFYVMEYVRDDLRKKAIQGE----AEDEEW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEG+L+R+L
Sbjct  374   GLALAFGPGITFEGVLMRSL  393



>emb|CDX93339.1| BnaC04g45570D [Brassica napus]
Length=393

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 340/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  22    GKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVLSRE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  82    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEI  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGLK+DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  142   RLPGGDLYLSAKLGLKNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P  S E+PFMEL +A QQF+PGTQ+VID
Sbjct  202   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-ESPFMELHYAVQQFVPGTQTVID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   ++++ +N++FW VHPGGPAILN
Sbjct  261   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA--GDDSMEFNDMFWTVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +K+G      G  EW
Sbjct  319   RLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---KKKGD-----GAQEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+LLR+L
Sbjct  371   GLGLAFGPGITFEGLLLRSL  390



>ref|XP_010107936.1| Chalcone synthase A [Morus notabilis]
 gb|EXC17336.1| Chalcone synthase A [Morus notabilis]
Length=385

 Score =   591 bits (1523),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 333/380 (88%), Gaps = 13/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G+ATILA+GKAFPSQL+PQ+CLVEGYIRDT C D +IKEKLERLCKTTTVKTRYTVMCKD
Sbjct  19    GRATILAIGKAFPSQLIPQECLVEGYIRDTNCQDASIKEKLERLCKTTTVKTRYTVMCKD  78

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG+PTI QRLE+ANPAV+ MAKEASLACIK+WGRP ++ITH+VYVSSSEI
Sbjct  79    ILEKYPELAREGTPTINQRLEIANPAVVEMAKEASLACIKEWGRPPQDITHIVYVSSSEI  138

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  139   RLPGGDLHLASQLGLRTDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  198

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN +RPYDLVGAALFGDGAAAVI+GA+P   LE+PFMEL+ A QQFLP T  VID
Sbjct  199   LGFRPPNMSRPYDLVGAALFGDGAAAVIIGADPITDLESPFMELNSAVQQFLPNTHDVID  258

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++SEEGINF+LGRDLP+KIE+NIE+FCKKL+ KA        YNELFWAVHPGGPAILN
Sbjct  259   GKLSEEGINFRLGRDLPQKIEDNIEEFCKKLMAKA---GLKFEYNELFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE  L LRSEKL  SRRALMD+GNVSSNTI YV+E MR+EL   +++G         EW
Sbjct  316   KLESCLKLRSEKLVSSRRALMDYGNVSSNTILYVIENMREEL---KREGS-------EEW  365

Query  1280  glalaFGPGITFEGILLRNL  1339
             G  LAFGPGITFEGIL+R+L
Sbjct  366   GFGLAFGPGITFEGILIRSL  385



>ref|XP_011094451.1| PREDICTED: LOW QUALITY PROTEIN: chalcone synthase [Sesamum indicum]
Length=383

 Score =   590 bits (1521),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 330/380 (87%), Gaps = 25/380 (7%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP+QLVPQD LVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVM K+
Sbjct  29    GKATILAIGKAFPNQLVPQDFLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMSKE  88

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD+YPELATEGSPTI QRLE+ANPAV+ MAKEASLAC+K+W RP   ITH+VYVSSSEI
Sbjct  89    ILDQYPELATEGSPTIKQRLEIANPAVLKMAKEASLACLKEWNRPPSHITHIVYVSSSEI  148

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLAAELGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  149   RLPGGDLYLAAELGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  208

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAA+V             F+EL+FA QQFLP T +VID
Sbjct  209   LGFRPPNKARPYDLVGAALFGDGAASVX------------FLELNFAVQQFLPETSNVID  256

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGI FKLGRDLP+KIE NIEDFCKKL+ KA        YNELFWAVHPGGPAILN
Sbjct  257   GRLSEEGIYFKLGRDLPQKIEENIEDFCKKLMVKAGLK----EYNELFWAVHPGGPAILN  312

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  LGL S+KLDCSRRALMDFGNVSSNTIFYV+EYMR+EL  K++ G+        EW
Sbjct  313   RLESNLGLDSQKLDCSRRALMDFGNVSSNTIFYVMEYMREEL-RKKENGE--------EW  363

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  364   GLALAFGPGITFEGILLRSL  383



>ref|XP_006418482.1| hypothetical protein EUTSA_v10007831mg [Eutrema salsugineum]
 gb|ESQ36835.1| hypothetical protein EUTSA_v10007831mg [Eutrema salsugineum]
Length=395

 Score =   590 bits (1522),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/380 (78%), Positives = 337/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  24    GKATVLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSRE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRP  +ITH+VYVSSSEI
Sbjct  84    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPAGDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRES E PFMEL +A QQFLPGTQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPRES-EAPFMELHYAVQQFLPGTQNVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILN
Sbjct  263   GRLSEEGINFKLGRDLPQKIEENIEEFCKKLMGKA--GDESMEFNDMFWAVHPGGPAILN  320

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+ SRRAL D+GNVSSNTI YV+EY+RDEL   +K+G+        EW
Sbjct  321   RLETKLKLEGEKLESSRRALRDYGNVSSNTILYVMEYVRDEL---KKKGE-----SAQEW  372

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+L+R+L
Sbjct  373   GLGLAFGPGITFEGLLIRSL  392



>ref|XP_007219350.1| hypothetical protein PRUPE_ppa019432mg, partial [Prunus persica]
 gb|EMJ20549.1| hypothetical protein PRUPE_ppa019432mg, partial [Prunus persica]
Length=362

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/340 (83%), Positives = 313/340 (92%), Gaps = 4/340 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQL+PQDCLVEGYIRDTKC D+AIKEKLERLCKTTTVKTRYTVM K+
Sbjct  27    GKATVLALGKAFPSQLIPQDCLVEGYIRDTKCVDVAIKEKLERLCKTTTVKTRYTVMSKE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEGS TI QRLE+ANPAV+ MA EASL+CIK+WGRPVE+ITHVVYVSSSEI
Sbjct  87    ILDKYPELATEGSATIRQRLEIANPAVVQMALEASLSCIKEWGRPVEDITHVVYVSSSEI  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ELGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  147   RLPGGDLYLASELGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPP+KARPYDLVGAALFGDGAAAVIVG+NP+   E PFMEL++A QQFLP T +VID
Sbjct  207   LGFRPPSKARPYDLVGAALFGDGAAAVIVGSNPKPGQETPFMELNYAVQQFLPDTHNVID  266

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KI+ NIE+FCKKL+ KA+       +NELFWAVHPGGPAILN
Sbjct  267   GRLSEEGINFKLGRDLPQKIDENIEEFCKKLMAKASLK----DFNELFWAVHPGGPAILN  322

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRD  1219
             +LE TL L S+KL+CSRRALMD+GNVSSNTIFYV+E MR+
Sbjct  323   KLESTLKLGSDKLECSRRALMDYGNVSSNTIFYVMENMRE  362



>ref|XP_009141701.1| PREDICTED: chalcone synthase [Brassica rapa]
Length=393

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/380 (78%), Positives = 338/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  22    GKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVLSRE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGR VE+ITH+VYVSSSEI
Sbjct  82    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRTVEDITHIVYVSSSEI  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  142   RLPGGDLYLSAKLGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P  S E PFMEL +A QQF+PGTQ+VID
Sbjct  202   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-EAPFMELHYAVQQFVPGTQTVID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   ++++ +N++FW VHPGGPAILN
Sbjct  261   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA--GDDSMEFNDMFWTVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +K+G      G  EW
Sbjct  319   RLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---KKKGD-----GAQEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+LLR+L
Sbjct  371   GLGLAFGPGITFEGLLLRSL  390



>ref|XP_010258840.1| PREDICTED: chalcone synthase-like [Nelumbo nucifera]
Length=401

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 332/380 (87%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQL+PQ+CLVEGY RDTKCDD AIKEKLERLCK TTVKTRYTVM K+
Sbjct  34    GKATVLALGKAFPSQLIPQECLVEGYFRDTKCDDSAIKEKLERLCKNTTVKTRYTVMSKE  93

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+ANPAV+ MA EASLACIK+WGRPV +ITH+VYVSSSEI
Sbjct  94    ILDKYPELTTEGSPTIKQRLEIANPAVLEMALEASLACIKEWGRPVGDITHIVYVSSSEI  153

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ LGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  154   RLPGGDLYLASGLGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  213

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LG+RPPN ARPYDLVGAALFGDGAAA+I+G +P   +E+PFMEL+FA QQFLPGT ++ID
Sbjct  214   LGYRPPNMARPYDLVGAALFGDGAAALIIGTDPISQIESPFMELNFAVQQFLPGTHNIID  273

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE+NIE FC+ L+ KAN       +N+LFWAVHPGGPAILN
Sbjct  274   GRLSEEGINFKLGRDLPQKIEDNIESFCRMLMEKANLKE----FNDLFWAVHPGGPAILN  329

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L+++KL CSRRALMD+GNVSSNTIFYV++YMR+EL     +          EW
Sbjct  330   RLESCLSLKADKLQCSRRALMDYGNVSSNTIFYVMDYMREELKGGGGE----------EW  379

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL+R+L
Sbjct  380   GLVLAFGPGITFEGILVRSL  399



>gb|ADF43044.1| chalcone synthase 3 protein [Brassica rapa subsp. rapa]
Length=393

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 337/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  22    GKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVLSRE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGR VE+ITH+VYVSSSEI
Sbjct  82    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRTVEDITHIVYVSSSEI  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  142   RLPGGDLYLSAKLGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P  S E PFMEL +A QQF+PGTQ+VID
Sbjct  202   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-EAPFMELHYAVQQFVPGTQTVID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+ KA   ++++ +N++FW VHPGGPAILN
Sbjct  261   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMAKA--GDDSIEFNDMFWTVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +K+G      G  EW
Sbjct  319   RLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---KKKGD-----GAQEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+LLR+L
Sbjct  371   GLGLAFGPGITFEGLLLRSL  390



>emb|CDY18415.1| BnaA04g21720D [Brassica napus]
Length=393

 Score =   587 bits (1513),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/380 (78%), Positives = 337/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  22    GKATVLALGKAFPSQVVPQEHLVEGFLRDTKCDDPFIKEKLEHLCKTTTVKTRYTVLSRE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGR VE+ITH+VYVSSSEI
Sbjct  82    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRTVEDITHIVYVSSSEI  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  142   RLPGGDLYLSAKLGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P  S E PFMEL +A QQF+PGTQ+VID
Sbjct  202   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPLPS-EAPFMELHYAVQQFVPGTQTVID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+ KA   ++++ +N++FW VHPGGPAILN
Sbjct  261   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMAKA--GDDSIEFNDMFWTVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+CSRRAL+D+GNVSSNTI YV+EYMRDEL   +K+G      G  EW
Sbjct  319   RLETKLKLGREKLECSRRALVDYGNVSSNTILYVMEYMRDEL---KKKGD-----GAQEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+LLR+L
Sbjct  371   GLGLAFGPGITFEGLLLRSL  390



>gb|EYU31920.1| hypothetical protein MIMGU_mgv1a007619mg [Erythranthe guttata]
Length=401

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/381 (77%), Positives = 330/381 (87%), Gaps = 5/381 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFPSQLVPQDCLVEG+IRDTKC DL IKEKLERLCKTTTVKTRYTVM ++
Sbjct  25    GKATILAIGKAFPSQLVPQDCLVEGFIRDTKCHDLVIKEKLERLCKTTTVKTRYTVMSRE  84

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L++YPELATEG+PTI QRL++ANPAV+ MA EASL C+K+WGRP  +ITH+VYVSSSEI
Sbjct  85    ILEQYPELATEGTPTIKQRLDIANPAVLKMATEASLTCLKEWGRPASDITHLVYVSSSEI  144

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL LA+ELGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLL TSETTI
Sbjct  145   RLPGGDLLLASELGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLATSETTI  204

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNK+RPYDLVGAALFGDGAAAV++GA P   LE+PF+EL+FA QQFLPGT  VID
Sbjct  205   LGFRPPNKSRPYDLVGAALFGDGAAAVVIGAEPVPGLESPFLELNFAVQQFLPGTSEVID  264

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGI FKLGRDLP+KIE+NI++FC KL+ KA        YNELFWAVHPGGPAILN
Sbjct  265   GRLSEEGIYFKLGRDLPQKIEDNIKEFCDKLMAKAGVE----DYNELFWAVHPGGPAILN  320

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  LGL  EKLDCSRRALMD+GNVSSNT+ YV+EYMR+E+  K+      E+ GG E 
Sbjct  321   RLEGKLGLGKEKLDCSRRALMDYGNVSSNTVLYVMEYMREEMKKKKAAAAAAEDGGGGEE  380

Query  1280  glal-aFGPGITFEGILLRNL  1339
                  AFGPGITFEGILLR+L
Sbjct  381   WGLALAFGPGITFEGILLRSL  401



>gb|AEE69028.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/380 (76%), Positives = 332/380 (87%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFP Q VPQ+CLV+ +I DTKC D AIKEKLERLC+TTTVKTRYTVMCK+
Sbjct  19    GKATVLAMGKAFPKQHVPQECLVDKFISDTKCTDAAIKEKLERLCETTTVKTRYTVMCKE  78

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             VLDKYPELA EGSPTI QR E+AN AV+ MA EAS ACIK+WGRP+ EITHVVYVSSSE+
Sbjct  79    VLDKYPELAVEGSPTIRQRFEIANSAVVEMALEASHACIKEWGRPISEITHVVYVSSSEL  138

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ELGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  139   RLPGGDLYLASELGLRTDVRRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  198

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             L FRPP+ ARPYDLVGAALFGDGAAAVI+GANP    E+PFMEL++A QQFLPGTQS++D
Sbjct  199   LAFRPPSNARPYDLVGAALFGDGAAAVIIGANPVAGKESPFMELNYATQQFLPGTQSIVD  258

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++ EEGINFKLGRDLP+KIE+NIE+FCKK++ +A        +N+LFWAVHPGGP ILN
Sbjct  259   GKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ----FNDLFWAVHPGGPEILN  314

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E  LGL ++KL+CSRRALMDFGNVSSNT+FYV+EY+R+EL  KRK  +        EW
Sbjct  315   RVESRLGLNADKLECSRRALMDFGNVSSNTVFYVMEYLREEL--KRKGSE--------EW  364

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEG+LLR+L
Sbjct  365   GLALAFGPGITFEGVLLRSL  384



>ref|XP_004492184.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=389

 Score =   585 bits (1507),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 332/380 (87%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFPSQ++PQ+CLVEGYIRDTKC D +IKEKLERLCK TTVKTRYTVM K+
Sbjct  24    GKATILALGKAFPSQVLPQECLVEGYIRDTKCADSSIKEKLERLCKNTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELA EG+PTI Q+LE+ANPAV+ MA  AS ACIK+WGRPVEEITH+VYVSSSEI
Sbjct  84    ILDKYPELAIEGTPTIRQKLEIANPAVVEMATRASKACIKEWGRPVEEITHMVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLANELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN +RPYDLVGAALFGDGAAA I+G NP  + E+PF+EL++A Q+FLP TQ+VID
Sbjct  204   LGFRPPNISRPYDLVGAALFGDGAAAAIIGTNPLLNHESPFIELNYAVQKFLPDTQNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GRISEEGINFKLGRDLP+KIE+NIE+FC KL+ K +       +NELFWAVHPGGPAILN
Sbjct  264   GRISEEGINFKLGRDLPQKIEDNIEEFCNKLMAKCDVK----DFNELFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE  L L  +KL+CSR+ALMD+GNVSSNTIFYV+EYMR+ L   ++ G+        EW
Sbjct  320   KLETILKLSGDKLECSRKALMDYGNVSSNTIFYVMEYMREYL---KEDGR-------EEW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGILLR+L
Sbjct  370   GLGLAFGPGITFEGILLRSL  389



>gb|ABP98922.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/380 (76%), Positives = 331/380 (87%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFP Q VPQ+CLVE +I DTKC D AIKEKLERLC+TTTVKTRYTVMCK+
Sbjct  19    GKATVLAMGKAFPKQHVPQECLVEKFISDTKCTDAAIKEKLERLCETTTVKTRYTVMCKE  78

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             VLDKYPELA EGSPTI QR E+AN AV+ MA EAS ACIK+WGRP+ EITHVVYVSSSE+
Sbjct  79    VLDKYPELAVEGSPTIRQRFEIANSAVVEMAIEASHACIKEWGRPISEITHVVYVSSSEL  138

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ELGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  139   RLPGGDLYLASELGLRTDVRRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  198

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             L FRPP+ ARPYDLVGAALFGDGAAAVI+G NP    E+PFMEL++A QQFLPGTQS++D
Sbjct  199   LAFRPPSTARPYDLVGAALFGDGAAAVIIGTNPVTGKESPFMELNYATQQFLPGTQSIVD  258

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++ EEGINFKLGRDLP+KIE+NIE+FCKK++ +A        +N+LFWAVHPGGP ILN
Sbjct  259   GKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ----FNDLFWAVHPGGPEILN  314

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E  LGL ++KL+CSRRAL+DFGNVSSNT+FYV+EY+R+EL  KRK  +        EW
Sbjct  315   RVESRLGLNADKLECSRRALVDFGNVSSNTVFYVMEYLREEL--KRKGSE--------EW  364

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEG+LLR+L
Sbjct  365   GLALAFGPGITFEGVLLRSL  384



>gb|AFN26935.1| polyketide synthase [Hypericum perforatum]
Length=386

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/380 (76%), Positives = 330/380 (87%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFP Q VPQ+CLVE +I DTKC D AIKEKLERLC+TTTVKTRYTVMCK+
Sbjct  19    GKATVLAMGKAFPKQHVPQECLVEKFISDTKCTDAAIKEKLERLCETTTVKTRYTVMCKE  78

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             VLDKYPELA EGSPTI QR E+AN AV+ MA EAS ACIK+WGRP+ EITHVVYVSSSE+
Sbjct  79    VLDKYPELAVEGSPTIRQRFEIANSAVVEMAIEASHACIKEWGRPISEITHVVYVSSSEL  138

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ELGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  139   RLPGGDLYLASELGLRTDVRRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  198

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             L FRPP+ ARPYDLVGAALFGDGAAAVI+G NP    E+PFMEL++A QQFLPGTQS++D
Sbjct  199   LAFRPPSNARPYDLVGAALFGDGAAAVIIGTNPVAGKESPFMELNYATQQFLPGTQSIVD  258

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++ EEGINFKLGRDLP+KIE+NIE+FCKK++ +A        +N+LFWAVHPGGP ILN
Sbjct  259   GKLHEEGINFKLGRDLPQKIEDNIEEFCKKIMSEAGLTQ----FNDLFWAVHPGGPEILN  314

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E  LGL ++KL+CSRRALMDFGNVSSNT+ YV+EY+R+EL  KRK  +        EW
Sbjct  315   RVESRLGLNADKLECSRRALMDFGNVSSNTVLYVMEYLREEL--KRKGSE--------EW  364

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEG+LLR+L
Sbjct  365   GLALAFGPGITFEGVLLRSL  384



>ref|XP_003607498.1| Chalcone synthase [Medicago truncatula]
 gb|AES89695.1| chalcone synthase family protein, putative [Medicago truncatula]
Length=389

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/380 (76%), Positives = 328/380 (86%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFPSQ++PQ+CLVEGYIRDTKC+D  +KEKL RLCK TTVKTRYTVM K+
Sbjct  24    GKATILALGKAFPSQVLPQECLVEGYIRDTKCEDDYVKEKLTRLCKNTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD+YPEL  EG+PTI Q+LE+ANPAV+ MA  AS ACI++WGR  EEITH+VYVSSSEI
Sbjct  84    ILDEYPELFIEGTPTIRQKLEIANPAVVEMATRASKACIEEWGRSPEEITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA ELGLKSDVNRVMLYFLGCYGGV+GLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLANELGLKSDVNRVMLYFLGCYGGVSGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAA I+G NP  + E PFMEL++A QQFLP TQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAAIIGTNPLPNQERPFMELNYAVQQFLPNTQNVID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GRI+EEGINFKLGRDLP+KIE+NIE+FCKKL+ K+        +NE+FWAVHPGGPAILN
Sbjct  264   GRITEEGINFKLGRDLPQKIEDNIEEFCKKLMAKSGVKE----FNEMFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE TL L  +KL+CSR+ALM+FGNVSSNTIFYV+EYMRD L   +  G         EW
Sbjct  320   KLENTLKLSGDKLECSRKALMNFGNVSSNTIFYVMEYMRDYL---KNDG-------TEEW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+LLR+L
Sbjct  370   GLGLAFGPGITFEGVLLRSL  389



>ref|XP_004308525.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=1128

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/380 (80%), Positives = 340/380 (89%), Gaps = 13/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ++PQDCLVEGYIRDTKC D+AIKEKLERLCKTTTVKTRYTVM K+
Sbjct  762   GKATVLALGKAFPSQIIPQDCLVEGYIRDTKCADVAIKEKLERLCKTTTVKTRYTVMSKE  821

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEG+ TI QRLE+ NPAV+ MA EASLACIK+WGRPVE+ITH+VYVSSSEI
Sbjct  822   ILDKYPELATEGTTTIRQRLEITNPAVVEMAFEASLACIKEWGRPVEDITHIVYVSSSEI  881

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  882   RLPGGDLYLASKLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  941

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVIVG+NP    E+PFMEL++A QQFLP T +VID
Sbjct  942   LGFRPPNKARPYDLVGAALFGDGAAAVIVGSNPVWGQESPFMELNYAVQQFLPDTHNVID  1001

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KI+ NIE FCKKL+ KAN       +NELFWAVHPGGPAILN
Sbjct  1002  GRLSEEGINFKLGRDLPQKIDENIEVFCKKLMAKANLK----DFNELFWAVHPGGPAILN  1057

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE TL L S+KL+CSR+ALMD+GNVSSNTIFYV+E MRDEL  ++K+G         EW
Sbjct  1058  KLEGTLKLTSDKLECSRQALMDYGNVSSNTIFYVMEKMRDEL--RKKEGS-------EEW  1108

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  1109  GLALAFGPGITFEGILLRSL  1128



>ref|XP_010501268.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic-like [Camelina sativa]
Length=1119

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/426 (72%), Positives = 359/426 (84%), Gaps = 26/426 (6%)
 Frame = +2

Query  68    TLLISILKASYILTMMSN--LNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPS  241
             TL +S+   ++ L  MSN  +NG + +ST+            +   GKAT+LALGKAFPS
Sbjct  715   TLQLSV--PNFHLHEMSNSRMNGVEKLSTRR-----------VANPGKATVLALGKAFPS  761

Query  242   QLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSP  421
             Q+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++LDKYPEL TEGSP
Sbjct  762   QVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREILDKYPELTTEGSP  821

Query  422   TIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELG  601
             TI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LG
Sbjct  822   TIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLG  881

Query  602   LKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDL  781
             L++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDL
Sbjct  882   LRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDL  941

Query  782   VGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGR  961
             VGAALFGDGAAAVI+GANP+E  E PFMEL +A QQFLPGTQ+VIDGR+SEEGINFKLGR
Sbjct  942   VGAALFGDGAAAVIIGANPKEC-EAPFMELHYAVQQFLPGTQNVIDGRLSEEGINFKLGR  1000

Query  962   DLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLD  1141
             DLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+
Sbjct  1001  DLPQKIEENIEEFCKKLMGKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEREKLE  1058

Query  1142  CSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEG  1321
              SRRAL+++GNVSSNTI YV+EYMRDEL   +K+G+        EWGL LAFGPGITFEG
Sbjct  1059  SSRRALVNYGNVSSNTILYVMEYMRDEL---KKKGE-----AAQEWGLGLAFGPGITFEG  1110

Query  1322  ILLRNL  1339
             +L+R+L
Sbjct  1111  LLIRSL  1116



>gb|AAY96720.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96722.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96724.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96727.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96733.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96734.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96737.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96738.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96740.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96721.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPE+ TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPEITTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAZ81860.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 338/380 (89%), Gaps = 10/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC+D  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  24    GKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVLSRE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  84    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILN
Sbjct  263   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILN  321

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EW
Sbjct  322   RLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---KKKGD-----AAQEW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+L+R+L
Sbjct  374   GLGLAFGPGITFEGLLIRSL  393



>ref|XP_002889339.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65598.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
Length=396

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/380 (77%), Positives = 337/380 (89%), Gaps = 10/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC+D  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  24    GKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVLSRE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  84    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILN
Sbjct  263   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILN  321

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL  K  + +        EW
Sbjct  322   RLETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREELKKKGDEAQ--------EW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+L+R+L
Sbjct  374   GLGLAFGPGITFEGLLIRSL  393



>ref|XP_010456329.1| PREDICTED: chalcone synthase-like isoform X1 [Camelina sativa]
Length=394

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/381 (74%), Positives = 330/381 (87%), Gaps = 9/381 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDDL+IK+KL+ LCKTTTVKTRYTVM +
Sbjct  23    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKDKLQHLCKTTTVKTRYTVMSR  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASL CIKDWGR VE+ITH++YVSSSE
Sbjct  83    ETLHKYPELATEGSPTINQRLEIANEAVVQMAYEASLVCIKDWGRAVEDITHLLYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVMLYFLGCYGG++GLRVAKDIAENNPGSRVLLTTSETT
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSETT  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGTQ VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTQGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGRDLP+KIE N+E+FCKKL+ KA + +  L  N+LFWAVHPGGPAIL
Sbjct  262   DGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLNDLFWAVHPGGPAIL  321

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             + LE  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +RDEL  K  +G+        E
Sbjct  322   SGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKGTEGE--------E  373

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  374   WGLGLAFGPGITFEGFLMRSL  394



>ref|NP_171707.1| polyketide synthase A [Arabidopsis thaliana]
 gb|AAC24368.1| Similar to rice chalcone synthase homolog, gp|U90341|2507617 
and anther specific protein, gp|Y14507|2326772 [Arabidopsis 
thaliana]
 gb|ABO09877.1| At1g02050 [Arabidopsis thaliana]
 gb|AEE27371.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=395

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96741.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKE+LE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKERLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>ref|XP_010456330.1| PREDICTED: chalcone synthase-like isoform X2 [Camelina sativa]
Length=384

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/381 (74%), Positives = 330/381 (87%), Gaps = 9/381 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDDL+IK+KL+ LCKTTTVKTRYTVM +
Sbjct  13    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKDKLQHLCKTTTVKTRYTVMSR  72

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASL CIKDWGR VE+ITH++YVSSSE
Sbjct  73    ETLHKYPELATEGSPTINQRLEIANEAVVQMAYEASLVCIKDWGRAVEDITHLLYVSSSE  132

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVMLYFLGCYGG++GLRVAKDIAENNPGSRVLLTTSETT
Sbjct  133   FRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSETT  192

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGTQ VI
Sbjct  193   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTQGVI  251

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGRDLP+KIE N+E+FCKKL+ KA + +  L  N+LFWAVHPGGPAIL
Sbjct  252   DGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLNDLFWAVHPGGPAIL  311

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             + LE  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +RDEL  K  +G+        E
Sbjct  312   SGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKGTEGE--------E  363

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  364   WGLGLAFGPGITFEGFLMRSL  384



>gb|AAZ81859.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ81864.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 338/380 (89%), Gaps = 10/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC+D  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  24    GKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVLSRE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  84    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILN
Sbjct  263   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILN  321

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EW
Sbjct  322   RLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---KKKGD-----AAQEW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+L+R+L
Sbjct  374   GLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81863.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 338/380 (89%), Gaps = 10/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC+D  IKEKLE LCKTTTVKTRYTV+ ++
Sbjct  24    GKATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVLSRE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  84    ILDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VID
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILN
Sbjct  263   GRLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILN  321

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EW
Sbjct  322   RLETKLKLEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---KKKGD-----AAQEW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEG+L+R+L
Sbjct  374   GLGLAFGPGITFEGLLIRSL  393



>gb|AAZ81867.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/379 (78%), Positives = 337/379 (89%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>gb|AAY96729.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96742.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96743.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLEAKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96717.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96718.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96726.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96730.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96731.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96732.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96735.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96736.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96739.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96744.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAY96747.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|ACY74337.1| putative chalcone synthase [Artemisia annua]
Length=378

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/381 (78%), Positives = 331/381 (87%), Gaps = 13/381 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQL+PQDCLVEG+ RDT C D A+KEKL RLCKTTTVKTRYTVM K+
Sbjct  11    GKATVLALGKAFPSQLIPQDCLVEGFFRDTNCADSAMKEKLARLCKTTTVKTRYTVMSKE  70

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELA EGS TI+QRL +AN AV  MAKEASLAC K WGRP E+ITHVVYVSSSEI
Sbjct  71    ILDKYPELAREGSATISQRLTIANEAVTEMAKEASLACFKQWGRPAEDITHVVYVSSSEI  130

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA+ELGL++DVNRVMLYFLGCYGGVTGLR+AKDIAENNPGSRVLLTTSETTI
Sbjct  131   RLPGGDLFLASELGLRNDVNRVMLYFLGCYGGVTGLRIAKDIAENNPGSRVLLTTSETTI  190

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNK+RPYDLVGAALFGDGAAA I+GA+P    E+PFMELS+A QQFLPGTQ+VID
Sbjct  191   LGFRPPNKSRPYDLVGAALFGDGAAAAIIGADPING-ESPFMELSYAVQQFLPGTQNVID  249

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKLGRDLP+KI++NIE FCKKL+ KA        +N+LFWAVHPGGPAILN
Sbjct  250   GRLTEEGINFKLGRDLPQKIDDNIEAFCKKLMEKAGKLE---DFNDLFWAVHPGGPAILN  306

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L+ EKLDCSRRAL DFGNVSSNTI YV+EYMRDELM K K  +         W
Sbjct  307   RLEATLKLKGEKLDCSRRALTDFGNVSSNTIIYVMEYMRDELMNKEKSEE---------W  357

Query  1280  glalaFGPGITFEGILLRNLQ  1342
             GLALAFGPGITFEGILLR+L 
Sbjct  358   GLALAFGPGITFEGILLRSLN  378



>ref|XP_008232397.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Prunus mume]
Length=1150

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/380 (79%), Positives = 340/380 (89%), Gaps = 11/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFPSQL+PQDCLVEGYIRDTKC D+AIKEKLERLCKTTTVKTRYTVM K+
Sbjct  782   GKATVLALGKAFPSQLIPQDCLVEGYIRDTKCVDVAIKEKLERLCKTTTVKTRYTVMSKE  841

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPELATEGS TI QRLE+ANPAV+ MA EASL+CIK+WGRPVE+ITH+VYVSSSEI
Sbjct  842   ILDKYPELATEGSATIRQRLEIANPAVVQMALEASLSCIKEWGRPVEDITHIVYVSSSEI  901

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  902   RLPGGDLYLASKLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  961

