BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7052_g1_i1 len=712 path=[690:0-711]

Length=712
                                                                      Score     E

ref|XP_011081682.1|  PREDICTED: auxin-responsive protein IAA14          221   8e-69   
ref|XP_002517529.1|  Auxin-responsive protein IAA1, putative            222   1e-68   Ricinus communis
gb|KDP37176.1|  hypothetical protein JCGZ_06232                         218   7e-67   
ref|XP_007024033.1|  AUX/IAA transcriptional regulator family pro...    214   5e-66   
ref|XP_010249884.1|  PREDICTED: auxin-responsive protein IAA1           215   6e-66   
ref|XP_010254225.1|  PREDICTED: auxin-responsive protein IAA1-like      214   1e-65   
ref|XP_009611025.1|  PREDICTED: auxin-responsive protein IAA17-like     213   3e-65   
ref|XP_008377585.1|  PREDICTED: auxin-responsive protein IAA1           209   1e-63   
ref|XP_007215971.1|  hypothetical protein PRUPE_ppa011570mg             208   2e-63   
ref|XP_009782640.1|  PREDICTED: auxin-responsive protein IAA17-like     208   2e-63   
ref|XP_008228610.1|  PREDICTED: auxin-responsive protein IAA1           208   2e-63   
ref|XP_006427106.1|  hypothetical protein CICLE_v10026522mg             207   3e-63   
ref|XP_006343103.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    208   7e-63   
ref|XP_006465436.1|  PREDICTED: auxin-responsive protein IAA17-like     206   9e-63   
ref|NP_001266077.1|  IAA15                                              208   9e-63   
ref|XP_009339009.1|  PREDICTED: auxin-responsive protein IAA1           206   1e-62   
ref|XP_002299625.1|  auxin-induced protein IAA4                         206   3e-62   Populus trichocarpa [western balsam poplar]
gb|KDO58189.1|  hypothetical protein CISIN_1g044582mg                   205   3e-62   
ref|XP_010033899.1|  PREDICTED: auxin-responsive protein IAA1           203   2e-61   
gb|ABG81096.1|  AUX/IAA-like protein                                    202   2e-61   
ref|XP_011072281.1|  PREDICTED: auxin-responsive protein IAA1-like      202   4e-61   
ref|XP_009416093.1|  PREDICTED: auxin-responsive protein IAA1-lik...    202   5e-61   
ref|XP_011045352.1|  PREDICTED: auxin-responsive protein IAA1           202   8e-61   
ref|XP_004302956.1|  PREDICTED: auxin-responsive protein IAA17-li...    201   1e-60   
gb|AFZ78621.1|  hypothetical protein                                    201   2e-60   
emb|CDO98081.1|  unnamed protein product                                200   3e-60   
ref|XP_008811586.1|  PREDICTED: auxin-responsive protein IAA1-like      199   6e-60   
ref|NP_001290520.1|  auxin-responsive protein IAA1                      199   1e-59   
gb|AGG19163.1|  auxin-responsive Aux/IAA protein                        198   1e-59   
emb|CAN70529.1|  hypothetical protein VITISV_010217                     198   2e-59   Vitis vinifera
ref|XP_002280524.2|  PREDICTED: auxin-responsive protein IAA1           198   2e-59   Vitis vinifera
emb|CBI36192.3|  unnamed protein product                                199   7e-59   
ref|XP_010691245.1|  PREDICTED: auxin-responsive protein IAA1           195   2e-58   
ref|XP_008809254.1|  PREDICTED: auxin-responsive protein IAA1-like      192   2e-57   
emb|CAD30274.1|  IAA16 protein                                          192   3e-57   Gossypium hirsutum [American cotton]
ref|XP_009385622.1|  PREDICTED: auxin-responsive protein IAA1           192   6e-57   
ref|XP_009395806.1|  PREDICTED: auxin-responsive protein IAA1-like      191   9e-57   
ref|XP_009416094.1|  PREDICTED: auxin-responsive protein IAA1-lik...    190   2e-56   
ref|XP_010110305.1|  Auxin-responsive protein IAA17                     189   3e-56   
emb|CBI28126.3|  unnamed protein product                                189   8e-56   
ref|XP_002284861.1|  PREDICTED: auxin-responsive protein IAA1-like      189   9e-56   Vitis vinifera
ref|XP_010925112.1|  PREDICTED: auxin-responsive protein IAA1-like      187   4e-55   
ref|XP_010047765.1|  PREDICTED: auxin-responsive protein IAA23-like     185   2e-54   
gb|KCW79738.1|  hypothetical protein EUGRSUZ_C01083                     186   1e-53   
ref|NP_001235069.1|  uncharacterized protein LOC100500488               179   1e-52   
ref|XP_010917602.1|  PREDICTED: auxin-responsive protein IAA30 is...    181   2e-52   
ref|XP_009623795.1|  PREDICTED: auxin-responsive protein IAA1-like      180   2e-52   
ref|XP_008785900.1|  PREDICTED: auxin-responsive protein IAA1-like      179   2e-52   
ref|XP_009802990.1|  PREDICTED: auxin-responsive protein IAA1-like      180   2e-52   
ref|XP_006451051.1|  hypothetical protein CICLE_v10010410mg             179   6e-52   
ref|XP_007150685.1|  hypothetical protein PHAVU_005G173000g             178   6e-52   
dbj|BAJ84870.1|  predicted protein                                      179   9e-52   
dbj|BAK01326.1|  predicted protein                                      179   9e-52   
ref|XP_003546269.1|  PREDICTED: auxin-responsive protein IAA17-li...    177   2e-51   
ref|XP_006597139.1|  PREDICTED: auxin-responsive protein IAA17-li...    177   2e-51   
gb|ACF88333.1|  unknown                                                 179   2e-51   Zea mays [maize]
ref|XP_003579189.1|  PREDICTED: auxin-responsive protein IAA30-like     178   3e-51   
ref|XP_008810170.1|  PREDICTED: auxin-responsive protein IAA30-like     177   4e-51   
gb|KHN44139.1|  Auxin-responsive protein IAA17                          177   1e-50   
ref|XP_002517023.1|  Auxin-responsive protein IAA7, putative            173   3e-50   Ricinus communis
emb|CDP06818.1|  unnamed protein product                                174   7e-50   
ref|XP_009398568.1|  PREDICTED: auxin-responsive protein IAA30-like     174   8e-50   
ref|NP_001042192.1|  Os01g0178500                                       173   8e-50   Oryza sativa Japonica Group [Japonica rice]
gb|ACF87179.1|  unknown                                                 175   9e-50   Zea mays [maize]
ref|NP_001150626.1|  IAA30 - auxin-responsive Aux/IAA family member     175   1e-49   Zea mays [maize]
ref|XP_010278165.1|  PREDICTED: auxin-responsive protein IAA16-like     174   1e-49   
ref|XP_006475755.1|  PREDICTED: auxin-responsive protein IAA1-like      173   1e-49   
ref|XP_006643826.1|  PREDICTED: auxin-responsive protein IAA1-like      172   1e-49   
ref|XP_004963100.1|  PREDICTED: auxin-responsive protein IAA30-like     174   1e-49   
ref|XP_010917600.1|  PREDICTED: auxin-responsive protein IAA30 is...    174   1e-49   
gb|EEE53980.1|  hypothetical protein OsJ_00603                          172   1e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006838867.1|  hypothetical protein AMTR_s00002p00266760          173   1e-49   
ref|XP_010274203.1|  PREDICTED: auxin-responsive protein IAA16-like     174   2e-49   
gb|KDP40274.1|  hypothetical protein JCGZ_02272                         173   2e-49   
ref|XP_009774251.1|  PREDICTED: auxin-responsive protein IAA16-like     172   2e-49   
gb|AAD32147.1|AF123509_1  Nt-iaa4.1 deduced protein                     172   2e-49   Nicotiana tabacum [American tobacco]
ref|XP_006420094.1|  hypothetical protein CICLE_v10005789mg             172   2e-49   
ref|XP_003568814.1|  PREDICTED: auxin-responsive protein IAA15-like     172   2e-49   
ref|NP_001275398.1|  auxin/indole-3-acetic acid 3                       173   3e-49   
ref|NP_001275031.1|  auxin-responsive protein IAA14-like                172   3e-49   
ref|XP_009610435.1|  PREDICTED: auxin-responsive protein IAA16          172   4e-49   
ref|XP_009776553.1|  PREDICTED: auxin-responsive protein IAA14-like     172   4e-49   
ref|NP_001266049.1|  IAA9 protein                                       173   4e-49   
ref|XP_009413916.1|  PREDICTED: auxin-responsive protein IAA30-like     172   4e-49   
ref|NP_001152494.1|  IAA15 - auxin-responsive Aux/IAA family member     171   5e-49   Zea mays [maize]
gb|KFK31703.1|  hypothetical protein AALP_AA6G148100                    171   5e-49   
ref|NP_001132035.1|  IAA15-auxin-responsive Aux/IAA family member       171   5e-49   Zea mays [maize]
ref|XP_009611797.1|  PREDICTED: auxin-responsive protein IAA14          172   6e-49   
gb|AAD32146.1|AF123508_1  Nt-iaa28 deduced protein                      172   6e-49   Nicotiana tabacum [American tobacco]
ref|XP_004968415.1|  PREDICTED: auxin-responsive protein IAA1-lik...    171   7e-49   
ref|XP_010936171.1|  PREDICTED: auxin-responsive protein IAA30-like     172   7e-49   
ref|XP_009364490.1|  PREDICTED: auxin-responsive protein IAA16          172   7e-49   
ref|XP_009761467.1|  PREDICTED: auxin-responsive protein IAA16          172   8e-49   
ref|XP_008218270.1|  PREDICTED: auxin-responsive protein IAA16          172   8e-49   
ref|XP_007223810.1|  hypothetical protein PRUPE_ppa010698mg             171   9e-49   
ref|XP_011027555.1|  PREDICTED: auxin-responsive protein IAA14 is...    172   9e-49   
ref|XP_008224185.1|  PREDICTED: auxin-responsive protein IAA14          172   9e-49   
ref|XP_002443496.1|  hypothetical protein SORBIDRAFT_08g020580          172   1e-48   Sorghum bicolor [broomcorn]
ref|XP_010552451.1|  PREDICTED: auxin-responsive protein IAA14-like     171   1e-48   
emb|CDO99148.1|  unnamed protein product                                171   1e-48   
ref|XP_011026048.1|  PREDICTED: auxin-induced protein AUX28-like        171   1e-48   
ref|XP_009777122.1|  PREDICTED: auxin-responsive protein IAA14-like     171   1e-48   
emb|CBI35213.3|  unnamed protein product                                169   1e-48   
ref|XP_006605305.1|  PREDICTED: uncharacterized protein LOC100499...    170   2e-48   
ref|XP_007143877.1|  hypothetical protein PHAVU_007G109500g             171   2e-48   
ref|NP_001266039.1|  IAA7 protein                                       170   2e-48   
dbj|BAG55005.1|  auxin-responsive Aux/IAA gene family member            170   2e-48   Ipomoea nil [qian niu]
gb|ADL36587.1|  ARF domain class transcription factor                   168   2e-48   
ref|XP_002311658.1|  aux/IAA family protein                             171   2e-48   Populus trichocarpa [western balsam poplar]
ref|XP_009591035.1|  PREDICTED: auxin-responsive protein IAA7-like      170   3e-48   
gb|AFZ78617.1|  hypothetical protein                                    170   3e-48   
ref|NP_001268036.1|  uncharacterized protein LOC100250231               170   3e-48   
ref|XP_010551700.1|  PREDICTED: auxin-responsive protein IAA14          170   3e-48   
ref|NP_001280973.1|  auxin-responsive protein IAA16                     170   3e-48   
gb|AEE25654.1|  auxin-responsive protein                                170   4e-48   
ref|XP_011030586.1|  PREDICTED: auxin-responsive protein IAA14-li...    170   4e-48   
gb|KHN05057.1|  Auxin-responsive protein IAA14                          170   4e-48   
dbj|BAJ97201.1|  predicted protein                                      169   6e-48   
gb|KHN22078.1|  Auxin-responsive protein IAA16                          169   6e-48   
ref|NP_001239753.1|  uncharacterized protein LOC100781847               169   6e-48   
