BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c70612_g1_i1 len=121 path=[1:0-120]

Length=121
                                                                      Score     E

ref|XP_009772438.1|  PREDICTED: putative late blight resistance p...  56.6    1e-07   
ref|XP_009758244.1|  PREDICTED: putative late blight resistance p...  56.2    2e-07   
ref|XP_009758245.1|  PREDICTED: putative late blight resistance p...  55.8    2e-07   
emb|CDP10671.1|  unnamed protein product                              55.1    3e-07   
ref|XP_009625958.1|  PREDICTED: putative late blight resistance p...  55.1    3e-07   
ref|XP_009793285.1|  PREDICTED: putative late blight resistance p...  54.7    4e-07   
ref|XP_009793283.1|  PREDICTED: putative late blight resistance p...  54.7    4e-07   
emb|CDP21314.1|  unnamed protein product                              52.0    1e-06   
ref|XP_009618655.1|  PREDICTED: putative late blight resistance p...  52.8    2e-06   
emb|CDP00687.1|  unnamed protein product                              51.2    4e-06   
ref|XP_009600123.1|  PREDICTED: putative late blight resistance p...  51.6    5e-06   
ref|XP_009763930.1|  PREDICTED: putative late blight resistance p...  51.6    6e-06   
ref|XP_009763931.1|  PREDICTED: putative late blight resistance p...  51.6    6e-06   
ref|XP_009772441.1|  PREDICTED: putative late blight resistance p...  51.6    6e-06   
emb|CDP00690.1|  unnamed protein product                              51.2    7e-06   
emb|CDP05558.1|  unnamed protein product                              50.4    1e-05   
ref|XP_009602298.1|  PREDICTED: putative late blight resistance p...  50.1    2e-05   
ref|XP_009602301.1|  PREDICTED: putative late blight resistance p...  50.1    2e-05   
emb|CDP10323.1|  unnamed protein product                              49.7    2e-05   
ref|XP_006362553.1|  PREDICTED: putative late blight resistance p...  48.1    2e-05   
emb|CDP00737.1|  unnamed protein product                              49.7    3e-05   
ref|XP_009803728.1|  PREDICTED: putative late blight resistance p...  48.9    4e-05   
ref|XP_011087138.1|  PREDICTED: putative late blight resistance p...  48.9    4e-05   
ref|XP_006350240.1|  PREDICTED: putative late blight resistance p...  48.5    7e-05   
ref|XP_011077109.1|  PREDICTED: putative late blight resistance p...  48.1    7e-05   
ref|XP_006362574.1|  PREDICTED: putative late blight resistance p...  48.1    8e-05   
gb|AAV31175.1|  Putative disease resistance protein, identical        48.1    9e-05   Solanum tuberosum [potatoes]
ref|XP_004248174.1|  PREDICTED: putative late blight resistance p...  47.8    1e-04   
ref|XP_006364074.1|  PREDICTED: putative late blight resistance p...  47.4    1e-04   
ref|XP_004238948.1|  PREDICTED: putative late blight resistance p...  47.4    1e-04   
ref|XP_009761168.1|  PREDICTED: uncharacterized protein LOC104213363  46.2    2e-04   
ref|XP_011088007.1|  PREDICTED: putative late blight resistance p...  47.4    2e-04   
ref|XP_011084823.1|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_006366307.1|  PREDICTED: putative late blight resistance p...  47.4    2e-04   
ref|XP_004248175.2|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_006351974.1|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_011071841.1|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_009606086.1|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_009606087.1|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_009767436.1|  PREDICTED: putative late blight resistance p...  47.0    2e-04   
ref|XP_009603186.1|  PREDICTED: putative late blight resistance p...  45.1    3e-04   
emb|CDP00692.1|  unnamed protein product                              46.6    3e-04   
ref|XP_011070551.1|  PREDICTED: putative late blight resistance p...  46.2    4e-04   
gb|EYU24181.1|  hypothetical protein MIMGU_mgv1a025424mg              46.2    4e-04   
ref|XP_009796673.1|  PREDICTED: uncharacterized protein LOC104243211  45.1    5e-04   
gb|EYU24183.1|  hypothetical protein MIMGU_mgv1a021378mg              45.8    6e-04   
ref|XP_009603189.1|  PREDICTED: uncharacterized protein LOC104098223  45.1    6e-04   
ref|XP_006367921.1|  PREDICTED: putative late blight resistance p...  45.1    6e-04   
ref|XP_009612031.1|  PREDICTED: putative late blight resistance p...  45.4    7e-04   
ref|XP_009603185.1|  PREDICTED: putative late blight resistance p...  44.3    7e-04   
gb|EYU40384.1|  hypothetical protein MIMGU_mgv1a020875mg              45.4    7e-04   
ref|XP_011071973.1|  PREDICTED: putative late blight resistance p...  45.4    7e-04   
ref|XP_011075662.1|  PREDICTED: putative late blight resistance p...  45.4    7e-04   
ref|XP_010327076.1|  PREDICTED: putative late blight resistance p...  45.4    7e-04   
ref|XP_004248476.2|  PREDICTED: putative late blight resistance p...  45.4    8e-04   
ref|XP_010327078.1|  PREDICTED: putative late blight resistance p...  45.4    8e-04   
gb|EYU21847.1|  hypothetical protein MIMGU_mgv1a017843mg              45.4    8e-04   
ref|NP_001234202.1|  NRC1                                             45.4    8e-04   
ref|XP_011071971.1|  PREDICTED: putative late blight resistance p...  45.4    8e-04   
ref|XP_011075746.1|  PREDICTED: putative late blight resistance p...  45.1    9e-04   
ref|XP_009794525.1|  PREDICTED: putative late blight resistance p...  45.1    0.001   
gb|EYU31596.1|  hypothetical protein MIMGU_mgv1a025161mg              45.1    0.001   
ref|XP_011089745.1|  PREDICTED: putative late blight resistance p...  45.1    0.001   