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVIVG+ P+   E PFMEL++A QQFLP T +VID
Sbjct  962   LGFRPPNKARPYDLVGAALFGDGAAAVIVGSKPKPGQETPFMELNYAVQQFLPDTHNVID  1021

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KI+ NIE+FCKKL+ KA+       +NELFWAVHPGGPAILN
Sbjct  1022  GRLSEEGINFKLGRDLPQKIDENIEEFCKKLMAKASLK----DFNELFWAVHPGGPAILN  1077

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE TL L S+KL+CSRRALMD+GNVSSNTIFYV+E MR+EL  K+++          EW
Sbjct  1078  KLESTLKLGSDKLECSRRALMDYGNVSSNTIFYVMENMREELKKKKEE-------EREEW  1130

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGIL+R+L
Sbjct  1131  GLALAFGPGITFEGILMRSL  1150



>gb|AAY96719.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 349/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQDVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLEAKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96723.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 349/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL  EGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTAEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96725.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/408 (74%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDGSMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAZ81870.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   572 bits (1474),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/379 (78%), Positives = 336/379 (89%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   +  + +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDEPMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>gb|AAZ81868.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 337/379 (89%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD +IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDASIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKY EL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYSELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>gb|AAZ81872.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   571 bits (1472),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 337/379 (89%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVL+TTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLVTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>gb|AAY96745.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/408 (73%), Positives = 349/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VI+GR++ EGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIEGRLTAEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLEAKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAY96728.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/408 (73%), Positives = 350/408 (86%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   G+AT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGRATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+IT++VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITYIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAZ81873.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 336/379 (89%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+ NVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLKLEKEKLESSRRALVDYENVSSNTILYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>ref|XP_011042452.1| PREDICTED: pentatricopeptide repeat-containing protein At1g02060, 
chloroplastic [Populus euphratica]
Length=1216

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/380 (78%), Positives = 339/380 (89%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA GKAFPSQLVPQ+CLVEGY+RDTKCDD +IKEKLERLCK+TTVKTRYTVM K+
Sbjct  851   GKATILATGKAFPSQLVPQECLVEGYMRDTKCDDASIKEKLERLCKSTTVKTRYTVMSKE  910

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEGSPTI QRLE+ANPAV+ MA +AS+ACI +WG  V++ITHVVYVSSSEI
Sbjct  911   ILEKYPELATEGSPTIKQRLEIANPAVVEMALKASIACINEWGGSVKDITHVVYVSSSEI  970

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSR+LLTTSETTI
Sbjct  971   RLPGGDLYLASQLGLRNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRILLTTSETTI  1030

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P    E+PFMELS+A QQFLPGTQ+VID
Sbjct  1031  LGFRPPNKARPYDLVGAALFGDGAAAVIIGADPVIGKESPFMELSYAVQQFLPGTQNVID  1090

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE+NIE+FC+KL+ KA        +N+LFWAVHPGGPAILN
Sbjct  1091  GRLSEEGINFKLGRDLPQKIEDNIEEFCRKLMSKAGLTE----FNDLFWAVHPGGPAILN  1146

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L +EKL+CSRRAL+++GNVSSNTI YVLEYM++EL  KR  G+        EW
Sbjct  1147  RLESNLKLNTEKLECSRRALINYGNVSSNTIVYVLEYMKEEL--KRGGGE--------EW  1196

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  1197  GLALAFGPGITFEGILLRSL  1216



>gb|AAZ81862.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ81865.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ81866.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/408 (73%), Positives = 348/408 (85%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LA GKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLAPGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGIT EG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITLEGLLIRSL  392



>gb|AAY96748.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/408 (73%), Positives = 348/408 (85%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLALGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EA L CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EAGLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTTSETTILGFR PNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRQPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VI+GR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIEGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGITFEG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITFEGLLIRSL  392



>gb|AAZ81871.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/379 (77%), Positives = 336/379 (89%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPP+KARPY LVGAALFGDGAAAVI+GA+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPSKARPYGLVGAALFGDGAAAVIIGADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>gb|AAY96746.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/408 (73%), Positives = 347/408 (85%), Gaps = 19/408 (5%)
 Frame = +2

Query  116   SNLNGKDNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVEGYIRDTKC  295
             S +NG + +S+++         RR+   GKAT+LA GKAFPSQ+VPQ+ LVEG++RDTKC
Sbjct  4     SRMNGVEKLSSKS--------TRRVANAGKATLLAPGKAFPSQVVPQENLVEGFLRDTKC  55

Query  296   DDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAK  475
             DD  IKEKLE LCKTTTVKTRYTV+ +++L KYPEL TEGSPTI QRLE+AN AV+ MA 
Sbjct  56    DDAFIKEKLEHLCKTTTVKTRYTVLTREILAKYPELTTEGSPTIKQRLEIANEAVVEMAL  115

Query  476   EASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGG  655
             EASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGG
Sbjct  116   EASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGG  175

Query  656   VTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGAN  835
             VTGLRVAKDIAENNPGSRVLLTT ETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+
Sbjct  176   VTGLRVAKDIAENNPGSRVLLTTPETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGAD  235

Query  836   PRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLI  1015
             PRE  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+
Sbjct  236   PREC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLM  294

Query  1016  GKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIF  1195
             GKA   + ++ +N++FWAVHPGGPAILNRLE  L L  EKL+ SRRAL+D+GNVSSNTI 
Sbjct  295   GKA--GDESMEFNDMFWAVHPGGPAILNRLETKLKLEKEKLESSRRALVDYGNVSSNTIL  352

Query  1196  YVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             YV+EYMRDEL   +K+G         EWGL LAFGPGIT EG+L+R+L
Sbjct  353   YVMEYMRDEL---KKKGD-----AAQEWGLGLAFGPGITLEGLLIRSL  392



>gb|AAZ81861.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   566 bits (1458),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/379 (77%), Positives = 335/379 (88%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKC+D  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCEDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TE SPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTESSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+ A+PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIRADPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EWG
Sbjct  323   LETKLELEKEKLESSRRALVDYGNVSSNTIMYVMEYMREEL---KKKGD-----AAQEWG  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>ref|XP_002511627.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF50296.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1163

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/380 (80%), Positives = 344/380 (91%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQL+PQDCLVEGYIRDTKC+D++IKEKLERLCKTTTVKTRYTVM K+
Sbjct  798   GKATVLAVGKAFPSQLIPQDCLVEGYIRDTKCEDVSIKEKLERLCKTTTVKTRYTVMSKE  857

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPE+A EGS TI QRL++ANPAV+ MAKEASLACIK+WGRPVE+ITH+VYVSSSEI
Sbjct  858   ILEKYPEIAIEGSTTIKQRLDIANPAVVEMAKEASLACIKEWGRPVEDITHIVYVSSSEI  917

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA++LGL++DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  918   RLPGGDLYLASQLGLRNDVCRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  977

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPNKARPYDLVGAALFGDGAAA I+GA+P  S E+PFMEL++A QQFLPGTQ VID
Sbjct  978   LGFRPPNKARPYDLVGAALFGDGAAAAIIGADPVLSSESPFMELNYAVQQFLPGTQHVID  1037

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGINFKLGRDLP+KIE+NIE+FCKKL+ KA        +N+LFWAVHPGGPAILN
Sbjct  1038  GRLSEEGINFKLGRDLPQKIEDNIEEFCKKLMSKAGLTE----FNDLFWAVHPGGPAILN  1093

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE TL L +EKL+CSR+ALMD+GNVSSNT+FYV+EYMR+EL  KRK  +        EW
Sbjct  1094  RLESTLKLNAEKLECSRKALMDYGNVSSNTVFYVIEYMREEL--KRKGSE--------EW  1143

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGILLR+L
Sbjct  1144  GLALAFGPGITFEGILLRSL  1163



>ref|XP_008444217.1| PREDICTED: chalcone synthase [Cucumis melo]
Length=389

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 336/380 (88%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFPSQLVPQ+CLVEGYIRDTKC D  IKEKLERLCKTTTV+TRYTVMCK+
Sbjct  24    GTATILALGKAFPSQLVPQECLVEGYIRDTKCIDTTIKEKLERLCKTTTVRTRYTVMCKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EAS ACIK+WGR VE+ITH+VYVSSSEI
Sbjct  84    ILDKYPELVTEGSPTIRQRLEIANSAVVEMATEASKACIKEWGRSVEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLY+A +LGLK+DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYIANQLGLKNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGAAAVI+GA+P    E+PFMEL++A QQFLP TQ+VI+
Sbjct  204   LGFRPPNNARPYDLVGAALFGDGAAAVIIGADPMLGQESPFMELNYAIQQFLPDTQNVIN  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++SEEGI+FKLGRDLP++I++NIE FC+KL+ K     N + +N+LFWAVHPGGPAILN
Sbjct  264   GKLSEEGISFKLGRDLPQRIDDNIEGFCRKLMKK----RNLMNFNDLFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE TL L+SEKL+CSR+ALMD+GNVSSNTIFYV+E MR+ L  KR+ G+        EW
Sbjct  320   KLENTLRLKSEKLECSRKALMDYGNVSSNTIFYVIENMRENL--KREDGE--------EW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGIL+R+L
Sbjct  370   GLALAFGPGITFEGILIRSL  389



>ref|XP_002875049.1| hypothetical protein ARALYDRAFT_490563 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51308.1| hypothetical protein ARALYDRAFT_490563 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   563 bits (1451),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/381 (73%), Positives = 330/381 (87%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDDL+IK+KL+ LCK+TTVKTRYTVM +
Sbjct  16    QGKATLLALGKAFPSNVVSQENLVEDYLREIKCDDLSIKDKLQHLCKSTTVKTRYTVMSR  75

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASL CIK+WGR VE+ITH+VYVSSSE
Sbjct  76    ETLQKYPELATEGSPTIKQRLEIANEAVVQMAYEASLVCIKEWGRTVEDITHLVYVSSSE  135

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+ +LGL+++V RVMLYFLGCYGG++GLRVAKDIAENNPGSRVLLTTSETT
Sbjct  136   FRLPGGDLYLSTQLGLRNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSETT  195

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+PRES E+PFMEL  A QQFLP TQ VI
Sbjct  196   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPRES-ESPFMELHCALQQFLPQTQGVI  254

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ KA   + +L  N+LFWAVHPGGPAIL
Sbjct  255   DGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAKA--GSGSLELNDLFWAVHPGGPAIL  312

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             + LE  L L+ EKL+CSRRALMD+GNVSSNTIFY+++ +RDEL  K  +G+        E
Sbjct  313   SGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKGTEGE--------E  364

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  365   WGLGLAFGPGITFEGFLMRSL  385



>ref|XP_006290098.1| hypothetical protein CARUB_v10003743mg [Capsella rubella]
 gb|EOA22996.1| hypothetical protein CARUB_v10003743mg [Capsella rubella]
Length=394

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/381 (73%), Positives = 328/381 (86%), Gaps = 9/381 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+  CDDL+I++KL+ LCKTTTVKTRYTVM +
Sbjct  23    QGKATVLALGKAFPSNVVSQENLVEEYLREINCDDLSIRDKLQHLCKTTTVKTRYTVMSR  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASL CIK+WGR V++ITH+VYVSSSE
Sbjct  83    ETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLVCIKEWGRAVQDITHLVYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVMLYFLGCYGGV+GLRVAKDIAENNPGSRVLLTTSETT
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGVSGLRVAKDIAENNPGSRVLLTTSETT  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF+EL  A QQFLPGT  VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFVELHCAMQQFLPGTHGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ +A + + +L  N+LFWAVHPGGPAIL
Sbjct  262   DGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELNDLFWAVHPGGPAIL  321

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             + LE  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +RDEL  K   G+        E
Sbjct  322   SGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVRDELEKKGTGGE--------E  373

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  374   WGLGLAFGPGITFEGFLMRSL  394



>ref|XP_004142644.1| PREDICTED: chalcone synthase J-like [Cucumis sativus]
 ref|XP_004168964.1| PREDICTED: chalcone synthase J-like [Cucumis sativus]
 gb|KGN54531.1| hypothetical protein Csa_4G358690 [Cucumis sativus]
Length=389

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/380 (77%), Positives = 335/380 (88%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFPSQLVPQ+CLVEGYIRDTKC D  IKEKLERLCKTTTV+TRYTVMCK+
Sbjct  24    GTATILALGKAFPSQLVPQECLVEGYIRDTKCIDATIKEKLERLCKTTTVRTRYTVMCKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL TEGSPTI QRLE+AN AV+ MA EAS ACIK+WGR VE+ITH+VYVSSSEI
Sbjct  84    ILDKYPELVTEGSPTIRQRLEIANSAVVEMATEASKACIKEWGRSVEDITHIVYVSSSEI  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLY+A +LGLK+DV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLYIANQLGLKNDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN ARPYDLVGAALFGDGAAAVI+GA+P    E+PFMEL+ A QQFLP TQ+VI+
Sbjct  204   LGFRPPNNARPYDLVGAALFGDGAAAVIIGADPVLGQESPFMELNCAIQQFLPDTQNVIN  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++SEEGI+FKLGRDLP++I++NIE FC+KL+ K     N + +N+LFWAVHPGGPAILN
Sbjct  264   GKLSEEGISFKLGRDLPQRIDDNIEGFCRKLMEK----RNLVNFNDLFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE TL L+SEKL+CSR+ALMD+GNVSSNTIFYV+E MR+ L  KR+ G+        EW
Sbjct  320   KLENTLRLKSEKLECSRKALMDYGNVSSNTIFYVIENMRENL--KREDGE--------EW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GLALAFGPGITFEGIL+R+L
Sbjct  370   GLALAFGPGITFEGILIRSL  389



>gb|AAM63363.1| putative chalcone synthase [Arabidopsis thaliana]
Length=385

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/381 (73%), Positives = 325/381 (85%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKA PS +V Q+ LVE Y+R+ KCDDL+IK+KL+ LCK+TTVKTRYTVM +
Sbjct  16    QGKATVLALGKALPSNVVSQENLVEEYLREIKCDDLSIKDKLQHLCKSTTVKTRYTVMSR  75

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASL CIK+WGR VE+ITH+VYVSSSE
Sbjct  76    ETLHKYPELATEGSPTIKQRLEIANDAVVQMAYEASLVCIKEWGRAVEDITHLVYVSSSE  135

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVMLYFLGCYGG++GLRVAKDIAENNPGSRVLLTTSETT
Sbjct  136   FRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSETT  195

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP KARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL  A QQFLP TQ VI
Sbjct  196   VLGFRPPKKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHCAMQQFLPQTQGVI  254

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI FKLGRDLP+KIE+N+E+FCKKL+ KA   +  L  N+LFWAVHPGGPAIL
Sbjct  255   DGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKA--GSGALELNDLFWAVHPGGPAIL  312

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             + LE  L L+ EKL+CSRRALMD+GNVSSNTIFY+++ +RDEL  K  +G+        E
Sbjct  313   SGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKGTEGE--------E  364

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+RNL
Sbjct  365   WGLGLAFGPGITFEGFLMRNL  385



>emb|CDX83215.1| BnaA03g22910D [Brassica napus]
Length=392

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 327/381 (86%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDD +IKEKL+ LCKTTTVKTRYTVM  
Sbjct  23    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVMSS  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + + KYPELATEG+PTI QRLE+AN AV+ MA EASLACIK+WGR VE+ITH+VYVSSSE
Sbjct  83    ETMQKYPELATEGTPTIKQRLEIANDAVVQMAYEASLACIKEWGRGVEDITHLVYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVM YFLGCYGGV+G+RVAKDIAENNPGSRVLLTTSET 
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSETM  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGTQ VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTQGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA   + +L  N+LFWAVHPGGPAIL
Sbjct  262   DGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKA--GSGSLELNDLFWAVHPGGPAIL  319

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +RDEL  K + G+        E
Sbjct  320   NGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRDELEKKGRSGE--------E  371

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  372   WGLGLAFGPGITFEGFLMRSL  392



>ref|XP_006396202.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37655.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=395

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/381 (72%), Positives = 327/381 (86%), Gaps = 9/381 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDDL+IK KL+ LCKTTTVKTRYTVM +
Sbjct  24    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKHKLQHLCKTTTVKTRYTVMSR  83

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASLACIK+WGRPVE+ITH++YVSSSE
Sbjct  84    ETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRPVEDITHLIYVSSSE  143

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL+ +V RVMLYFLGCYGGVTGLR+AKDIAENN GSRVLLTTSET 
Sbjct  144   FRLPGGDLYLSAQLGLRHEVQRVMLYFLGCYGGVTGLRLAKDIAENNRGSRVLLTTSETM  203

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF+EL  A Q+FLPGTQ VI
Sbjct  204   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFIELHCAMQKFLPGTQGVI  262

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKL RDLP++IE+N+EDFCKKL+ +A + + +L  N+LFWAVHPGGPAIL
Sbjct  263   DGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELNDLFWAVHPGGPAIL  322

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N LE  L L+  KL+CSR+ALMD+GN SSNTIFY+++ +RDEL  K + G+        E
Sbjct  323   NGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKGRGGE--------E  374

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  375   WGLGLAFGPGITFEGFLMRSL  395



>ref|NP_191915.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
 gb|AAC19299.1| similar to plant chalcone and stilbene synthases [Arabidopsis 
thaliana]
 emb|CAB80762.1| putative chalcone synthase [Arabidopsis thaliana]
 gb|AAN72004.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37822.1| At4g00040 [Arabidopsis thaliana]
 gb|AEE81817.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=385

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/381 (73%), Positives = 326/381 (86%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKA PS +V Q+ LVE Y+R+ KCD+L+IK+KL+ LCK+TTVKTRYTVM +
Sbjct  16    QGKATVLALGKALPSNVVSQENLVEEYLREIKCDNLSIKDKLQHLCKSTTVKTRYTVMSR  75

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASL CIK+WGR VE+ITH+VYVSSSE
Sbjct  76    ETLHKYPELATEGSPTIKQRLEIANDAVVQMAYEASLVCIKEWGRAVEDITHLVYVSSSE  135

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVMLYFLGCYGG++GLRVAKDIAENNPGSRVLLTTSETT
Sbjct  136   FRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTSETT  195

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPY+LVGAALFGDGAAA+I+GA+P ES E+PFMEL  A QQFLP TQ VI
Sbjct  196   VLGFRPPNKARPYNLVGAALFGDGAAALIIGADPTES-ESPFMELHCAMQQFLPQTQGVI  254

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI FKLGRDLP+KIE+N+E+FCKKL+ KA   +  L  N+LFWAVHPGGPAIL
Sbjct  255   DGRLSEEGITFKLGRDLPQKIEDNVEEFCKKLVAKA--GSGALELNDLFWAVHPGGPAIL  312

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             + LE  L L+ EKL+CSRRALMD+GNVSSNTIFY+++ +RDEL  K  +G+        E
Sbjct  313   SGLETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMDKVRDELEKKGTEGE--------E  364

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+RNL
Sbjct  365   WGLGLAFGPGITFEGFLMRNL  385



>ref|XP_009133969.1| PREDICTED: chalcone synthase [Brassica rapa]
Length=392

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 326/381 (86%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDD +IKEKL+ LCKTTTVKTRYTVM  
Sbjct  23    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVMSS  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + + KYPELATEGSPTI QRLE+AN AV+ MA EASLACIK+WGR VE+ITH+VYVSSSE
Sbjct  83    ETMQKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRGVEDITHLVYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVM YFLGCYGGV+G+RVAKDIAENNPGSRVLLTTSET 
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSETM  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGTQ VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTQGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA   + +L  N+LFWAVHPGGPAIL
Sbjct  262   DGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKA--GSGSLELNDLFWAVHPGGPAIL  319

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +R EL  K + G+        E
Sbjct  320   NGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKGRGGE--------E  371

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  372   WGLGLAFGPGITFEGFLMRSL  392



>gb|ADF43043.1| chalcone synthase 2 protein [Brassica rapa subsp. rapa]
Length=392

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 326/381 (86%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDD +IKEKL+ LCKTTTVKTRYTVM  
Sbjct  23    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVMSS  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + + KYPELATEGSPTI QRLE+AN AV+ MA EASLACIK+WGR VE+ITH+VYVSSSE
Sbjct  83    ETMKKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRGVEDITHLVYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVM YFLGCYGGV+G+RVAKDIAENNPGSRVLLTTSET 
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSETM  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGTQ VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTQGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA   + +L  N+LFWAVHPGGPAIL
Sbjct  262   DGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKA--GSGSLELNDLFWAVHPGGPAIL  319

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +R EL  K + G+        E
Sbjct  320   NGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKGRGGE--------E  371

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  372   WGLGLAFGPGITFEGFLMRSL  392



>emb|CDY21499.1| BnaC03g26980D [Brassica napus]
Length=392

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/381 (72%), Positives = 326/381 (86%), Gaps = 11/381 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDD +IKEKL+ LCKTTTVKTRYTVM  
Sbjct  23    QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVMSS  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + + KYPELATEG+PTI QRLE+AN AV+ MA EASLACIK+WGR VE+ITH+VYVSSSE
Sbjct  83    ETMQKYPELATEGTPTIKQRLEIANDAVVQMAYEASLACIKEWGRGVEDITHLVYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RVM YFLGCYGGV+G+RVAKDIAENNPGSRVLLTTSET 
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVMFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSETM  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGTQ VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTQGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA   + +L  N+LFWAVHPGGPAIL
Sbjct  262   DGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKA--GSGSLELNDLFWAVHPGGPAIL  319

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N LE  L L+ EKL+CSR+AL+D+GN SSNTIFY+++ +R EL  K + G+        E
Sbjct  320   NGLETKLKLKPEKLECSRQALVDYGNASSNTIFYIMDKVRGELEKKGRGGE--------E  371

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  372   WGLGLAFGPGITFEGFLMRSL  392



>ref|XP_006396200.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37653.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=538

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/381 (72%), Positives = 327/381 (86%), Gaps = 9/381 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             QGKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDDL+IK KL+ LCKTTTVKTRYTVM +
Sbjct  167   QGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDLSIKHKLQHLCKTTTVKTRYTVMSR  226

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + L KYPELATEGSPTI QRLE+AN AV+ MA EASLACIK+WGRPVE+ITH++YVSSSE
Sbjct  227   ETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRPVEDITHLIYVSSSE  286

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL+ +V RVMLYFLGCYGGVTGLR+AKDIAENN GSRVLLTTSET 
Sbjct  287   FRLPGGDLYLSAQLGLRHEVQRVMLYFLGCYGGVTGLRLAKDIAENNRGSRVLLTTSETM  346

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF+EL  A Q+FLPGTQ VI
Sbjct  347   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFIELHCAMQKFLPGTQGVI  405

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+SEEGI+FKL RDLP++IE+N+EDFCKKL+ +A + + +L  N+LFWAVHPGGPAIL
Sbjct  406   DGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLELNDLFWAVHPGGPAIL  465

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N LE  L L+  KL+CSR+ALMD+GN SSNTIFY+++ +RDEL  K + G+        E
Sbjct  466   NGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELGKKGRGGE--------E  517

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEG L+R+L
Sbjct  518   WGLGLAFGPGITFEGFLMRSL  538



>gb|AAZ81869.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=393

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/379 (77%), Positives = 335/379 (88%), Gaps = 10/379 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KAT+LALGKAFPSQ+VPQ+ LVEG++RDTKCDD  IKEKLE LCKTTTVKTRYTV+ +++
Sbjct  25    KATLLALGKAFPSQVVPQENLVEGFLRDTKCDDAFIKEKLEHLCKTTTVKTRYTVLSREI  84

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LDKYPEL TEGSPTI QRLE+AN AV+ MA EASL CIK+WGRPVE+ITH+VYVSSSEIR
Sbjct  85    LDKYPELTTEGSPTIKQRLEIANEAVVEMALEASLGCIKEWGRPVEDITHIVYVSSSEIR  144

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYL+A+LGL++DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL
Sbjct  145   LPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  204

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPPNKARPYDLVGAALFGDGAAAVI+GA PRE  E PFMEL +A QQFLPGTQ+VIDG
Sbjct  205   GFRPPNKARPYDLVGAALFGDGAAAVIIGAAPREC-EAPFMELHYAVQQFLPGTQNVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGINFKLGRDLP+KIE NIE+FCKKL+GKA   + ++ +N++FWAVHPGGPAILNR
Sbjct  264   RLTEEGINFKLGRDLPQKIEENIEEFCKKLMGKA-GGDESMEFNDMFWAVHPGGPAILNR  322

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  EKL+ SRRAL+D+GNVSSNTI YV+EYMR+EL   +K+G         EW 
Sbjct  323   LETKLKLEKEKLESSRRALVDYGNVSSNTILYVMEYMREEL---KKKGD-----AAQEWR  374

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEG+L+R+L
Sbjct  375   LGLAFGPGITFEGLLIRSL  393



>ref|XP_006837297.1| hypothetical protein AMTR_s00111p00033190 [Amborella trichopoda]
 gb|ERN00151.1| hypothetical protein AMTR_s00111p00033190 [Amborella trichopoda]
Length=383

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/381 (73%), Positives = 317/381 (83%), Gaps = 14/381 (4%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             Q +ATILA+GKAFP Q++PQ+CLVE Y R+T C D  I+EKLERLCK TTVKTRYTV+ K
Sbjct  16    QKEATILAVGKAFPEQVIPQECLVEAYFRNTNCQDPVIREKLERLCKNTTVKTRYTVISK  75

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDKYPEL TEGSPTI QRL++AN AV+ MA +ASL+CI DWG+PV +ITH+VYVSSSE
Sbjct  76    EILDKYPELTTEGSPTITQRLDIANHAVLEMALQASLSCISDWGKPVSQITHLVYVSSSE  135

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             IR PGGDLYLAA LGLK+DVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTT+ETT
Sbjct  136   IRFPGGDLYLAANLGLKTDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTAETT  195

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             ILG+RPPN ARPYDLVGAALFGDGAAAVIVG+ P    E PFMEL  A Q+FLPGTQ +I
Sbjct  196   ILGYRPPNLARPYDLVGAALFGDGAAAVIVGSGPFSEGEKPFMELHNAVQEFLPGTQGII  255

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             +GR++EEGINFKLGRDLP+KIE +I+ FCK L+  AN       +N+LFWAVHPGGPAIL
Sbjct  256   EGRLTEEGINFKLGRDLPQKIEGHIDIFCKNLMKNANLTE----FNDLFWAVHPGGPAIL  311

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N+LE  L L  EKL CSR+ALMD+GNVSSNTIFYVL+YMR+E   K   G+        E
Sbjct  312   NKLESNLRLNPEKLKCSRKALMDYGNVSSNTIFYVLDYMREE--AKEDGGE--------E  361

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEGIL+R L
Sbjct  362   WGLVLAFGPGITFEGILVRRL  382



>ref|XP_010053966.1| PREDICTED: chalcone synthase-like [Eucalyptus grandis]
 gb|KCW78344.1| hypothetical protein EUGRSUZ_D02515 [Eucalyptus grandis]
Length=393

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/382 (76%), Positives = 331/382 (87%), Gaps = 13/382 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFPSQ++PQ+CLVEG+IRDTKC+D +IKEKLERLCKTTTVKTRYTVM K+
Sbjct  24    GKATILAIGKAFPSQVIPQECLVEGFIRDTKCEDASIKEKLERLCKTTTVKTRYTVMSKE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LDKYPEL  EGSPT+ QRLE+ANPAV  MA +ASL+CIK WGRP   ITH+VYVSSSE+
Sbjct  84    ILDKYPELVREGSPTLNQRLEIANPAVTEMALQASLSCIKQWGRPPGHITHLVYVSSSEL  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL+SDV RVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI
Sbjct  144   RLPGGDLHLATRLGLRSDVGRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  203

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESL-ENPFMELSFAAQQFLPGTQSVI  916
             LGFRPPNKARPYDLVGAALFGDGAAA I+GA+P     E+PFMEL  AAQ+FLPGT  VI
Sbjct  204   LGFRPPNKARPYDLVGAALFGDGAAAAIIGADPLLCHGESPFMELRHAAQRFLPGTHDVI  263

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR+S+EGI FKLGRDLP+KIE NIE+FCK L+  A  +     +N++FWAVHPGGPAI+
Sbjct  264   DGRLSDEGIYFKLGRDLPQKIEANIEEFCKGLMATAGLSEG---FNDVFWAVHPGGPAIM  320

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N+LE TL LRS+KL+CSR+ALMD+GNVSSNTIFYV+E MRDEL MKR+ G+        E
Sbjct  321   NKLESTLKLRSDKLECSRKALMDYGNVSSNTIFYVIENMRDEL-MKREGGE--------E  371

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGLALAFGPGITFEGIL+R+L 
Sbjct  372   WGLALAFGPGITFEGILVRSLS  393



>gb|EPS63204.1| hypothetical protein M569_11580, partial [Genlisea aurea]
Length=373

 Score =   523 bits (1346),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 281/380 (74%), Positives = 325/380 (86%), Gaps = 12/380 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA+GKAFPSQ+VPQDCLVEG+IRDT C D  IK+KL+RLCKTTTV+TRYTVM K+
Sbjct  6     GKATVLAMGKAFPSQVVPQDCLVEGFIRDTNCHDSIIKDKLQRLCKTTTVRTRYTVMSKE  65

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD++PELA EGSPTI QRL++AN AV+ MAKEASL+C+++WGRP  +ITHVVYV+SSEI
Sbjct  66    ILDEFPELAMEGSPTIKQRLQIANTAVVQMAKEASLSCLREWGRPASDITHVVYVTSSEI  125

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LAAELGL   VNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVL+ TSETTI
Sbjct  126   RLPGGDLHLAAELGLNPHVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLVATSETTI  185

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPPN++RPYDLVGAALFGDGAAA +VGA+P E  E+PF+EL+ A Q+FLPGT  VID
Sbjct  186   LGFRPPNRSRPYDLVGAALFGDGAAAAVVGADPVEGRESPFLELNAAMQKFLPGTSDVID  245

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGI FKLGRDLP++IE+NIE FC++L+  A  +     YN+LFWAVHPGGPAILN
Sbjct  246   GRLSEEGIYFKLGRDLPQRIEDNIECFCRELMSAAGLS----EYNDLFWAVHPGGPAILN  301

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
              LER L L   KLDCSRRALMDFGNVSSNTIFYV+EYMR E+  K +  +        EW
Sbjct  302   GLERRLKLDKAKLDCSRRALMDFGNVSSNTIFYVMEYMRKEMKEKGEAAE--------EW  353

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGILLRN+
Sbjct  354   GLGLAFGPGITFEGILLRNV  373



>ref|XP_010661353.1| PREDICTED: chalcone synthase isoform X1 [Vitis vinifera]
Length=409

 Score =   521 bits (1342),  Expect = 1e-178, Method: Compositional matrix adjust.
 Identities = 265/335 (79%), Positives = 295/335 (88%), Gaps = 14/335 (4%)
 Frame = +2