ref|XP_004172452.1|  PREDICTED: auxin-responsive protein IAA14-like     169   7e-48   
ref|XP_008788131.1|  PREDICTED: auxin-responsive protein IAA30-like     169   7e-48   
ref|XP_010674855.1|  PREDICTED: auxin-induced protein AUX28             171   7e-48   
ref|XP_003569702.1|  PREDICTED: auxin-responsive protein IAA1-like      168   8e-48   
gb|ABM53872.1|  IAA4                                                    166   8e-48   Cestrum elegans
ref|XP_008654436.1|  PREDICTED: hypothetical protein isoform X1         167   8e-48   
ref|XP_006366663.1|  PREDICTED: auxin-responsive protein IAA16-like     168   9e-48   
ref|XP_004982376.1|  PREDICTED: auxin-responsive protein IAA30-li...    170   9e-48   
ref|XP_004982377.1|  PREDICTED: auxin-responsive protein IAA30-li...    169   1e-47   
gb|EYU30526.1|  hypothetical protein MIMGU_mgv1a012831mg                169   1e-47   
gb|KHN31465.1|  Auxin-responsive protein IAA16                          169   1e-47   
ref|XP_009409331.1|  PREDICTED: auxin-responsive protein IAA1-lik...    169   1e-47   
ref|XP_007034956.1|  Indole-3-acetic acid 7 isoform 1                   169   1e-47   
ref|XP_011038568.1|  PREDICTED: auxin-responsive protein IAA16-like     169   1e-47   
ref|XP_007030567.1|  Indoleacetic acid-induced protein 16               169   1e-47   
ref|XP_004302055.1|  PREDICTED: auxin-responsive protein IAA16-like     169   1e-47   
ref|XP_011091113.1|  PREDICTED: auxin-responsive protein IAA14          169   1e-47   
gb|EEE53551.1|  hypothetical protein OsJ_36765                          167   1e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008465181.1|  PREDICTED: auxin-responsive protein IAA14-like     169   1e-47   
gb|EPS72871.1|  hypothetical protein M569_01882                         167   1e-47   
gb|ACG41827.1|  IAA15 - auxin-responsive Aux/IAA family member          168   1e-47   Zea mays [maize]
gb|KDO48905.1|  hypothetical protein CISIN_1g026005mg                   169   1e-47   
ref|XP_003521753.1|  PREDICTED: auxin-responsive protein IAA16-like     168   1e-47   
ref|XP_009337294.1|  PREDICTED: auxin-responsive protein IAA14-like     168   2e-47   
gb|KHG19190.1|  Auxin-responsive IAA16 -like protein                    168   2e-47   
ref|XP_006432923.1|  hypothetical protein CICLE_v10002290mg             168   2e-47   
ref|XP_010532600.1|  PREDICTED: auxin-responsive protein IAA14          168   2e-47   
ref|XP_009409330.1|  PREDICTED: auxin-responsive protein IAA1-lik...    169   2e-47   
ref|XP_002284133.1|  PREDICTED: auxin-responsive protein IAA14          168   2e-47   Vitis vinifera
gb|AEE25653.1|  auxin-responsive protein                                168   2e-47   
emb|CBI26357.3|  unnamed protein product                                168   2e-47   
gb|KDP23667.1|  hypothetical protein JCGZ_23500                         168   2e-47   
ref|XP_006664171.1|  PREDICTED: auxin-responsive protein IAA30-like     168   2e-47   
ref|NP_001266070.1|  IAA14                                              168   2e-47   
ref|XP_008362015.1|  PREDICTED: auxin-responsive protein IAA14-like     168   2e-47   
ref|XP_004288427.1|  PREDICTED: auxin-responsive protein IAA14-like     167   3e-47   
ref|XP_002531288.1|  Auxin-responsive protein IAA16, putative           168   3e-47   Ricinus communis
gb|ACG46110.1|  IAA1 - auxin-responsive Aux/IAA family member           166   3e-47   Zea mays [maize]
ref|XP_010025014.1|  PREDICTED: auxin-responsive protein IAA16-like     168   3e-47   
ref|NP_001267662.1|  auxin-induced protein AUX28-like                   167   3e-47   
ref|XP_011079949.1|  PREDICTED: auxin-induced protein AUX28-like        167   4e-47   
emb|CDY63072.1|  BnaCnng41350D                                          172   4e-47   
ref|XP_006304183.1|  hypothetical protein CARUB_v10010236mg             167   4e-47   
gb|KHG04941.1|  Auxin-induced AUX28                                     167   4e-47   
ref|XP_002281771.1|  PREDICTED: auxin-responsive protein IAA16-like     167   4e-47   Vitis vinifera
ref|XP_007205640.1|  hypothetical protein PRUPE_ppa009254mg             169   4e-47   
gb|AFS44507.1|  auxin repressor                                         167   4e-47   
gb|EAZ27868.1|  hypothetical protein OsJ_11821                          167   4e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009420668.1|  PREDICTED: auxin-responsive protein IAA30-like     167   4e-47   
ref|XP_002315736.1|  aux/IAA family protein                             168   4e-47   Populus trichocarpa [western balsam poplar]
ref|XP_009418923.1|  PREDICTED: auxin-responsive protein IAA30-like     167   5e-47   
ref|NP_001237212.1|  uncharacterized protein LOC100499872               167   5e-47   
ref|XP_002302075.1|  auxin-induced protein aux28                        167   5e-47   Populus trichocarpa [western balsam poplar]
ref|XP_002319075.1|  hypothetical protein POPTR_0013s03870g             167   5e-47   Populus trichocarpa [western balsam poplar]
ref|XP_004493739.1|  PREDICTED: auxin-induced protein AUX28-like        167   5e-47   
emb|CAN63268.1|  hypothetical protein VITISV_013635                     167   5e-47   Vitis vinifera
gb|KHF98789.1|  Auxin-responsive IAA14 -like protein                    167   5e-47   
ref|XP_007013279.1|  Indoleacetic acid-induced protein 16, putative     166   6e-47   
ref|XP_004134096.1|  PREDICTED: auxin-responsive protein IAA14-li...    167   6e-47   
ref|NP_001067209.1|  Os12g0601300                                       167   8e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657103.1|  PREDICTED: auxin-responsive protein IAA23-like     163   8e-47   
ref|XP_010925299.1|  PREDICTED: auxin-responsive protein IAA1-like      165   8e-47   
ref|XP_004495392.1|  PREDICTED: auxin-responsive protein IAA14-li...    166   8e-47   
ref|XP_011027545.1|  PREDICTED: auxin-responsive protein IAA14 is...    167   8e-47   
ref|NP_001240213.1|  auxin-induced protein ali50                        166   9e-47   
ref|XP_003556389.2|  PREDICTED: auxin-responsive protein IAA14-like     169   9e-47   
ref|XP_006418150.1|  hypothetical protein EUTSA_v10008679mg             166   9e-47   
ref|XP_010024036.1|  PREDICTED: auxin-responsive protein IAA14-like     166   9e-47   
ref|XP_010102292.1|  Auxin-responsive protein IAA16                     167   1e-46   
sp|Q75GK0.1|IAA11_ORYSJ  RecName: Full=Auxin-responsive protein I...    166   1e-46   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006418149.1|  hypothetical protein EUTSA_v10008679mg             166   1e-46   
ref|XP_010923478.1|  PREDICTED: auxin-responsive protein IAA30-li...    166   1e-46   
ref|XP_008451270.1|  PREDICTED: auxin-induced protein AUX28-like        166   1e-46   
gb|EYU33008.1|  hypothetical protein MIMGU_mgv1a012321mg                166   1e-46   
ref|NP_001266055.1|  IAA10 protein                                      165   1e-46   
gb|ABI36493.1|  AUX/IAA16 A                                             163   1e-46   
ref|XP_008438588.1|  PREDICTED: auxin-responsive protein IAA14-like     166   1e-46   
gb|AFK44192.1|  unknown                                                 166   1e-46   
ref|XP_004960835.1|  PREDICTED: auxin-responsive protein IAA1-lik...    164   1e-46   
ref|XP_004495802.1|  PREDICTED: auxin-responsive protein IAA16-like     166   1e-46   
gb|ACU19136.1|  unknown                                                 166   1e-46   Glycine max [soybeans]
gb|KHG01271.1|  Auxin-responsive IAA14 -like protein                    166   1e-46   
ref|XP_003591806.1|  Indoleacetic acid-induced-like protein             166   1e-46   
gb|AFK42876.1|  unknown                                                 166   2e-46   
ref|XP_009409328.1|  PREDICTED: auxin-responsive protein IAA1-lik...    167   2e-46   
gb|EMT29956.1|  Auxin-responsive protein IAA15                          164   2e-46   
gb|AFK37379.1|  unknown                                                 165   2e-46   
ref|XP_004981820.1|  PREDICTED: auxin-responsive protein IAA13-li...    165   2e-46   
emb|CAH59413.1|  auxin resistance protein                               165   2e-46   Plantago major [cart-track plant]
ref|XP_010483317.1|  PREDICTED: auxin-responsive protein IAA17-like     165   2e-46   
ref|XP_004968414.1|  PREDICTED: auxin-responsive protein IAA1-lik...    166   2e-46   
gb|KDO68557.1|  hypothetical protein CISIN_1g026823mg                   165   2e-46   
gb|KEH43017.1|  auxin-responsive AUX/IAA family protein                 166   2e-46   
ref|XP_008382962.1|  PREDICTED: auxin-induced protein AUX28-like        166   2e-46   
ref|XP_006362195.1|  PREDICTED: auxin-responsive protein IAA14-like     165   2e-46   
ref|XP_002889499.1|  hypothetical protein ARALYDRAFT_470401             165   2e-46   
ref|XP_010457463.1|  PREDICTED: auxin-responsive protein IAA17          165   2e-46   
ref|XP_009111119.1|  PREDICTED: auxin-responsive protein IAA17          165   2e-46   
ref|XP_006382798.1|  hypothetical protein POPTR_0005s05560g             166   2e-46   
ref|XP_004965976.1|  PREDICTED: auxin-responsive protein IAA23-li...    163   3e-46   
emb|CDY15493.1|  BnaA08g27770D                                          165   3e-46   
ref|XP_010475075.1|  PREDICTED: auxin-responsive protein IAA17-like     165   3e-46   
gb|ADJ68049.1|  auxin responsive protein                                165   3e-46   
gb|AEE25650.1|  auxin-responsive protein                                166   3e-46   
gb|ABM53874.1|  IAA6                                                    162   3e-46   Cestrum elegans
gb|AAM21317.1|AF373100_1  auxin-regulated protein                       165   3e-46   Populus tremula x Populus tremuloides
ref|XP_011032399.1|  PREDICTED: auxin-responsive protein IAA16-like     165   3e-46   
ref|XP_010556884.1|  PREDICTED: auxin-responsive protein IAA17          165   3e-46   
ref|XP_011030585.1|  PREDICTED: auxin-responsive protein IAA14-li...    165   3e-46   
ref|NP_171921.1|  auxin-responsive protein IAA17                        164   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006383686.1|  auxin-induced protein aux28                        165   3e-46   
gb|AAM64837.1|  putative auxin-induced protein, IAA17/AXR3-1            164   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450026.1|  PREDICTED: auxin-responsive protein IAA14-like     164   3e-46   
gb|ACJ84642.1|  unknown                                                 165   4e-46   Medicago truncatula
ref|XP_011073485.1|  PREDICTED: auxin-responsive protein IAA14          165   4e-46   
gb|ABH01143.1|  auxin-regulated protein                                 165   4e-46   Populus tomentosa [Chinese white poplar]
ref|XP_010435110.1|  PREDICTED: auxin-responsive protein IAA14          164   4e-46   
ref|NP_001280875.1|  auxin-responsive protein IAA14-like                165   4e-46   
gb|AFK44393.1|  unknown                                                 164   4e-46   
ref|XP_010440448.1|  PREDICTED: auxin-responsive protein IAA14-like     164   4e-46   
ref|XP_011042427.1|  PREDICTED: auxin-induced protein AUX28-like        164   5e-46   