>ref|XP_009772438.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009772439.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=877

 Score = 56.6 bits (135),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M+I S LPNLEVL+LKN+A +G EWE+T
Sbjct  739  LTLSRTCLPWNCMNIFSKLPNLEVLELKNYAFSGDEWEIT  778



>ref|XP_009758244.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=883

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LTF  TCIPW+ M+I S LPNLEVL+LK+ A +G EWE+T
Sbjct  749  LTFSGTCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEIT  788



>ref|XP_009758245.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009758246.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=873

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LTF  TCIPW+ M+I S LPNLEVL+LK+ A +G EWE+T
Sbjct  739  LTFSGTCIPWNCMNIFSKLPNLEVLELKDDAFSGDEWEIT  778



>emb|CDP10671.1| unnamed protein product [Coffea canephora]
Length=776

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT  S+ +PW DM+++SMLPNLEVLKLKN A  G +WE
Sbjct  645  LTLSSSYLPWKDMNVLSMLPNLEVLKLKNNAFVGSDWE  682



>ref|XP_009625958.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625959.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625960.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625961.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625962.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625963.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625964.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625965.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625966.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009625967.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=873

 Score = 55.1 bits (131),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M+I S LPNLEVL+LKN A +G EWE+T
Sbjct  739  LTLSRTCLPWNCMNIFSKLPNLEVLELKNLACSGNEWEIT  778



>ref|XP_009793285.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana sylvestris]
Length=870

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M I S LPNLEVL+LKN A +G EWE+T
Sbjct  736  LTLTRTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEIT  775



>ref|XP_009793283.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009793284.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
Length=874

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M I S LPNLEVL+LKN A +G EWE+T
Sbjct  736  LTLTRTCLPWNCMKIFSKLPNLEVLELKNRAFSGDEWEIT  775



>emb|CDP21314.1| unnamed protein product [Coffea canephora]
Length=249

 Score = 52.0 bits (123),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            L+   + +PW DM+ I+MLPNLEVLKLKN+A  G +WE T
Sbjct  116  LSLSRSYLPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPT  155



>ref|XP_009618655.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618657.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618658.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
 ref|XP_009618659.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana tomentosiformis]
Length=870

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LTF+ T +PW +M I+ MLPNLEVLKL++ A  G+EWE
Sbjct  723  LTFIFTYMPWKNMDIVGMLPNLEVLKLRSSACIGEEWE  760