Query  335   KTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRP  514
             KTTTVKTRYTVM K++L+KYPELATEGSPTI Q+LE+ANPAV+ MA EASLACI++WGRP
Sbjct  89    KTTTVKTRYTVMSKEILEKYPELATEGSPTIKQKLEIANPAVLQMAMEASLACIEEWGRP  148

Query  515   VEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAEN  694
             V +ITH+VYVSSSEIRLPGGDLYLA++LGL+SDV R+MLYFLGCYGGVTGLRVAKDIAEN
Sbjct  149   VGDITHIVYVSSSEIRLPGGDLYLASQLGLRSDVGRIMLYFLGCYGGVTGLRVAKDIAEN  208

Query  695   NPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELS  874
             NPGSRVLLTTSETTILGFRPPNK RPYDLVGAALFGDGAAAVIVG +P    E PFMEL+
Sbjct  209   NPGSRVLLTTSETTILGFRPPNKERPYDLVGAALFGDGAAAVIVGTDPIPGKECPFMELN  268

Query  875   FAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYN  1054
              A QQFLPGT +VIDGR+SEEGINFKLGRDLP KIE NIE+FCKKL+ KA      + +N
Sbjct  269   HAVQQFLPGTHNVIDGRLSEEGINFKLGRDLPAKIEENIEEFCKKLMEKA----GLVEFN  324

Query  1055  ELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMK  1234
             +LFWAVHPGGPAILNRLE TL LRSEKL+CSRRALMD+GNVSSNTIFYV+EYMR+ L  K
Sbjct  325   DLFWAVHPGGPAILNRLESTLKLRSEKLECSRRALMDYGNVSSNTIFYVMEYMREAL--K  382

Query  1235  RKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             RK G+        EWGLALAFGPGITFEGIL+R+L
Sbjct  383   RKGGE--------EWGLALAFGPGITFEGILIRSL  409



>ref|XP_010934708.1| PREDICTED: chalcone synthase-like [Elaeis guineensis]
Length=331

 Score =   507 bits (1306),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 252/345 (73%), Positives = 291/345 (84%), Gaps = 14/345 (4%)
 Frame = +2

Query  308   IKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASL  487
             +KEKLERLCK TTVK R+TVM K++LDKYPELATEGSPTI Q+L++AN AV+ MA EAS 
Sbjct  1     MKEKLERLCKNTTVKRRFTVMSKEILDKYPELATEGSPTIKQKLDIANAAVVEMAVEASR  60

Query  488   ACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGL  667
             AC+ +W RP  +ITH++YVSSSEIRLPGGDLYLA  LGL+S+V RVMLYFLGCYGGVTGL
Sbjct  61    ACMAEWKRPAGDITHIIYVSSSEIRLPGGDLYLANHLGLRSNVGRVMLYFLGCYGGVTGL  120

Query  668   RVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRES  847
             RVAKDIAENNPGSR+LL TSETTILGFRPPN ARPYDLVGAALFGDGAAAV++GA+P + 
Sbjct  121   RVAKDIAENNPGSRILLATSETTILGFRPPNMARPYDLVGAALFGDGAAAVVIGADPIDG  180

Query  848   LENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAn  1027
             +E PFMEL +A QQFLPGT ++IDGRISEEGINFKLGRDLP+ IE +IE FC+ L+ KA 
Sbjct  181   VETPFMELDYAVQQFLPGTHNIIDGRISEEGINFKLGRDLPQMIEGHIEGFCRMLMAKAG  240

Query  1028  nnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLE  1207
                    +NELFWAVHPGGPAILNRLE +L LR EKL CSRRALMD+GN SSNT+FYV++
Sbjct  241   LQ----DFNELFWAVHPGGPAILNRLESSLRLRPEKLQCSRRALMDYGNASSNTVFYVMD  296

Query  1208  YMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNLQ  1342
             YMR+EL   R++G         EWGL LAFGPGITFEGIL+R+LQ
Sbjct  297   YMREEL---RREGG-------DEWGLVLAFGPGITFEGILVRSLQ  331



>emb|CDO96957.1| unnamed protein product [Coffea canephora]
Length=391

 Score =   498 bits (1281),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 301/380 (79%), Gaps = 6/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY R+T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  16    GKATILALGKAFPPQLVMQEFLVDGYFRNTNCDDPDLKQKLTRLCKTTTVKTRYVVMSEE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L++YPEL  EG PT+ QRL++ NPAV  MA EA+ +CIK+WGRP+ +ITH+VYVSSSE+
Sbjct  76    ILNQYPELVVEGLPTVKQRLDICNPAVTEMAIEAAQSCIKNWGRPISDITHLVYVSSSEV  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL+ +  RVML F GC GGV G+RVAKDIAENNPGSRVLL TSETTI
Sbjct  136   RLPGGDLYLAKGLGLRPETQRVMLNFSGCSGGVAGIRVAKDIAENNPGSRVLLATSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A+IVG++P  S+E P  EL  + Q FLP T+ +ID
Sbjct  196   IGFRPPSAERPYDLVGVALFGDGAGAMIVGSSPEPSIERPLFELHTSMQHFLPDTEKIID  255

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKLGR+LP+ IE+NIE FC +L+  A  +     YN++FWAVHPGGPAILN
Sbjct  256   GRLTEEGISFKLGRELPQIIEDNIEGFCARLMDVAGYSEK--DYNKMFWAVHPGGPAILN  313

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRAL DFGN SSNTI YVLEYM +E  + RK+ +    +G  EW
Sbjct  314   RMEKKLDLLPEKLNASRRALADFGNASSNTIVYVLEYMLEENKIARKEDQ----KGNEEW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL R L
Sbjct  370   GLILAFGPGITFEGILTRTL  389



>gb|AAZ23686.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23687.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   498 bits (1281),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|AAZ23702.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23708.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   497 bits (1280),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 296/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+ +ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKMID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|ABK28665.1| unknown [Arabidopsis thaliana]
Length=393

 Score =   497 bits (1280),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|AAZ23704.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHSAIQNFLPETEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>ref|NP_567971.1| protein LESS ADHESIVE POLLEN 5 [Arabidopsis thaliana]
 gb|AAM63130.1| chalcone synthase-like protein [Arabidopsis thaliana]
 gb|AAZ23694.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23695.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23696.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23697.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23698.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23700.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23701.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23703.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23706.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23707.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23710.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23711.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23712.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23713.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23714.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23715.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23716.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23718.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23719.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23720.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23722.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23723.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23724.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23725.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|ABE66111.1| chalcone and stilbene synthase family protein [Arabidopsis thaliana]
 gb|AEE86428.1| Chalcone and stilbene synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|AAZ23717.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   497 bits (1279),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMWEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>ref|XP_011092869.1| PREDICTED: chalcone synthase [Sesamum indicum]
Length=390

 Score =   496 bits (1278),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 257/381 (67%), Positives = 293/381 (77%), Gaps = 11/381 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KA ILALGKAFP QLV Q+ LV+GY RDT CDD  +K+KL RLCK+TTVKTRY VM +++
Sbjct  17    KAAILALGKAFPHQLVMQEFLVDGYFRDTNCDDPELKQKLARLCKSTTVKTRYVVMSEEI  76

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             L KYPELA EG PT+ QRLE+ N AV  MA EAS +CIK WGRPV +ITH+VYVSSSE R
Sbjct  77    LTKYPELAIEGLPTVKQRLEICNSAVTQMAIEASESCIKKWGRPVSDITHLVYVSSSEAR  136

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYLA  LGL+ D  R MLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI+
Sbjct  137   LPGGDLYLAKGLGLRPDTRRTMLYFSGCSGGVAGLRVAKDIAENNPGSRVLLATSETTII  196

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPP+  RPYDLVG ALFGDGA A+I+G+NP    E P  EL  A Q FLPGT+ VIDG
Sbjct  197   GFRPPSADRPYDLVGVALFGDGAGAMIIGSNPVVKTERPLFELYAALQHFLPGTEKVIDG  256

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             +++EEGI+FKL R LP+ IENNI+DFC +L+G A  +     +N+LFWAVHPGGPAILNR
Sbjct  257   KLTEEGISFKLERQLPQIIENNIQDFCVQLMGSAGYSEK--DFNKLFWAVHPGGPAILNR  314

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRK--QGKeeeeeggle  1276
             LE+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E    RK  QG         E
Sbjct  315   LEKKLELLPEKLNASRRALTDYGNASSNTIVYVLEYMLEEAKNVRKDEQGH-------NE  367

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEGIL +NL
Sbjct  368   WGLILAFGPGITFEGILTKNL  388



>ref|XP_002869122.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45381.1| chalcone synthase family protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   496 bits (1278),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+IVG++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIVGSDPDPICEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EEDEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|AAB80804.1| chalcone synthase homolog PrChS1 [Pinus radiata]
Length=390

 Score =   496 bits (1277),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 256/381 (67%), Positives = 302/381 (79%), Gaps = 14/381 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GK T +A G+AFP QLV Q+ LV+GY R+T C D  +++KLERLCKTTTVKTRY VM  +
Sbjct  22    GKTTAMAFGRAFPDQLVMQEFLVDGYFRNTNCQDPVLRQKLERLCKTTTVKTRYVVMSDE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L ++PELA EGS T+ QRLE++N AV  MA +A   C+K+WGRPV EITH+VYVSSSEI
Sbjct  82    ILAQHPELAVEGSATVRQRLEISNVAVTDMAVDACRDCLKEWGRPVSEITHLVYVSSSEI  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ LGL+SDV+RVMLYFLGCYGGVTGLRVAKD+AENNPGSRVLL TSETTI
Sbjct  142   RLPGGDLYLASRLGLRSDVSRVMLYFLGCYGGVTGLRVAKDLAENNPGSRVLLATSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPR-ESLENPFMELSFAAQQFLPGTQSVI  916
             LGFRPPN  RPYDLVGAALFGDGAAA+++G +PR E+ E  F+EL +A QQFLP T   I
Sbjct  202   LGFRPPNPERPYDLVGAALFGDGAAAMVLGTDPRPEAGEQGFLELDWAVQQFLPDTHGTI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             +GR++EEGINFKLGR+LP+ IE++IE FC+KL+ KA  +     YNELFW VHPGGPAIL
Sbjct  262   NGRLTEEGINFKLGRELPQIIEDHIEGFCRKLMDKAGVD----DYNELFWGVHPGGPAIL  317

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE+ L L  EKL  SR+AL D+GN SSNTI YVL+ MR +L    KQ          E
Sbjct  318   NRLEKKLSLGPEKLYYSRQALADYGNASSNTIVYVLDAMR-QLKGGEKQSP--------E  368

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WGL LAFGPGITFEGIL R+L
Sbjct  369   WGLILAFGPGITFEGILARSL  389



>gb|AAZ23682.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   496 bits (1277),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D++RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDIHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>ref|XP_010088676.1| Chalcone synthase 9 [Morus notabilis]
 gb|EXB36843.1| Chalcone synthase 9 [Morus notabilis]
Length=393

 Score =   496 bits (1277),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 297/380 (78%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY RDT CDD  +K KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFRDTNCDDPELKRKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGRPV +ITH+VYVSSSEI
Sbjct  78    ILKKYPELALEGRSTVKQRLDICNDAVTQMAIEASQACIKNWGRPVSDITHLVYVSSSEI  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA+ LGL  +  RVMLYF+GC GGV GLRVAKDIAENNPGSR+LL TSETTI
Sbjct  138   RLPGGDLYLASGLGLSPETQRVMLYFVGCSGGVAGLRVAKDIAENNPGSRILLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G++PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q+FLPGT   ID
Sbjct  198   IGYKPPSADRPYDLVGVALFGDGAGAMIIGSDPVSETEKPLFELHSAMQRFLPGTDKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+++E FC+KL+G    +     YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLARELPQVIEDSVEGFCEKLMGVKGFDKEW--YNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SR+ALMD+GN SSNTI YVLEYM +E        K + ++   EW
Sbjct  316   RIEKRLDLDPEKLNASRKALMDYGNASSNTIVYVLEYMLEE------SSKMKVDQEENEW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  370   GLILAFGPGITFEGILARNL  389



>ref|XP_010437562.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=392

 Score =   496 bits (1276),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRSMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|AAZ23683.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   496 bits (1276),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+ER L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMERRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>gb|AAZ23705.1| chalcone synthase family protein [Arabidopsis thaliana]
 gb|AAZ23709.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   495 bits (1275),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>gb|AAZ23721.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   495 bits (1275),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/379 (66%), Positives = 294/379 (78%), Gaps = 7/379 (2%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM +++
Sbjct  19    KATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEEI  78

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE R
Sbjct  79    LKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEAR  138

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI+
Sbjct  139   LPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTII  198

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  IDG
Sbjct  199   GFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTIDG  258

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILNR
Sbjct  259   RLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILNR  316

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             +E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EWG
Sbjct  317   IEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEWG  371

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPG+TFEGI+ RNL
Sbjct  372   LILAFGPGVTFEGIIARNL  390



>ref|XP_007041944.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
 gb|EOX97775.1| Chalcone and stilbene synthase family protein [Theobroma cacao]
Length=391

 Score =   495 bits (1274),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 296/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV QD LV+GY ++T CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  16    GKATILALGKAFPHQLVMQDFLVDGYFKNTNCDDPELKQKLSRLCKTTTVKTRYVVMSDE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA EAS ACIK WGRP+ +ITH+VYVSSSE 
Sbjct  76    ILKKYPELAIEGLPTVKQRLDICNNAVTEMAIEASRACIKKWGRPMSDITHLVYVSSSEA  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  +  RVMLYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  136   RLPGGDLFLAKGLGLSPETQRVMLYFMGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P  S+E P  EL  A Q FLP T+  ID
Sbjct  196   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPVLSIERPLFELHTAIQNFLPNTEKTID  255

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+++EEGI+FKL R+LP+ IE+N+E FC+KL+G     +    YN +FWAVHPGGPAILN
Sbjct  256   GKLTEEGISFKLARELPQIIEDNVEGFCEKLMGIVGLTDK--DYNNMFWAVHPGGPAILN  313

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E + ++ + +        EW
Sbjct  314   RMEKRLDLFPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKRKTESR-----EDSEW  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGIL RNL
Sbjct  369   GLILAFGPGVTFEGILARNL  388



>gb|AAZ23684.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23689.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23690.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
 gb|AAZ23691.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   494 bits (1273),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>ref|XP_006285956.1| hypothetical protein CARUB_v10007475mg [Capsella rubella]
 gb|EOA18854.1| hypothetical protein CARUB_v10007475mg [Capsella rubella]
Length=396

 Score =   495 bits (1274),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 293/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  22    GKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  82    ILKKYPELAIEGGSTVEQRLDICNDAVTEMAVEASRACIKNWGRSISDITHLVYVSSSEA  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  142   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  202   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFELHTAIQNFLPDTEKTID  261

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA        YN++FWAVHPGGPAILN
Sbjct  262   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAYK--DYNQMFWAVHPGGPAILN  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   K        EW
Sbjct  320   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIIYVLEYMLEESKKVRSMNK-----EENEW  374

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  375   GLILAFGPGVTFEGIIARNL  394



>ref|XP_006423581.1| hypothetical protein CICLE_v10028633mg [Citrus clementina]
 gb|ESR36821.1| hypothetical protein CICLE_v10028633mg [Citrus clementina]
 gb|KDO44184.1| hypothetical protein CISIN_1g016569mg [Citrus sinensis]
Length=387

 Score =   494 bits (1273),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 254/380 (67%), Positives = 295/380 (78%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY ++T CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  14    GKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYVVMSDE  73

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA EAS ACIK WGRP+ +ITHVVYVSSSE 
Sbjct  74    ILKKYPELAIEGLPTVKQRLDICNKAVTQMAIEASQACIKSWGRPITDITHVVYVSSSEA  133

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF+GC GGV+GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  134   RLPGGDLYLARGLGLSPETQRVMLYFMGCSGGVSGLRVAKDIAENNPGSRVLLATSETTI  193

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+IVG++P  S E P  EL  A Q FLP T+  ID
Sbjct  194   IGFKPPSAERPYDLVGVALFGDGAGAMIVGSDPVPS-ERPLFELHTAIQNFLPNTEKTID  252

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIE FC KL+G     NN   YN++FWAVHPGGPAILN
Sbjct  253   GRLTEEGISFKLARELPQIIEDNIEGFCGKLMGNIGFTNN--DYNKMFWAVHPGGPAILN  310

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E +  + Q          +W
Sbjct  311   KLEKRLNLLPDKLNASRRALMDYGNASSNTIVYVLEYMLEESLKMKSQDH-----EDTDW  365

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  366   GLILAFGPGITFEGILARNL  385



>gb|AAZ23699.1| chalcone synthase family protein [Arabidopsis thaliana]
Length=392

 Score =   494 bits (1273),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RIEKRLNLSPEKLSPSRRALMDCGNASSNSIVYVLEYMLEESKKVRNMNE-----EEDEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>ref|XP_010268693.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
 ref|XP_010268695.1| PREDICTED: chalcone synthase [Nelumbo nucifera]
Length=398

 Score =   494 bits (1273),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/382 (66%), Positives = 297/382 (78%), Gaps = 7/382 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GK  +LALGKAFP+QLV Q+ LV+GY R+T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  20    GKTKLLALGKAFPNQLVIQEYLVDGYFRNTNCDDPDLKQKLARLCKTTTVKTRYVVMSEE  79

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL+++N AV  MA EAS ACIK+WGRP  +ITH+VYVSSSE 
Sbjct  80    ILAKYPELAVEGLPTVKQRLDISNKAVTQMAIEASQACIKNWGRPSSDITHLVYVSSSEA  139

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +V RVMLYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  140   RLPGGDLYLARGLGLSPEVRRVMLYFMGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  199

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G +P   +E P  EL  A Q FLP T+  ID
Sbjct  200   IGFKPPSANRPYDLVGVALFGDGAGAMILGRDPIPGIERPLFELHTAIQNFLPDTEKTID  259

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGK--AnnnnnnLTYNELFWAVHPGGPAI  1093
             GR++EEGINFKL RDLP  IEN+++ FC KLI    + ++ ++  YN +FWAVHPGGPAI
Sbjct  260   GRLTEEGINFKLERDLPNIIENHVQGFCDKLIQAVGSGSSYDDNDYNNMFWAVHPGGPAI  319

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             LNRLE+ L L  EKL  SRRALM+FGN SSNTI YVLEYM +E +  +K+GK        
Sbjct  320   LNRLEKRLNLLPEKLSASRRALMNFGNASSNTIVYVLEYMVEESLKMKKEGK-----QDS  374

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             EWGL LAFGPGITFEGIL RNL
Sbjct  375   EWGLILAFGPGITFEGILARNL  396



>ref|XP_002529257.1| Chalcone synthase, putative [Ricinus communis]
 gb|EEF33135.1| Chalcone synthase, putative [Ricinus communis]
Length=387

 Score =   494 bits (1272),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 297/380 (78%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY ++T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  14    GKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  73

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG PT+ QRL++ N AV  MA EAS  CIK+WGRP+ +ITH+VYVSSSE 
Sbjct  74    ILEKYPELAVEGLPTLKQRLDICNEAVTKMAIEASQKCIKNWGRPISDITHLVYVSSSEA  133

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  +  RV LYF+GC GGV+GLR+AKDIAENNPGSRVLL TSETTI
Sbjct  134   RLPGGDLHLARGLGLSPETQRVTLYFMGCSGGVSGLRIAKDIAENNPGSRVLLATSETTI  193

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G +P    E+P  EL  A Q FLP T+ +ID
Sbjct  194   IGFKPPSADRPYDLVGVALFGDGAGAMIIGTDPVSKTESPLFELHTAIQNFLPDTEKIID  253

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP  IE+NIE FC+KL+G A   +    YN+LFWAVHPGGPAILN
Sbjct  254   GRLTEEGISFKLARELPHIIEDNIEGFCQKLMGVAGLTDK--DYNKLFWAVHPGGPAILN  311

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E +  +++          EW
Sbjct  312   RMEKRLDLFPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKMKEEN------VNNEW  365

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  366   GLILAFGPGITFEGILARNL  385



>ref|XP_010432375.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=392

 Score =   494 bits (1272),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMILGSDPDPICEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRSLNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>ref|XP_006487398.1| PREDICTED: chalcone synthase 6-like [Citrus sinensis]
Length=387

 Score =   494 bits (1271),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 295/380 (78%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LALGKAFP QLV Q+ LV+GY ++T CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  14    GKATVLALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYVVMSDE  73

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA EAS ACIK WGRP+ +ITHVVYVSSSE 
Sbjct  74    ILKKYPELAMEGLPTVKQRLDICNKAVTQMAIEASQACIKSWGRPITDITHVVYVSSSEA  133

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF+GC GGV+GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  134   RLPGGDLYLARGLGLSPETQRVMLYFMGCSGGVSGLRVAKDIAENNPGSRVLLATSETTI  193

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+IVG++P  S E P  EL  A Q FLP T+  ID
Sbjct  194   IGFKPPSAERPYDLVGVALFGDGAGAMIVGSDPVPS-ERPLFELHTAIQNFLPNTEKTID  252

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIE FC KL+G     NN   YN++FWAVHPGGPAILN
Sbjct  253   GRLTEEGISFKLARELPQIIEDNIEGFCGKLMGNIGFTNN--DYNKMFWAVHPGGPAILN  310

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             +LE+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E +  + Q          +W
Sbjct  311   KLEKRLNLLPDKLNASRRALMDYGNASSNTIVYVLEYMLEESLKMKSQDH-----EDTDW  365

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  366   GLILAFGPGITFEGILARNL  385



>gb|AAZ23685.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   494 bits (1271),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDKHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>ref|XP_008775196.1| PREDICTED: chalcone synthase-like [Phoenix dactylifera]
Length=331

 Score =   491 bits (1264),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 249/345 (72%), Positives = 288/345 (83%), Gaps = 14/345 (4%)
 Frame = +2

Query  308   IKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASL  487
             +KEKLERLCK TTVK R+TVM K++L+KYPELATEGSPTI QRL++AN AV+ MA EAS 
Sbjct  1     MKEKLERLCKNTTVKRRFTVMSKEILEKYPELATEGSPTIKQRLDIANAAVLEMAVEASR  60

Query  488   ACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGL  667
             AC+ +W R   +ITH+VYVSSSEIRLPGGDLYLA +LGL+S+V RVMLYFLGCYGGV GL
Sbjct  61    ACMAEWKRAAGDITHIVYVSSSEIRLPGGDLYLADQLGLRSNVGRVMLYFLGCYGGVAGL  120

Query  668   RVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRES  847
             RVAKDIAENNPGSRVLLTTSETTILGFRPPN ARPYDLVGAALFGDGAAAV++GA+P E 
Sbjct  121   RVAKDIAENNPGSRVLLTTSETTILGFRPPNMARPYDLVGAALFGDGAAAVVIGADPVEG  180

Query  848   LENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAn  1027
              E PFMEL +A QQFLPGT ++IDGRISEEGI+FKLGRDLP+ IE +IE FC+ L+  A 
Sbjct  181   TETPFMELDYAVQQFLPGTHNIIDGRISEEGISFKLGRDLPQMIEGHIEGFCRMLMANAG  240

Query  1028  nnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLE  1207
                    +NELFWAVHPGGPAILNRLE +LGLR EKL CSRRALMD+GN SSNT+FYV++
Sbjct  241   LQ----DFNELFWAVHPGGPAILNRLESSLGLRPEKLQCSRRALMDYGNASSNTVFYVMD  296

Query  1208  YMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNLQ  1342
             Y+R+EL  +  +          EWGL LAFGPGITFEGIL+R+L+
Sbjct  297   YVREELRREGGE----------EWGLVLAFGPGITFEGILVRSLK  331



>ref|XP_006396201.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
 gb|ESQ37654.1| hypothetical protein EUTSA_v10028565mg [Eutrema salsugineum]
Length=359

 Score =   492 bits (1267),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 245/337 (73%), Positives = 289/337 (86%), Gaps = 9/337 (3%)
 Frame = +2

Query  329   LCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWG  508
             L KTTTVKTRYTVM ++ L KYPELATEGSPTI QRLE+AN AV+ MA EASLACIK+WG
Sbjct  32    LGKTTTVKTRYTVMSRETLHKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWG  91

Query  509   RPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIA  688
             RPVE+ITH++YVSSSE RLPGGDLYL+A+LGL+ +V RVMLYFLGCYGGVTGLR+AKDIA
Sbjct  92    RPVEDITHLIYVSSSEFRLPGGDLYLSAQLGLRHEVQRVMLYFLGCYGGVTGLRLAKDIA  151

Query  689   ENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFME  868
             ENN GSRVLLTTSET +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF+E
Sbjct  152   ENNRGSRVLLTTSETMVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFIE  210

Query  869   LSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLT  1048
             L  A Q+FLPGTQ VIDGR+SEEGI+FKL RDLP++IE+N+EDFCKKL+ +A + + +L 
Sbjct  211   LHCAMQKFLPGTQGVIDGRLSEEGISFKLARDLPQRIEDNVEDFCKKLVAEAGSGSGSLE  270

Query  1049  YNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELM  1228
              N+LFWAVHPGGPAILN LE  L L+  KL+CSR+ALMD+GN SSNTIFY+++ +RDEL 
Sbjct  271   LNDLFWAVHPGGPAILNGLETKLKLKPGKLECSRQALMDYGNASSNTIFYIMDKVRDELG  330

Query  1229  MKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
              K + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  331   KKGRGGE--------EWGLGLAFGPGITFEGFLMRSL  359



>ref|XP_009799363.1| PREDICTED: chalcone synthase [Nicotiana sylvestris]
Length=390

 Score =   493 bits (1270),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 296/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFP QLV Q+ LV+GY ++T CDD  +K++L RLCKTTTVKTRY VM ++
Sbjct  16    GNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVKTRYVVMSEE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPEL  EG PT+ QRL++ N AV  MA EAS +CI  WGRP+ +ITHVVYVSSSE 
Sbjct  76    ILKKYPELTVEGLPTVKQRLDICNAAVTEMAIEASQSCINKWGRPISDITHVVYVSSSEA  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  136   RLPGGDLYLAKGLGLSPETKRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G+NP + +E P  EL  A Q FLP T+ +ID
Sbjct  196   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPVQDIERPLFELHTAIQHFLPDTEKIID  255

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIEDFC KLI  +    NN  YN+LFWAVHPGGPAILN
Sbjct  256   GRLTEEGISFKLERELPQIIEDNIEDFCDKLI--SITRYNNREYNKLFWAVHPGGPAILN  313

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  +KL  SRRAL D+GN SSNTI YVLEYM +E      +GK++E +   +W
Sbjct  314   RLEKRLELSPDKLSASRRALADYGNASSNTIVYVLEYMLEE-----NKGKKKENQEHSDW  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL +NL
Sbjct  369   GLILAFGPGITFEGILTKNL  388



>gb|AAZ23693.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   493 bits (1270),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCK+LIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKRLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>gb|AAZ23692.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   493 bits (1268),  Expect = 9e-168, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 293/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTT VKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTMVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>ref|XP_007199914.1| hypothetical protein PRUPE_ppa006852mg [Prunus persica]
 gb|EMJ01113.1| hypothetical protein PRUPE_ppa006852mg [Prunus persica]
Length=393

 Score =   492 bits (1267),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 254/380 (67%), Positives = 302/380 (79%), Gaps = 6/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G+ATILALGKAFP QLV QD LV+GY RDT CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  18    GRATILALGKAFPHQLVMQDFLVDGYFRDTNCDDPELKQKLARLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPEL TEG+PTI QRL + N AV  MA EAS ACIK+WGRP+ +ITH+VYVSSSE 
Sbjct  78    ILEKYPELTTEGTPTIKQRLHICNEAVTQMAIEASGACIKNWGRPISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGD+YLA  LGL+ +  RV+LYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDIYLAKGLGLRPETQRVLLYFSGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G++PP+  RPYDLVG ALFGDGA A+++G++P    E P  EL  A Q+FLP T+  ID
Sbjct  198   IGYKPPSAHRPYDLVGVALFGDGAGAMLIGSDPDLISEKPLFELHTAIQEFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKLGR+LP+ IE++IE FC +L+G      +N  YN++FWAVHPGGPAILN
Sbjct  258   GRVTEEGISFKLGRELPQIIEDHIEGFCGRLMG--VLGYDNKEYNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E     K+ K+E++EG  EW
Sbjct  316   RLEKRLDLFPEKLNASRRALTDYGNASSNTIVYVLEYMIEE----SKKIKKEQQEGDGEW  371

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  372   GLILAFGPGITFEGILARNL  391



>ref|XP_010447028.1| PREDICTED: chalcone synthase [Camelina sativa]
Length=392

 Score =   492 bits (1266),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 293/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS  CIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRTCIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA AVI+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSMDRPYDLVGVALFGDGAGAVIIGSDPDPICEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLI KA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIVKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRSLNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIIARNL  390



>ref|XP_006379273.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
 gb|ERP57070.1| chalcone and stilbene synthase family protein [Populus trichocarpa]
Length=391

 Score =   491 bits (1265),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 292/380 (77%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY ++T CDDL +K+KL RLCKTTTVKTRY VM  +
Sbjct  18    GKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDLELKQKLTRLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA +AS ACIK WGRPV +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGLPTVKQRLDICNDAVTRMAIDASRACIKKWGRPVSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAGGLGLSPETQRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+IVG +P    E+P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIVGTDPIPVTESPLFELHTAIQNFLPNTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIE FC KLIG A   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLSRELPQIIEDNIEGFCHKLIGNAGLTDK--DYNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+   L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K K+G         +W
Sbjct  316   RMEKRFDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEEC-RKMKEGS-----ENCDW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL R L
Sbjct  370   GLILAFGPGITFEGILARKL  389



>ref|XP_010690460.1| PREDICTED: chalcone synthase [Beta vulgaris subsp. vulgaris]
Length=395

 Score =   492 bits (1266),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGK FP QLV Q+ LV+GY R+T CDD  +KEKL RLCKTTTVKTRY VM ++
Sbjct  21    GKATILALGKGFPHQLVMQEFLVDGYFRNTNCDDPELKEKLMRLCKTTTVKTRYVVMSEE  80

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG PT+ QRL++ N AV  MA EAS ACI +WGRP+ +ITH+VYVSSSE 
Sbjct  81    ILNKYPELAIEGQPTVTQRLDICNEAVTQMAIEASKACISNWGRPISDITHLVYVSSSEA  140

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGD+YLA  LGLK + NRVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  141   RLPGGDIYLAKGLGLKPETNRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  200