gb|KFK24541.1|  hypothetical protein AALP_AAs58011U000100               164   5e-46   
ref|XP_002520980.1|  Auxin-induced protein AUX28, putative              164   5e-46   Ricinus communis
ref|NP_001267710.1|  auxin-responsive protein IAA9-like                 167   6e-46   
ref|XP_011082603.1|  PREDICTED: auxin-responsive protein IAA14-like     163   6e-46   
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like      167   6e-46   
ref|XP_006443920.1|  hypothetical protein CICLE_v10022032mg             164   6e-46   
gb|AAM96891.1|  auxin-responsive protein IAA1                           162   7e-46   Mirabilis jalapa
ref|XP_004289900.1|  PREDICTED: auxin-induced protein AUX28-like        164   7e-46   
ref|XP_007050421.1|  Indole-3-acetic acid inducible 14 isoform 1        166   8e-46   
ref|XP_009354870.1|  PREDICTED: auxin-induced protein AUX28-like        164   8e-46   
emb|CAC84710.1|  aux/IAA protein                                        165   9e-46   Populus tremula x Populus tremuloides
ref|XP_009367750.1|  PREDICTED: auxin-induced protein AUX28-like        164   1e-45   
dbj|BAH15071.1|  indole-3-acetic acid 14 transcription factor like      164   1e-45   Malus prunifolia
gb|KEH27147.1|  auxin response factor                                   164   1e-45   
ref|XP_006443921.1|  hypothetical protein CICLE_v10022032mg             163   1e-45   
gb|AAP44406.1|  auxin-induced protein 3                                 164   1e-45   Pinus taeda
ref|NP_001275473.1|  Aux/IAA protein                                    166   1e-45   
gb|ABB55368.1|  Aux/IAA protein-like                                    166   1e-45   Solanum tuberosum [potatoes]
emb|CAN72026.1|  hypothetical protein VITISV_014421                     164   1e-45   Vitis vinifera
ref|XP_008783241.1|  PREDICTED: auxin-responsive protein IAA17-li...    166   1e-45   
dbj|BAJ34138.1|  unnamed protein product                                163   2e-45   
ref|XP_004134097.1|  PREDICTED: auxin-responsive protein IAA14-li...    162   2e-45   
gb|ACL81167.1|  auxin-responsive protein IAA1                           164   2e-45   Mirabilis jalapa
ref|XP_006408159.1|  hypothetical protein EUTSA_v10021441mg             163   2e-45   
ref|XP_007147174.1|  hypothetical protein PHAVU_006G102100g             164   2e-45   
ref|NP_001241599.1|  uncharacterized protein LOC100803065               163   2e-45   
ref|NP_001054800.1|  Os05g0178600                                       162   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010522504.1|  PREDICTED: auxin-responsive protein IAA17-like     162   2e-45   
emb|CBI19314.3|  unnamed protein product                                165   2e-45   
ref|XP_008372303.1|  PREDICTED: auxin-induced protein AUX28-like        163   3e-45   
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              166   3e-45   
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    166   3e-45   
ref|NP_001268170.1|  Aux/IAA protein                                    166   3e-45   
gb|KHN18836.1|  Auxin-induced protein AUX28                             162   3e-45   
gb|ABD98055.1|  auxin-regulated protein                                 162   3e-45   Striga asiatica [witchweed]
gb|EYU32514.1|  hypothetical protein MIMGU_mgv1a012542mg                162   3e-45   
gb|ACV31210.1|  auxin/indole-3-acetic acid 4                            161   4e-45   Solanum tuberosum [potatoes]
gb|AAL92850.1|  Aux/IAA protein                                         165   4e-45   Vitis vinifera
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    166   4e-45   
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    166   4e-45   
gb|ABI36490.1|  AUX/IAA7 C                                              159   4e-45   
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like      165   4e-45   
emb|CAC84706.1|  aux/IAA protein                                        165   5e-45   
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     165   5e-45   
ref|XP_002463898.1|  hypothetical protein SORBIDRAFT_01g008480          162   5e-45   
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like      165   5e-45   
ref|XP_006284476.1|  hypothetical protein CARUB_v10005662mg             161   5e-45   
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like      165   5e-45   
ref|XP_009614298.1|  PREDICTED: auxin-responsive protein IAA27-like     162   5e-45   
gb|EAZ01547.1|  hypothetical protein OsI_23582                          160   5e-45   
ref|NP_001057986.1|  Os06g0597000                                       160   5e-45   
ref|XP_002302351.1|  auxin-responsive family protein                    165   5e-45   
emb|CAI77628.1|  Aux/IAA protein                                        164   6e-45   
gb|KHG27397.1|  Auxin-responsive IAA27 -like protein                    161   6e-45   
gb|AFZ78618.1|  hypothetical protein                                    165   6e-45   
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like      165   6e-45   
gb|KFK39592.1|  hypothetical protein AALP_AA3G264300                    161   6e-45   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           165   6e-45   
gb|AFK36086.1|  unknown                                                 162   7e-45   
ref|XP_010485858.1|  PREDICTED: auxin-responsive protein IAA16-like     161   7e-45   
gb|AAC49055.1|  IAA14                                                   159   7e-45   
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      165   7e-45   
ref|XP_006451212.1|  hypothetical protein CICLE_v10009070mg             163   8e-45   
gb|KDP41528.1|  hypothetical protein JCGZ_15935                         164   9e-45   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    164   9e-45   
gb|ABI36487.1|  AUX/IAA7 A                                              158   9e-45   
emb|CDX89832.1|  BnaA10g02500D                                          160   9e-45   
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g             164   1e-44   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 164   1e-44   
ref|XP_006298251.1|  hypothetical protein CARUB_v10014321mg             162   1e-44   
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9           164   1e-44   
ref|XP_007160318.1|  hypothetical protein PHAVU_002G311500g             162   1e-44   
gb|ABM53871.1|  IAA3                                                    158   1e-44   
ref|XP_006475665.1|  PREDICTED: auxin-responsive protein IAA27-li...    162   1e-44   
ref|XP_004960834.1|  PREDICTED: auxin-responsive protein IAA1-lik...    160   1e-44   
gb|AAC39440.1|  IAA17/AXR3-1 protein                                    160   1e-44   
gb|ADL70671.1|  indole-3-acetic acid inducible 16                       158   1e-44   
gb|AEI70507.1|  auxin-responsive protein                                164   1e-44   
gb|AFK49596.1|  unknown                                                 162   1e-44   
ref|XP_010418365.1|  PREDICTED: auxin-responsive protein IAA16          160   1e-44   
gb|ABR16302.1|  unknown                                                 163   1e-44   
gb|AAP44405.1|  auxin-induced protein 2                                 162   1e-44   
gb|KHN09036.1|  Auxin-responsive protein IAA8                           164   1e-44   
gb|AFK45766.1|  unknown                                                 161   2e-44   
ref|XP_003630761.1|  Auxin-responsive protein (Aux/IAA)                 162   2e-44   
ref|XP_010521483.1|  PREDICTED: auxin-responsive protein IAA27-li...    160   2e-44   
ref|XP_010915883.1|  PREDICTED: auxin-responsive protein IAA17-like     163   2e-44   
ref|NP_187124.1|  auxin-responsive protein IAA16                        160   2e-44   
ref|XP_008235328.1|  PREDICTED: auxin-induced protein AUX28-like        160   2e-44   
emb|CAD10639.1|  IAA9 protein                                           163   2e-44   
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g             162   2e-44   
dbj|BAI94494.1|  Aux/IAA protein                                        160   2e-44   
ref|NP_001288939.1|  auxin-responsive protein IAA16                     160   2e-44   
ref|NP_001241389.1|  uncharacterized protein LOC100783314               163   2e-44   
ref|XP_009380572.1|  PREDICTED: auxin-responsive protein IAA21-li...    162   2e-44   
ref|XP_010679165.1|  PREDICTED: auxin-responsive protein IAA14-like     161   2e-44   
ref|NP_001050713.2|  Os03g0633500                                       160   2e-44   
gb|ACU18407.1|  unknown                                                 160   2e-44   
gb|KFK37887.1|  hypothetical protein AALP_AA3G042100                    160   2e-44   
ref|XP_003615390.1|  Auxin-responsive protein IAA5                      163   2e-44   
ref|XP_006343091.1|  PREDICTED: auxin-responsive protein IAA27-like     161   2e-44   
ref|XP_006850381.1|  hypothetical protein AMTR_s00184p00030540          164   2e-44   
ref|XP_007162490.1|  hypothetical protein PHAVU_001G156600g             160   2e-44   
emb|CDY41894.1|  BnaC05g47100D                                          160   2e-44   
ref|XP_006406100.1|  hypothetical protein EUTSA_v10021428mg             160   3e-44   
emb|CDY50750.1|  BnaAnng10570D                                          161   3e-44   
gb|AAV50046.1|  auxin-induced protein                                   158   3e-44   
gb|ACL54532.1|  unknown                                                 160   3e-44   
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                162   3e-44   
ref|NP_001150629.1|  LOC100284262                                       160   3e-44   
ref|XP_009421456.1|  PREDICTED: auxin-responsive protein IAA21-like     162   3e-44   
ref|NP_193191.2|  auxin-responsive protein IAA14                        159   3e-44   
ref|XP_006654102.1|  PREDICTED: auxin-responsive protein IAA15-like     158   3e-44   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...    163   3e-44   
ref|XP_007034957.1|  Indole-3-acetic acid inducible 14 isoform 2        159   3e-44   
emb|CDP00957.1|  unnamed protein product                                163   3e-44   
emb|CDY18214.1|  BnaC05g02370D                                          159   3e-44   
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      163   4e-44   
emb|CBI28036.3|  unnamed protein product                                157   4e-44   
ref|XP_010038039.1|  PREDICTED: auxin-induced protein AUX28-like        160   4e-44   
ref|XP_010466604.1|  PREDICTED: auxin-responsive protein IAA7-like      159   4e-44   
ref|XP_009388718.1|  PREDICTED: auxin-responsive protein IAA17-like     161   4e-44   
emb|CAC85936.1|  putative auxin induced transcription factor Aux/IAA    161   4e-44   
gb|KHN16618.1|  Auxin-responsive protein IAA27                          160   4e-44   
gb|ADL70672.1|  indole-3-acetic acid inducible 16                       157   5e-44   
ref|NP_001266034.1|  IAA6 protein                                       160   5e-44   
ref|XP_007201399.1|  hypothetical protein PRUPE_ppa010342mg             159   5e-44   
ref|XP_007144686.1|  hypothetical protein PHAVU_007G176600g             159   5e-44   