>emb|CDP00687.1| unnamed protein product [Coffea canephora]
Length=386

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  23   IPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            +PW DM+ I+MLPNLEVLKLKN+A  G +WE T
Sbjct  260  LPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPT  292



>ref|XP_009600123.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=902

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M+I S LPNLEVL+LK+ A  G EWE+T
Sbjct  742  LTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVT  781



>ref|XP_009763930.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=909

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M+I S LPNLEVL+LK+ A  G EWE+T
Sbjct  753  LTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVT  792



>ref|XP_009763931.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
Length=898

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M+I S LPNLEVL+LK+ A  G EWE+T
Sbjct  742  LTLSGTCLPWNCMNIFSKLPNLEVLELKDHAFVGIEWEVT  781



>ref|XP_009772441.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=872

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M+I S LPNLEVL+LK  A +G EWE+T
Sbjct  740  LTLSRTCLPWNCMNIFSKLPNLEVLELKARAFSGNEWEIT  779



>emb|CDP00690.1| unnamed protein product [Coffea canephora]
Length=604

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  23   IPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            +PW DM+ I+MLPNLEVLKLKN+A  G +WE T
Sbjct  428  LPWEDMTFIAMLPNLEVLKLKNYAFQGPKWEPT  460



>emb|CDP05558.1| unnamed protein product [Coffea canephora]
Length=888

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T + WS+MS + MLPNLEVLKLK++A  G  WE
Sbjct  752  LTLSDTLLDWSEMSTLGMLPNLEVLKLKDYAFKGSRWE  789



>ref|XP_009602298.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009602299.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009602300.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=872

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M I S LPNLEVL+LK  A +G EWE+T
Sbjct  739  LTLSRTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEIT  778



>ref|XP_009602301.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009602302.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X4 [Nicotiana tomentosiformis]
Length=871

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   TC+PW+ M I S LPNLEVL+LK  A +G EWE+T
Sbjct  738  LTLSRTCLPWNCMIIFSKLPNLEVLELKVHAFSGNEWEIT  777



>emb|CDP10323.1| unnamed protein product [Coffea canephora]
Length=686

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT  ++ +PW DM+ ++ LPNLEVLKLKN+A  G  W+LT
Sbjct  561  LTLSASNLPWEDMTNVAKLPNLEVLKLKNYAFRGSTWKLT  600



>ref|XP_006362553.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006362554.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
isoform X2 [Solanum tuberosum]
Length=239

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            L+ V T   W DMSI+ +LP+LEVLKLK +A  GQ WE
Sbjct  99   LSLVDTWFEWKDMSILGLLPDLEVLKLKEYAFKGQSWE  136



>emb|CDP00737.1| unnamed protein product [Coffea canephora]
Length=1006

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  23   IPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            +PW D++ I+MLPNLEVLKLKN+A  G +WE T
Sbjct  888  LPWKDIACIAMLPNLEVLKLKNYAFQGPDWEPT  920



>ref|XP_009803728.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Nicotiana sylvestris]
Length=1076

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWEL  118
            L F  TC+ W D+SI+  LP LEVLKL+N A  G EWE+
Sbjct  936  LAFSGTCLQWMDLSIVGKLPKLEVLKLENDACIGDEWEV  974



>ref|XP_011087138.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=821

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT     +PW DMS+I+ LPNLEVLKL+ +A  G EWE
Sbjct  685  LTLGGLGLPWEDMSLIACLPNLEVLKLRCYAFRGPEWE  722



>ref|XP_006350240.1| PREDICTED: putative late blight resistance protein homolog R1B-23-like 
[Solanum tuberosum]
Length=879

 Score = 48.5 bits (114),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            L    TC+PW  MSIIS LP LEVLKLK  A  G EW+ T
Sbjct  739  LKLSRTCLPWEYMSIISKLPELEVLKLKYDALVGDEWKAT  778



>ref|XP_011077109.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=760

 Score = 48.1 bits (113),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/30 (63%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  26   PWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            PW DM I+S+LPNLEVLKL+++A  G +WE
Sbjct  629  PWEDMGIVSLLPNLEVLKLRDYAFRGYKWE  658