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+++G++P  S+E P  EL  A Q FLP T+ +ID
Sbjct  201   IGFKPPSANRPYDLVGVALFGDGAGAMLIGSDPDLSIERPLFELHTAIQHFLPDTEKIID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R LP+ IE+NIE FC KL+     +N    YN++FWAVHPGGPAILN
Sbjct  261   GRLTEEGISFKLDRALPQIIEDNIESFCGKLMENIGLSNK--DYNKIFWAVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  +KL  SRRAL D+GN SSNTI YV+EYM +E     K+ K        +W
Sbjct  319   RLEKRLDLSPDKLIASRRALADYGNASSNTIVYVMEYMMEEGAKMNKEHK-----NDDQW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGIL +NL
Sbjct  374   GLILAFGPGVTFEGILAKNL  393



>gb|AAZ23688.1| chalcone synthase family protein [Arabidopsis halleri subsp. 
gemmifera]
Length=392

 Score =   491 bits (1265),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 292/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T  QRL++ N AV  MA EAS ACIK+WGR + EITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTATQRLDICNDAVTEMAVEASRACIKNWGRSISEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPVCEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFKLARELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRR LMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRVLMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+  NL
Sbjct  371   GLILAFGPGVTFEGIIAINL  390



>emb|CDX69091.1| BnaC01g03620D [Brassica napus]
Length=392

 Score =   490 bits (1262),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 291/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK WGR + +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKKWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINF L R+LP+ IE+N+E FCKKLIGKA        YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGINFTLSRELPKLIEDNVESFCKKLIGKAGLTPK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    RK  +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARKMKE-----VENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>ref|XP_009350954.1| PREDICTED: chalcone synthase [Pyrus x bretschneideri]
 ref|XP_011037255.1| PREDICTED: chalcone synthase [Populus euphratica]
Length=391

 Score =   490 bits (1261),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 254/380 (67%), Positives = 292/380 (77%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY R+T CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  18    GKATILALGKAFPHQLVMQEFLVDGYFRNTNCDDPELKQKLTRLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG PTI QRL++ N AV  MA  AS ACIK WGR V +ITH+VYVSSSE 
Sbjct  78    ILNKYPELAIEGIPTIKQRLDICNDAVTRMAIGASRACIKKWGRSVSDITHMVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAGGLGLSPETQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGAAA+++G +P    E+P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAAAMVIGTDPVPVTESPLFELHTAIQNFLPNTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE NIE FC+KLIG A   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLARELPQIIEENIEGFCRKLIGVAGLTDK--DYNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K K G         +W
Sbjct  316   RMEKRLDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEE-SRKMKAG-----IANCDW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  370   GLILAFGPGITFEGILARNL  389



>ref|XP_007131762.1| hypothetical protein PHAVU_011G039700g [Phaseolus vulgaris]
 gb|ESW03756.1| hypothetical protein PHAVU_011G039700g [Phaseolus vulgaris]
Length=392

 Score =   490 bits (1261),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY R T CD+  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPPQLVMQEYLVDGYFRSTNCDNPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPEL TEG+PT+ QRLE+ N AV  MA EA+L CIK+WG  + +ITH+VYVSSSE 
Sbjct  78    ILIKYPELVTEGTPTVKQRLEICNEAVTEMAIEAALGCIKNWGGSLSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D  R+MLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTQRIMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q+FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPILEYEKPLFELHTAVQEFLPHTEKKID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+N+E FC+KL+  +     N  YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLARELPQIIEDNVEGFCEKLM--SVVGFQNKEYNKVFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  RK G+     G  EW
Sbjct  316   RIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEALKTRKDGR-----GDSEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  371   GLILAFGPGITFEGILARNL  390



>ref|XP_004505681.1| PREDICTED: chalcone synthase-like [Cicer arietinum]
Length=391

 Score =   489 bits (1260),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATIL+LGKAFP QLV Q+ LV+GY RDT CD+  +K+KL RLCKTTTVKTRY VM ++
Sbjct  17    GKATILSLGKAFPHQLVMQEYLVDGYFRDTNCDNPELKQKLARLCKTTTVKTRYVVMSEE  76

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG+ T+ QRLE+ N AV  MA EAS  CIK+WGR + +ITHVVYVSSSE 
Sbjct  77    ILKKYPELAVEGAATVKQRLEICNKAVTQMAIEASQVCIKNWGRSLSDITHVVYVSSSEA  136

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+  LGL   + R MLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  137   RLPGGDLYLSKGLGLNPIIQRTMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  196

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  AAQ+FLP T+  ID
Sbjct  197   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPVSETETPLFELHTAAQEFLPDTEKKID  256

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+N+E FC KLI      N    YN+LFWAVHPGGPAILN
Sbjct  257   GRLTEEGISFKLARELPQIIEDNVEGFCDKLIDVVGLQNK--DYNKLFWAVHPGGPAILN  314

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E +  RK+G      G  EW
Sbjct  315   RMEKRLDLLPEKLNASRRALMDYGNASSNTIVYVLEYMIEEGLKIRKEG-----GGDPEW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RN+
Sbjct  370   GLILAFGPGITFEGILARNM  389



>ref|XP_004230925.1| PREDICTED: chalcone synthase [Solanum lycopersicum]
Length=383

 Score =   489 bits (1259),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 287/380 (76%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFP QLV Q+ LV+GY ++T CDD  +K++L RLCKTTTVKTRY VM ++
Sbjct  16    GNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVKTRYVVMSEE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA EAS +CIK WGRP+ +ITHVVYVSSSE 
Sbjct  76    ILKKYPELAVEGLPTVKQRLDICNAAVTEMAIEASQSCIKKWGRPISDITHVVYVSSSEA  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  136   RLPGGDLYLAKGLGLNPETKRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G+NP   +E P  EL  A Q FLP T+ +ID
Sbjct  196   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPIRDIERPLFELHTAIQHFLPDTEKIID  255

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIEDFC KLI  +   +    YN+LFWAVHPGGPAILN
Sbjct  256   GRLTEEGISFKLERELPQIIEDNIEDFCDKLINISGIKDRE--YNKLFWAVHPGGPAILN  313

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  +KL  SRRAL D+GN SSNTI YVLEYM +E       G           
Sbjct  314   RLEKKLDLSPDKLSASRRALADYGNASSNTIVYVLEYMLEEKKDITDWG-----------  362

Query  1280  glalaFGPGITFEGILLRNL  1339
              L LAFGPGITFEGIL +NL
Sbjct  363   -LILAFGPGITFEGILTKNL  381



>ref|XP_008344150.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing 
protein At1g02060, chloroplastic [Malus domestica]
Length=1210

 Score =   515 bits (1327),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 282/416 (68%), Positives = 331/416 (80%), Gaps = 11/416 (3%)
 Frame = +2

Query  95    SYILTMMSNLNGK-DNVSTQNYYrssptsrrrlptQGKATILALGKAFPSQLVPQDCLVE  271
             S +L M+S +  K  N S++ Y+  +  +       GKAT+LALGKAFPSQ +P DCLVE
Sbjct  805   SCVLGMISKVKRKGTNGSSEQYHAPTRYAPT----PGKATVLALGKAFPSQRIPXDCLVE  860

Query  272   GYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVAN  451
             GYI D KC+D+ IKEKLE LCKTTT+KT YTVM K++LDKYPELATEG+ TI QRL +AN
Sbjct  861   GYIXDMKCEDVPIKEKLELLCKTTTLKTGYTVMSKEILDKYPELATEGTATIKQRLXIAN  920

Query  452   PAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVML  631
             P V+ MA EASLACIK+WGRPVE+I H+VYVSS EIRLPGG+L L+++LGL++DV RVML
Sbjct  921   PXVVEMALEASLACIKEWGRPVEDIIHIVYVSSXEIRLPGGBLXLSSKLGLRNDVGRVML  980

Query  632   YFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGA  811
             YFLG YGGVTGLR++KDIAEN PGS VLLTTSETTILG  PPNKA PYDLVGAALFGDGA
Sbjct  981   YFLGFYGGVTGLRISKDIAENYPGSXVLLTTSETTILGXWPPNKACPYDLVGAALFGDGA  1040

Query  812   AAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNI  991
             AAVI+G+NP    E+PFMEL++A QQFL  T +VIDGR+ EEGINFKLGRDLP+KI+ NI
Sbjct  1041  AAVIIGSNPIAGQESPFMELNYAVQQFLXETHNVIDGRLFEEGINFKLGRDLPQKIDZNI  1100

Query  992   EDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFG  1171
             E FCKKL+  AN       +NELFWAVHPGGPAILN+LE TL   S+KL+ SRRAL D+G
Sbjct  1101  EVFCKKLVVAANAELR--DFNELFWAVHPGGPAILNKLESTLKRSSDKLESSRRALXDYG  1158

Query  1172  NVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             NVSSNTIFYV+E MR+EL +K K+          E  LALAFGPGITFEGILLR+L
Sbjct  1159  NVSSNTIFYVMENMREELXLKLKK----XXXREEECXLALAFGPGITFEGILLRSL  1210



>gb|ADF43047.1| chalcone synthase 6 protein [Brassica rapa subsp. rapa]
Length=392

 Score =   489 bits (1258),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVKQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS +CIK+WGR V +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWGRSVSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+K RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPDPVSEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E GINF L R+LP+ IE+N+E FCKKL+GKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    RK  +     G  EW
Sbjct  316   RMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKARKMNE-----GENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>ref|XP_008236187.1| PREDICTED: chalcone synthase [Prunus mume]
Length=393

 Score =   489 bits (1258),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 300/380 (79%), Gaps = 6/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV QD LV+GY RDT CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  18    GKATILALGKAFPHQLVMQDFLVDGYFRDTNCDDPELKQKLARLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPEL TEG+PTI QRL + N AV  MA EAS ACIK+WGRP  +ITH+VYVSSSE 
Sbjct  78    ILEKYPELTTEGTPTIKQRLHICNEAVTQMAIEASRACIKNWGRPTSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGD+YLA  LGL+ +  RV+LYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDVYLAKGLGLRPETQRVLLYFSGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G++PP+  RPYDLVG ALFGDGA A+++G++P    E P  EL  A Q+FLP T+  ID
Sbjct  198   IGYKPPSTHRPYDLVGVALFGDGAGAMLIGSDPDLISEKPLFELHNAIQEFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE++IE FC +L+G    +N    YN++FWAVHPGGPAILN
Sbjct  258   GRVTEEGISFKLARELPQIIEDHIEGFCGRLMGVLGYDNKE--YNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  +KL+ SRRAL D+GN SSNTI YVLEYM +E     K+ K+E++EG  EW
Sbjct  316   RLEKRLDLFPDKLNASRRALTDYGNASSNTIVYVLEYMIEE----SKKIKKEQQEGDGEW  371

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  372   GLILAFGPGITFEGILARNL  391



>emb|CDX75466.1| BnaA01g02360D [Brassica napus]
Length=392

 Score =   488 bits (1257),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 290/380 (76%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK WGR + +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKKWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINF L R+LP+ IE+N+E FCKKLIGKA        YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGINFTLSRELPQIIEDNVESFCKKLIGKAGLTPK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNMKE-----VENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>ref|XP_009108697.1| PREDICTED: chalcone synthase-like [Brassica rapa]
 ref|XP_009108700.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   488 bits (1257),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 296/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATI+A+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATIIAIGKAFPQQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILNKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P   LE P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPILEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+++E+GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GKLTEQGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +     GG EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNMNE-----GGNEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>emb|CDY40656.1| BnaA03g53070D [Brassica napus]
Length=392

 Score =   488 bits (1256),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 294/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS +CIK+WGR V +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWGRSVSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+K RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPDPVSEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E GINF L R+LP+ IE+N+E FCKKL+GKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    RK  +     G  EW
Sbjct  316   RMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKARKMNE-----GENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>ref|XP_006359643.1| PREDICTED: chalcone synthase 2-like [Solanum tuberosum]
Length=380

 Score =   488 bits (1255),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 288/380 (76%), Gaps = 14/380 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFP QLV Q+ LV+GY ++T CDD  +K++L RLCKTTTVKTRY VM ++
Sbjct  13    GNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVKTRYVVMSEE  72

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA EAS +CIK WGRP+ +ITHVVYVSSSE 
Sbjct  73    ILKKYPELAVEGLPTVKQRLDICNAAVTEMAIEASQSCIKKWGRPISDITHVVYVSSSEA  132

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  133   RLPGGDLYLAKGLGLSPETKRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  192

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G+NP   +E P  EL  A Q FLP T+ +ID
Sbjct  193   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPIRDIERPLFELHTAIQHFLPDTEKIID  252

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIE FC KLI  + +  N+  YN+LFWAVHPGGPAILN
Sbjct  253   GRLTEEGISFKLERELPQIIEDNIEGFCDKLI--SISGINDREYNKLFWAVHPGGPAILN  310

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  EKL  SRRAL D+GN SSNTI YVLEYM +E       G           
Sbjct  311   RLEKKLDLSPEKLSASRRALADYGNASSNTIVYVLEYMLEEKKDITDWG-----------  359

Query  1280  glalaFGPGITFEGILLRNL  1339
              L LAFGPGITFEGIL +NL
Sbjct  360   -LILAFGPGITFEGILTKNL  378



>ref|XP_002305482.1| hypothetical protein POPTR_0004s17460g [Populus trichocarpa]
 gb|EEE85993.1| hypothetical protein POPTR_0004s17460g [Populus trichocarpa]
Length=391

 Score =   488 bits (1255),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 252/380 (66%), Positives = 291/380 (77%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY ++T CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  18    GKATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQKLTRLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG PTI QRL++ N AV  MA  AS ACIK WGR V +ITH+VYVSSSE 
Sbjct  78    ILNKYPELAIEGIPTIKQRLDICNDAVTQMAIGASRACIKKWGRSVSDITHMVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAGGLGLSPETQRVMLYFSGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+++G +P    E+P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMVIGTDPVPVTESPLFELHTAIQNFLPNTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+NIE FC KLIG A   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLARELPQIIEDNIEGFCHKLIGVAGLTDK--DYNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K K G         +W
Sbjct  316   RMEKRLDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEE-SRKMKAG-----AANCDW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  370   GLILAFGPGITFEGILARNL  389



>ref|XP_011046865.1| PREDICTED: chalcone synthase-like [Populus euphratica]
 ref|XP_011046870.1| PREDICTED: chalcone synthase-like [Populus euphratica]
Length=391

 Score =   488 bits (1255),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 251/379 (66%), Positives = 291/379 (77%), Gaps = 8/379 (2%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KATILALGKAFP QLV Q+ LV+GY ++T CDDL +K+KL RLCK+TTVKTRY VM  ++
Sbjct  19    KATILALGKAFPPQLVMQEFLVDGYFKNTNCDDLELKQKLTRLCKSTTVKTRYVVMSDEI  78

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             L KYPELA EG PT+ QRL + N AV  MA +AS ACIK WGRPV +ITH+VYVSSSE R
Sbjct  79    LKKYPELAIEGLPTVKQRLSICNDAVTRMAIDASRACIKKWGRPVSDITHLVYVSSSEAR  138

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYLA  LGL  +  RVMLYF GC GGV G+RVAKDIAENNPGSRVLL TSETTI+
Sbjct  139   LPGGDLYLAGGLGLSPETQRVMLYFAGCSGGVAGIRVAKDIAENNPGSRVLLATSETTII  198

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GF+PP+  RPYDLVG ALFGDGA A+IVG +P    E+P  EL  A Q FLP T+  IDG
Sbjct  199   GFKPPSADRPYDLVGVALFGDGAGAMIVGTDPIPVTESPLFELHTAIQNFLPNTEKTIDG  258

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             R++EEGI+FKL R+LP+ IE+NIE FC KLIG A   +    YN++FWAVHPGGPAILNR
Sbjct  259   RLTEEGISFKLSRELPQIIEDNIEGFCHKLIGIAGLTDK--DYNKMFWAVHPGGPAILNR  316

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             +E+   L  +KL+ SRRALMD+GN SSNTI YVLEYM +E   K K+G         +WG
Sbjct  317   MEKRFDLLPDKLNASRRALMDYGNASSNTIVYVLEYMIEEC-RKMKEGS-----ENCDWG  370

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGITFEGIL RNL
Sbjct  371   LILAFGPGITFEGILARNL  389



>ref|XP_009108194.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   488 bits (1255),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 291/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK WGR + +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASKACIKKWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPNPISEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+++EEGINF L R+LP+ IE+N+E FCKKLIGKA        YN++FWAVHPGGPAILN
Sbjct  258   GKLTEEGINFTLSRELPQIIEDNVESFCKKLIGKAGLTPK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +     G  EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNMNE-----GENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>ref|XP_008372871.1| PREDICTED: chalcone synthase [Malus domestica]
Length=392

 Score =   487 bits (1253),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 293/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFP QLV QD LV+GY +DT  DD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GNATILALGKAFPHQLVMQDFLVDGYFKDTNSDDPQLKQKLARLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPEL TEG+PTI QRL + N AV  MA EAS ACI  WGRP  +ITH+VYVSSSE 
Sbjct  78    ILEKYPELTTEGTPTIKQRLHICNEAVTKMAIEASQACITKWGRPTSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL     RVMLYF GC GGV G+RVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPQTKRVMLYFSGCSGGVAGVRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G++PP+  RPYDLVG ALFGDGA A+++G++P    ENP  EL  A Q+FLPGT+  ID
Sbjct  198   IGYKPPSANRPYDLVGVALFGDGAGAMMIGSDPELVSENPLFELHTALQEFLPGTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE++IE FC +L+G    +N    YN++FWAVHPGGPAILN
Sbjct  258   GRVTEEGISFKLERELPQIIEDHIEGFCGRLMGVVGYDNKE--YNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRAL D+GN SSNTI YVLEY+ +E    +K+G+     G   W
Sbjct  316   RMEKRLDLSPEKLNASRRALADYGNASSNTIVYVLEYIIEESKKMKKEGE-----GDGGW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             G+ LAFGPG+TFEGIL RNL
Sbjct  371   GMILAFGPGVTFEGILARNL  390



>ref|XP_003537759.1| PREDICTED: chalcone synthase-like [Glycine max]
Length=387

 Score =   486 bits (1251),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 253/380 (67%), Positives = 292/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY RDT CD   +K+KL RLCKTTTVKTRY VM ++
Sbjct  13    GKATILALGKAFPHQLVMQEYLVDGYFRDTNCDSPELKQKLTRLCKTTTVKTRYVVMSEE  72

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRLE+ N AV  MA EAS ACI +WG  + +ITH+VYVSSSE 
Sbjct  73    ILKKYPELAAEGIPTVKQRLEICNEAVTEMAIEASQACINNWGGSLSDITHLVYVSSSEA  132

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D  RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI
Sbjct  133   RLPGGDLYLAKGLGLSPDTQRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLIATSETTI  192

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q+FLP T+  ID
Sbjct  193   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPILESEKPLFELHTAVQEFLPHTEKKID  252

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+N+E FC KLI  +     N  YN++FWAVHPGGPAILN
Sbjct  253   GRLTEEGISFKLARELPQIIEDNVEGFCDKLI--SVVGFENKEYNKMFWAVHPGGPAILN  310

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  RK  +     G LEW
Sbjct  311   RIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKIRKDAR-----GDLEW  365

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  366   GLILAFGPGITFEGILARNL  385



>ref|XP_009621338.1| PREDICTED: chalcone synthase [Nicotiana tomentosiformis]
Length=390

 Score =   486 bits (1251),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFP QLV Q+ LV+GY ++T CDD  +K++L RLCKTTTVKTRY VM ++
Sbjct  16    GNATILALGKAFPHQLVMQEFLVDGYFKNTNCDDPELKQRLTRLCKTTTVKTRYVVMSEE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PT+ QRL++ N AV  MA EAS +CI  WGRP+ +ITHVVYVSSSE 
Sbjct  76    ILKKYPELAVEGLPTVKQRLDICNAAVTEMAIEASQSCINKWGRPISDITHVVYVSSSEA  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  +  RVMLYF GC GGV G+RVAKDIAENNPGSRVLL TSETTI
Sbjct  136   RLPGGDLYLAKGLGLSPETKRVMLYFAGCSGGVAGIRVAKDIAENNPGSRVLLATSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G+NP + +E P  EL  A Q FLP T+ +ID
Sbjct  196   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSNPIQDIERPLFELHTAIQHFLPDTEKIID  255

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE NIEDFC KLI  +    N+  YN+LFWAVHPGGPAILN
Sbjct  256   GRLTEEGISFKLERELPQIIEENIEDFCDKLI--SITGYNDREYNKLFWAVHPGGPAILN  313

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  EKL  SRRAL D+GN SSNTI YVLEY     M++ K+ K++E +    W
Sbjct  314   RLEKKLELSPEKLSASRRALADYGNASSNTIVYVLEY-----MLEEKKDKKKENQEDSNW  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL +NL
Sbjct  369   GLILAFGPGITFEGILTKNL  388



>ref|XP_006412179.1| hypothetical protein EUTSA_v10025417mg [Eutrema salsugineum]
 gb|ESQ53632.1| hypothetical protein EUTSA_v10025417mg [Eutrema salsugineum]
Length=392

 Score =   486 bits (1250),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 247/380 (65%), Positives = 291/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + T C+D  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTNCEDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G+ P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSEPDPISEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEAGINFTLSRELPQIIEDNVESFCKKLIGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +     G  EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKVRNTSE-----GENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>emb|CDX72506.1| BnaC07g45280D [Brassica napus]
Length=392

 Score =   485 bits (1249),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 243/380 (64%), Positives = 291/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPE+A EG  T+ QRL++ N AV  MA EAS +CIK+WGR V +ITH+VYVSSSE 
Sbjct  78    ILTKYPEIAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWGRSVSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+K RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q F+P T+  ID
Sbjct  198   IGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPDPVSEKPLFELHTAIQNFIPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTETGINFTLSRELPQIIEDNVESFCKKLIGKAGLADK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    R            EW
Sbjct  316   RMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKSRSMS-----GSENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>gb|KDP27594.1| hypothetical protein JCGZ_19599 [Jatropha curcas]
Length=391

 Score =   485 bits (1249),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 292/380 (77%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G ATILALGKAFP QLV Q+ LV+GY ++T C D  +K+KL RLC+TTTVKTRY VM ++
Sbjct  18    GTATILALGKAFPHQLVMQEFLVDGYFKNTNCYDPDLKQKLTRLCQTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG PT+ QRL++ N AV  MA EAS  CIK WGRP+ +ITH+VYVSSSE 
Sbjct  78    ILNKYPELAIEGIPTVKQRLDICNDAVTQMAIEASETCIKKWGRPISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  +  RVMLYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLHLARGLGLSPETQRVMLYFMGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPPN  RPYDLVG ALFGDGA A+I+G +P  ++E+P  EL  A Q FLP T+ +ID
Sbjct  198   IGFRPPNADRPYDLVGVALFGDGAGAMIIGTDPVSNVESPLFELHTAIQNFLPDTEKIID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP  IE+NIE FC+KL+  A   +    YN  FWAVHPGGPAILN
Sbjct  258   GRMTEEGISFKLARELPHIIEDNIESFCQKLMRGAGVGDKG--YNNFFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRALMD+GN SSNTI YVLEYM +E +   K+ +        +W
Sbjct  316   RIEKRLQLLPEKLNASRRALMDYGNASSNTIVYVLEYMIEESLKINKENE------DCQW  369

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGIT EG+L RNL
Sbjct  370   GLILAFGPGITLEGVLARNL  389



>ref|XP_002276653.1| PREDICTED: chalcone synthase [Vitis vinifera]
Length=392

 Score =   485 bits (1249),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 292/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY R+T CDD  +KEKL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEFLVDGYFRNTNCDDPDLKEKLARLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPEL  EG PT+ QRL++ N AV  MA +AS ACIK WGR V EITH+VYVSSSE 
Sbjct  78    ILRKYPELVIEGQPTVKQRLDICNKAVTQMAIDASKACIKKWGRSVSEITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV LYF+GC GGV GLRVAKDIAENNP SRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVQLYFMGCSGGVAGLRVAKDIAENNPESRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P  S E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPIPSTERPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE++IE FC KLI     ++    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLARELPQIIEDHIEAFCDKLIRNVGFSDE--DYNKIFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SRRAL D+GN SSNTI YVLEYM +E    ++Q +     G  EW
Sbjct  316   RMEKRLDLLPEKLNASRRALADYGNASSNTIVYVLEYMLEESSKTKRQDQ-----GDGEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  371   GLILAFGPGITFEGILARNL  390



>emb|CDY58814.1| BnaAnng15370D [Brassica napus]
Length=392

 Score =   485 bits (1249),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 244/380 (64%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLC TTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPQQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCNTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILNKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLP GDL+LA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETT+
Sbjct  138   RLPSGDLFLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTV  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P   LE P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPILEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+++E+GINF L R+LP+ IE+N+E FCKKLIGKA     ++ YN++FWAVHPGGPAILN
Sbjct  258   GKLTEQGINFTLSRELPQIIEDNVESFCKKLIGKA--GLAHIDYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +     GG EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNMNE-----GGNEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>gb|KFK30118.1| hypothetical protein AALP_AA7G219100 [Arabis alpina]
Length=392

 Score =   485 bits (1248),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 291/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAFGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASKACIKNWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+ ++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSVDRPYDLVGVALFGDGAGAMIIASDPDPICEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINF L R+LP+ IE+N+E FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTEQGINFTLSRELPQIIEDNVEGFCKKLIGKAGLGHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +     G  EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNANE-----GENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>emb|CDY34811.1| BnaA09g41780D [Brassica napus]
Length=392

 Score =   485 bits (1248),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/380 (65%), Positives = 289/380 (76%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK WGR + +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRACIKKWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + + V+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHPVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPISEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINF L R+LP+ IE+N+E FCKKLIGKA        YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGINFTLSRELPKLIEDNVESFCKKLIGKAGLTPK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNMKE-----VENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>emb|CDY17490.1| BnaC03g65730D [Brassica napus]
Length=392

 Score =   485 bits (1248),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/380 (64%), Positives = 295/380 (78%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLC TTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPQQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCNTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+KYPELATEG  T+ QRL++ N AV  MA EAS ACI++WGR + +ITH+VYVSSSE 
Sbjct  78    ILNKYPELATEGGSTVKQRLDICNDAVTEMAVEASRACIENWGRSISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPDPVREKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+++E+GINF L R+LP+ IE+N++ FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GKLTEQGINFTLSRELPQIIEDNVDSFCKKLIGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +     GG EW
Sbjct  316   RMEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESRKARNMNE-----GGNEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RN+
Sbjct  371   GLILAFGPGVTFEGIVARNI  390



>ref|XP_004138289.1| PREDICTED: chalcone synthase A-like [Cucumis sativus]
 ref|XP_004155075.1| PREDICTED: chalcone synthase A-like [Cucumis sativus]
 gb|KGN63621.1| hypothetical protein Csa_1G006310 [Cucumis sativus]
Length=392

 Score =   484 bits (1247),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 244/380 (64%), Positives = 290/380 (76%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV QD LV+GY +DT CDD+ +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPPQLVLQDYLVDGYFKDTSCDDIDLKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PTI QRLE+ N AV  MA EAS A I +WGRP  +ITH+VYVSSSE 
Sbjct  78    ILKKYPELAKEGQPTIKQRLEICNKAVTEMAIEASQAAINNWGRPASDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL     RVMLYF GC GGV GLRVAKD+AENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLFLARGLGLSPQTQRVMLYFTGCSGGVAGLRVAKDLAENNPGSRVLLVTSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+++G +P   +E P  EL    Q+F+P TQ++ID
Sbjct  198   IGFKPPSVNRPYDLVGVALFGDGAGAMVIGRDPFLGIERPLFELHTTTQKFIPDTQNIID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++SEEGI+F + R+LP+ IE+NIE FC+  +     +     YN++FWAVHPGGPAILN
Sbjct  258   GKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGLHEKE--YNKIFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  + +G+        EW
Sbjct  316   RLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMKMEGR-----KIEEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGI+FEGIL RNL
Sbjct  371   GLILAFGPGISFEGILARNL  390



>ref|XP_009138330.1| PREDICTED: chalcone synthase-like [Brassica rapa]
Length=392

 Score =   484 bits (1245),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 245/380 (64%), Positives = 292/380 (77%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILA+GKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILAIGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS +CIK+WGR V +ITH+VYVSSSE 
Sbjct  78    ILTKYPELAIEGGSTVKQRLDICNDAVTEMAVEASRSCIKNWGRSVSDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  + +RV+L F GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLFLAKGLGLSPETHRVLLSFGGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+K RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  198   IGFKPPSKDRPYDLVGVALFGDGAGAMIIGSDPARVSEKPLFELHTAIQNFLPDTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E GINF L R+LP+ IE+N+E FCKKL+GKA   +    YN++FWAVHPGGPAILN
Sbjct  258   GRLTESGINFTLSRELPQIIEDNVESFCKKLLGKAGLAHK--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRR+LMD+GN SSN+I YVLEYM +E    RK  +     G  EW
Sbjct  316   RMEKRLNLSPEKLSPSRRSLMDYGNASSNSIVYVLEYMLEESRKARKMNE-----GENEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  371   GLILAFGPGVTFEGIVARNL  390



>gb|KEH30597.1| chalcone synthase family protein [Medicago truncatula]
Length=390

 Score =   482 bits (1241),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 248/380 (65%), Positives = 292/380 (77%), Gaps = 8/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY RDT CD+  +K+KL RLCKTTTVKTRY VM ++
Sbjct  17    GKATILALGKAFPHQLVMQEYLVDGYFRDTNCDNPELKQKLARLCKTTTVKTRYVVMNEE  76

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG+ T+ QRLE+ N AV  MA EAS  CIK+WG  + +ITHVVYVSSSE 
Sbjct  77    ILKKYPELAVEGASTVKQRLEICNEAVTQMAIEASQVCIKNWGGSLSDITHVVYVSSSEA  136

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYL+  LGL   + R MLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  137   RLPGGDLYLSKGLGLNPTIRRTMLYFSGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  196

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P+   E P  EL  +AQ+F+P T+  ID
Sbjct  197   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPKLETEMPLFELHTSAQEFIPDTEKKID  256

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+F L R+LP+ IE+N+E FC +L+      N    YN+LFWAVHPGGPAILN
Sbjct  257   GRLTEEGISFTLARELPQIIEDNVEGFCDRLMDAVELENKE--YNKLFWAVHPGGPAILN  314

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL+ SR+ALMD+GN SSNTI YVLEYM DE    RK+G      G  EW
Sbjct  315   RVEKRLELSPEKLNASRKALMDYGNASSNTIIYVLEYMLDESKKIRKEG------GYPEW  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  369   GLILAFGPGITFEGILARNL  388



>ref|XP_008453147.1| PREDICTED: chalcone synthase [Cucumis melo]
Length=395

 Score =   482 bits (1240),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/380 (64%), Positives = 289/380 (76%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV QD LV+GY +DT CDD+ +K+KL RLCKTTTVKTRY VM ++
Sbjct  21    GKATILALGKAFPPQLVLQDYLVDGYFKDTSCDDIDLKQKLTRLCKTTTVKTRYVVMSEE  80