ref|XP_010512022.1|  PREDICTED: auxin-responsive protein IAA7           159   5e-44   
ref|XP_010488346.1|  PREDICTED: auxin-responsive protein IAA7-like      159   5e-44   
ref|XP_006353472.1|  PREDICTED: auxin-responsive protein IAA27          160   6e-44   
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                    161   6e-44   
gb|AEI70506.1|  auxin-responsive protein                                161   6e-44   
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg             162   6e-44   
gb|ABK24636.1|  unknown                                                 163   6e-44   
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                     162   6e-44   
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      162   6e-44   
ref|XP_002514266.1|  Auxin-responsive protein IAA27, putative           160   6e-44   
ref|XP_007201400.1|  hypothetical protein PRUPE_ppa010342mg             159   7e-44   
gb|KGN60808.1|  hypothetical protein Csa_2G010920                       159   7e-44   
ref|XP_002868277.1|  hypothetical protein ARALYDRAFT_493451             158   7e-44   
ref|XP_009135842.1|  PREDICTED: auxin-responsive protein IAA7-like      159   8e-44   
gb|KDP21369.1|  hypothetical protein JCGZ_21840                         159   8e-44   
gb|EMS51633.1|  Auxin-responsive protein IAA23                          157   8e-44   
gb|EPS64756.1|  hypothetical protein M569_10024                         158   8e-44   
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27          160   8e-44   
gb|EEC75792.1|  hypothetical protein OsI_12721                          156   9e-44   
ref|XP_006381732.1|  hypothetical protein POPTR_0006s16640g             160   9e-44   
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                   162   9e-44   
ref|XP_004503453.1|  PREDICTED: auxin-responsive protein IAA27-like     160   9e-44   
gb|AAM12952.1|  auxin-regulated protein                                 161   9e-44   
ref|XP_006414696.1|  hypothetical protein EUTSA_v10026031mg             159   9e-44   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9-like      162   9e-44   
ref|XP_009124981.1|  PREDICTED: auxin-responsive protein IAA16-like     158   9e-44   
ref|XP_003554705.1|  PREDICTED: auxin-responsive protein IAA16-li...    158   1e-43   
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...    161   1e-43   
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...    161   1e-43   
ref|XP_008455985.1|  PREDICTED: auxin-responsive protein IAA16 is...    158   1e-43   
ref|XP_008455992.1|  PREDICTED: auxin-responsive protein IAA16 is...    158   1e-43   
ref|XP_004965975.1|  PREDICTED: auxin-responsive protein IAA23-li...    156   1e-43   
ref|XP_006298436.1|  hypothetical protein CARUB_v10014507mg             158   1e-43   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like      161   1e-43   
ref|XP_004142529.1|  PREDICTED: auxin-responsive protein IAA16-like     158   1e-43   
ref|XP_007013107.1|  Phytochrome-associated protein 2 isoform 2         160   1e-43   
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27          160   1e-43   
ref|XP_007013106.1|  Phytochrome-associated protein 2 isoform 1         160   1e-43   
ref|XP_009786555.1|  PREDICTED: auxin-responsive protein IAA27-like     159   1e-43   
ref|XP_004156465.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    158   2e-43   
gb|AFK38538.1|  unknown                                                 160   2e-43   
emb|CBI36106.3|  unnamed protein product                                159   2e-43   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...    161   2e-43   
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27          160   2e-43   
emb|CDY47148.1|  BnaA08g05350D                                          157   2e-43   
ref|XP_008802939.1|  PREDICTED: auxin-responsive protein IAA17-like     160   2e-43   
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          161   2e-43   
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             161   2e-43   
gb|ACJ84768.1|  unknown                                                 156   2e-43   
gb|AGV54230.1|  auxin-induced protein AUX28                             158   2e-43   
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like     160   2e-43   
ref|XP_007024229.1|  Phytochrome-associated protein 2 isoform 2         160   2e-43   
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 161   2e-43   
gb|AAP44408.1|  auxin-induced protein 5                                 158   2e-43   
emb|CDY32537.1|  BnaA09g50590D                                          157   2e-43   
ref|XP_010098941.1|  Serine/threonine protein phosphatase 2A 57 k...    165   2e-43   
ref|XP_009119323.1|  PREDICTED: auxin-responsive protein IAA17-like     157   2e-43   
ref|XP_007203891.1|  hypothetical protein PRUPE_ppa009134mg             159   2e-43   
gb|EMS64858.1|  Auxin-responsive protein IAA30                          159   2e-43   
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like     159   2e-43   
ref|NP_001236693.1|  auxin-induced protein AUX28                        157   2e-43   
ref|XP_006584572.1|  PREDICTED: uncharacterized protein LOC100795...    160   2e-43   
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             161   2e-43   
gb|KHN02537.1|  Auxin-induced protein AUX28                             158   2e-43   
ref|NP_188945.1|  auxin-responsive protein IAA7                         157   3e-43   
gb|KHN08222.1|  Auxin-responsive protein IAA8                           160   3e-43   
ref|XP_010925905.1|  PREDICTED: auxin-responsive protein IAA17-like     159   3e-43   
ref|XP_009390697.1|  PREDICTED: auxin-responsive protein IAA17-like     159   3e-43   
gb|KHN30563.1|  Auxin-responsive protein IAA14                          157   3e-43   
gb|AAM65301.1|  indoleacetic acid (IAA)-inducible gene (IAA7)           157   3e-43   
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      160   3e-43   
ref|XP_002883395.1|  hypothetical protein ARALYDRAFT_319024             157   3e-43   
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-like      160   3e-43   
ref|XP_009774736.1|  PREDICTED: auxin-responsive protein IAA27-like     159   3e-43   
gb|KHN41649.1|  Auxin-responsive protein IAA27                          158   3e-43   
gb|AEV89263.1|  IAA9                                                    159   3e-43   
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      160   3e-43   
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like      160   3e-43   
ref|XP_009107777.1|  PREDICTED: auxin-responsive protein IAA14          157   3e-43   
ref|NP_001239808.1|  uncharacterized protein LOC100778529               158   3e-43   
ref|XP_004495391.1|  PREDICTED: auxin-responsive protein IAA14-li...    157   4e-43   
ref|XP_008462706.1|  PREDICTED: auxin-responsive protein IAA16-li...    157   4e-43   
gb|EYU46510.1|  hypothetical protein MIMGU_mgv1a013084mg                156   4e-43   
ref|NP_001280937.1|  auxin-responsive protein IAA27                     159   4e-43   
gb|ADL70673.1|  indole-3-acetic acid inducible 16                       154   4e-43   
emb|CDP03299.1|  unnamed protein product                                159   4e-43   
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like     159   5e-43   
gb|KHG03466.1|  Auxin-responsive IAA27 -like protein                    159   5e-43   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like     158   5e-43   
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             159   6e-43   
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like      159   6e-43   
ref|NP_001140514.1|  IAA23-auxin-responsive Aux/IAA family member       155   6e-43   
emb|CAN77436.1|  hypothetical protein VITISV_007399                     159   6e-43   
gb|KEH42778.1|  auxin-responsive AUX/IAA family protein                 156   6e-43   
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like     157   6e-43   
emb|CDY10068.1|  BnaC08g43830D                                          156   6e-43   
ref|XP_003563684.1|  PREDICTED: auxin-responsive protein IAA23-like     154   7e-43   
ref|XP_010463960.1|  PREDICTED: auxin-responsive protein IAA16-like     156   7e-43   
ref|XP_011072390.1|  PREDICTED: auxin-responsive protein IAA27          159   7e-43   
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)                 159   7e-43   
ref|XP_009417112.1|  PREDICTED: auxin-responsive protein IAA30-like     156   7e-43   
ref|XP_009118658.1|  PREDICTED: auxin-responsive protein IAA17-like     156   7e-43   
ref|XP_004965463.1|  PREDICTED: auxin-responsive protein IAA21-like     156   7e-43   
ref|XP_010249636.1|  PREDICTED: auxin-responsive protein IAA27          159   8e-43   
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      159   8e-43   
gb|KEH43016.1|  auxin-responsive AUX/IAA family protein                 156   8e-43   
gb|ABY48132.1|  GH1 protein                                             159   8e-43   
ref|XP_003521268.1|  PREDICTED: auxin-induced protein AUX28-like        156   9e-43   
gb|ABR17764.1|  unknown                                                 158   9e-43   
ref|XP_002306817.1|  hypothetical protein POPTR_0005s23980g             155   9e-43   
ref|XP_009336858.1|  PREDICTED: auxin-responsive protein IAA27-like     158   9e-43   
gb|ACJ83896.1|  unknown                                                 156   9e-43   
ref|XP_010087762.1|  Auxin-responsive protein IAA7                      157   9e-43   
emb|CDY30017.1|  BnaC01g39910D                                          155   1e-42   
ref|XP_010254042.1|  PREDICTED: auxin-responsive protein IAA27-like     158   1e-42   
gb|AGV54485.1|  auxin-responsive protein                                159   1e-42   
ref|NP_001149952.1|  IAA13 - auxin-responsive Aux/IAA family member     155   1e-42   
ref|XP_008463353.1|  PREDICTED: auxin-responsive protein IAA16-like     155   1e-42   
ref|XP_002284118.1|  PREDICTED: auxin-responsive protein IAA27          158   1e-42   
gb|ACU21378.1|  unknown                                                 156   1e-42   
emb|CDX89499.1|  BnaC04g35180D                                          156   1e-42   
gb|ADL70681.1|  indole-3-acetic acid inducible 16                       153   1e-42   
ref|XP_002440705.1|  hypothetical protein SORBIDRAFT_09g005430          154   1e-42   
gb|AFK38170.1|  unknown                                                 158   1e-42   
ref|XP_008789309.1|  PREDICTED: auxin-responsive protein IAA27-like     157   1e-42   
emb|CDP02673.1|  unnamed protein product                                159   2e-42   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    159   2e-42   
emb|CDY62130.1|  BnaC08g47390D                                          155   2e-42   
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             159   2e-42   
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           159   2e-42   
ref|XP_003597715.1|  Auxin-responsive protein IAA                       157   2e-42   