>ref|XP_006362574.1| PREDICTED: putative late blight resistance protein homolog R1B-12-like 
[Solanum tuberosum]
Length=891

 Score = 48.1 bits (113),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            L+ V T   W DMSI+ +LP+LEVLKLK  A  GQ WE
Sbjct  751  LSLVDTWFEWKDMSILGLLPDLEVLKLKENAFKGQSWE  788



>gb|AAV31175.1| Putative disease resistance protein, identical [Solanum tuberosum]
Length=842

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            L    TC+PW  MSIIS LP LEVL+LK +A  G +W+ T
Sbjct  657  LKLSRTCLPWEYMSIISKLPVLEVLQLKRYAFRGHKWKAT  696



>ref|XP_004248174.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
[Solanum lycopersicum]
Length=889

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT     +PW+ M+I+ MLP LEVLKLK++A  G EWE T
Sbjct  753  LTLRGCQLPWNQMTILCMLPELEVLKLKDYAFQGSEWEST  792



>ref|XP_006364074.1| PREDICTED: putative late blight resistance protein homolog R1A-4-like 
[Solanum tuberosum]
Length=761

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT  +T + W DM+I+S LPNLEVLKLK+ A  G  W+L+
Sbjct  617  LTLCTTHLEWEDMNILSKLPNLEVLKLKDHAFRGHIWKLS  656



>ref|XP_004238948.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
 ref|XP_010320774.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Solanum lycopersicum]
Length=891

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            L+ V T   W DMSI+ +LP LEVLKLK  A  GQ WE
Sbjct  751  LSLVDTWFEWKDMSILGLLPELEVLKLKENAFKGQSWE  788



>ref|XP_009761168.1| PREDICTED: uncharacterized protein LOC104213363 [Nicotiana sylvestris]
Length=235

 Score = 46.2 bits (108),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  5    TFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            T V TC+ W DM+ +  LPN+EVL+LK FA  G+ W L 
Sbjct  103  TLVGTCLLWEDMTTLGQLPNVEVLRLKCFAFQGRNWNLN  141



>ref|XP_011088007.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=903

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T +PW DM  +SMLP LEVLKL+N+A +G  W+
Sbjct  772  LTLSGTSLPWEDMVELSMLPKLEVLKLRNYAFSGSVWK  809



>ref|XP_011084823.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Sesamum indicum]
Length=557

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT     +PW DM++I  LPNLEVLKL++ A  G++WE
Sbjct  424  LTLTDCALPWQDMAVIHSLPNLEVLKLRDDAFMGEKWE  461



>ref|XP_006366307.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006366308.1| PREDICTED: putative late blight resistance protein homolog R1B-14-like 
isoform X2 [Solanum tuberosum]
Length=887

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T + WS +S + MLPNLEVLKLK++A  G +WE
Sbjct  752  LTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWE  789



>ref|XP_004248175.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Solanum lycopersicum]
Length=887

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T + WS +S + MLPNLEVLKLK++A  G +WE
Sbjct  752  LTLSDTFLDWSHISTLGMLPNLEVLKLKDYAFKGTQWE  789



>ref|XP_006351974.1| PREDICTED: putative late blight resistance protein homolog R1B-16-like 
[Solanum tuberosum]
Length=926

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T +PW  M+ +  LPNLEVLKLKN+A TG +WE
Sbjct  785  LTLSFTYLPWESMASLCRLPNLEVLKLKNYAFTGPKWE  822



>ref|XP_011071841.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=1095

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT     +PW  M+I+  LPNLEVLKLK  A  GQEWE
Sbjct  951  LTLSGCGLPWETMTIVGSLPNLEVLKLKKDACRGQEWE  988



>ref|XP_009606086.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=990

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T +PW  M+ +  LPNLEVLKLKN+A TG +WE
Sbjct  841  LTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPKWE  878



>ref|XP_009606087.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=975

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T +PW  M+ +  LPNLEVLKLKN+A TG +WE
Sbjct  826  LTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPKWE  863