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG PTI QRLE+ N AV  MA EAS A I +WGR V +ITH+VYVSSSE 
Sbjct  81    ILKKYPELAKEGQPTIKQRLEICNKAVTEMAIEASQAAINNWGRSVLDITHLVYVSSSEA  140

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL     RVMLYF GC GGV GLRVAKD+AENNPGSRVLL TSETTI
Sbjct  141   RLPGGDLFLARGLGLSPQTQRVMLYFTGCSGGVAGLRVAKDLAENNPGSRVLLVTSETTI  200

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+++G +P   +E P  EL    Q+F+P TQ++ID
Sbjct  201   IGFKPPSANRPYDLVGVALFGDGAGAMLIGRDPFLGIERPLFELHTTTQKFIPDTQNIID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G++SEEGI+F + R+LP+ IE+NIE FC+  +     +     YN++FWAVHPGGPAILN
Sbjct  261   GKLSEEGISFTITRELPQIIEDNIESFCETFLQTLGLHEKE--YNKMFWAVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  +  G+        EW
Sbjct  319   RLEKRLELLPEKLTASRRALMDYGNASSNTIVYVLEYMMEESLKMKMDGR-----KTEEW  373

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGI+FEGIL RNL
Sbjct  374   GLILAFGPGISFEGILARNL  393



>ref|XP_004289833.1| PREDICTED: chalcone synthase-like [Fragaria vesca subsp. vesca]
Length=393

 Score =   482 bits (1240),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 250/380 (66%), Positives = 292/380 (77%), Gaps = 6/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             G+ATILALGKAFP QLV QD LVEGY RD  CDD  +KEKL RLCKTTTVKTRY VM  +
Sbjct  18    GRATILALGKAFPHQLVMQDYLVEGYFRDNNCDDPDLKEKLARLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             VL +YPEL  EG PT+ QRL++ + AV  MA EAS ACIK+WGRP  +ITH+VYVSSSE 
Sbjct  78    VLKRYPELTLEGIPTVKQRLDICHDAVTQMAIEASHACIKNWGRPASDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  L L     RVMLYF GC GGV GLRVAKDIAENNP SRVLL TSETTI
Sbjct  138   RLPGGDLYLARGLELSPRTKRVMLYFSGCSGGVAGLRVAKDIAENNPLSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G++PP+  RPYDLVG ALFGDGA A+I+G++P    ENP  EL  A Q+FLPGT+  ID
Sbjct  198   IGYKPPSAHRPYDLVGVALFGDGAGAMIIGSDPELVSENPLFELHTALQEFLPGTEKTID  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+N+E FC++L+     +     YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGISFKLARELPQIIEDNVEGFCERLMDVVGFDKKE--YNKMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKLD SRRALMD+GN SSNTI YVLEYM +E   K+K+ +    +   EW
Sbjct  316   RMEKRLDLFPEKLDASRRALMDYGNASSNTIVYVLEYMIEESKKKKKKKE----QSNGEW  371

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  372   GLILAFGPGITFEGILARNL  391



>ref|XP_010028685.1| PREDICTED: chalcone synthase [Eucalyptus grandis]
 gb|KCW55471.1| hypothetical protein EUGRSUZ_I01371 [Eucalyptus grandis]
Length=393

 Score =   481 bits (1239),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 243/381 (64%), Positives = 295/381 (77%), Gaps = 7/381 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKATILALGKAFP+QLV Q+ LV+GY R+T CDD  +K+KL RLCKTTTVKTRY VM +
Sbjct  18    RGKATILALGKAFPNQLVMQEFLVDGYFRNTNCDDPDLKQKLTRLCKTTTVKTRYVVMSE  77

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++L+KYPELA EG PT+ QRL++ N AV  MA +AS  CIK WGRP  +ITH+VYVSSSE
Sbjct  78    EILEKYPELAMEGLPTVKQRLDICNEAVTEMAIKASQDCIKKWGRPASDITHLVYVSSSE  137

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYLA  + L  +  RV+LYF+GC GGV GLRVAKDIAENNPGSR+LL TSETT
Sbjct  138   ARLPGGDLYLAKGIKLSPETRRVLLYFVGCSGGVAGLRVAKDIAENNPGSRILLATSETT  197

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             I+G++PP+  RPYDLVG ALFGDGA A+I+GA+P  S+E P  EL+ A Q FLP T+ +I
Sbjct  198   IIGYKPPSAERPYDLVGVALFGDGAGAMIIGADPDLSIEKPLFELNTAIQHFLPDTEKII  257

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DGR++EEGI+FKL R+LP+ IE+NIE FC KL+     +N    YN +FWAVHPGGPAIL
Sbjct  258   DGRLTEEGISFKLARELPQIIEDNIEGFCSKLMEPIGLSNK--DYNRIFWAVHPGGPAIL  315

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE+ L L  +KL  SR+AL D+GN SSNTI YVL+YM +E M  +K  +        E
Sbjct  316   NRLEKRLDLLPDKLRASRQALKDYGNASSNTIVYVLDYMLEESMKMKKDDQ-----SQDE  370

Query  1277  wglalaFGPGITFEGILLRNL  1339
             +GL LAFGPG+TFEGIL RNL
Sbjct  371   FGLILAFGPGVTFEGILARNL  391



>ref|XP_010530789.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
 ref|XP_010530790.1| PREDICTED: chalcone synthase [Tarenaya hassleriana]
Length=392

 Score =   481 bits (1238),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 244/380 (64%), Positives = 290/380 (76%), Gaps = 7/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + T CDD  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTNCDDPELKQKLARLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPEL  EG PT+ QRL++ N AV  MA EAS  CI +WGRP  +ITHVVYVSSSE 
Sbjct  78    ILRKYPELTIEGQPTVKQRLDICNDAVTEMAVEASRTCINNWGRPASDITHVVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL T+ETTI
Sbjct  138   RLPGGDLYLAKGLGLSPDTHRVLLYFIGCSGGVAGLRVAKDIAENNPGSRVLLATAETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  I 
Sbjct  198   IGFKPPSAERPYDLVGVALFGDGAGAMIIGSDPDPVHEKPLFELHTAIQNFLPETEKTIV  257

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGINFKL R+LP+ IE+N+E+FC KL+  A    +   YN++FWAVHPGGPAILN
Sbjct  258   GRLTEEGINFKLARELPQIIEDNVENFCSKLMKVAGLTPD--DYNQMFWAVHPGGPAILN  315

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEY+ +E    + + +      G EW
Sbjct  316   RMEKRLDLSPEKLSPSRRALMDYGNASSNSIVYVLEYLLEESRKAKNEDE-----RGEEW  370

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGIL RNL
Sbjct  371   GLILAFGPGVTFEGILARNL  390



>gb|EYU40405.1| hypothetical protein MIMGU_mgv1a008045mg [Erythranthe guttata]
Length=386

 Score =   479 bits (1234),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/379 (65%), Positives = 290/379 (77%), Gaps = 6/379 (2%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KA ILALGKAFP QLV Q+ LV+GY+R+T CDD  +K+KL RLCK TTVKTRY VM +++
Sbjct  12    KAAILALGKAFPHQLVMQEFLVDGYLRNTNCDDPDLKQKLTRLCKATTVKTRYVVMSEEI  71

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             L+KYPELA EG PT+ QRLE+ N AV  MA EAS +CI+ WGRPV +ITHVVYVSSSE R
Sbjct  72    LNKYPELAAEGVPTLNQRLEICNSAVTKMAIEASRSCIEKWGRPVSDITHVVYVSSSEAR  131

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYLA  LGL+ D  RVMLYF GC GGV GLRVAKDIAENNP SRVLL TSETTI+
Sbjct  132   LPGGDLYLARGLGLRPDTRRVMLYFSGCSGGVAGLRVAKDIAENNPNSRVLLATSETTII  191

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GF+PP+  RPYDLVG ALFGDGA A+I+G+ P   +E P  EL  A Q FLP T+ +IDG
Sbjct  192   GFKPPSADRPYDLVGVALFGDGAGAMIIGSGPVSEIEKPLFELHTAIQHFLPDTEKIIDG  251

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             +++EEGI+FKL + LP+ IE+NI+DFC +L+G          +NELFWAVHPGGPAILN+
Sbjct  252   KLTEEGISFKLEKQLPQIIEDNIQDFCVELMGYGGFCEK--DFNELFWAVHPGGPAILNK  309

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE+ L L  EKL  SRRAL D+GN SSNTI YVLEYM +E    + +G+     G  EWG
Sbjct  310   LEKKLELLPEKLKSSRRALSDYGNASSNTIVYVLEYMLEEAKNFKNKGQ----NGNCEWG  365

Query  1283  lalaFGPGITFEGILLRNL  1339
             L LAFGPGIT EGIL +NL
Sbjct  366   LILAFGPGITLEGILAKNL  384



>gb|EPS66734.1| hypothetical protein M569_08037, partial [Genlisea aurea]
Length=381

 Score =   474 bits (1221),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 245/379 (65%), Positives = 284/379 (75%), Gaps = 6/379 (2%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KA ILALGKAFP QL+ QD LV+ Y R+T   D  +K+KL +LCK TTVKTRY VMC+++
Sbjct  7     KANILALGKAFPHQLLIQDLLVDAYFRNTNSHDPHLKQKLIQLCKATTVKTRYVVMCEEI  66

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             L KYPELAT+G PT+ QRLE+ N AV  MA EAS +CI  WGR V EITH+VYVSSSE R
Sbjct  67    LTKYPELATQGLPTVKQRLEICNSAVTQMAIEASNSCIHKWGRQVSEITHLVYVSSSEAR  126

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDLYLA  LGL+ D  RVMLYF GC GGV GLRVAKDIAENN GSRVLL TSETTI+
Sbjct  127   LPGGDLYLAKGLGLRPDTQRVMLYFSGCSGGVAGLRVAKDIAENNYGSRVLLATSETTII  186

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPP+  RPYDLVG ALFGDGA AVI+G+NP   +E P  EL  A Q FLP T+ VIDG
Sbjct  187   GFRPPSADRPYDLVGVALFGDGAGAVIIGSNPVMKIERPLFELHTAIQHFLPDTEKVIDG  246

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             +++EEGI+FKL + LP  IE+NI+DFC+KL+G A  +     +N++FWAVHPGGPAILNR
Sbjct  247   QLTEEGISFKLEKQLPCIIEHNIQDFCEKLMGHAEFSKP--DFNKMFWAVHPGGPAILNR  304

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE+ L L  EKL  SRRAL D+GN SSNTI YVLEY+ +E    R  G+        EWG
Sbjct  305   LEKRLELSPEKLGASRRALADYGNASSNTIVYVLEYLLEEGNNTRTNGE----IEENEWG  360

Query  1283  lalaFGPGITFEGILLRNL  1339
               LAFGPGIT EGIL R L
Sbjct  361   FILAFGPGITLEGILTRKL  379



>ref|XP_003574084.1| PREDICTED: chalcone synthase-like [Brachypodium distachyon]
Length=386

 Score =   471 bits (1213),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 236/382 (62%), Positives = 290/382 (76%), Gaps = 19/382 (5%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
              GKA +LALGK  P  + PQD LVE Y++DT+CDD A + KLERLCKTTTVKTRYTVM K
Sbjct  18    HGKAKLLALGKGLPEHVQPQDKLVETYLQDTRCDDPATRAKLERLCKTTTVKTRYTVMSK  77

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LD++PEL TEG+PT+  RL++ N AV+ +   A+ A + +WGRP  EITH+VY+SSSE
Sbjct  78    ELLDEHPELKTEGTPTLTPRLDICNAAVLELGAAAAHAALGEWGRPAVEITHLVYISSSE  137

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LA  LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+  +ETT
Sbjct  138   LRLPGGDLFLATRLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVIAAETT  197

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+A I+GA+P  + ENPF+EL F+ Q+FLPGT  VI
Sbjct  198   VLGFRPPSPDRPYDLVGAALFGDGASAAIIGASPITAEENPFLELEFSTQEFLPGTDKVI  257

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N++FWAVHPGGPAIL
Sbjct  258   DGKITEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIKE----FNDVFWAVHPGGPAIL  313

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---MMKRKQGKeeeeeg  1267
             NRLE  L L  +KL  SR+ALM++GNVSSNT+FYVLEY+RD L   M++ + G       
Sbjct  314   NRLEICLQLDPDKLKISRKALMNYGNVSSNTVFYVLEYLRDGLKKGMIREEWG-------  366

Query  1268  glewglalaFGPGITFEGILLR  1333
                  L LAFGPGITFEG+L+R
Sbjct  367   -----LILAFGPGITFEGMLVR  383



>emb|CAB45446.1| chalcone synthase-like protein [Arabidopsis thaliana]
 emb|CAB80202.1| chalcone synthase-like protein [Arabidopsis thaliana]
Length=390

 Score =   467 bits (1202),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 249/380 (66%), Positives = 293/380 (77%), Gaps = 9/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY + TKCDD  +K+KL R  KTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPHQLVMQEYLVDGYFKTTKCDDPELKQKLTR--KTTTVKTRYVVMSEE  75

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPELA EG  T+ QRL++ N AV  MA EAS ACIK+WGR + +ITHVVYVSSSE 
Sbjct  76    ILKKYPELAIEGGSTVTQRLDICNDAVTEMAVEASRACIKNWGRSISDITHVVYVSSSEA  135

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  D +RV+LYF+GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  136   RLPGGDLYLAKGLGLSPDTHRVLLYFVGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  195

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q FLP T+  ID
Sbjct  196   IGFKPPSVDRPYDLVGVALFGDGAGAMIIGSDPDPICEKPLFELHTAIQNFLPETEKTID  255

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++E+GINFKL R+LP+ IE+N+E+FCKKLIGKA   +    YN++FWAVHPGGPAILN
Sbjct  256   GRLTEQGINFKLSRELPQIIEDNVENFCKKLIGKAGLAHK--NYNQMFWAVHPGGPAILN  313

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSN+I YVLEYM +E    R   +        EW
Sbjct  314   RIEKRLNLSPEKLSPSRRALMDYGNASSNSIVYVLEYMLEESKKVRNMNE-----EENEW  368

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+TFEGI+ RNL
Sbjct  369   GLILAFGPGVTFEGIIARNL  388



>ref|XP_006664811.1| PREDICTED: chalcone synthase LF2-like [Oryza brachyantha]
Length=407

 Score =   467 bits (1202),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 244/381 (64%), Positives = 286/381 (75%), Gaps = 4/381 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T CDD  +KEKL RLCKTTTVKTRY VM ++
Sbjct  22    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCDDPELKEKLTRLCKTTTVKTRYVVMSEE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC++ WG  + EITH+VYVSSSE 
Sbjct  82    ILRSYPELAQEGQPTMKQRLDISNKAVTQMATEASLACVRSWGGALSEITHLVYVSSSEA  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETTI
Sbjct  142   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A IVGA+P   LE P  EL  A Q+FLP T   ID
Sbjct  202   VGFRPPSPDRPYDLVGVALFGDGAGAAIVGADP-TPLERPLFELHSALQRFLPDTDKTID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI F+LGR+LP  IE N+E FC+KL+ + +     LTY+++FWAVHPGGPAIL 
Sbjct  261   GRLTEEGIKFQLGRELPHIIEANVEAFCQKLM-QEHPQQRQLTYDDMFWAVHPGGPAILT  319

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   +R+      EE   EW
Sbjct  320   KMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEETRQRRETA--TAEEEDCEW  377

Query  1280  glalaFGPGITFEGILLRNLQ  1342
             GL LAFGPGITFEGIL RNL+
Sbjct  378   GLILAFGPGITFEGILARNLE  398



>gb|EEC81903.1| hypothetical protein OsI_25733 [Oryza sativa Indica Group]
Length=405

 Score =   467 bits (1201),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/381 (64%), Positives = 287/381 (75%), Gaps = 4/381 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++R+T CDD  +KEKL RLCKTTTVKTRY VM ++
Sbjct  22    GKATILALGHAFPQQLVMQDYVVDGFMRNTNCDDPELKEKLTRLCKTTTVKTRYVVMSEE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC++ WG  + EITH+VYVSSSE 
Sbjct  82    ILKSYPELAQEGQPTMKQRLDISNKAVTQMATEASLACVRSWGGALSEITHLVYVSSSEA  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETTI
Sbjct  142   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A +VGA+P   +E P  EL  A Q+FLP T   ID
Sbjct  202   VGFRPPSPDRPYDLVGVALFGDGAGAAVVGADP-TPVERPLFELHSALQRFLPDTDKTID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI F+LGR+LP  IE N+E FC+KL+ +     + LTY ++FWAVHPGGPAIL 
Sbjct  261   GRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVHPGGPAILT  320

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E    R++ +E  EE   EW
Sbjct  321   KMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE---TRQRREEAAEEEDCEW  377

Query  1280  glalaFGPGITFEGILLRNLQ  1342
             GL LAFGPGITFEGIL RNLQ
Sbjct  378   GLILAFGPGITFEGILARNLQ  398



>ref|NP_001059449.2| Os07g0411300 [Oryza sativa Japonica Group]
 dbj|BAC21541.1| putative chalcone synthase [Oryza sativa Japonica Group]
 dbj|BAF21363.2| Os07g0411300 [Oryza sativa Japonica Group]
Length=405

 Score =   467 bits (1201),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/381 (64%), Positives = 287/381 (75%), Gaps = 4/381 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++R+T CDD  +KEKL RLCKTTTVKTRY VM ++
Sbjct  22    GKATILALGHAFPQQLVMQDYVVDGFMRNTNCDDPELKEKLTRLCKTTTVKTRYVVMSEE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC++ WG  + EITH+VYVSSSE 
Sbjct  82    ILKSYPELAQEGQPTMKQRLDISNKAVTQMATEASLACVRSWGGALSEITHLVYVSSSEA  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETTI
Sbjct  142   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTI  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A +VGA+P   +E P  EL  A Q+FLP T   ID
Sbjct  202   VGFRPPSPDRPYDLVGVALFGDGAGAAVVGADP-TPVERPLFELHSALQRFLPDTDKTID  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI F+LGR+LP  IE N+E FC+KL+ +     + LTY ++FWAVHPGGPAIL 
Sbjct  261   GRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHPQAADKLTYGDMFWAVHPGGPAILT  320

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E    R++ +E  EE   EW
Sbjct  321   KMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEE---TRQRREEAAEEEDCEW  377

Query  1280  glalaFGPGITFEGILLRNLQ  1342
             GL LAFGPGITFEGIL RNLQ
Sbjct  378   GLILAFGPGITFEGILARNLQ  398



>dbj|BAG32254.1| chalcone synthase [Raphanus sativus]
Length=360

 Score =   463 bits (1192),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 219/291 (75%), Positives = 257/291 (88%), Gaps = 3/291 (1%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKAT+LALGKAFPS +V Q+ LVE Y+R+ KCDD +IKEKL+ LCKTTTVKTRYTVM  
Sbjct  23    KGKATVLALGKAFPSNVVSQENLVEEYLREIKCDDPSIKEKLQHLCKTTTVKTRYTVMSS  82

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             + + KYPELATEGSPTI QRLE+AN AV+ MA EASLACIK+WGR VE+ITH+VYVSSSE
Sbjct  83    ETMQKYPELATEGSPTIKQRLEIANEAVVQMAYEASLACIKEWGRTVEDITHLVYVSSSE  142

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
              RLPGGDLYL+A+LGL ++V RV+ YFLGCYGGV+G+RVAKDIAENNPGSRVLLTTSET 
Sbjct  143   FRLPGGDLYLSAQLGLSNEVQRVLFYFLGCYGGVSGMRVAKDIAENNPGSRVLLTTSETM  202

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL +A QQFLPGT  VI
Sbjct  203   VLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHYALQQFLPGTHGVI  261

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWA  1069
             DGR+SEEGI+FKLGR+LP+KIE+NIE+FCKKL+ KA   + +L  N+LFWA
Sbjct  262   DGRLSEEGISFKLGRELPQKIEDNIEEFCKKLVAKA--GSGSLELNDLFWA  310



>ref|NP_001150611.1| chalcone synthase G [Zea mays]
 gb|ACG39754.1| chalcone synthase G [Zea mays]
 tpg|DAA49571.1| TPA: chalcone synthase G [Zea mays]
Length=385

 Score =   461 bits (1187),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/382 (61%), Positives = 293/382 (77%), Gaps = 18/382 (5%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             + KA +LALGK+FP Q++PQ+ +VE Y++++ CDD A + KL+RL     +KTRYTVM K
Sbjct  17    RAKAMLLALGKSFPDQVLPQEKVVESYLQESSCDDPATRAKLQRL-----LKTRYTVMSK  71

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDK+PEL  EG+PT+  RL++ N AVI +   A+ A + +WGRP  +ITH++Y+SSS+
Sbjct  72    ELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALDEWGRPAADITHLIYISSSD  131

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+T +ETT
Sbjct  132   LRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTAAETT  191

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+AVI+GA P    ENPF+EL F+ Q+FLPGT  VI
Sbjct  192   VLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMTPAENPFLELEFSTQEFLPGTDKVI  251

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N++FWAVHPGGPAIL
Sbjct  252   DGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK----DFNDIFWAVHPGGPAIL  307

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    K+G         E
Sbjct  308   NRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----KKG-----AISEE  358

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGL LAFGPGITFEG+L+R ++
Sbjct  359   WGLILAFGPGITFEGLLVRGVK  380



>dbj|BAE80096.1| Chalcone synthase [Silene latifolia]
Length=379

 Score =   461 bits (1185),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 226/349 (65%), Positives = 266/349 (76%), Gaps = 4/349 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+L+LGK FP  LV Q+ LV+GY R+T CDD  +K+KL RLCKTTTVKTRY VM  +
Sbjct  18    GKATVLSLGKGFPHTLVMQEFLVDGYFRNTNCDDPELKQKLTRLCKTTTVKTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L K PELA  G  T+ QRL++ N AV  MA +AS ACI DWGRP+ +ITH+VYVSSSE 
Sbjct  78    ILKKCPELAMAGQATVKQRLDICNDAVTEMAIDASKACISDWGRPISDITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL  + NRVMLYF GC GGV G RVAKDIAENNPGSRVLL TSETTI
Sbjct  138   RLPGGDLYLAKGLGLSPETNRVMLYFSGCSGGVAGFRVAKDIAENNPGSRVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PPN  RPYDLVG ALFGDGA A+I+G++P  S ENP  EL  A Q FLP T+ +ID
Sbjct  198   IGFKPPNPDRPYDLVGVALFGDGAGAMIIGSDPNSS-ENPLFELHTAIQHFLPDTEKIID  256

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+F L R LP+ IE+NIE FC KL+      +    YN++FWAVHPGGPAILN
Sbjct  257   GRLTEEGISFTLDRALPQIIEDNIEAFCDKLMSSVGLTSK--DYNDMFWAVHPGGPAILN  314

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQG  1246
             RLE+ L L  +KL  SRRAL D+GN SSNTI YV+EYM +E  +KRK G
Sbjct  315   RLEKRLDLSPDKLSASRRALTDYGNASSNTIVYVMEYMIEE-GLKRKNG  362



>ref|XP_004982809.1| PREDICTED: stilbene synthase 4-like [Setaria italica]
Length=387

 Score =   458 bits (1179),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 244/382 (64%), Positives = 296/382 (77%), Gaps = 13/382 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK  P Q++PQ+ +VE Y++D+ CDD A + KLERLCKTTTV+TRYTVM K
Sbjct  19    RGKAMLLALGKGLPGQVLPQEKVVESYLQDSTCDDPATRAKLERLCKTTTVRTRYTVMTK  78

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LD++PEL TEG PT+  RL++ N AVI +   A+ A + DWGRP  +ITH+VY+SSSE
Sbjct  79    ELLDEHPELKTEGIPTLTPRLDICNSAVIDLGAAAARAALDDWGRPAADITHLVYISSSE  138

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+T +ETT
Sbjct  139   LRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTAAETT  198

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+AVIVGA P    ENPF+EL F+ Q+FLPGT  VI
Sbjct  199   VLGFRPPSYDRPYDLVGAALFGDGASAVIVGAGPMTPAENPFLELEFSTQEFLPGTDKVI  258

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  259   DGKISEEGINFKLGRDLPEKIESRIEGFCRNLMDQVGIK----DFNDVFWAVHPGGPAIL  314

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    K+G         E
Sbjct  315   NRLEFCLELQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----KKG-----AISEE  365

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGL LAFGPGITFEG+L+R + 
Sbjct  366   WGLILAFGPGITFEGLLVRGVN  387



>gb|KHN32314.1| Chalcone synthase [Glycine soja]
Length=358

 Score =   456 bits (1174),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 237/362 (65%), Positives = 276/362 (76%), Gaps = 7/362 (2%)
 Frame = +2

Query  254   QDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQ  433
             Q+ LV+GY RDT CD   +K+KL RLCKTTTVKTRY VM +++L KYPELA EG PT+ Q
Sbjct  2     QEYLVDGYFRDTNCDSPELKQKLTRLCKTTTVKTRYVVMSEEILKKYPELAAEGIPTVKQ  61

Query  434   RLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSD  613
             RLE+ N AV  MA EAS ACI +WG  + +ITH+VYVSSSE RLPGGDLYLA  LGL  D
Sbjct  62    RLEICNEAVTEMAIEASQACINNWGGSLSDITHLVYVSSSEARLPGGDLYLAKGLGLSPD  121

Query  614   VNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAA  793
               RVMLYF GC GGV GLRVAKDIAENNPGSRVL+ TSETTI+GF+PP+  RPYDLVG A
Sbjct  122   TQRVMLYFAGCSGGVAGLRVAKDIAENNPGSRVLIATSETTIIGFKPPSADRPYDLVGVA  181

Query  794   LFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPE  973
             LFGDGA A+I+G++P    E P  EL  A Q+FLP T+  IDGR++EEGI+FKL R+LP+
Sbjct  182   LFGDGAGAMIIGSDPILESEKPLFELHTAVQEFLPHTEKKIDGRLTEEGISFKLARELPQ  241

Query  974   KIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRR  1153
              IE+N+E FC KLI  +     N  YN++FWAVHPGGPAILNR+E+ L L  EKL  SRR
Sbjct  242   IIEDNVEGFCDKLI--SVVGFENKEYNKMFWAVHPGGPAILNRIEKRLDLLPEKLSASRR  299

Query  1154  ALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLR  1333
             ALMD+GN SSNTI YVLEYM +E +  RK  +     G LEWGL LAFGPGITFEGIL R
Sbjct  300   ALMDYGNASSNTIVYVLEYMIEEGLKIRKDAR-----GDLEWGLILAFGPGITFEGILAR  354

Query  1334  NL  1339
             NL
Sbjct  355   NL  356



>ref|XP_008678397.1| PREDICTED: chalcone synthase G isoform X1 [Zea mays]
 gb|ACF85939.1| unknown [Zea mays]
 tpg|DAA49572.1| TPA: hypothetical protein ZEAMMB73_179866 [Zea mays]
Length=390

 Score =   457 bits (1177),  Expect = 6e-154, Method: Compositional matrix adjust.
 Identities = 239/382 (63%), Positives = 297/382 (78%), Gaps = 13/382 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             + KA +LALGK+FP Q++PQ+ +VE Y++++ CDD A + KL+RLC TTTVKTRYTVM K
Sbjct  17    RAKAMLLALGKSFPDQVLPQEKVVESYLQESSCDDPATRAKLQRLCTTTTVKTRYTVMSK  76

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDK+PEL  EG+PT+  RL++ N AVI +   A+ A + +WGRP  +ITH++Y+SSS+
Sbjct  77    ELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALDEWGRPAADITHLIYISSSD  136

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+T +ETT
Sbjct  137   LRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTAAETT  196

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+AVI+GA P    ENPF+EL F+ Q+FLPGT  VI
Sbjct  197   VLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMTPAENPFLELEFSTQEFLPGTDKVI  256

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N++FWAVHPGGPAIL
Sbjct  257   DGKISEEGINFKLGRDLPEKIESRIEGFCRTLMNKVGIK----DFNDIFWAVHPGGPAIL  312

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    K+G         E
Sbjct  313   NRLEFCLKLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----KKG-----AISEE  363

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGL LAFGPGITFEG+L+R ++
Sbjct  364   WGLILAFGPGITFEGLLVRGVK  385



>ref|XP_006661875.1| PREDICTED: stilbene synthase 4-like [Oryza brachyantha]
Length=392

 Score =   457 bits (1176),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 235/384 (61%), Positives = 297/384 (77%), Gaps = 19/384 (5%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKA +LALGK  P Q++PQ+ +VE Y++D+ CDD A + KLERLCKTTTV+TRYTVM K+
Sbjct  23    GKAMLLALGKGLPEQVLPQEKVVETYLQDSSCDDPATRAKLERLCKTTTVRTRYTVMSKE  82

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD++PEL TEG+PT+  RL++ N AV+ +   A+ A + +WGRP  +ITH+VY+SSSE+
Sbjct  83    LLDEHPELKTEGTPTLTPRLDICNAAVLELGATAARAALGEWGRPAADITHLVYISSSEL  142

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+  +ETT+
Sbjct  143   RLPGGDLFLAARLGLHPNTIRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVIAAETTV  202

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPP+  RPYDLVGAALFGDGA+AVI+GA P  + ENPF+EL F+ Q+FLPGT+ VID
Sbjct  203   LGFRPPSPDRPYDLVGAALFGDGASAVIIGAGPITAEENPFLELQFSRQEFLPGTEKVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAILN
Sbjct  263   GKISEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK----EFNDVFWAVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---MMKRKQGKeeeeegg  1270
             RLE  L L++EKL  SR+ALM++GNVSSNT+FYVLEY+RDEL   +++ + G        
Sbjct  319   RLELCLELQTEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGVIREEWG--------  370

Query  1271  lewglalaFGPGITFEGILLRNLQ  1342
                 L LAFGPGITFEG+L+R + 
Sbjct  371   ----LILAFGPGITFEGMLVRGVN  390



>ref|NP_001064891.1| Os10g0484800 [Oryza sativa Japonica Group]
 gb|AAL59036.1|AC087182_19 anther-specific protein YY2 [Oryza sativa Japonica Group]
 dbj|BAA23618.1| YY2 protein [Oryza sativa]
 gb|AAP54339.1| Chalcone and stilbene synthases, N-terminal domain containing 
protein, expressed [Oryza sativa Japonica Group]
 dbj|BAC78574.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF26805.1| Os10g0484800 [Oryza sativa Japonica Group]
 gb|EAZ16469.1| hypothetical protein OsJ_31939 [Oryza sativa Japonica Group]
 dbj|BAG97274.1| unnamed protein product [Oryza sativa Japonica Group]
Length=389