>ref|XP_011081682.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=197

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/124 (81%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRSYRKN+MK+ K+VKVAVDGAPYLRKVDL  + SYQQLL +LE+MFTCLTIC
Sbjct  69   QVVGWPPVRSYRKNMMKNCKYVKVAVDGAPYLRKVDLEIYTSYQQLLAALEEMFTCLTIC  128

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            NV+N +K+MD+S+GTEYVPTYED+DGDWMLVGDVPWKMFVESCKR+RLMKSS+ VGLAP 
Sbjct  129  NVVNERKIMDSSNGTEYVPTYEDRDGDWMLVGDVPWKMFVESCKRMRLMKSSEAVGLAPK  188

Query  352  TPSK  341
            T SK
Sbjct  189  TSSK  192



>ref|XP_002517529.1| Auxin-responsive protein IAA1, putative [Ricinus communis]
 gb|EEF44693.1| Auxin-responsive protein IAA1, putative [Ricinus communis]
Length=217

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/129 (79%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR+YRKN MKS+KFVKVAVDGAPYLRKVDL  ++SYQQLLT+LEDMF+C TI 
Sbjct  88   QVVGWPPVRAYRKNAMKSSKFVKVAVDGAPYLRKVDLEMYNSYQQLLTALEDMFSCFTIR  147

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +K+MD  +G EYVPTYEDKDGDWM+VGDVPW MFVESCKRLRLMKSS+  GLAP 
Sbjct  148  NYLNERKIMDQVNGVEYVPTYEDKDGDWMMVGDVPWTMFVESCKRLRLMKSSEATGLAPR  207

Query  352  TPSKCSRTS  326
            TPSKCS +S
Sbjct  208  TPSKCSSSS  216



>gb|KDP37176.1| hypothetical protein JCGZ_06232 [Jatropha curcas]
Length=220

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 114/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR+YRKN MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL++LEDMF+CL I 
Sbjct  91   QVVGWPPVRAYRKNAMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLSALEDMFSCLAIR  150

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +K+MD  +G EYVPTYEDKDGDWM+VGDVPWKMFVESCKR+RLMKS++ +GL P 
Sbjct  151  NYLNERKIMDQVNGVEYVPTYEDKDGDWMMVGDVPWKMFVESCKRVRLMKSTETIGLGPR  210

Query  352  TPSKCSRTS  326
            TPSKCS +S
Sbjct  211  TPSKCSSSS  219



>ref|XP_007024033.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
 gb|EOY26655.1| AUX/IAA transcriptional regulator family protein [Theobroma cacao]
Length=202

 Score =   214 bits (546),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR+ RKN MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL+SLEDMF+C TI 
Sbjct  74   QVVGWPPVRALRKNAMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLSSLEDMFSCFTIR  133

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN KK++D  +G EYVPTYEDKDGDWMLVGDVPW+MFV+SCKRLRLMKSS+ +GLAP 
Sbjct  134  NCLNEKKIVDQVNGLEYVPTYEDKDGDWMLVGDVPWQMFVDSCKRLRLMKSSEAIGLAPR  193

Query  352  TPSKCSRTS  326
            TP KCS T+
Sbjct  194  TPPKCSSTT  202



>ref|XP_010249884.1| PREDICTED: auxin-responsive protein IAA1 [Nelumbo nucifera]
Length=217

 Score =   215 bits (547),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN +KS  +VKVAVDGAPYLRKVDL  + SYQQLL++LE+MFTC TI 
Sbjct  89   QVVGWPPVRSFRKNALKSCTYVKVAVDGAPYLRKVDLETYSSYQQLLSALENMFTCFTIR  148

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            NVLN +KLMD  +GTEYVPTYEDKDGDWMLVGDVPWKMFV SCKR+RLMKSS+ VGLAP 
Sbjct  149  NVLNERKLMDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRIRLMKSSEAVGLAPG  208

Query  352  TPSKCSRTS  326
            TP++ +  S
Sbjct  209  TPAQSASAS  217



>ref|XP_010254225.1| PREDICTED: auxin-responsive protein IAA1-like [Nelumbo nucifera]
Length=212

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN++KS  +VKVAVDGAPYLRKVDL  + SYQQLL++LE+MFTC TI 
Sbjct  85   QVVGWPPVRSFRKNVLKSCTYVKVAVDGAPYLRKVDLETYGSYQQLLSALEEMFTCFTIR  144

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            NVLN  KLMD  +GTEYVPTYEDKDGDWMLVGDVPWKMFV SCKR+RLMKSS+ VGLAP 
Sbjct  145  NVLNESKLMDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRIRLMKSSEAVGLAPR  204

Query  352  TPSKCSRT  329
            TP++ + T
Sbjct  205  TPTQSTST  212



>ref|XP_009611025.1| PREDICTED: auxin-responsive protein IAA17-like [Nicotiana tomentosiformis]
Length=207

 Score =   213 bits (542),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRSYRKN++   K+VKVAVDGAPYLRKVDL  + SYQ+LL +L++MFTCLTIC
Sbjct  79   QVVGWPPVRSYRKNMIDKCKYVKVAVDGAPYLRKVDLEIYDSYQKLLNALQNMFTCLTIC  138

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  +  KLMD ++G EYVPTYEDKDGDWMLVGDVPWKMFV++CKR+RLMKSS+ +GLAP 
Sbjct  139  NFQSQSKLMDITNGVEYVPTYEDKDGDWMLVGDVPWKMFVDTCKRIRLMKSSEAIGLAPR  198