>ref|XP_009767436.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=930

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT   T +PW  M+ +  LPNLEVLKLKN+A TG +WE
Sbjct  790  LTLSFTYLPWESMTSLCRLPNLEVLKLKNYAFTGPKWE  827



>ref|XP_009603186.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana tomentosiformis]
Length=191

 Score = 45.1 bits (105),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT V T + W DM+ +  LPNLEVL+LK FA  G+ W L 
Sbjct  58   LTLVGTRLLWEDMTTLGQLPNLEVLRLKCFAFQGRNWNLN  97



>emb|CDP00692.1| unnamed protein product [Coffea canephora]
Length=1121

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 24/31 (77%), Gaps = 0/31 (0%)
 Frame = +2

Query  23    IPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
             +PW D S+I MLP LEVLKLK+FA  G +WE
Sbjct  1001  LPWEDTSLIGMLPRLEVLKLKHFAFHGPKWE  1031



>ref|XP_011070551.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
[Sesamum indicum]
Length=891

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            +T   T + W  MS + MLPNLEVLKLK++A  G  WE
Sbjct  753  ITLSDTLLDWDHMSTLGMLPNLEVLKLKDYAFKGSRWE  790



>gb|EYU24181.1| hypothetical protein MIMGU_mgv1a025424mg, partial [Erythranthe 
guttata]
Length=702

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  11   VSTC-IPWSDMSIISMLPNLEVLKLKNFA*TGQEW  112
            +S C IPW DMSI+  LPNLEVLKL++ A  GQ+W
Sbjct  594  LSECKIPWEDMSIVGSLPNLEVLKLQSNAAVGQKW  628



>ref|XP_009796673.1| PREDICTED: uncharacterized protein LOC104243211 [Nicotiana sylvestris]
Length=270

 Score = 45.1 bits (105),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 25/38 (66%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            LT + T   W DMSI+ +L  LEVLKLK  A TGQ WE
Sbjct  135  LTLIDTGFEWKDMSILGLLEYLEVLKLKENAFTGQSWE  172



>gb|EYU24183.1| hypothetical protein MIMGU_mgv1a021378mg, partial [Erythranthe 
guttata]
Length=828

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  11   VSTC-IPWSDMSIISMLPNLEVLKLKNFA*TGQEW  112
            +S C IPW DMSI+  LPNL+VLKL++ A  GQ+W
Sbjct  720  LSECKIPWEDMSIVGSLPNLQVLKLRSNAAVGQKW  754



>ref|XP_009603189.1| PREDICTED: uncharacterized protein LOC104098223 [Nicotiana tomentosiformis]
Length=329

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 25/39 (64%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWEL  118
            LT  +T + W D+S +  LPNLEVLKLK FA  G  W L
Sbjct  3    LTLEATHLLWKDISFLGKLPNLEVLKLKYFAFQGSNWNL  41



>ref|XP_006367921.1| PREDICTED: putative late blight resistance protein homolog R1A-10-like 
isoform X6 [Solanum tuberosum]
Length=403

 Score = 45.1 bits (105),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT   T + W DM+I+  LPNLEVLKLK++A  G  W+L+
Sbjct  267  LTLCRTNLQWEDMNILRKLPNLEVLKLKDYAFRGLTWKLS  306



>ref|XP_009612031.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
 ref|XP_009612039.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Nicotiana tomentosiformis]
Length=872

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            L   +T +PW  M+II  LPNLEVL+LK +A  G EW++T
Sbjct  740  LKLTTTHLPWEYMAIIGKLPNLEVLQLKKWAFEGNEWKVT  779



>ref|XP_009603185.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana tomentosiformis]
Length=235

 Score = 44.3 bits (103),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT V T + W DM+ +  LPNLEVL+LK FA  G+ W L 
Sbjct  102  LTLVGTRLLWEDMTTLGQLPNLEVLRLKCFAFQGRNWNLN  141



>gb|EYU40384.1| hypothetical protein MIMGU_mgv1a020875mg, partial [Erythranthe 
guttata]
Length=834

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +2

Query  11   VSTC-IPWSDMSIISMLPNLEVLKLKNFA*TGQEW  112
            +S C +PW DMSI+  LPNLEVLKLK+ A  G++W
Sbjct  718  LSECKVPWEDMSIVGSLPNLEVLKLKSGAAKGEKW  752