 Score =   456 bits (1172),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 234/385 (61%), Positives = 294/385 (76%), Gaps = 19/385 (5%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK  P Q++PQ+ +VE Y++DT CDD A + KLERLCKTTTV+TRYTVM K
Sbjct  21    RGKAMLLALGKGLPEQVLPQEKVVETYLQDTICDDPATRAKLERLCKTTTVRTRYTVMSK  80

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LD++PEL TEG+PT+  RL++ N AV+ +   A+ A + +WGRP  +ITH+VY+SSSE
Sbjct  81    ELLDEHPELRTEGTPTLTPRLDICNAAVLELGATAARAALGEWGRPAADITHLVYISSSE  140

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LA  LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+  +ETT
Sbjct  141   LRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVVAAETT  200

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+A I+GA P  + E+PF+EL F+ Q+FLPGT  VI
Sbjct  201   VLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGPIAAEESPFLELQFSTQEFLPGTDKVI  260

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+I+EEGINFKLGRDLPEKIEN IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  261   DGKITEEGINFKLGRDLPEKIENRIEGFCRTLMDRVGIK----EFNDVFWAVHPGGPAIL  316

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---MMKRKQGKeeeeeg  1267
             NRLE  L L+ EKL  SR+ALM++GNVSSNT+FYVLEY+RDEL   M++ + G       
Sbjct  317   NRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGMIREEWG-------  369

Query  1268  glewglalaFGPGITFEGILLRNLQ  1342
                  L LAFGPGITFEG+L+R + 
Sbjct  370   -----LILAFGPGITFEGMLVRGIN  389



>ref|XP_008780014.1| PREDICTED: chalcone synthase [Phoenix dactylifera]
Length=360

 Score =   454 bits (1169),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 227/362 (63%), Positives = 279/362 (77%), Gaps = 5/362 (1%)
 Frame = +2

Query  254   QDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQ  433
             QD LV+GY ++TKCDD  +K++L RLCKTTTVKTRY VM +++L  YPELA EG PT+ Q
Sbjct  2     QDFLVDGYFKNTKCDDPELKQRLTRLCKTTTVKTRYVVMSEEILRNYPELAAEGLPTVKQ  61

Query  434   RLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSD  613
             RLE++N AV  MA EASL+CIK  GRP+  +TH+VYVSSSE R PGGDL+LA  LGL  D
Sbjct  62    RLEISNKAVTQMAVEASLSCIKALGRPLSAVTHLVYVSSSEARFPGGDLHLALGLGLSPD  121

Query  614   VNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAA  793
             V R+ML F GC GGV GLRVAKD+AENNPGSRVLL TSETTI+GFRPP+ +RPYDLVGAA
Sbjct  122   VRRIMLSFTGCSGGVAGLRVAKDLAENNPGSRVLLATSETTIVGFRPPSASRPYDLVGAA  181

Query  794   LFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPE  973
             LFGDGA A I+G +P   +E    EL  AAQQ+LPGT+  IDGR++EEGINF+LGR+LP+
Sbjct  182   LFGDGAGAAILGVDPIPGVETALFELHSAAQQYLPGTEKTIDGRLTEEGINFRLGRELPQ  241

Query  974   KIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRR  1153
              IE+++E FCKKL+ +      +   NE+FWAVHPGGPAIL+++E  L L  +KL+ SR+
Sbjct  242   VIEDHVEAFCKKLMREGREGGEDAENNEMFWAVHPGGPAILSKVESRLELWPDKLNASRK  301

Query  1154  ALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLR  1333
             AL D+GN SSNTI YVL YM +E   +R++G+        EWGL LAFGPG+TFEGIL R
Sbjct  302   ALRDYGNASSNTIVYVLNYMVEESRKRREKGE-----KDCEWGLILAFGPGVTFEGILAR  356

Query  1334  NL  1339
             NL
Sbjct  357   NL  358



>emb|CAJ15412.1| unnamed protein product [Triticum aestivum]
Length=421

 Score =   456 bits (1173),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 241/390 (62%), Positives = 284/390 (73%), Gaps = 10/390 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM  +
Sbjct  27    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLARLCKTTTVKTRYVVMSDE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC+K WG  +  ITH+VYVSSSE 
Sbjct  87    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVKAWGGDLSAITHLVYVSSSEA  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  147   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VG +P   LE P  EL  A Q+FLPGT+  ID
Sbjct  207   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDP-TPLECPLFELHSALQRFLPGTEKTID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnnLTYNELFWAVHPGG  1084
             GR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N LTY+++FWAVHPGG
Sbjct  266   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHPGG  325

Query  1085  PAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeee  1264
             PAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   + +  + E E 
Sbjct  326   PAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRAEAPEPEPEP  385

Query  1265  gglewg----lalaFGPGITFEGILLRNLQ  1342
              G +      L LAFGPGITFEGIL RNLQ
Sbjct  386   EGADQECEWGLILAFGPGITFEGILARNLQ  415



>emb|CAJ13966.1| unnamed protein product [Aegilops tauschii]
Length=420

 Score =   455 bits (1171),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 240/389 (62%), Positives = 282/389 (72%), Gaps = 9/389 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM  +
Sbjct  27    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLARLCKTTTVKTRYVVMSDE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC+K WG  +  ITH+VYVSSSE 
Sbjct  87    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVKAWGGDLSAITHLVYVSSSEA  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  147   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VG +P   LE P  EL  A Q+FLP T+  ID
Sbjct  207   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDP-TPLERPLFELHSALQRFLPDTEKTID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnnLTYNELFWAVHPGG  1084
             GR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N LTY+++FWAVHPGG
Sbjct  266   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHPGG  325

Query  1085  PAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeee  1264
             PAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   + +  + E E 
Sbjct  326   PAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRAEAPEPEPEP  385

Query  1265  gglewgl---alaFGPGITFEGILLRNLQ  1342
              G E       LAFGPGITFEGIL RNLQ
Sbjct  386   EGEEECEWGLILAFGPGITFEGILARNLQ  414



>gb|EAY78973.1| hypothetical protein OsI_34081 [Oryza sativa Indica Group]
Length=389

 Score =   454 bits (1167),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/385 (61%), Positives = 294/385 (76%), Gaps = 19/385 (5%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK  P Q++PQ+ +VE Y++DT CDD A + KLERLCKTTTV+TRYTVM K
Sbjct  21    RGKAMLLALGKGLPEQVLPQEKVVETYLQDTICDDPATRAKLERLCKTTTVRTRYTVMSK  80

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LD++PEL TEG+PT+  RL++ N AV+ +   A+ A + +WGRP  +ITH+VY+SSSE
Sbjct  81    ELLDEHPELRTEGTPTLTPRLDICNAAVLELGATAARAALGEWGRPAADITHLVYISSSE  140

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LA  LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+  +ETT
Sbjct  141   LRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVVAAETT  200

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+A I+GA P  + E+PF+EL F+ Q+FLPGT  VI
Sbjct  201   VLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGPIAAEESPFLELQFSTQEFLPGTDKVI  260

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  261   DGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK----EFNDVFWAVHPGGPAIL  316

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---MMKRKQGKeeeeeg  1267
             NRLE  L L+ EKL  SR+ALM++GNVSSNT+FYVLEY+RDEL   M++ + G       
Sbjct  317   NRLEVCLELQPEKLKISRKALMNYGNVSSNTVFYVLEYLRDELKKGMIREEWG-------  369

Query  1268  glewglalaFGPGITFEGILLRNLQ  1342
                  L LAFGPGITFEG+L+R + 
Sbjct  370   -----LILAFGPGITFEGMLVRGIN  389



>gb|AAV49989.1| putative chalcone synthase [Hordeum vulgare subsp. vulgare]
Length=432

 Score =   455 bits (1170),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 243/401 (61%), Positives = 289/401 (72%), Gaps = 21/401 (5%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM ++
Sbjct  27    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMSEE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC++ WG  +  ITH+VYVSSSE 
Sbjct  87    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVEAWGGDLSAITHLVYVSSSEA  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  147   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VGA+P  ++E P  EL  A Q+FLP T+  ID
Sbjct  207   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGADP-TAVERPLFELHSALQRFLPDTEKTID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLI----GKAnnnnnnLTYNELFWAVHPGGP  1087
             GR++EEGI F+LGR+LP  IE ++E FC+KLI    G A   +  LTY+++FWAVHPGGP
Sbjct  266   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPGAAAAEDVPLTYDKMFWAVHPGGP  325

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELM-------------  1228
             AIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E               
Sbjct  326   AILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRRQRMTEAPVLENM  385

Query  1229  ---MKRKQGKeeeeegglewglalaFGPGITFEGILLRNLQ  1342
                 +R++  E E E   EWGL LAFGPGITFEGIL RNLQ
Sbjct  386   VEESRRQRTTEPEMEPECEWGLILAFGPGITFEGILARNLQ  426



>ref|XP_002467058.1| hypothetical protein SORBIDRAFT_01g018950 [Sorghum bicolor]
 gb|EER94056.1| hypothetical protein SORBIDRAFT_01g018950 [Sorghum bicolor]
Length=387

 Score =   453 bits (1165),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 238/382 (62%), Positives = 296/382 (77%), Gaps = 13/382 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK FP Q++PQ+ +VE Y++D+ CDD A + KLERLC TTTV+TRYTVM K
Sbjct  14    RGKAMLLALGKGFPDQVLPQEKVVESYLQDSSCDDPATRAKLERLCTTTTVRTRYTVMSK  73

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDK+PEL  EG+PT+  RL++ N AVI +   A+ A + DWGRP  +ITH++Y+SSSE
Sbjct  74    ELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALDDWGRPAADITHLIYISSSE  133

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGD++LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+T +ETT
Sbjct  134   LRLPGGDVHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTAAETT  193

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+AVI+GA P    E+PF+EL F+ Q+FLPGT  VI
Sbjct  194   VLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMAPAEDPFLELEFSTQEFLPGTDKVI  253

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  254   DGKIAEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK----DFNDVFWAVHPGGPAIL  309

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE  L L+ EKL  SR+AL ++GNVSSNTIFYVLEY+RDEL    K+G         E
Sbjct  310   NRLEFCLELQPEKLKISRKALKNYGNVSSNTIFYVLEYLRDEL----KKG-----AISEE  360

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGL LAFGPGITFEG+L+R ++
Sbjct  361   WGLILAFGPGITFEGLLVRGVK  382



>dbj|BAJ95097.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=429

 Score =   454 bits (1168),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 242/400 (61%), Positives = 289/400 (72%), Gaps = 20/400 (5%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM ++
Sbjct  25    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMSEE  84

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC++ WG  +  ITH+VYVSSSE 
Sbjct  85    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVEAWGGDLSAITHLVYVSSSEA  144

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  145   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  204

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VGA+P  ++E P  EL  A Q+FLP T+  ID
Sbjct  205   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGADP-TAVERPLFELHSALQRFLPDTEKTID  263

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGK---AnnnnnnLTYNELFWAVHPGGPA  1090
             GR++EEGI F+LGR+LP  IE ++E FC+KLI +   A    + LTY+++FWAVHPGGPA
Sbjct  264   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPGAAAAEDVLTYDKMFWAVHPGGPA  323

Query  1091  ILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELM--------------  1228
             IL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E                
Sbjct  324   ILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRRQSMTEAPVLENMV  383

Query  1229  --MKRKQGKeeeeegglewglalaFGPGITFEGILLRNLQ  1342
                +R++  E E E   EWGL LAFGPGITFEGIL RNLQ
Sbjct  384   EESRRQRTTEPEMEPECEWGLILAFGPGITFEGILARNLQ  423



>emb|CAJ13548.1| unnamed protein product [Triticum turgidum]
Length=418

 Score =   452 bits (1164),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 242/387 (63%), Positives = 284/387 (73%), Gaps = 7/387 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM  +
Sbjct  27    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMSDE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLACIK WG  +  ITH+VYVSSSE 
Sbjct  87    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACIKAWGGDLSAITHLVYVSSSEA  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  147   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VG +P +  E P  EL  A Q+FLP T+  ID
Sbjct  207   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPTDQ-ERPLFELYSALQRFLPDTEKTID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnnLTYNELFWAVHPGG  1084
             GR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N LTY+++FWAVHPGG
Sbjct  266   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHPGG  325

Query  1085  PAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeee  1264
             PAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   + +  + E E 
Sbjct  326   PAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRTEAPEPEAEG  385

Query  1265  ggl-ewglalaFGPGITFEGILLRNLQ  1342
             G   EWGL LAFGPGIT EGIL RNLQ
Sbjct  386   GQECEWGLILAFGPGITLEGILARNLQ  412



>gb|ACB38748.1| chalcone synthase-like protein [Triticum aestivum]
 gb|EMT16036.1| Stilbene synthase 4 [Aegilops tauschii]
Length=390

 Score =   450 bits (1158),  Expect = 4e-151, Method: Compositional matrix adjust.
 Identities = 239/380 (63%), Positives = 294/380 (77%), Gaps = 13/380 (3%)
 Frame = +2

Query  203   KATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDV  382
             KA +LALGK  P Q++PQ+ LVE Y++DT CDD A + KLERLCKTTTV+TRYTVM K++
Sbjct  24    KAKLLALGKGLPEQVLPQEKLVETYLQDTSCDDPATRAKLERLCKTTTVRTRYTVMSKEL  83

Query  383   LDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIR  562
             LD+YPEL TEGSPT+  RL++ N AV+ +   A+ A + +WGRP  +ITH+VY+SSSE+R
Sbjct  84    LDEYPELKTEGSPTLTPRLDICNAAVLELGAAAARAALGEWGRPAADITHLVYISSSELR  143

Query  563   LPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTIL  742
             LPGGDL+LA  LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+  +ETT+L
Sbjct  144   LPGGDLFLATRLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVIAAETTVL  203

Query  743   GFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDG  922
             GFRPP+  RPYDLVGAALFGDGA+A I+GA+P ++ E+PF+EL F+ Q+FLPGT  VIDG
Sbjct  204   GFRPPSPDRPYDLVGAALFGDGASAAIIGASPIKAEEDPFLELEFSTQEFLPGTDKVIDG  263

Query  923   RISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNR  1102
             +ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N++FWAVHPGGPAILNR
Sbjct  264   KISEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIK----EFNDVFWAVHPGGPAILNR  319

Query  1103  LERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewg  1282
             LE  L L  +KL  SR+ALM++GNVSSNT+FYVLEY+RDEL    K+G         EWG
Sbjct  320   LEVCLELEPDKLKISRKALMNYGNVSSNTVFYVLEYLRDEL----KKG-----AIREEWG  370

Query  1283  lalaFGPGITFEGILLRNLQ  1342
             L LAFGPGITFEG+L+R + 
Sbjct  371   LILAFGPGITFEGMLVRGIN  390



>gb|ACJ22498.1| chalcone synthase [Triticum aestivum]
Length=422

 Score =   451 bits (1161),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 239/391 (61%), Positives = 281/391 (72%), Gaps = 11/391 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C D  +KEKL RLCKTTTVKTRY VM  +
Sbjct  27    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCKDPELKEKLTRLCKTTTVKTRYVVMSDE  86

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLACIK WG  +  ITH+VYVSSSE 
Sbjct  87    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACIKAWGGDLSAITHLVYVSSSEA  146

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  147   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  206

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VG +P +  E P  EL  A Q+FLP T+  ID
Sbjct  207   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDPTDQ-ERPLFELYSALQRFLPDTEKTID  265

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnn-------LTYNELFWAVHP  1078
             GR++EEGI F+LGR+LP  IE ++E FC+KLI +              LTY+++FWAVHP
Sbjct  266   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDHGEQLTYDKMFWAVHP  325

Query  1079  GGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeee  1258
             GGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   + +  + E 
Sbjct  326   GGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRTEAPEPEP  385

Query  1259  eegglew---glalaFGPGITFEGILLRNLQ  1342
             E  G +    GL LAFGPGITFEGIL RNLQ
Sbjct  386   EPEGGQECEWGLILAFGPGITFEGILARNLQ  416



>gb|EMS57002.1| Stilbene synthase 4 [Triticum urartu]
Length=390

 Score =   450 bits (1157),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 238/381 (62%), Positives = 295/381 (77%), Gaps = 13/381 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKA +LALGK  P Q++PQ+ LVE Y++DT CDD A + KLERLCKTTTV+TRYTVM K+
Sbjct  23    GKAKLLALGKGLPEQVLPQEKLVETYLQDTSCDDPATRAKLERLCKTTTVRTRYTVMSKE  82

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD++PEL TEG+PT+  RL++ N AV+ +   A+ A + +WGRP  +ITH+VY+SSSE+
Sbjct  83    LLDEHPELKTEGTPTLTPRLDICNAAVLELGAAAARAALGEWGRPAADITHLVYISSSEL  142

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDL+LA  LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+  +ETT+
Sbjct  143   RLPGGDLFLATRLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVIAAETTV  202

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             LGFRPP+  RPYDLVGAALFGDGA+A I+GA+P ++ E+PF+EL F+ Q+FLPGT  VID
Sbjct  203   LGFRPPSPDRPYDLVGAALFGDGASAAIIGASPIKAEEDPFLELEFSTQEFLPGTDKVID  262

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             G+ISEEGINFKLGRDLPEKIE+ IE FC+ L+ K         +N++FWAVHPGGPAILN
Sbjct  263   GKISEEGINFKLGRDLPEKIESRIEGFCRILMDKVGIK----EFNDVFWAVHPGGPAILN  318

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             RLE  L L  +KL  SR+ALM++GNVSSNT+FYVLEY+RDEL    K+G         EW
Sbjct  319   RLEVCLQLEPDKLKISRKALMNYGNVSSNTVFYVLEYLRDEL----KKG-----AIREEW  369

Query  1280  glalaFGPGITFEGILLRNLQ  1342
             GL LAFGPGITFEG+L+R + 
Sbjct  370   GLILAFGPGITFEGLLVRGIN  390



>ref|NP_001131211.1| uncharacterized protein LOC100192519 [Zea mays]
 gb|ACF79526.1| unknown [Zea mays]
Length=390

 Score =   449 bits (1154),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 236/382 (62%), Positives = 293/382 (77%), Gaps = 13/382 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK FP Q++PQ+ +   Y++++ CDD   + KLERLC TTTV+TRYTVM K
Sbjct  17    RGKAMLLALGKGFPDQVLPQEKVAASYLQESSCDDPDTRAKLERLCTTTTVRTRYTVMSK  76

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDK+PEL  EG+PT+  RL+V N AVI +   A+ A + +WGRP  +ITH++Y+SSSE
Sbjct  77    ELLDKHPELKMEGTPTLTPRLDVCNAAVIDLGAAAARAALHEWGRPAADITHLIYISSSE  136

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+T +ETT
Sbjct  137   LRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTAAETT  196

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+AVI+GA P    ENPF+EL F+ Q+FLPGT  VI
Sbjct  197   VLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMAPAENPFLELQFSTQEFLPGTDKVI  256

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  257   DGNISEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK----DFNDVFWAVHPGGPAIL  312

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    K+G         +
Sbjct  313   NRLEICLQLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----KKG-----TISED  363

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGL LAFGPGITFEG+L++ ++
Sbjct  364   WGLILAFGPGITFEGLLVQGVK  385



>ref|XP_004956033.1| PREDICTED: chalcone synthase 1-like [Setaria italica]
Length=409

 Score =   449 bits (1155),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 233/384 (61%), Positives = 283/384 (74%), Gaps = 4/384 (1%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++++T CDD  +KEKL RLCKTTTVKTRY VM  +
Sbjct  22    GKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVKTRYVVMSDE  81

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC++ WG  +  ITH+VYVSSSE 
Sbjct  82    ILKSYPELAQEGLPTMKQRLDISNKAVTQMATEASLACVRSWGGALSSITHLVYVSSSEA  141

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  +GL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  142   RFPGGDLHLARAMGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  201

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A +VGA+P    E P  EL  A Q FLPGT   I+
Sbjct  202   VGFRPPSADRPYDLVGVALFGDGAGAAVVGADPAPH-ERPLFELHSALQCFLPGTDKTIE  260

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIG--KAnnnnnnLTYNELFWAVHPGGPAI  1093
             GR++EEGI F+LGR+LP  IE ++E+FC+KL+   +       + Y+++FWAVHPGGPAI
Sbjct  261   GRLTEEGIKFQLGRELPHIIEAHVEEFCRKLMAEREGGGGEEEMGYDDMFWAVHPGGPAI  320

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L ++E  LGL  +KL  SR AL DFGN SSNTI YVLE M +E   ++      + +G  
Sbjct  321   LTKMEGRLGLGGDKLRASRCALRDFGNASSNTIVYVLENMVEETRRRKAAAAAGDSDGDD  380

Query  1274  -ewglalaFGPGITFEGILLRNLQ  1342
              EWGL LAFGPGITFEGIL RNLQ
Sbjct  381   CEWGLILAFGPGITFEGILARNLQ  404



>ref|XP_007131590.1| hypothetical protein PHAVU_011G026000g [Phaseolus vulgaris]
 gb|ESW03584.1| hypothetical protein PHAVU_011G026000g [Phaseolus vulgaris]
Length=376

 Score =   447 bits (1151),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 234/380 (62%), Positives = 278/380 (73%), Gaps = 23/380 (6%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALGKAFP QLV Q+ LV+GY R T CD+  +K+KL RLCKTTTVKTRY VM ++
Sbjct  18    GKATILALGKAFPPQLVMQEYLVDGYFRSTNCDNPELKQKLTRLCKTTTVKTRYVVMSEE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L KYPEL TEG+PT+ QRLE+ N AV  MA EA+L CIK+WG  + +ITH         
Sbjct  78    ILIKYPELVTEGTPTVKQRLEICNEAVTEMAIEAALGCIKNWGGALSDITH---------  128

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
                    +++  LGL  D  R+MLYF GC GGV GLRVAKDIAENNPGSRVLL TSETTI
Sbjct  129   -------FMSKGLGLSPDTQRIMLYFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTI  181

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GF+PP+  RPYDLVG ALFGDGA A+I+G++P    E P  EL  A Q+FLP T+  ID
Sbjct  182   IGFKPPSADRPYDLVGVALFGDGAGAMIIGSDPILEHEKPLFELHTAVQEFLPHTEKKID  241

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR++EEGI+FKL R+LP+ IE+N+E FC KL+  +     N  YN+LFWAVHPGGPAILN
Sbjct  242   GRLTEEGISFKLARELPQIIEDNVEGFCDKLM--SVVEFQNKEYNKLFWAVHPGGPAILN  299

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
             R+E+ L L  EKL  SRRALMD+GN SSNTI YVLEYM +E +  RK G+        EW
Sbjct  300   RIEKRLDLLPEKLSASRRALMDYGNASSNTIVYVLEYMIEEGLKTRKDGR-----EDPEW  354

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPGITFEGIL RNL
Sbjct  355   GLILAFGPGITFEGILARNL  374



>gb|AFW68541.1| hypothetical protein ZEAMMB73_283153 [Zea mays]
Length=421

 Score =   449 bits (1155),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 235/382 (62%), Positives = 293/382 (77%), Gaps = 13/382 (3%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK FP Q++PQ+ +   Y++++ CDD   + KLERLC TTTV+TRYTVM K
Sbjct  48    RGKAMLLALGKGFPDQVLPQEKVAASYLQESSCDDPDTRAKLERLCTTTTVRTRYTVMSK  107

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LDK+PEL  EG+PT+  RL++ N AVI +   A+ A + +WGRP  +ITH++Y+SSSE
Sbjct  108   ELLDKHPELKMEGTPTLTPRLDICNAAVIDLGAAAARAALHEWGRPAADITHLIYISSSE  167

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LAA LGL  +  R  L FLGC GG   LR AKDIAENNPGSRVL+T +ETT
Sbjct  168   LRLPGGDLHLAARLGLSPNTVRTSLLFLGCSGGAAALRTAKDIAENNPGSRVLVTAAETT  227

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+AVI+GA P    ENPF+EL F+ Q+FLPGT  VI
Sbjct  228   VLGFRPPSYDRPYDLVGAALFGDGASAVIIGAGPMAPAENPFLELQFSTQEFLPGTDKVI  287

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG ISEEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  288   DGNISEEGINFKLGRDLPEKIESRIEGFCRTLMNQVGIK----DFNDVFWAVHPGGPAIL  343

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             NRLE  L L+ EKL  SR+ALM++GNVSSNTIFYVLEY+RDEL    K+G         +
Sbjct  344   NRLEICLQLQPEKLKISRKALMNYGNVSSNTIFYVLEYLRDEL----KKG-----TISED  394

Query  1277  wglalaFGPGITFEGILLRNLQ  1342
             WGL LAFGPGITFEG+L++ ++
Sbjct  395   WGLILAFGPGITFEGLLVQGVK  416



>ref|XP_002461886.1| hypothetical protein SORBIDRAFT_02g009850 [Sorghum bicolor]
 gb|EER98407.1| hypothetical protein SORBIDRAFT_02g009850 [Sorghum bicolor]
Length=418

 Score =   449 bits (1154),  Expect = 4e-150, Method: Compositional matrix adjust.
 Identities = 232/387 (60%), Positives = 283/387 (73%), Gaps = 7/387 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++++T CDD  +KEKL RLCKTTTVKTRY VM ++
Sbjct  24    GKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVKTRYVVMSEE  83

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASL+C++ WG  +  ITH+VYVSSSE 
Sbjct  84    ILKNYPELAQEGLPTMKQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSSEA  143

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAEN-NPGSRVLLTTSETT  736
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+  PG+RVLL TSETT
Sbjct  144   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCGPGARVLLATSETT  203

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             I+GFRPP+  RPYDLVG ALFGDGA A ++G +P    E P  EL  A Q+FLP T+  I
Sbjct  204   IVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPG-ERPLFELHSALQRFLPDTEKTI  262

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnn-----nLTYNELFWAVHPG  1081
             +GR++EEGI F+LGR+LP  IE ++EDFC KL+ +     +      L+Y ++FWAVHPG
Sbjct  263   EGRLTEEGIKFQLGRELPHIIEAHVEDFCHKLMKEREEVGDDDRGPELSYGDMFWAVHPG  322

Query  1082  GPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeee  1261
             GPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M +E   ++       +
Sbjct  323   GPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVEETRRRKLLAAPAGD  382

Query  1262  egglewglalaFGPGITFEGILLRNLQ  1342
                 EWGL LAFGPGITFEGIL RNLQ
Sbjct  383   GEDCEWGLILAFGPGITFEGILARNLQ  409



>ref|XP_010933363.1| PREDICTED: chalcone synthase [Elaeis guineensis]
Length=360

 Score =   446 bits (1147),  Expect = 6e-150, Method: Compositional matrix adjust.
 Identities = 225/362 (62%), Positives = 276/362 (76%), Gaps = 5/362 (1%)
 Frame = +2

Query  254   QDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQ  433
             QD +V+GY  +TKC D  +K++L RLCKTTTVKTRY VM +++L  YPELATEG PT+ Q
Sbjct  2     QDFVVDGYFNNTKCHDPELKQRLTRLCKTTTVKTRYVVMSEEILRNYPELATEGLPTVKQ  61

Query  434   RLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSD  613
             RL+++N AV  MA EASL+CIK  GRP+  ITH+VYVSSSE R PGGDL+LA  LGL  D
Sbjct  62    RLDISNKAVTQMAIEASLSCIKALGRPLSCITHLVYVSSSEARFPGGDLHLALGLGLSPD  121

Query  614   VNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAA  793
             V R+ML F GC GGV GLRVAKD+AENNPGSRVLL TSETTI+GFRPP+  RPYDLVG A
Sbjct  122   VRRIMLSFTGCSGGVAGLRVAKDLAENNPGSRVLLATSETTIVGFRPPSADRPYDLVGVA  181

Query  794   LFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPE  973
             LFGDGA A ++G +P    E    EL  A Q++LPGT+  IDGR++EEGINF+LGR+LP+
Sbjct  182   LFGDGAGAAVLGVDPIPGAETALFELHSAVQRYLPGTEKTIDGRLTEEGINFQLGRELPQ  241

Query  974   KIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRR  1153
              IE+++E FCKK++ +      N  Y+E+FWAVHPGGPAIL+R+E  L L  EKL+ SR+
Sbjct  242   VIEDHVEGFCKKVMREGREGGENTKYDEMFWAVHPGGPAILSRVESRLELGPEKLNASRK  301

Query  1154  ALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLR  1333
             AL D+GN SSNTI YVLEYM +E   +R++G+        EWGL LAFGPG+TFEGIL R
Sbjct  302   ALRDYGNASSNTIVYVLEYMVEESRKRREKGE-----KDCEWGLILAFGPGVTFEGILAR  356

Query  1334  NL  1339
             NL
Sbjct  357   NL  358



>tpg|DAA60357.1| TPA: hypothetical protein ZEAMMB73_750242 [Zea mays]
Length=412

 Score =   446 bits (1148),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 287/388 (74%), Gaps = 9/388 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++++T CDD  +KEKL RLCKTTTV+TRY VM  +
Sbjct  18    GKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVRTRYVVMSDE  77

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASL+C++ WG  +  ITH+VYVSSSE 
Sbjct  78    ILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSSEA  137

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETTI
Sbjct  138   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTI  197

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A ++G +P  + E P  EL  A Q+FLP T+  I+
Sbjct  198   VGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTERTIE  256

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnn-------LTYNELFWAVHP  1078
             GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +        ++Y ++FWAVHP
Sbjct  257   GRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFWAVHP  316

Query  1079  GGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeee  1258
             GGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M ++   +R+    ++
Sbjct  317   GGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVED-TRRRRLLAADD  375

Query  1259  eegglewglalaFGPGITFEGILLRNLQ  1342
                  EWGL LAFGPGITFEGIL RNLQ
Sbjct  376   GGEDCEWGLILAFGPGITFEGILARNLQ  403



>ref|NP_001149508.1| chalcone synthase [Zea mays]
 gb|ACF88048.1| unknown [Zea mays]
 gb|ACG35664.1| chalcone synthase [Zea mays]
 gb|ACN27825.1| unknown [Zea mays]
 tpg|DAA60356.1| TPA: chalcone synthase [Zea mays]
Length=417

 Score =   447 bits (1149),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 287/388 (74%), Gaps = 9/388 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++++T CDD  +KEKL RLCKTTTV+TRY VM  +
Sbjct  23    GKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVRTRYVVMSDE  82

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASL+C++ WG  +  ITH+VYVSSSE 
Sbjct  83    ILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSSEA  142

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETTI
Sbjct  143   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTI  202

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A ++G +P  + E P  EL  A Q+FLP T+  I+
Sbjct  203   VGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTERTIE  261

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnn-------LTYNELFWAVHP  1078
             GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +        ++Y ++FWAVHP
Sbjct  262   GRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFWAVHP  321

Query  1079  GGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeee  1258
             GGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M ++   +R+    ++
Sbjct  322   GGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVED-TRRRRLLAADD  380

Query  1259  eegglewglalaFGPGITFEGILLRNLQ  1342
                  EWGL LAFGPGITFEGIL RNLQ
Sbjct  381   GGEDCEWGLILAFGPGITFEGILARNLQ  408