Query  352  TPSKCSRTS  326
            TP KCS TS
Sbjct  199  TPVKCSSTS  207



>ref|XP_008377585.1| PREDICTED: auxin-responsive protein IAA1 [Malus domestica]
 ref|XP_008347482.1| PREDICTED: auxin-responsive protein IAA1-like [Malus domestica]
Length=205

 Score =   209 bits (531),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR  RKN+MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL +LEDMF+ LTI 
Sbjct  77   QVVGWPPVRVSRKNLMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLGALEDMFSFLTIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN  KLMD ++G EYVPTYED+DGDWMLVGDVPWKMFVE+CKRLRLMKSS+ +GLAP+
Sbjct  137  NCLNESKLMDPANGVEYVPTYEDRDGDWMLVGDVPWKMFVETCKRLRLMKSSEAIGLAPS  196

Query  352  TPSKCSRTS  326
            TP +C  T+
Sbjct  197  TPPRCRSTN  205



>ref|XP_007215971.1| hypothetical protein PRUPE_ppa011570mg [Prunus persica]
 gb|EMJ17170.1| hypothetical protein PRUPE_ppa011570mg [Prunus persica]
Length=205

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR  RKN+MK+ K+VKVAVDGAPYLRKVDL  ++SYQQLL +LEDMF+ LTI 
Sbjct  77   QVVGWPPVRVARKNLMKTCKYVKVAVDGAPYLRKVDLEMYNSYQQLLGALEDMFSFLTIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +KLMD ++G EYVPTYED+DGDWMLVGDVPWKMFVESCKRLRLMKSS+ VGLAP 
Sbjct  137  NYLNERKLMDPANGVEYVPTYEDRDGDWMLVGDVPWKMFVESCKRLRLMKSSEAVGLAPR  196

Query  352  TPSKCSRTS  326
            TP K + TS
Sbjct  197  TPPKSTSTS  205



>ref|XP_009782640.1| PREDICTED: auxin-responsive protein IAA17-like [Nicotiana sylvestris]
Length=207

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRSYRKN++   K+VKVAVDGAPYLRKVDL  + SYQ++L +L++MFTCLTIC
Sbjct  79   QVVGWPPVRSYRKNMIDKGKYVKVAVDGAPYLRKVDLELYDSYQKMLNALQNMFTCLTIC  138

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  +  KLMD ++G EYVPTYEDKDGD MLVGDVPWKMFV++CKR+RLMKSS+ +GLAP 
Sbjct  139  NFQSESKLMDITNGVEYVPTYEDKDGDRMLVGDVPWKMFVDTCKRIRLMKSSEAIGLAPR  198

Query  352  TPSKCSRTS  326
            TP KCS TS
Sbjct  199  TPVKCSSTS  207



>ref|XP_008228610.1| PREDICTED: auxin-responsive protein IAA1 [Prunus mume]
Length=205

 Score =   208 bits (529),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/129 (77%), Positives = 112/129 (87%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR  RKN+MK+ K+VKVAVDGAPYLRKVDL  ++SYQQLL +LEDMF+ LTI 
Sbjct  77   QVVGWPPVRVARKNLMKTCKYVKVAVDGAPYLRKVDLEMYNSYQQLLGALEDMFSFLTIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +KLMD ++G EYVPTYED+DGDWMLVGDVPWKMFVESCKRLRLMKSS+ VGLAP 
Sbjct  137  NYLNERKLMDPANGVEYVPTYEDRDGDWMLVGDVPWKMFVESCKRLRLMKSSEAVGLAPR  196

Query  352  TPSKCSRTS  326
            TP K + TS
Sbjct  197  TPPKSTTTS  205



>ref|XP_006427106.1| hypothetical protein CICLE_v10026522mg [Citrus clementina]
 gb|ESR40346.1| hypothetical protein CICLE_v10026522mg [Citrus clementina]
Length=202

 Score =   207 bits (527),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVR+YRKN MK S KFVKVAV+GAPYLRKVDL  +HSYQ+LL++LEDMF+ LTI
Sbjct  73   QVVGWPPVRAYRKNAMKGSCKFVKVAVEGAPYLRKVDLEIYHSYQELLSALEDMFSFLTI  132

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N +N +K++D  +G EYVPTYEDKDGDWMLVGDVPWKMFVESCKR+RLMKSS+ +GLAP
Sbjct  133  RNHVNERKIIDNVNGVEYVPTYEDKDGDWMLVGDVPWKMFVESCKRVRLMKSSEAIGLAP  192

Query  355  TTPSKCSRTS  326
             TP+K S  S
Sbjct  193  RTPAKNSSKS  202



>ref|XP_006343103.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA17-like 
[Solanum tuberosum]
Length=253

 Score =   208 bits (530),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QV+GWPPVRSYRKN+++  K+VKVAVDGAPYLRKVDL  + SYQ+LL +LE+MFTCLTIC
Sbjct  125  QVIGWPPVRSYRKNVIEKCKYVKVAVDGAPYLRKVDLEMYDSYQKLLNALENMFTCLTIC  184

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  +  KLMD ++G EYVPTYEDKDGDWMLVGDVPWKMFV++CKR+RLMKS++ +GLAP 
Sbjct  185  NSQSESKLMDLTNGVEYVPTYEDKDGDWMLVGDVPWKMFVDTCKRIRLMKSTEAIGLAPR  244

Query  352  TPSKCSRTS  326
            TP   S +S
Sbjct  245  TPGGSSSSS  253



>ref|XP_006465436.1| PREDICTED: auxin-responsive protein IAA17-like [Citrus sinensis]
Length=202

 Score =   206 bits (525),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVR+YRK+ MK S KFVKVAVDGAPYLRKVDL  +HSYQ+LL++LEDMF+ LTI
Sbjct  73   QVVGWPPVRAYRKSAMKGSCKFVKVAVDGAPYLRKVDLEIYHSYQELLSALEDMFSFLTI  132

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N +N +K++D  +G EYVPTYEDKDGDWMLVGDVPWKMFVESCKR+RLMKSS+ +GLAP
Sbjct  133  RNHVNERKIIDNVNGVEYVPTYEDKDGDWMLVGDVPWKMFVESCKRVRLMKSSEAIGLAP  192

Query  355  TTPSKCSRTS  326
             TP+K S  S
Sbjct  193  RTPAKNSSKS  202



>ref|NP_001266077.1| IAA15 [Solanum lycopersicum]
 gb|AEX00358.1| IAA15 [Solanum lycopersicum]
Length=252

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QV+GWPPVRSYRKN+++  K+VKVAVDGAPYLRKVDL  + SYQ+LL +LE+MFTCLTIC
Sbjct  126  QVIGWPPVRSYRKNVIEKCKYVKVAVDGAPYLRKVDLEMYDSYQKLLNALENMFTCLTIC  185

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  +  KLMD ++G EYVPTYEDKDGDWMLVGDVPWKMFV++CKR+RLMKS++ +GLAP 
Sbjct  186  NSQSESKLMDLTNGVEYVPTYEDKDGDWMLVGDVPWKMFVDTCKRIRLMKSTEAIGLAPR  245

Query  352  TPSKCS  335
            TP + S
Sbjct  246  TPGRSS  251



>ref|XP_009339009.1| PREDICTED: auxin-responsive protein IAA1 [Pyrus x bretschneideri]
Length=205

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/129 (74%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR  RK +MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL +LEDMF+ LTI 
Sbjct  77   QVVGWPPVRVSRKKLMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLGALEDMFSFLTIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN  KLMD ++G EYVPTYED+DGDWMLVGDVPWKMFVE+CKRLRLMKSS+ +GLAP+
Sbjct  137  NCLNESKLMDPANGVEYVPTYEDRDGDWMLVGDVPWKMFVETCKRLRLMKSSEAIGLAPS  196

Query  352  TPSKCSRTS  326
            TP +C  T+
Sbjct  197  TPPRCRSTN  205



>ref|XP_002299625.1| auxin-induced protein IAA4 [Populus trichocarpa]
 gb|ABK94664.1| unknown [Populus trichocarpa]
 gb|EEE84430.1| auxin-induced protein IAA4 [Populus trichocarpa]
Length=220

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 112/133 (84%), Gaps = 4/133 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCL--T  539
            QVVGWPPVR+YRKN MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL +L+DMF+C   T
Sbjct  88   QVVGWPPVRAYRKNAMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLNALQDMFSCFSFT  147

Query  538  ICNVLNGKKLMD--TSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVG  365
            I N LN + +M+   ++G EYVPTYEDKDGDWM++GDVPWKMFVESCKRLRLMKSS+  G
Sbjct  148  IRNYLNERTIMEQEVNNGVEYVPTYEDKDGDWMMLGDVPWKMFVESCKRLRLMKSSEATG  207

Query  364  LAPTTPSKCSRTS  326
             AP TPSKCS +S
Sbjct  208  FAPRTPSKCSSSS  220



>gb|KDO58189.1| hypothetical protein CISIN_1g044582mg [Citrus sinensis]
Length=202

 Score =   205 bits (521),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVR+YRK+ MK S KFVKVAV+GAPYLRKVDL  +HSYQ+LL++LEDMF+ LTI
Sbjct  73   QVVGWPPVRAYRKSAMKGSCKFVKVAVEGAPYLRKVDLEIYHSYQELLSALEDMFSFLTI  132

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N +N +K++D  +G EYVPTYEDKDGDWMLVGDVPWKMFVESCKR+RLMKSS+ +GLAP
Sbjct  133  RNHVNERKIIDNVNGVEYVPTYEDKDGDWMLVGDVPWKMFVESCKRVRLMKSSEAIGLAP  192

Query  355  TTPSKCSRTS  326
             TP+K S  S
Sbjct  193  RTPAKNSSKS  202



>ref|XP_010033899.1| PREDICTED: auxin-responsive protein IAA1 [Eucalyptus grandis]
 gb|KCW53763.1| hypothetical protein EUGRSUZ_J03016 [Eucalyptus grandis]
Length=215