>ref|XP_011071973.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWEL  118
            +T      PW DM I++ LPNLE LKL  +A  G EWEL
Sbjct  733  ITLSGCGFPWEDMKILAQLPNLEALKLGCYAFQGPEWEL  771



>ref|XP_011075662.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=738

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  23   IPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            IPWS M+I+  LPNLEVLKL+  A  G EWE
Sbjct  601  IPWSSMTIVGALPNLEVLKLRKNACQGVEWE  631



>ref|XP_010327076.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
 ref|XP_010327077.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X1 [Solanum lycopersicum]
Length=879

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT     +PW  M+I+  LP LEVLKLK++A  G EWE T
Sbjct  733  LTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWEST  772



>ref|XP_004248476.2| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X2 [Solanum lycopersicum]
Length=869

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT     +PW  M+I+  LP LEVLKLK++A  G EWE T
Sbjct  733  LTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWEST  772



>ref|XP_010327078.1| PREDICTED: putative late blight resistance protein homolog R1B-14 
isoform X3 [Solanum lycopersicum]
Length=869

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWELT  121
            LT     +PW  M+I+  LP LEVLKLK++A  G EWE T
Sbjct  733  LTLRGCQLPWDQMTILCKLPKLEVLKLKHYAFQGSEWEST  772



>gb|EYU21847.1| hypothetical protein MIMGU_mgv1a017843mg, partial [Erythranthe 
guttata]
Length=857

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 27/39 (69%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSI-ISMLPNLEVLKLKNFA*TGQEWE  115
            LT + TC+ W DM   I +LPNL+VLKLK ++  G EWE
Sbjct  717  LTLMGTCLKWEDMKTKICLLPNLQVLKLKEYSFVGTEWE  755



>ref|NP_001234202.1| NRC1 [Solanum lycopersicum]
 gb|ABC26878.1| NRC1 [Solanum lycopersicum]
Length=888

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWEL  118
            LT + T + W DMS++  L NL+VLKLK+ A  G+ WEL
Sbjct  747  LTLLDTWLEWDDMSVLKQLENLQVLKLKDNAFKGENWEL  785



>ref|XP_011071971.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=872

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWEL  118
            LT     + W DM+II  LPNLEVLKL+ FA  G +W+L
Sbjct  740  LTLSGCGLHWEDMAIIEELPNLEVLKLREFAFQGPKWDL  778



>ref|XP_011075746.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=967

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = +2

Query  23   IPWSDMSIISMLPNLEVLKLKNFA*TGQEWE  115
            IPWS M+I+  LPNLEVLKL+  A  G EWE
Sbjct  830  IPWSSMTIVGALPNLEVLKLRKNACQGIEWE  860



>ref|XP_009794525.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794533.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794540.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794546.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X2 [Nicotiana sylvestris]
 ref|XP_009794554.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009794561.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
isoform X1 [Nicotiana sylvestris]
Length=893

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 0/39 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEWEL  118
            LT  ST +PW DM+ I MLPNL+VLK+K+    G  W L
Sbjct  760  LTLESTYLPWEDMANIVMLPNLQVLKIKDNGFDGDVWRL  798



>gb|EYU31596.1| hypothetical protein MIMGU_mgv1a025161mg [Erythranthe guttata]
Length=754

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 26/39 (67%), Gaps = 1/39 (3%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSI-ISMLPNLEVLKLKNFA*TGQEWE  115
            LT   TC+ W DM   I +LPNL+VLKLK ++  G EWE
Sbjct  621  LTLHRTCLKWEDMKTKIGLLPNLQVLKLKEYSFVGTEWE  659



>ref|XP_011089745.1| PREDICTED: putative late blight resistance protein homolog R1A-10 
[Sesamum indicum]
Length=894

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  2    LTFVSTCIPWSDMSIISMLPNLEVLKLKNFA*TGQEW  112
            LT   + +PW DM+ +++LP LEVLKL++FA  GQ W
Sbjct  746  LTLSGSFLPWEDMAKLAVLPKLEVLKLRSFAFEGQIW  782



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 518182412384