>tpg|DAA60355.1| TPA: chalcone synthase [Zea mays]
Length=427

 Score =   447 bits (1149),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 230/388 (59%), Positives = 287/388 (74%), Gaps = 9/388 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +V+G++++T CDD  +KEKL RLCKTTTV+TRY VM  +
Sbjct  33    GKATILALGHAFPQQLVMQDYVVDGFMKNTNCDDPELKEKLTRLCKTTTVRTRYVVMSDE  92

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASL+C++ WG  +  ITH+VYVSSSE 
Sbjct  93    ILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVSSSEA  152

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETTI
Sbjct  153   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTI  212

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +GFRPP+  RPYDLVG ALFGDGA A ++G +P  + E P  EL  A Q+FLP T+  I+
Sbjct  213   VGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTERTIE  271

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnn-------LTYNELFWAVHP  1078
             GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +        ++Y ++FWAVHP
Sbjct  272   GRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFWAVHP  331

Query  1079  GGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeee  1258
             GGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M ++   +R+    ++
Sbjct  332   GGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVED-TRRRRLLAADD  390

Query  1259  eegglewglalaFGPGITFEGILLRNLQ  1342
                  EWGL LAFGPGITFEGIL RNLQ
Sbjct  391   GGEDCEWGLILAFGPGITFEGILARNLQ  418



>ref|XP_003557301.2| PREDICTED: probable inorganic phosphate transporter 1-3 [Brachypodium 
distachyon]
Length=930

 Score =   462 bits (1190),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 242/388 (62%), Positives = 286/388 (74%), Gaps = 8/388 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATI+ALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM  +
Sbjct  542   GKATIVALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLTRLCKTTTVKTRYVVMSDE  601

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L +YPELA EG PT+ QRL+++N AV  MA EASL+CI+ WG  +  ITH+VYVSSSE 
Sbjct  602   ILGRYPELAQEGLPTMKQRLDISNKAVTQMATEASLSCIRSWGGALSSITHLVYVSSSEA  661

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  662   RFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKALAESCPGARVLLATSETTV  721

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A IV  +P   LE P  EL  A Q+FLPGT+  ID
Sbjct  722   AGFRPPSPDRPYDLVGVALFGDGAGAAIVCTDP-TPLERPLFELHSALQRFLPGTEKTID  780

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnnLTYNELFWAVHPGG  1084
             GR++EEGI F+LGR+LP  IE ++EDFC+KLI     G   + +  LTY+++FWAVHPGG
Sbjct  781   GRLTEEGIKFQLGRELPHIIEAHVEDFCQKLIKERDQGGDGHTHAQLTYDDMFWAVHPGG  840

Query  1085  PAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKR--KQGKeee  1258
             PAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   +R  +Q    E
Sbjct  841   PAILTKMEGRLGLDGAKLTASRSALRDFGNASSNTIVYVLENMVEESRRRRELQQAAGAE  900

Query  1259  eegglewglalaFGPGITFEGILLRNLQ  1342
                  EWGL LAFGPGITFEGIL RNLQ
Sbjct  901   GGQECEWGLILAFGPGITFEGILARNLQ  928



>emb|CAA62921.1| chalcone synthase-like [Oryza sativa Japonica Group]
Length=389

 Score =   444 bits (1141),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 228/385 (59%), Positives = 290/385 (75%), Gaps = 19/385 (5%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCK  376
             +GKA +LALGK  P Q++PQ+ +VE Y++DT C+D A + KLERLCKTTTV+TRYTVM K
Sbjct  21    RGKAMLLALGKGLPEQVLPQEKVVETYLQDTICNDPATRAKLERLCKTTTVRTRYTVMSK  80

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++LD++PEL TEG+PT+  RL++ N AV+ +   A+ A + +WGRP  +ITH+VY+SSSE
Sbjct  81    ELLDEHPELRTEGTPTLTPRLDICNAAVLELGATAARAALGEWGRPAVDITHLVYISSSE  140

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             +RLPGGDL+LA  LGL  +  R  L FLGC GG    R AKDIAENNPGSRVL+  +ETT
Sbjct  141   LRLPGGDLFLATRLGLHPNTVRTSLLFLGCSGGAAAFRTAKDIAENNPGSRVLVVAAETT  200

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             +LGFRPP+  RPYDLVGAALFGDGA+A I+GA P  + E+PF+EL F+ Q+FLPGT  VI
Sbjct  201   VLGFRPPSPDRPYDLVGAALFGDGASAAIIGAGPIAAEESPFLELQFSTQEFLPGTDKVI  260

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAIL  1096
             DG+I+EEGINFKLGRDLPEKIE+ IE FC+ L+ +         +N++FWAVHPGGPAIL
Sbjct  261   DGKITEEGINFKLGRDLPEKIESRIEGFCRTLMDRVGIK----EFNDVFWAVHPGGPAIL  316

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDEL---MMKRKQGKeeeeeg  1267
             NRLE    L+ EKL  SR+ALM++GNV SNT+FYVLEY+R EL   M++ + G       
Sbjct  317   NRLEVCFELQREKLKISRKALMNYGNVRSNTVFYVLEYLRAELKKGMIREEWG-------  369

Query  1268  glewglalaFGPGITFEGILLRNLQ  1342
                  L LAFGPGITFEG+L+R + 
Sbjct  370   -----LILAFGPGITFEGMLVRGIN  389



>ref|XP_009401221.1| PREDICTED: chalcone synthase [Musa acuminata subsp. malaccensis]
Length=361

 Score =   433 bits (1114),  Expect = 7e-145, Method: Compositional matrix adjust.
 Identities = 223/363 (61%), Positives = 272/363 (75%), Gaps = 6/363 (2%)
 Frame = +2

Query  254   QDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQ  433
             QD LV+GY R+T C D  +K+KL RLCKTTTVKTRY VMC ++L+ +PELA +G PT+ Q
Sbjct  2     QDLLVDGYFRNTNCTDPDLKKKLTRLCKTTTVKTRYLVMCDEILENHPELARDGQPTLRQ  61

Query  434   RLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSD  613
             RLE+++ AV  MA EAS +C+K WGRP   ITH+VYVSSSE R P GDL+LA  L L  D
Sbjct  62    RLEISHEAVTEMAIEASRSCVKAWGRPFAAITHLVYVSSSEARFPSGDLHLARALRLNPD  121

Query  614   VNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAA  793
             V+RVM+ F GC GGV GLRVAKDIAENNPGSRVLL TSETTI+GFRPPN  RPYDLVGAA
Sbjct  122   VSRVMISFAGCSGGVAGLRVAKDIAENNPGSRVLLATSETTIVGFRPPNPHRPYDLVGAA  181

Query  794   LFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPE  973
             LFGDGA AV++G +P    E P  ELS A QQ+LP T   I G ++EEGI+F LGR+LP 
Sbjct  182   LFGDGAGAVVLGTDPIPGTETPMFELSSAIQQYLPDTDKTIQGELTEEGISFLLGRELPL  241

Query  974   KIENNIEDFCKKLIGKAnn-nnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSR  1150
              IE+++E FCKKL  +     ++++ YN++FWA+HPGGPAILN++E  L L  +KL+ SR
Sbjct  242   VIEDHVEAFCKKLAMEGLRGESHDVNYNDMFWAMHPGGPAILNKVESRLRLCPDKLNASR  301

Query  1151  RALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILL  1330
             +AL DFGN SSNTI YVLE + +E   K++ G+        EWGL LAFGPGITFEGIL 
Sbjct  302   QALRDFGNASSNTIIYVLENIIEESRKKKESGE-----SDCEWGLILAFGPGITFEGILA  356

Query  1331  RNL  1339
             RNL
Sbjct  357   RNL  359



>ref|XP_001781520.1| predicted protein [Physcomitrella patens]
 gb|EDQ53700.1| predicted protein [Physcomitrella patens]
Length=418

 Score =   434 bits (1115),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 219/380 (58%), Positives = 282/380 (74%), Gaps = 6/380 (2%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GK TI+A+G+A P+     D L + YI++    D  ++ KL RLC+TTTVKTRY V+ K+
Sbjct  44    GKTTIMAIGRAVPANTTFNDGLADHYIQEFNLQDPVLQAKLRRLCETTTVKTRYLVVNKE  103

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +LD++PE   +G+ T++QRL +   AV  +  EA+ A IK+WGRP  EITH+VYVSSSEI
Sbjct  104   ILDEHPEFLVDGAATVSQRLAITGEAVTQLGHEAATAAIKEWGRPASEITHLVYVSSSEI  163

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             RLPGGDLYLA  LGL+SDVNRVMLY LGCYGG +G+RVAKD+AENNPGSRVLL TSE T+
Sbjct  164   RLPGGDLYLAQLLGLRSDVNRVMLYMLGCYGGASGIRVAKDLAENNPGSRVLLITSECTL  223

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G++  +  RPYDLVGAALFGDGAAA+I+G +P   LE  F EL +A Q F+PGT   ID
Sbjct  224   IGYKSLSPDRPYDLVGAALFGDGAAAMIMGKDPIPVLERAFFELDWAGQSFIPGTNKTID  283

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAILN  1099
             GR+SEEGI+FKLGR+LP+ IE+NI+ FC  ++ +A      L YN++FWAVHPGGPAILN
Sbjct  284   GRLSEEGISFKLGRELPKLIESNIQGFCDPILKRA----GGLKYNDIFWAVHPGGPAILN  339

Query  1100  RLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeegglew  1279
              +++ L L  EKL  +R+ L D+GN+SS+T  YVL+YMR +  +K K+   +      EW
Sbjct  340   AVQKQLDLAPEKLQTARQVLRDYGNISSSTCIYVLDYMRHQ-SLKLKEAN-DNVNTEPEW  397

Query  1280  glalaFGPGITFEGILLRNL  1339
             GL LAFGPG+T EG LLRNL
Sbjct  398   GLLLAFGPGVTIEGALLRNL  417



>ref|XP_006854881.1| hypothetical protein AMTR_s00182p00053650 [Amborella trichopoda]
 gb|ERN16348.1| hypothetical protein AMTR_s00182p00053650 [Amborella trichopoda]
Length=317

 Score =   418 bits (1074),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 216/324 (67%), Positives = 251/324 (77%), Gaps = 8/324 (2%)
 Frame = +2

Query  368   MCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVS  547
             M  ++L KYPELA EG PTI+QRL ++N AV  MA EAS ACIK+WGRPV +ITH+VYVS
Sbjct  1     MSDEILKKYPELALEGLPTISQRLSISNEAVTEMAIEASKACIKNWGRPVSDITHLVYVS  60

Query  548   SSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTS  727
             SSE RLPGGD+YLA  +GL  + NRVMLYF+GC GGV GLRVAKDIAENNPGSRVLL T+
Sbjct  61    SSEARLPGGDIYLARGIGLNPEANRVMLYFMGCSGGVAGLRVAKDIAENNPGSRVLLATT  120

Query  728   ETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQ  907
             ETTI+GF+PP+ +RPYDLVGAALFGDGA A+I+G NP E  E P  EL  A Q FLPGT+
Sbjct  121   ETTIIGFKPPSASRPYDLVGAALFGDGAGAMILGTNPIEG-EKPLFELHTAIQHFLPGTE  179

Query  908   SVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGP  1087
              +IDGR++EEGINFK+ RDLP+ IE+ IE FC KL+ K         YNE+FWAVHPGGP
Sbjct  180   KIIDGRLTEEGINFKIERDLPQIIEDYIEAFCLKLMQKVGLGEEG--YNEMFWAVHPGGP  237

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeg  1267
             AILNRLE+ L L  EKL  SRRALMD+GNVSSNTI YVLE+M +E +  R  G+      
Sbjct  238   AILNRLEKRLNLTPEKLVASRRALMDYGNVSSNTIVYVLEFMMEESLKMRDTGE-----R  292

Query  1268  glewglalaFGPGITFEGILLRNL  1339
               EWGL LAFGPGITFEGIL R+L
Sbjct  293   ENEWGLILAFGPGITFEGILARSL  316



>ref|XP_002985571.1| hypothetical protein SELMODRAFT_122361 [Selaginella moellendorffii]
 ref|XP_002987004.1| hypothetical protein SELMODRAFT_235157 [Selaginella moellendorffii]
 gb|EFJ11847.1| hypothetical protein SELMODRAFT_235157 [Selaginella moellendorffii]
 gb|EFJ13445.1| hypothetical protein SELMODRAFT_122361 [Selaginella moellendorffii]
Length=393

 Score =   419 bits (1078),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 216/381 (57%), Positives = 284/381 (75%), Gaps = 10/381 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKAT+LA GKA P  +V Q+ LV+GY RDTK ++ A+KEKL+RLCKTTTVKTRY VM K+
Sbjct  20    GKATLLAFGKALPDTVVKQEYLVDGYFRDTKVENAALKEKLQRLCKTTTVKTRYVVMSKE  79

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L+ +PE  T G+P+I QRLE+A  AV  M   A+   + +WGRP+ +ITH+VYVSSSE+
Sbjct  80    ILENHPEFYTPGTPSIRQRLEIAGEAVTKMGVAAATQALAEWGRPISDITHLVYVSSSEV  139

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
             R PGGDLYL+  LGL SD++RVMLY LGC GG  GLRV+KD+AENNPGSR+LL  S+TT+
Sbjct  140   RFPGGDLYLSKHLGLSSDISRVMLYMLGCCGGAGGLRVSKDLAENNPGSRILLVISDTTL  199

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
             +G+RPPN  RPYDLVGAALFGDGA+AV++GA+P  S ENP  EL  A+Q F+PG++  ID
Sbjct  200   IGWRPPNPQRPYDLVGAALFGDGASAVVIGADPLPS-ENPCYELVTASQCFVPGSEKTID  258

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKA-nnnnnnLTYNELFWAVHPGGPAIL  1096
             GR++E+GI F LGR+LP+ IE+ +E F + L+ ++       + Y+ LFWA+HPGGPAIL
Sbjct  259   GRLTEDGIIFSLGRELPQMIESEVEGFIQGLLKRSGRVEAGGVDYDRLFWAIHPGGPAIL  318

Query  1097  NRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggle  1276
             N  E+ L L  +KL CSR+ L D+GN++ +TI YVL+YMR        Q     ++   E
Sbjct  319   NACEKKLQLAGDKLKCSRQVLSDYGNINGSTIIYVLDYMR--------QVNAAADKPDPE  370

Query  1277  wglalaFGPGITFEGILLRNL  1339
             WG+ LAFGPG+T EG++ RNL
Sbjct  371   WGVILAFGPGVTMEGMVARNL  391



>gb|EMT21347.1| hypothetical protein F775_52323 [Aegilops tauschii]
Length=401

 Score =   404 bits (1038),  Expect = 7e-133, Method: Compositional matrix adjust.
 Identities = 223/389 (57%), Positives = 266/389 (68%), Gaps = 30/389 (8%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLCKTTTVKTRYTVMCKD  379
             GKATILALG AFP QLV QD +VEG++R+T C+D  +KEKL RLCKTTTVKTRY VM  +
Sbjct  29    GKATILALGHAFPQQLVMQDYVVEGFMRNTNCNDPELKEKLARLCKTTTVKTRYVVMSDE  88

Query  380   VLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSEI  559
             +L  YPELA EG PT+ QRL+++N AV  MA EASLAC+K               +S  +
Sbjct  89    ILKSYPELAQEGWPTMKQRLDISNKAVTQMATEASLACVK---------------ASRRV  133

Query  560   RLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETTI  739
                   L+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TSETT+
Sbjct  134   ------LHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATSETTV  187

Query  740   LGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVID  919
              GFRPP+  RPYDLVG ALFGDGA A +VG +P   LE P  EL  A Q+FLP T+  ID
Sbjct  188   AGFRPPSPDRPYDLVGVALFGDGAGAAVVGTDP-TPLERPLFELHSALQRFLPDTEKTID  246

Query  920   GRISEEGINFKLGRDLPEKIENNIEDFCKKLI-----GKAnnnnnnLTYNELFWAVHPGG  1084
             GR++EEGI F+LGR+LP  IE ++E FC+KLI       A   +N LTY+++FWAVHPGG
Sbjct  247   GRLTEEGIKFQLGRELPHIIEAHVESFCQKLIKEHPAAAAAEGDNMLTYDKMFWAVHPGG  306

Query  1085  PAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeee  1264
             PAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE M +E   + +  + E E 
Sbjct  307   PAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLENMVEESRQRAEAPEPEPEP  366

Query  1265  gglewgl---alaFGPGITFEGILLRNLQ  1342
              G +       LAFGPGITFEGIL RNLQ
Sbjct  367   EGGQECEWGLILAFGPGITFEGILARNLQ  395



>ref|XP_010466554.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=277

 Score =   369 bits (946),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 191/264 (72%), Positives = 228/264 (86%), Gaps = 9/264 (3%)
 Frame = +2

Query  548   SSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTS  727
             + E RLPGGDLYL+A+LGL ++V RVMLYFLGCYGG++GLRVAKDIAENNPGSRVLLTTS
Sbjct  23    ACEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNPGSRVLLTTS  82

Query  728   ETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQ  907
             ETT+LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL  A QQFLPGTQ
Sbjct  83    ETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHCALQQFLPGTQ  141

Query  908   SVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGP  1087
              VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ KA + +  L +N+LFWAVHPGGP
Sbjct  142   GVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAKAGSGSGLLDFNDLFWAVHPGGP  201

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeg  1267
             AIL+ +E  L L+ EKL+CSRRALMD+GNVSSNTIFY++E +++EL  K  +G+      
Sbjct  202   AILSGIETKLKLKPEKLECSRRALMDYGNVSSNTIFYIMEKVKEELEKKGTEGE------  255

Query  1268  glewglalaFGPGITFEGILLRNL  1339
               EWGL LAFGPGITFEG L+R+L
Sbjct  256   --EWGLGLAFGPGITFEGFLMRSL  277



>gb|EAZ39507.1| hypothetical protein OsJ_23944 [Oryza sativa Japonica Group]
Length=410

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 215/405 (53%), Positives = 258/405 (64%), Gaps = 47/405 (12%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLAIKEKLERLC---------------  334
             GKATILALG AFP QLV QD +V+G++R+T CDD  +KEKL RLC               
Sbjct  22    GKATILALGHAFPQQLVMQDYVVDGFMRNTNCDDPELKEKLTRLCTVPDPNLIICSYKYI  81

Query  335   ---------KTTTVKTRYTVMCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASL  487
                      KTTTVKTRY VM +++L  YPELA EG PT+ QRL+++N AV  MA EASL
Sbjct  82    YSTIIELACKTTTVKTRYVVMSEEILKSYPELAQEGQPTMKQRLDISNKAVTQMATEASL  141

Query  488   ACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGL  667
             AC++ WG  + EITH+VYVSSSE R PGGDL+LA  LGL  DV RVML F GC GGV GL
Sbjct  142   ACVRSWGGALSEITHLVYVSSSEARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGL  201

Query  668   RVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRES  847
             RVAK +AE+ P      T+S +                           A +VGA+P   
Sbjct  202   RVAKGLAESCPAPTAPTTSSASPSSATA-------------------PGAAVVGADP-TP  241

Query  848   LENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAn  1027
             +E P  EL  A Q+FLP T   IDGR++EEGI F+LGR+LP  IE N+E FC+KL+ +  
Sbjct  242   VERPLFELHSALQRFLPDTDKTIDGRLTEEGIKFQLGRELPHIIEANVEAFCQKLMQEHP  301

Query  1028  nnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLE  1207
                + LTY ++FWAVHPGGPAIL ++E  LGL   KL  SR AL DFGN SSNTI YVLE
Sbjct  302   QAADKLTYGDMFWAVHPGGPAILTKMEGRLGLDGGKLRASRSALRDFGNASSNTIVYVLE  361

Query  1208  YMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNLQ  1342
              M +E    R++ +E  EE   EWGL LAFGPGITFEGIL RNLQ
Sbjct  362   NMVEE---TRQRREEAAEEEDCEWGLILAFGPGITFEGILARNLQ  403



>gb|ACN35784.1| unknown [Zea mays]
Length=339

 Score =   365 bits (937),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 191/332 (58%), Positives = 240/332 (72%), Gaps = 9/332 (3%)
 Frame = +2

Query  368   MCKDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVS  547
             M  ++L  YPELA EG PT+ QRL+++N AV  MA EASL+C++ WG  +  ITH+VYVS
Sbjct  1     MSDEILKNYPELAQEGLPTMNQRLDISNAAVTQMATEASLSCVRSWGGALSSITHLVYVS  60

Query  548   SSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTS  727
             SSE R PGGDL+LA  LGL  DV RVML F GC GGV GLRVAK +AE+ PG+RVLL TS
Sbjct  61    SSEARFPGGDLHLARALGLSPDVRRVMLAFTGCSGGVAGLRVAKGLAESCPGARVLLATS  120

Query  728   ETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQ  907
             ETTI+GFRPP+  RPYDLVG ALFGDGA A ++G +P  + E P  EL  A Q+FLP T+
Sbjct  121   ETTIVGFRPPSPDRPYDLVGVALFGDGAGAAVIGTDPAPA-ERPLFELHSALQRFLPDTE  179

Query  908   SVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnn-------LTYNELFW  1066
               I+GR++EEGI F+LGR+LP  IE ++EDFC+KL+ +  +  +        ++Y ++FW
Sbjct  180   RTIEGRLTEEGIKFQLGRELPHIIEAHVEDFCQKLMKERQSGEDADGGGPEPMSYGDMFW  239

Query  1067  AVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQG  1246
             AVHPGGPAIL ++E  LGL ++KL  SR AL DFGN SSNTI YVLE M ++   +R+  
Sbjct  240   AVHPGGPAILTKMEGRLGLGADKLRASRCALRDFGNASSNTIVYVLENMVED-TRRRRLL  298

Query  1247  KeeeeegglewglalaFGPGITFEGILLRNLQ  1342
               ++     EWGL LAFGPGITFEGIL RNLQ
Sbjct  299   AADDGGEDCEWGLILAFGPGITFEGILARNLQ  330



>ref|XP_010462511.1| PREDICTED: chalcone synthase-like [Camelina sativa]
Length=242

 Score =   354 bits (908),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 193/291 (66%), Positives = 221/291 (76%), Gaps = 52/291 (18%)
 Frame = +2

Query  467   MAKEASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGC  646
             MA EA+L CIK WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGC
Sbjct  1     MALEANLGCIKQWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGC  60

Query  647   YGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIV  826
             YGGVTGL +AKDIAENNPGSRVLLTTSETTILGFRPPNKAR YDLVGAALFGDGAAAVI+
Sbjct  61    YGGVTGLCMAKDIAENNPGSRVLLTTSETTILGFRPPNKARSYDLVGAALFGDGAAAVII  120

Query  827   GANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCK  1006
             GANP+E  E PFMEL +A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCK
Sbjct  121   GANPKEC-EAPFMELHYAVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCK  179

Query  1007  KLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSN  1186
             KL+GKA + +                                         M+F ++  N
Sbjct  180   KLMGKAGDES-----------------------------------------MEFNDI--N  196

Query  1187  TIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             TI YV+EYMRDEL   +K+G+        EWGL LAFGPGITFEG+L+R+L
Sbjct  197   TILYVMEYMRDEL---KKKGE-----AAQEWGLGLAFGPGITFEGLLIRSL  239



>gb|AEN80624.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80625.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80626.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80627.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80628.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80629.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80630.1| AT1G02050-like protein, partial [Capsella rubella]
 gb|AEN80631.1| AT1G02050-like protein, partial [Capsella rubella]
Length=185

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 175/182 (96%), Gaps = 1/182 (1%)
 Frame = +2

Query  479   ASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGV  658
             ASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGLK+DVNRVMLYFLGCYGGV
Sbjct  1     ASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLKNDVNRVMLYFLGCYGGV  60

Query  659   TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANP  838
             TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P
Sbjct  61    TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP  120

Query  839   RESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIG  1018
             +E  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+G
Sbjct  121   KEC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMG  179

Query  1019  KA  1024
             KA
Sbjct  180   KA  181



>gb|ADG37724.1| AT1G02050-like protein [Capsella grandiflora]
 gb|ADG37725.1| AT1G02050-like protein [Capsella grandiflora]
 gb|ADG37726.1| AT1G02050-like protein [Capsella grandiflora]
 gb|ADG37728.1| AT1G02050-like protein [Capsella grandiflora]
 gb|ADG37729.1| AT1G02050-like protein [Capsella grandiflora]
Length=180

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 174/181 (96%), Gaps = 1/181 (1%)
 Frame = +2

Query  479   ASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGV  658
             ASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGLK+DVNRVMLYFLGCYGGV
Sbjct  1     ASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLKNDVNRVMLYFLGCYGGV  60

Query  659   TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANP  838
             TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P
Sbjct  61    TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP  120

Query  839   RESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIG  1018
             +E  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+G
Sbjct  121   KEC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMG  179

Query  1019  K  1021
             K
Sbjct  180   K  180



>gb|ADG37730.1| AT1G02050-like protein [Neslia paniculata]
Length=180

 Score =   331 bits (849),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = +2

Query  479   ASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGV  658
             ASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGL++DVNRVMLYFLGCYGGV
Sbjct  1     ASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLRNDVNRVMLYFLGCYGGV  60

Query  659   TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANP  838
             TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P
Sbjct  61    TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP  120

Query  839   RESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIG  1018
             +E  E PFMEL +A QQFLPGTQSVIDGR++EEGINFKLGRDLP+KIE NIE FCKKL+G
Sbjct  121   KEC-EAPFMELHYAVQQFLPGTQSVIDGRLTEEGINFKLGRDLPQKIEENIEGFCKKLMG  179

Query  1019  K  1021
             K
Sbjct  180   K  180



>gb|ADG38688.1| AT4G00040-like protein [Neslia paniculata]
Length=204

 Score =   331 bits (848),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  521   EITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNP  700
             +ITH+VYVSSSE RLPGGDLYL+A+LGL ++V RVMLYFLGCYGG++GLRVAKDIAENNP
Sbjct  1     DITHLVYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGLSGLRVAKDIAENNP  60

Query  701   GSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFA  880
             GSRVLLTTSETT+LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PFMEL  A
Sbjct  61    GSRVLLTTSETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFMELHCA  119

Query  881   AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNEL  1060
              QQFLPGTQ VIDGR+SEEGI+FKLGRDLP+KIE N+E+FCKKL+ KA + +  L  N+L
Sbjct  120   LQQFLPGTQGVIDGRLSEEGISFKLGRDLPQKIEENVEEFCKKLVAKAGSGSGLLDLNDL  179

Query  1061  FWAVHPGGPAILNRLERTLGLRSEK  1135
             FWAVHPGGPAIL+ LE  L L+ EK
Sbjct  180   FWAVHPGGPAILSGLETKLKLKPEK  204



>gb|ADG37727.1| AT1G02050-like protein [Capsella grandiflora]
Length=180

 Score =   329 bits (843),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = +2

Query  479   ASLACIKDWGRPVEEITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGV  658
             ASL CIK+WGRPVE+ITH+VYVSSSEIRLPGGDLYL+A+LGLK+DVNRVMLYFLGCYGGV
Sbjct  1     ASLGCIKEWGRPVEDITHIVYVSSSEIRLPGGDLYLSAKLGLKNDVNRVMLYFLGCYGGV  60

Query  659   TGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANP  838
             TGLRVAKDIAENN GSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVI+GA+P
Sbjct  61    TGLRVAKDIAENNXGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIIGADP  120

Query  839   RESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIG  1018
             +E  E PFMEL +A QQFLPGTQ+VIDGR++EEGINFKLGRDLP+KIE NIE+FCKKL+G
Sbjct  121   KEC-EAPFMELHYAVQQFLPGTQNVIDGRLTEEGINFKLGRDLPQKIEENIEEFCKKLMG  179

Query  1019  K  1021
             K
Sbjct  180   K  180



>gb|ADG38683.1| AT4G00040-like protein [Capsella grandiflora]
 gb|ADG38684.1| AT4G00040-like protein [Capsella grandiflora]
 gb|ADG38686.1| AT4G00040-like protein [Capsella grandiflora]
 gb|ADG38687.1| AT4G00040-like protein [Capsella grandiflora]
Length=204

 Score =   328 bits (841),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 184/205 (90%), Gaps = 1/205 (0%)
 Frame = +2

Query  521   EITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNP  700
             +ITH+VYVSSSE RLPGGDLYL+A+LGL ++V RVMLYFLGCYGGV+GLRVAKDIAENNP
Sbjct  1     DITHLVYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGVSGLRVAKDIAENNP  60

Query  701   GSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFA  880
             GSRVLLTTSETT+LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF+EL  A
Sbjct  61    GSRVLLTTSETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFVELHCA  119

Query  881   AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNEL  1060
              QQFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ +A + + +L  N+L
Sbjct  120   MQQFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELNDL  179

Query  1061  FWAVHPGGPAILNRLERTLGLRSEK  1135
             FWAVHPGGPAIL+ LE  L L+ EK
Sbjct  180   FWAVHPGGPAILSGLETKLKLKPEK  204



>gb|ADG38685.1| AT4G00040-like protein [Capsella grandiflora]
Length=204

 Score =   327 bits (837),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/205 (77%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = +2

Query  521   EITHVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNP  700
             +ITH+VYVSSSE RLPGGDLYL+A+LGL ++V RVMLYFLGCYGGV+GLRVAKDIAENNP
Sbjct  1     DITHLVYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGVSGLRVAKDIAENNP  60

Query  701   GSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFA  880
             GSRVLLTTSETT+LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF EL  A
Sbjct  61    GSRVLLTTSETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFXELHCA  119

Query  881   AQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNEL  1060
              QQFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E FCKKL+ +A + + +L  N+L
Sbjct  120   MQQFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEXFCKKLVAEAGSGSGSLELNDL  179

Query  1061  FWAVHPGGPAILNRLERTLGLRSEK  1135
             FWAVHPGGPAIL+ LE  L L+ EK
Sbjct  180   FWAVHPGGPAILSGLETKLKLKPEK  204



>gb|AEN82337.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82338.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82339.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82340.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82341.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82342.1| AT4G00040-like protein, partial [Capsella rubella]
 gb|AEN82343.1| AT4G00040-like protein, partial [Capsella rubella]
Length=202

 Score =   326 bits (836),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +2

Query  527   THVVYVSSSEIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGS  706
             TH+VYVSSSE RLPGGDLYL+A+LGL ++V RVMLYFLGCYGGV+GLRVAKDIAENNPGS
Sbjct  1     THLVYVSSSEFRLPGGDLYLSAQLGLSNEVQRVMLYFLGCYGGVSGLRVAKDIAENNPGS  60