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 110/129 (85%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            Q VGWPPV+++RK++MKS K+VKVAVDGAPYLRKVDL A+ SYQQLL +LE +F+C +IC
Sbjct  87   QAVGWPPVKAFRKSVMKSCKYVKVAVDGAPYLRKVDLEAYDSYQQLLAALEKLFSCFSIC  146

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  + +K++D ++G E++PTYEDKDGDWMLVGDVPWKMFVESCKRLR MKSS+  GL PT
Sbjct  147  NYASERKIVDPANGAEFLPTYEDKDGDWMLVGDVPWKMFVESCKRLRFMKSSEATGLGPT  206

Query  352  TPSKCSRTS  326
            T S C+ +S
Sbjct  207  TQSACTSSS  215



>gb|ABG81096.1| AUX/IAA-like protein [Pelargonium x hortorum]
Length=192

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 113/129 (88%), Gaps = 1/129 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPV++ RK+++ ++ K+VKVAVDGAPYLRKVDL  + SYQQLL +LE++F+CLTI
Sbjct  63   QVVGWPPVKASRKSVVARNCKYVKVAVDGAPYLRKVDLEMYGSYQQLLEALEELFSCLTI  122

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N LN +KLMD  +G EYVPTYEDKDGDWMLVGDVPWKMFVESCKR+RLMKSSD VGLAP
Sbjct  123  RNCLNERKLMDLVNGVEYVPTYEDKDGDWMLVGDVPWKMFVESCKRVRLMKSSDAVGLAP  182

Query  355  TTPSKCSRT  329
             TPS+C+ T
Sbjct  183  RTPSRCTST  191



>ref|XP_011072281.1| PREDICTED: auxin-responsive protein IAA1-like [Sesamum indicum]
Length=200

 Score =   202 bits (513),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 2/121 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVRSYRKN+M K  KFVKVAVDGAPYLRKVDL  + SYQ+LL +LE MF CLTI
Sbjct  69   QVVGWPPVRSYRKNMMMKIGKFVKVAVDGAPYLRKVDLELYTSYQELLAALEAMFACLTI  128

Query  535  CNVLNGKKLMDTSDG-TEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
            CNV+N +K+MD+++G  EYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSS+ VGLA
Sbjct  129  CNVVNERKIMDSTNGKEEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSEAVGLA  188

Query  358  P  356
            P
Sbjct  189  P  189



>ref|XP_009416093.1| PREDICTED: auxin-responsive protein IAA1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=207

 Score =   202 bits (513),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+R+N++KS  +VKVAVDG PYLRKVDL A+  YQQLLT+LE+MFTC T  
Sbjct  79   QVVGWPPVRSFRRNVLKSCTYVKVAVDGTPYLRKVDLEAYAGYQQLLTALEEMFTCFTAR  138

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  N ++L+D  +GTEYVPTYEDKDGDWML+GDVPWKMFV SCKRLRLMKSS+ V LAP 
Sbjct  139  NYPNERRLVDPVNGTEYVPTYEDKDGDWMLIGDVPWKMFVASCKRLRLMKSSEAVDLAPR  198

Query  352  TPSKC  338
            TP+ C
Sbjct  199  TPTGC  203



>ref|XP_011045352.1| PREDICTED: auxin-responsive protein IAA1 [Populus euphratica]
Length=220

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 4/133 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCL--T  539
            QVVGWPPVR++RKN MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL +L+DMF+C   T
Sbjct  88   QVVGWPPVRAFRKNAMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLNALQDMFSCFSFT  147

Query  538  ICNVLNGKKLMD--TSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVG  365
            I N LN + LM+   ++G EYV TYEDKDGDWM++GDVPWKMFVESCKRLRLMKSS+  G
Sbjct  148  IRNYLNERTLMEQEVNNGAEYVSTYEDKDGDWMMLGDVPWKMFVESCKRLRLMKSSEATG  207

Query  364  LAPTTPSKCSRTS  326
             AP TPSKCS +S
Sbjct  208  FAPRTPSKCSSSS  220



>ref|XP_004302956.1| PREDICTED: auxin-responsive protein IAA17-like isoform 1 [Fragaria 
vesca subsp. vesca]
Length=197

 Score =   201 bits (511),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 93/129 (72%), Positives = 109/129 (84%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR  R+N+MKS K+VKVAVDGAPYLRK+DL    SYQQLL +LED+F+ LTI 
Sbjct  69   QVVGWPPVRGSRRNLMKSCKYVKVAVDGAPYLRKMDLEMCKSYQQLLGALEDLFSFLTIR  128

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
              +N +KLMD ++G EYVPTYED+DGDWMLVGDVPW MFVESCKRLRLMKSS+ +GLAP 
Sbjct  129  KDMNERKLMDLANGVEYVPTYEDRDGDWMLVGDVPWNMFVESCKRLRLMKSSEAIGLAPR  188

Query  352  TPSKCSRTS  326
            TP KC+ +S
Sbjct  189  TPPKCTSSS  197



>gb|AFZ78621.1| hypothetical protein [Populus tomentosa]
Length=220

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 4/133 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCL--T  539
            QVVGWPPVR+YRKN MK  K+VKVAVDGAPYLRKVDL  ++SYQQLL +L+DMF+C   T
Sbjct  88   QVVGWPPVRAYRKNAMKGCKYVKVAVDGAPYLRKVDLEMYNSYQQLLNALQDMFSCFSFT  147

Query  538  ICNVLNGKKLMD--TSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVG  365
            I N LN + +M+   ++G EYVPTY DKDGDWM++GDVPWKMFVESCKRLRLMKSS+  G
Sbjct  148  IRNYLNERTIMEQEVNNGVEYVPTYGDKDGDWMMLGDVPWKMFVESCKRLRLMKSSEATG  207

Query  364  LAPTTPSKCSRTS  326
             AP TPSKCS +S
Sbjct  208  FAPRTPSKCSSSS  220



>emb|CDO98081.1| unnamed protein product [Coffea canephora]
Length=202

 Score =   200 bits (508),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/129 (74%), Positives = 107/129 (83%), Gaps = 1/129 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS-AKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPV+S R+N+MKS +K+VKVAVDGAPYLRKVDL  ++ YQQLL  LE MFTC TI
Sbjct  73   QVVGWPPVKSSRRNMMKSGSKYVKVAVDGAPYLRKVDLEMYNGYQQLLGGLEGMFTCQTI  132

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
            CN    KKLMD ++G +YVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSS+ + LA 
Sbjct  133  CNGATQKKLMDPANGMQYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSEAIELAT  192

Query  355  TTPSKCSRT  329
             TP  CS T
Sbjct  193  RTPPNCSST  201



>ref|XP_008811586.1| PREDICTED: auxin-responsive protein IAA1-like [Phoenix dactylifera]
Length=211

 Score =   199 bits (507),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN +KS  +VKVAVDGAPYLRKVDL  +  YQQLLT+LEDMF+C T+ 
Sbjct  83   QVVGWPPVRSFRKNALKSCTYVKVAVDGAPYLRKVDLEIYGGYQQLLTALEDMFSCFTVR  142

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  N ++L+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFV SCKRLRLMKSS+ V LAP 
Sbjct  143  NYPNERRLVDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMKSSEAVNLAPR  202

Query  352  TP  347
            TP
Sbjct  203  TP  204



>ref|NP_001290520.1| auxin-responsive protein IAA1 [Elaeis guineensis]
 gb|AAT76903.1| IAA type protein [Elaeis guineensis]
Length=211

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN +KS  +VKVAVDGAPYLRKVDL  +  YQQ LT++EDMF+C T+ 
Sbjct  83   QVVGWPPVRSFRKNALKSCTYVKVAVDGAPYLRKVDLEMYGGYQQFLTAIEDMFSCFTVR  142

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N  N ++L+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFV SCKRLRLMKSS+ + LAP 
Sbjct  143  NCPNERRLVDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMKSSEAINLAPR  202

Query  352  TPSKCSR  332
            TP   +R
Sbjct  203  TPQGSTR  209



>gb|AGG19163.1| auxin-responsive Aux/IAA protein [Pyrus pyrifolia]
Length=205

 Score =   198 bits (504),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR  RKN+MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL  LE MF+ LTI 
Sbjct  77   QVVGWPPVRVSRKNLMKSCKYVKVAVDGAPYLRKVDLEMYNSYQQLLGGLEYMFSFLTIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN  KLMD ++G EYVPTYED+D DWMLVGDVPWKMFVE+CKRLRL KSS+ +GLAP 
Sbjct  137  NYLNESKLMDPANGVEYVPTYEDRDDDWMLVGDVPWKMFVETCKRLRLTKSSEAIGLAPR  196

Query  352  TPSKCSRT  329
            TP +C+ T
Sbjct  197  TPPQCTST  204



>emb|CAN70529.1| hypothetical protein VITISV_010217 [Vitis vinifera]
Length=210

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            Q+VGWPPV++ RKN+ K +K+VKVAVDGAPYLRKVDL  + SYQQLL SLEDMF+C  I 
Sbjct  77   QIVGWPPVKASRKNVAKISKYVKVAVDGAPYLRKVDLEMYGSYQQLLGSLEDMFSCFPIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +KLMD   G++Y+PTYED+DGDWMLVGDVPWKMFVESCKRLRLMKS + +GLAP 
Sbjct  137  NYLNERKLMDPVKGSDYMPTYEDRDGDWMLVGDVPWKMFVESCKRLRLMKSIEAIGLAPR  196

Query  352  TPSKCSRTS  326
               KC+ TS
Sbjct  197  ESQKCTSTS  205



>ref|XP_002280524.2| PREDICTED: auxin-responsive protein IAA1 [Vitis vinifera]
Length=210

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            Q+VGWPPV++ RKN+ K +K+VKVAVDGAPYLRKVDL  + SYQQLL SLEDMF+C  I 
Sbjct  77   QIVGWPPVKASRKNVAKISKYVKVAVDGAPYLRKVDLEMYGSYQQLLGSLEDMFSCFPIR  136

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +KLMD   G++Y+PTYED+DGDWMLVGDVPWKMFVESCKRLRLMKS + +GLAP 
Sbjct  137  NYLNERKLMDPVKGSDYMPTYEDRDGDWMLVGDVPWKMFVESCKRLRLMKSIEAIGLAPR  196