Query  707   RVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQ  886
             RVLLTTSETT+LGFRPPNKARPYDLVGAALFGDGAAA+I+GA+P ES E+PF+EL  A Q
Sbjct  61    RVLLTTSETTVLGFRPPNKARPYDLVGAALFGDGAAALIIGADPTES-ESPFVELHCAMQ  119

Query  887   QFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFW  1066
             QFLPGT  VIDGR+SEEGI+FKLGRDLP+KIE+N+E+FCKKL+ +A + + +L  N+LFW
Sbjct  120   QFLPGTHGVIDGRLSEEGISFKLGRDLPQKIEDNVEEFCKKLVAEAGSGSGSLELNDLFW  179

Query  1067  AVHPGGPAILNRLERTLGLRSEK  1135
             AVHPGGPAIL+ LE  L L+ EK
Sbjct  180   AVHPGGPAILSGLETKLKLKPEK  202



>gb|AAB23817.1| chalcone synthase homolog {C-terminal} [Brassica napus, cv. Westar, 
Peptide Partial, 222 aa]
Length=222

 Score =   324 bits (831),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 167/233 (72%), Positives = 199/233 (85%), Gaps = 11/233 (5%)
 Frame = +2

Query  641   GCYGGVTGLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAV  820
             GCYGGV+G+RVAKDIAENNPGSRVLLTTSET +LGFRPPNKARPYDLVGAALFGDGAAA+
Sbjct  1     GCYGGVSGMRVAKDIAENNPGSRVLLTTSETMVLGFRPPNKARPYDLVGAALFGDGAAAL  60

Query  821   IVGANPRESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDF  1000
             I+GA+P ES E+PFMEL +A QQFLPGTQ+VIDGR+SEEGI+FKLGR+LP+KIE+NIE+F
Sbjct  61    IIGADPTES-ESPFMELHYALQQFLPGTQAVIDGRLSEEGISFKLGRELPQKIEDNIEEF  119

Query  1001  CKKLIGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVS  1180
             CKKL+ KA   + +L  N+LFWAVHP GPAILN LE  L L+ EKL+CSR+AL+D+GN S
Sbjct  120   CKKLVAKA--GSGSLELNDLFWAVHPCGPAILNGLETKLKLKPEKLECSRQALVDYGNAS  177

Query  1181  SNTIFYVLEYMRDELMMKRKQGKeeeeegglewglalaFGPGITFEGILLRNL  1339
             SNTIFY+++ +RDEL  K + G+        EWGL LAFGPGITFEG L+R+L
Sbjct  178   SNTIFYIMDKVRDELEKKGRSGE--------EWGLGLAFGPGITFEGFLMRSL  222



>gb|AGR67381.1| chalcone synthase-like protein, partial [Citrus reshni]
Length=191

 Score =   308 bits (789),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/196 (79%), Positives = 174/196 (89%), Gaps = 11/196 (6%)
 Frame = +2

Query  662   GLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKARPYDLVGAALFGDGAAAVIVGANP-  838
             GLRVAKDIAENNPGSRVLLTTSETTILGFRPPNK+RPYDLVGAALFGDGAAAVIVGA+P 
Sbjct  1     GLRVAKDIAENNPGSRVLLTTSETTILGFRPPNKSRPYDLVGAALFGDGAAAVIVGADPF  60

Query  839   --RESLENPFMELSFAAQQFLPGTQSVIDGRISEEGINFKLGRDLPEKIENNIEDFCKKL  1012
               +ES  +PFMEL++A QQFLPGTQ+VIDGR+SEEGINFKLGRDLP+KIE NIE+FCKKL
Sbjct  61    LDKES--SPFMELNYAVQQFLPGTQNVIDGRLSEEGINFKLGRDLPQKIEENIEEFCKKL  118

Query  1013  IGKAnnnnnnLTYNELFWAVHPGGPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTI  1192
             + KA        +N+LFWAVHPGGPAILNRLE  L L ++KL+CSRRALMD+GNVSSNTI
Sbjct  119   MAKAGLQ----DFNDLFWAVHPGGPAILNRLESNLKLNNQKLECSRRALMDYGNVSSNTI  174

Query  1193  FYVLEYMRDELMMKRK  1240
             FYV++YMR+EL  KRK
Sbjct  175   FYVMDYMREEL--KRK  188



>gb|AHY39238.1| stilbenecarboxylate synthase 2 [Plagiochasma appendiculatum]
Length=411

 Score =   299 bits (766),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 165/384 (43%), Positives = 233/384 (61%), Gaps = 15/384 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDL-AIKEKLERLCKTTTVKTRYTVMCK  376
             G AT+LA+GKA P  +  Q    + +   TKC+D   +K K +R+C  + +K R+  + +
Sbjct  31    GPATVLAMGKAVPHNVFEQATYPDFFFNITKCNDKPTLKAKFQRICDKSGIKKRHFYLDQ  90

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
              +L+  P + T    ++  R E+A   V  +AKEA+   IK+WGRP  EITH+V  ++S 
Sbjct  91    KILESSPSMCTYMETSLNCRQEIAIAQVPKLAKEAAQVAIKEWGRPKSEITHIVMATTSG  150

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             + +PG +L  A  LGL+ +V RVM+Y  GC+ G T LRVAKD+AENN G+RVL   SE T
Sbjct  151   VNMPGAELATAKLLGLRPNVRRVMMYQQGCFAGATVLRVAKDLAENNAGARVLAICSEVT  210

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
              + FR P +     LVG+ALFGDGAAAVIVGA+PR  +E P  E+ +A +  LP +   I
Sbjct  211   AVTFRAPCETHIDGLVGSALFGDGAAAVIVGADPRPEIERPMFEMHWAGEMVLPESDGAI  270

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDF---CKKLIGKAnnnnnnLTYNELFWAVHPGGP  1087
             DG ++E G+ F L +D+P  I  NI  F    K L+G +       T+N+LFWAVHPGGP
Sbjct  271   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS-------TWNDLFWAVHPGGP  323

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeg  1267
             AIL+++E  L L   K   SR  L D+GN+SS ++ +VL+ +R+  +   K         
Sbjct  324   AILDQVEAKLELEKNKFQASRDILADYGNMSSASVLFVLDRVRERSLESNK----YTFGE  379

Query  1268  glewglalaFGPGITFEGILLRNL  1339
             G EWG  + FGPG+T E +LLR L
Sbjct  380   GSEWGFLIGFGPGLTVETLLLRAL  403



>gb|AIV42295.1| chalcone synthase [Plagiochasma appendiculatum]
Length=411

 Score =   299 bits (765),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 165/384 (43%), Positives = 233/384 (61%), Gaps = 15/384 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDL-AIKEKLERLCKTTTVKTRYTVMCK  376
             G AT+LA+GKA P  +  Q    + +   TKC+D   +K K +R+C  + +K R+  + +
Sbjct  31    GPATVLAMGKAVPHNVFEQATYPDFFFNITKCNDKPTLKAKFQRICDKSGIKKRHFYLDQ  90

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
              +L+  P + T    ++  R E+A   V  +AKEA+   IK+WGRP  EITH+V  ++S 
Sbjct  91    KILESNPSMCTYMETSLNCRQEIAIAHVPKLAKEAAQVAIKEWGRPKSEITHIVMATTSG  150

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             + +PG +L  A  LGL+ +V RVM+Y  GC+ G T LRVAKD+AENN G+RVL   SE T
Sbjct  151   VNMPGAELATAKLLGLRPNVRRVMMYQQGCFAGATVLRVAKDLAENNAGARVLAICSEVT  210

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
              + FR P +     LVG+ALFGDGAAAVIVGA+PR  +E P  E+ +A +  LP +   I
Sbjct  211   AVTFRAPCETHIDGLVGSALFGDGAAAVIVGADPRPEIERPMFEMHWAGEMVLPESDGAI  270

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDF---CKKLIGKAnnnnnnLTYNELFWAVHPGGP  1087
             DG ++E G+ F L +D+P  I  NI  F    K L+G +       T+N+LFWAVHPGGP
Sbjct  271   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS-------TWNDLFWAVHPGGP  323

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeg  1267
             AIL+++E  L L   K   SR  L D+GN+SS ++ +VL+ +R+  +   K         
Sbjct  324   AILDQVEAKLELEKNKFQASRDILADYGNMSSASVLFVLDRVRERSLESNK----YTFGE  379

Query  1268  glewglalaFGPGITFEGILLRNL  1339
             G EWG  + FGPG+T E +LLR L
Sbjct  380   GSEWGFLIGFGPGLTVETLLLRAL  403



>gb|AAW30010.1| stilbenecarboxylate synthase 2 [Marchantia polymorpha]
Length=392

 Score =   298 bits (762),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 164/384 (43%), Positives = 235/384 (61%), Gaps = 15/384 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDL-AIKEKLERLCKTTTVKTRYTVMCK  376
             G AT+LA+GKA P+ +  Q    + +   T  +D  A+K K +R+C  + +K R+  + +
Sbjct  12    GPATVLAMGKAVPANVFEQATYPDFFFNITNSNDKPALKAKFQRICDKSGIKKRHFYLDQ  71

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
              +L+  P + T    ++  R E+A   V  +AKEAS+  IK+WGRP  EITH+V  ++S 
Sbjct  72    KILESNPAMCTYMETSLNCRQEIAVAQVPKLAKEASMNAIKEWGRPKSEITHIVMATTSG  131

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             + +PG +L  A  LGL+ +V RVM+Y  GC+ G T LRVAKD+AENN G+RVL   SE T
Sbjct  132   VNMPGAELATAKLLGLRPNVRRVMMYQQGCFAGATVLRVAKDLAENNAGARVLAICSEVT  191

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
              + FR P++     LVG+ALFGDGAAAVIVG++PR  +E P  E+ +A +  LP +   I
Sbjct  192   AVTFRAPSETHIDGLVGSALFGDGAAAVIVGSDPRPGIERPIYEMHWAGEMVLPESDGAI  251

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDF---CKKLIGKAnnnnnnLTYNELFWAVHPGGP  1087
             DG ++E G+ F L +D+P  I  NI  F    K L+G +       ++NELFWAVHPGGP
Sbjct  252   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS-------SWNELFWAVHPGGP  304

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeg  1267
             AIL+++E  L L   K   SR  L D+GN+SS ++ +VL+ +R+  +   K         
Sbjct  305   AILDQVEAKLELEKGKFQASRDILSDYGNMSSASVLFVLDRVRERSLESNKS----TFGE  360

Query  1268  glewglalaFGPGITFEGILLRNL  1339
             G EWG  + FGPG+T E +LLR L
Sbjct  361   GSEWGFLIGFGPGLTVETLLLRAL  384



>ref|XP_002271371.1| PREDICTED: stilbene synthase 2 [Vitis vinifera]
Length=392

 Score =   295 bits (754),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C+ + +K RY  + 
Sbjct  14    KGPATILAIGTATPDNCVYQSDYADYYFRVTKSEHMTDLKKKFNRICEKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNMGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETHLDSLVGQALFGDGSAAVIVGSDPDTSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A        +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFGPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR + + + +         GL
Sbjct  310   LDAIEAKLNLEKKKLEATRHILSEYGNMSSACVLFILDEMRKKSLKEER----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>gb|AFN21537.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATVLAIGAATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P+      LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSGTALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW VHPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPIGISDWNSLFWIVHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL  +R  L ++GN+SS  + ++L+ MR + + + K         GL
Sbjct  310   LDAVEAKLSLDKQKLKATRHVLSEYGNMSSACVLFILDEMRKKSLKEEK----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++LR++
Sbjct  366   DWGVLFGFGPGLTIETVVLRSI  387



>gb|AFN21530.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   294 bits (753),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C+ + +K RY  + 
Sbjct  14    KGPATILAIGTATPDNCVYQSDYADYYFRVTKSEHMTDLKKKFNRICEKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNMGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETHLDSLVGQALFGDGSAAVIVGSDPDTSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A        +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFGPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR + + + +         GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHILSEYGNMSSACVLFILDEMRKKSLKEER----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>ref|XP_010662505.1| PREDICTED: stilbene synthase 4-like [Vitis vinifera]
Length=392

 Score =   294 bits (752),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 237/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY+ + 
Sbjct  14    KGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYSHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETALDSLVGQALFGDGSAAVIVGSDPNLSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPIGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL  +R  L ++GN+SS  + ++++ MR + + + K         GL
Sbjct  310   LDAVEAKLSLDKQKLKATRHVLSEYGNMSSACVLFIMDEMRKKSLKEEK----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++LR++
Sbjct  366   DWGVLFGFGPGLTIETVVLRSI  387



>ref|XP_002263722.1| PREDICTED: stilbene synthase 3 [Vitis vinifera]
Length=392

 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTKAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSSKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|ABJ97068.1| stilbene synthase [Vitis vinifera]
Length=392

 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 158/382 (41%), Positives = 234/382 (61%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  IK+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKAIKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTKAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G+      GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGERATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
              WG+   FGPG+T E ++L ++
Sbjct  366   NWGVLFGFGPGLTIETVVLHSI  387



>ref|XP_002272129.2| PREDICTED: stilbene synthase 2-like [Vitis vinifera]
Length=392

 Score =   293 bits (751),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 237/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C+ + +K RY  + 
Sbjct  14    KGPATILAIGTATPDNCVYQSDYADYYFRVTKSEHMTDLKKKFNRICEKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNMGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGVDYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETHLDSLVGQALFGDGSAAVIVGSDPDTSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR + + + +         GL
Sbjct  310   LDAIEAKLNLEKKKLEATRHILSEYGNMSSACVLFILDEMRKKSLKEER----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>ref|XP_009393403.1| PREDICTED: chalcone synthase 6-4-like [Musa acuminata subsp. 
malaccensis]
Length=429

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 165/382 (43%), Positives = 229/382 (60%), Gaps = 10/382 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDD-LAIKEKLERLCKTTTVKTRYTVMCK  376
             G A I+A+G A P  ++ Q    + Y R T  +D   +KEK + +C  TTVK RY  + +
Sbjct  54    GPAAIMAIGTANPPNVIDQVNFADFYFRMTSSEDKQELKEKFKLICDRTTVKNRYAHLTE  113

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             +++++ P L    +P++  RL +   AV  + KEA+   +K+WG+P   ITH+V+ S + 
Sbjct  114   EIVEQNPNLRNPTAPSLETRLRIMIEAVPNLGKEAAAKALKEWGQPKSMITHLVFCSGAG  173

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSE-T  733
             + +PG D  L   LGL   V RVMLY LGCYGG T LRVAKD+AENN G+RVL+   E T
Sbjct  174   VDMPGADYQLVKLLGLSPSVKRVMLYHLGCYGGGTVLRVAKDLAENNRGARVLVVNVEIT  233

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T+  FR P++A    LVG ALFGDGAAA+IVGA+P + +E P  E++ A Q  LP ++  
Sbjct  234   TVSAFRAPDEAHLDSLVGQALFGDGAAALIVGADPIQGVEKPIFEMAIATQTLLPESEGK  293

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G++ E G+   L RD+P+ I  NIED     +  A        +N LFW  HPGGPAI
Sbjct  294   IGGQLKESGLAIHLHRDVPKIISKNIED----ALMDAFKQLGISDWNSLFWVAHPGGPAI  349

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             LN +E  L L  +KL  +RR L +FGN+SS T+F+VL    DE   +           GL
Sbjct  350   LNHVETKLKLEPKKLQVTRRVLREFGNMSSATVFFVL----DETRKQSATEGWATTGQGL  405

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             EWG+    GPGIT E ++LR++
Sbjct  406   EWGVLCGLGPGITVETVVLRSV  427



>pdb|2P0U|A Chain A, Crystal Structure Of Marchantia Polymorpha Stilbenecarboxylate 
Synthase 2 (Stcs2)
 pdb|2P0U|B Chain B, Crystal Structure Of Marchantia Polymorpha Stilbenecarboxylate 
Synthase 2 (Stcs2)
Length=413

 Score =   293 bits (751),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/384 (42%), Positives = 234/384 (61%), Gaps = 15/384 (4%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDL-AIKEKLERLCKTTTVKTRYTVMCK  376
             G AT+LA+GKA P+ +  Q    + +   T  +D  A+K K +R+C  + +K R+  + +
Sbjct  33    GPATVLAMGKAVPANVFEQATYPDFFFNITNSNDKPALKAKFQRICDKSGIKKRHFYLDQ  92

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
              +L+  P + T    ++  R E+A   V  +AKEAS+  IK+WGRP  EITH+V  ++S 
Sbjct  93    KILESNPAMCTYMETSLNCRQEIAVAQVPKLAKEASMNAIKEWGRPKSEITHIVMATTSG  152

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             + +PG +L  A  LGL+ +V RVM+Y  G + G T LRVAKD+AENN G+RVL   SE T
Sbjct  153   VNMPGAELATAKLLGLRPNVRRVMMYQQGXFAGATVLRVAKDLAENNAGARVLAICSEVT  212

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
              + FR P++     LVG+ALFGDGAAAVIVG++PR  +E P  E+ +A +  LP +   I
Sbjct  213   AVTFRAPSETHIDGLVGSALFGDGAAAVIVGSDPRPGIERPIYEMHWAGEMVLPESDGAI  272

Query  917   DGRISEEGINFKLGRDLPEKIENNIEDF---CKKLIGKAnnnnnnLTYNELFWAVHPGGP  1087
             DG ++E G+ F L +D+P  I  NI  F    K L+G +       ++NELFWAVHPGGP
Sbjct  273   DGHLTEAGLVFHLLKDVPGLITKNIGGFLKDTKNLVGAS-------SWNELFWAVHPGGP  325

Query  1088  AILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeg  1267
             AIL+++E  L L   K   SR  L D+GN+SS ++ +VL+ +R+  +   K         
Sbjct  326   AILDQVEAKLELEKGKFQASRDILSDYGNMSSASVLFVLDRVRERSLESNKS----TFGE  381

Query  1268  glewglalaFGPGITFEGILLRNL  1339
             G EWG  + FGPG+T E +LLR L
Sbjct  382   GSEWGFLIGFGPGLTVETLLLRAL  405



>gb|AAM21772.1| stilbene synthase [Cissus rhombifolia]
Length=392

 Score =   293 bits (749),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 238/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P Q V Q    + Y R TK + +  +K+K  R+C+ + +K RY+ + 
Sbjct  14    KGPATILAIGTATPDQCVYQSDYADYYFRVTKSEHMTELKKKFNRICEKSMIKKRYSHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P   +E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSETALDSLVGQALFGDGSAAVIVGSDPDILIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLSLDKQKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>ref|XP_003634076.1| PREDICTED: stilbene synthase 4-like isoform X1 [Vitis vinifera]
Length=392

 Score =   293 bits (749),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 154/382 (40%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY+ + 
Sbjct  14    KGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYSHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+A VIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETALDSLVGQALFGDGSATVIVGSDPDLSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLNQAFDPIGINDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             LN +E  L L  +KL  +R  L ++GN+SS  + ++++ MR + + ++K         GL
Sbjct  310   LNAVEAKLSLDKQKLKATRHVLSEYGNMSSACVLFIMDEMRKKSLKEQK----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>ref|XP_002264989.1| PREDICTED: stilbene synthase 4 [Vitis vinifera]
Length=392

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 239/382 (63%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P+ +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITTEVPKLGKEAALKALKEWGQPISKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL+  V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P+++    LVG ALFGDG+AA+I+G++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSESALDSLVGQALFGDGSAAMIIGSDPDISIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR + +   K+GK      GL
Sbjct  310   LDAVEAKLSLDKQKLNATRHILSEYGNMSSACVLFILDEMRKKSL---KEGK-TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>ref|XP_002263881.1| PREDICTED: stilbene synthase 1 [Vitis vinifera]
Length=392

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTKAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFN21506.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 235/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTKAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G+      GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGERATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>ref|XP_002263807.1| PREDICTED: stilbene synthase 6 [Vitis vinifera]
Length=392

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 234/382 (61%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPEHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A        +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLSQAFEPLGIRDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G+      GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGENATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFN21500.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 157/382 (41%), Positives = 235/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDISIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTKAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G+      GL
Sbjct  310   LDAVETKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGERATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFN21548.1| stilbene synthase [Vitis pseudoreticulata]
Length=399

 Score =   292 bits (748),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/382 (40%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY+ + 
Sbjct  14    KGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYSHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVKRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETALDSLVGQALFGDGSAAVIVGSDPDLSIEQPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW VHPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPIGISDWNSLFWIVHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL  +R  L ++GN+SS  + ++++ MR + + + K         G 
Sbjct  310   LDAVEAKLSLDKQKLKATRHVLSEYGNMSSACVLFIMDEMRKKSLKEEK----TTTGEGW  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLPSI  387



>gb|AFM22751.1| stilbene synthase [Vitis amurensis]
Length=392

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 158/382 (41%), Positives = 237/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL+  V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLEPSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSEIALDSLVGQALFGDGSAAVIVGSDPDLSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL  +R  L ++GN+SS  + ++L+ MR + +   K+GK      GL
Sbjct  310   LDAVEAKLSLDKQKLKATRHILSEYGNMSSACVLFILDEMRKKSL---KEGK-TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++LR++
Sbjct  366   DWGVLFGFGPGLTIETVVLRSI  387



>ref|XP_010662506.1| PREDICTED: stilbene synthase 4-like isoform X2 [Vitis vinifera]
Length=392

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 238/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G AT+LA+G A P   + Q    + Y R TK + +  +K+K  R+C  + +K RY+ + 
Sbjct  14    KGPATVLAIGTATPDNCLYQSDFADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYSHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+A VIVG++P  S+E P  +L  AAQ F+P TQ  
Sbjct  194   TVVTFRGPSETALDSLVGQALFGDGSATVIVGSDPDLSIERPLFQLVSAAQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE+     + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIEN----CLTKAFDPIGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  +GL  +KL  +R  L ++GN+SS  + ++L+ MR + +   K+GK      GL
Sbjct  310   LDAVEAKVGLDKQKLKATRHILSEYGNMSSACVLFILDEMRKKSL---KEGK-TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>gb|ABV82966.1| stilbene synthase [Vitis vinifera]
Length=392

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 237/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + ++ +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMSELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTAS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  N+E    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENVE----KCLTQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLDKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSHKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFM56656.1| stilbene synthase [Vitis quinquangularis]
Length=392

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVI+G++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIIGSDPDISIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + KA +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTKAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFN21517.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLSQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVETKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKVTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFM56666.1| stilbene synthase [Vitis quinquangularis]
Length=392

 Score =   292 bits (747),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 235/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLSQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G+      GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGENATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFM56643.1| stilbene synthase [Vitis quinquangularis]
Length=392

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLNQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>gb|AFM56658.1| stilbene synthase [Vitis quinquangularis]
Length=392

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 235/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +++WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALREWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPHVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLSQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G+      GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGENATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>gb|AFM56664.1| stilbene synthase [Vitis quinquangularis]
 gb|AFN21515.1| stilbene synthase [Vitis pseudoreticulata]
 gb|AFN21522.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLSQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>dbj|BAA32733.1| coumaroyl triacetic acid synthase [Hydrangea macrophylla]
Length=399

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/386 (40%), Positives = 244/386 (63%), Gaps = 13/386 (3%)
 Frame = +2

Query  200   GKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMCK  376
             G ATILA+G A PS    Q    + Y R TK D L  +K K +R+C+ +++K RY  + +
Sbjct  19    GPATILAIGTAVPSNCYYQSEYPDFYFRVTKSDHLTDLKSKFKRMCERSSIKKRYMHLTE  78

Query  377   DVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSSE  556
             ++L++ P + T  +P+I  R ++    +  +AKEA+   IK+WG+P   ITH+V+ ++S 
Sbjct  79    EILEENPNMCTFAAPSIDGRQDIVVKEIPKLAKEAASKAIKEWGQPKSNITHLVFCTTSG  138

Query  557   IRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSETT  736
             + +PG D  L   LGL+  + R+M+Y  GC+ G TGLR+AKD+AENN G+RVL+  SE T
Sbjct  139   VDMPGCDYQLTRLLGLRPSIKRLMMYQQGCHAGGTGLRLAKDLAENNKGARVLVVCSEMT  198

Query  737   ILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSVI  916
             ++ FR P++A    LVG +LFGDGA+AVIVG++P  S E+P  ++  A+Q  +  ++  I
Sbjct  199   VINFRGPSEAHMDSLVGQSLFGDGASAVIVGSDPDLSTEHPLYQIMSASQIIVADSEGAI  258

Query  917   DGRISEEGINFKLGRDLPEKIENNIED-----FCKKLIGKAnnnnnnLTYNELFWAVHPG  1081
             DG + +EG+ F L +D+P  + +NIE+     F   L+      ++ + +N +FW  HPG
Sbjct  259   DGHLRQEGLTFHLRKDVPSLVSDNIENTLVEAFTPILMDS---IDSIIDWNSIFWIAHPG  315

Query  1082  GPAILNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeee  1261
             GPAILN+++  +GL+ EKL  SR  L ++GN+SS  +F++++ MR   M   ++GK    
Sbjct  316   GPAILNQVQAKVGLKEEKLRVSRHILSEYGNMSSACVFFIMDEMRKRSM---EEGK-GTT  371

Query  1262  egglewglalaFGPGITFEGILLRNL  1339
               GLEWG+   FGPG T E I+L ++
Sbjct  372   GEGLEWGVLFGFGPGFTVETIVLHSV  397



>gb|AFN21544.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   292 bits (747),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 155/382 (41%), Positives = 235/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C+ + +K RY  + 
Sbjct  14    KGPATILAIGTATPDNCVYQSDYADYYFRVTKSEHMTDLKKKFNRICEKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNMGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  A Q F+P TQ  
Sbjct  194   TVVTFRGPSETHLDSLVGQALFGDGSAAVIVGSDPDTSIERPLFQLVSADQTFIPNTQGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A        +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLTQAFGPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR + + + +         GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHILSEYGNMSSACVLFILDEMRKKSLKEER----TTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>gb|AFN21535.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLNQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



>sp|P51075.2|CHSY_BETPN RecName: Full=Chalcone synthase; AltName: Full=Naringenin-chalcone 
synthase [Betula pendula]
 emb|CAA71904.1| chalcone synthase [Betula pendula]
Length=395

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 159/382 (42%), Positives = 231/382 (60%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
              G AT+LA+G A PS  + Q    + Y R TK D +  +KEK +R+C  + +K RY  + 
Sbjct  14    HGPATVLAIGTATPSNCITQADYPDYYFRITKSDHMTELKEKFKRMCDKSMIKKRYMYLN  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L++ P +    +P++  R  +    V  + KEA+   IK+WG+P  +ITH+V+ ++S
Sbjct  74    EEILNENPNMCAYMAPSLDARQTIVVVEVPKLGKEAATKAIKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  L   LGL+  V R+M+Y  GC+ G T LR+AKD+AENN G+RVL+  SE 
Sbjct  134   GVDMPGADYQLTKLLGLRPSVKRLMMYQQGCFAGGTVLRLAKDLAENNKGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T + FR P       LVG ALFGDGAAAVIVGA+P  S+E P  EL  AAQ  LP +   
Sbjct  194   TAVTFRGPTDTHLDSLVGQALFGDGAAAVIVGADPDTSVERPLFELISAAQTILPDSDGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             IDG + E G+ F L +D+P  I  NIE    K + +A        +N LFW  HPGGPAI
Sbjct  254   IDGHLREVGLTFHLLKDVPGIISKNIE----KSLAEAFAPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+++E  LGL+ EKL  +R  L ++GN+SS  + ++L+ MR   +    +G +     GL
Sbjct  310   LDQVESKLGLKEEKLRATRHVLSEYGNMSSACVLFILDEMRRNSL----EGGKVTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             EWG+   FGPG+T E ++L ++
Sbjct  366   EWGVLFGFGPGLTVETVVLHSV  387



>gb|AFN21542.1| stilbene synthase [Vitis pseudoreticulata]
Length=392

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSMIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLRPNVPTLISENIE----KCLSQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVETKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKVTTGEGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSI  387



>ref|XP_002268756.1| PREDICTED: stilbene synthase 5 [Vitis vinifera]
Length=392

 Score =   291 bits (746),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 156/382 (41%), Positives = 236/382 (62%), Gaps = 9/382 (2%)
 Frame = +2

Query  197   QGKATILALGKAFPSQLVPQDCLVEGYIRDTKCDDLA-IKEKLERLCKTTTVKTRYTVMC  373
             +G ATILA+G A P   V Q    + Y R TK + +  +K+K  R+C  + +K RY  + 
Sbjct  14    KGPATILAIGTATPDHCVYQSDYADYYFRVTKSEHMTELKKKFNRICDKSIIKKRYIHLT  73

Query  374   KDVLDKYPELATEGSPTIAQRLEVANPAVIAMAKEASLACIKDWGRPVEEITHVVYVSSS  553
             +++L+++P +    +P++  R E+    V  + KEA+L  +K+WG+P  +ITH+V+ ++S
Sbjct  74    EEMLEEHPNIGAYMAPSLNIRQEIITAEVPKLGKEAALKALKEWGQPKSKITHLVFCTTS  133

Query  554   EIRLPGGDLYLAAELGLKSDVNRVMLYFLGCYGGVTGLRVAKDIAENNPGSRVLLTTSET  733
              + +PG D  LA  LGL++ V RVMLY  GCY G T LR AKD+AENN G+RVL+  SE 
Sbjct  134   GVEMPGADYKLANLLGLETSVRRVMLYHQGCYAGGTVLRTAKDLAENNAGARVLVVCSEI  193

Query  734   TILGFRPPNKARPYDLVGAALFGDGAAAVIVGANPRESLENPFMELSFAAQQFLPGTQSV  913
             T++ FR P++     LVG ALFGDG+AAVIVG++P  S+E P  +L  AAQ F+P +   
Sbjct  194   TVVTFRGPSEDALDSLVGQALFGDGSAAVIVGSDPDVSIERPLFQLVSAAQTFIPNSAGA  253

Query  914   IDGRISEEGINFKLGRDLPEKIENNIEDFCKKLIGKAnnnnnnLTYNELFWAVHPGGPAI  1093
             I G + E G+ F L  ++P  I  NIE    K + +A +      +N LFW  HPGGPAI
Sbjct  254   IAGNLREVGLTFHLWPNVPTLISENIE----KCLNQAFDPLGISDWNSLFWIAHPGGPAI  309

Query  1094  LNRLERTLGLRSEKLDCSRRALMDFGNVSSNTIFYVLEYMRDELMMKRKQGKeeeeeggl  1273
             L+ +E  L L  +KL+ +R  L ++GN+SS  + ++L+ MR     K  +G++     GL
Sbjct  310   LDAVEAKLNLEKKKLEATRHVLSEYGNMSSACVLFILDEMRK----KSLKGEKATTGDGL  365

Query  1274  ewglalaFGPGITFEGILLRNL  1339
             +WG+   FGPG+T E ++L ++
Sbjct  366   DWGVLFGFGPGLTIETVVLHSV  387



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4412942777432