Query  352  TPSKCSRTS  326
               KC+ TS
Sbjct  197  ESQKCTSTS  205



>emb|CBI36192.3| unnamed protein product [Vitis vinifera]
Length=294

 Score =   199 bits (507),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            Q+VGWPPV++ RKN+ K +K+VKVAVDGAPYLRKVDL  + SYQQLL SLEDMF+C  I 
Sbjct  161  QIVGWPPVKASRKNVAKISKYVKVAVDGAPYLRKVDLEMYGSYQQLLGSLEDMFSCFPIR  220

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN +KLMD   G++Y+PTYED+DGDWMLVGDVPWKMFVESCKRLRLMKS + +GLAP 
Sbjct  221  NYLNERKLMDPVKGSDYMPTYEDRDGDWMLVGDVPWKMFVESCKRLRLMKSIEAIGLAPR  280

Query  352  TPSKCSRTS  326
               KC+ TS
Sbjct  281  ESQKCTSTS  289



>ref|XP_010691245.1| PREDICTED: auxin-responsive protein IAA1 [Beta vulgaris subsp. 
vulgaris]
Length=205

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            Q+VGWPPVR+ RKN+MKS K+VKVAVDGAPYLRKVDL  ++SYQQLL +LEDMF+  TI 
Sbjct  80   QLVGWPPVRASRKNVMKSYKYVKVAVDGAPYLRKVDLELYNSYQQLLKALEDMFSSFTIR  139

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            +  N  KLMD  +G++YVPT+EDKDGDWM+VGDVPW MFVESCKR+RLMKSS+ VGL P 
Sbjct  140  HFFNDGKLMDPVNGSDYVPTFEDKDGDWMMVGDVPWNMFVESCKRIRLMKSSEAVGLGPR  199

Query  352  TPS  344
            TPS
Sbjct  200  TPS  202



>ref|XP_008809254.1| PREDICTED: auxin-responsive protein IAA1-like [Phoenix dactylifera]
Length=210

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 4/128 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN +KS  +VKVAVDGAPYLRKVDL  +  YQQLLT+LEDMF+C T+ 
Sbjct  86   QVVGWPPVRSFRKNALKSCTYVKVAVDGAPYLRKVDLEMYGGYQQLLTALEDMFSCFTVR  145

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N    K+L+D  +G EYVPTYEDKDGDWMLVGDVPWKMFV SCKRLRLMKSS+ V LAP 
Sbjct  146  N----KRLVDPVNGMEYVPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMKSSEAVDLAPR  201

Query  352  TPSKCSRT  329
            TP   + T
Sbjct  202  TPQGSTNT  209



>emb|CAD30274.1| IAA16 protein [Gossypium hirsutum]
 gb|KHF99239.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=208

 Score =   192 bits (489),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 105/129 (81%), Gaps = 1/129 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR + K   KS K+VKVAVDGAPYLRKVDL  ++SYQQLLTSLEDMF+C TI 
Sbjct  81   QVVGWPPVRGFAKRGKKSCKYVKVAVDGAPYLRKVDLEIYNSYQQLLTSLEDMFSCFTIR  140

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N LN KK+ D  +G EY+PTYEDKDGDWMLVGDVPW+MFVESCKRLRLMKSS+ VGL   
Sbjct  141  NYLNEKKI-DQVNGIEYMPTYEDKDGDWMLVGDVPWQMFVESCKRLRLMKSSEAVGLGLK  199

Query  352  TPSKCSRTS  326
            T  K S T+
Sbjct  200  TAPKYSSTN  208



>ref|XP_009385622.1| PREDICTED: auxin-responsive protein IAA1 [Musa acuminata subsp. 
malaccensis]
Length=212

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+R+N ++S  +VKVAVDG PYLRKVDL A+  YQQLL +LE+MF+C T  
Sbjct  84   QVVGWPPVRSFRRNALRSCTYVKVAVDGTPYLRKVDLDAYAGYQQLLIALEEMFSCFTAR  143

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            +  N ++L+D  +G  YVPTYEDKDGDWMLVGDVPWKMFV SCKRLRLMKSS+ V LAP 
Sbjct  144  DYTNERRLVDPVNGAAYVPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMKSSEAVNLAPR  203

Query  352  TPSKCS  335
            TP  C+
Sbjct  204  TPQGCA  209



>ref|XP_009395806.1| PREDICTED: auxin-responsive protein IAA1-like [Musa acuminata 
subsp. malaccensis]
Length=215

 Score =   191 bits (486),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+R+N ++S  +VKVAVDGAPYLRKVDL A   Y+QLL +LE+MF+C T+ 
Sbjct  88   QVVGWPPVRSFRRNALRSCTYVKVAVDGAPYLRKVDLEAHGGYEQLLAALEEMFSCFTVR  147

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            +  + ++L+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFV SCKRLRLMKSSD + LA  
Sbjct  148  HYPDERRLVDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMKSSDAINLATR  207

Query  352  TPSKCS  335
             P +CS
Sbjct  208  MPQECS  213



>ref|XP_009416094.1| PREDICTED: auxin-responsive protein IAA1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=201

 Score =   190 bits (483),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+R+N++KS  +VKVAVDG PYLRKVDL A+  YQQLLT+LE+MFTC T  
Sbjct  79   QVVGWPPVRSFRRNVLKSCTYVKVAVDGTPYLRKVDLEAYAGYQQLLTALEEMFTCFTAR  138

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
            N  N ++L+D  +GTEYVPTYEDKDGDWML+GDVPWKMFV SCKRLRLMKSS+ V L 
Sbjct  139  NYPNERRLVDPVNGTEYVPTYEDKDGDWMLIGDVPWKMFVASCKRLRLMKSSEAVDLG  196



>ref|XP_010110305.1| Auxin-responsive protein IAA17 [Morus notabilis]
 gb|EXC25825.1| Auxin-responsive protein IAA17 [Morus notabilis]
Length=205

 Score =   189 bits (481),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 102/118 (86%), Gaps = 1/118 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFT-CLTI  536
            QVVGWPPVR+ RKN+MKS KF+KV +DGAPYLRKVDL  ++SY QLLT+L+DMF+ CLTI
Sbjct  87   QVVGWPPVRASRKNVMKSCKFIKVGLDGAPYLRKVDLEMYNSYNQLLTALQDMFSSCLTI  146

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
             N LN +KLMD  +G EY+PTYEDKDGDWMLVGDVPW MFVESCKRLRLMK S+ +GL
Sbjct  147  RNYLNERKLMDPVNGMEYLPTYEDKDGDWMLVGDVPWTMFVESCKRLRLMKRSEAIGL  204



>emb|CBI28126.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS RK  +KS K+VKVAVDGAPYLRKVDL    SYQQLL +LE MF C TI 
Sbjct  88   QVVGWPPVRSVRKKALKSCKYVKVAVDGAPYLRKVDLEVHRSYQQLLMALETMFDCFTIS  147

Query  532  -NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N L   K+M+  +G EYVPTYEDKDGDWMLVGDVPW MFVESCKR+RLMKSS+ +GLAP
Sbjct  148  SNDLEESKIMNPVNGAEYVPTYEDKDGDWMLVGDVPWNMFVESCKRVRLMKSSEAIGLAP  207

Query  355  TTPSKCSRTS  326
             TPS C+ T+
Sbjct  208  RTPS-CTSTT  216



>ref|XP_002284861.1| PREDICTED: auxin-responsive protein IAA1-like [Vitis vinifera]
Length=224

 Score =   189 bits (480),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS RK  +KS K+VKVAVDGAPYLRKVDL    SYQQLL +LE MF C TI 
Sbjct  96   QVVGWPPVRSVRKKALKSCKYVKVAVDGAPYLRKVDLEVHRSYQQLLMALETMFDCFTIS  155

Query  532  -NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N L   K+M+  +G EYVPTYEDKDGDWMLVGDVPW MFVESCKR+RLMKSS+ +GLAP
Sbjct  156  SNDLEESKIMNPVNGAEYVPTYEDKDGDWMLVGDVPWNMFVESCKRVRLMKSSEAIGLAP  215

Query  355  TTPSKCSRTS  326
             TPS C+ T+
Sbjct  216  RTPS-CTSTT  224



>ref|XP_010925112.1| PREDICTED: auxin-responsive protein IAA1-like [Elaeis guineensis]
Length=210

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 103/128 (80%), Gaps = 4/128 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN +KS  +VKVAVDGAPYLRKVDL  +  Y QLL +LE+MF+C T+ 
Sbjct  86   QVVGWPPVRSFRKNALKSCTYVKVAVDGAPYLRKVDLEMYGGYHQLLIALEEMFSCFTVR  145

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N    ++L+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFV SCKRLRLM+SS+ V LAP 
Sbjct  146  N----ERLVDPVNGTEYVPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMRSSEAVDLAPG  201

Query  352  TPSKCSRT  329
            TP   + T
Sbjct  202  TPQGSTNT  209



>ref|XP_010047765.1| PREDICTED: auxin-responsive protein IAA23-like [Eucalyptus grandis]
Length=214

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI-  536
            QVVGWPPVRS+R+  ++S K+VKVAVDGAPYLRKVDL  ++SY +LL +LE MF C T+ 
Sbjct  88   QVVGWPPVRSFRQKTLESCKYVKVAVDGAPYLRKVDLRTYNSYDELLKALEGMFNCFTVN  147

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N L G K+MD +   EYVPTYED DGDWML GDVPWKMF ESCKR+RLMKSSD  G+AP
Sbjct  148  GNFLEGSKVMDPATRMEYVPTYEDGDGDWMLAGDVPWKMFAESCKRIRLMKSSDAAGIAP  207

Query  355  TTPS  344
             TP+
Sbjct  208  RTPT  211



>gb|KCW79738.1| hypothetical protein EUGRSUZ_C01083 [Eucalyptus grandis]
Length=316

 Score =   186 bits (473),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI-  536
            QVVGWPPVRS+R+  ++S K+VKVAVDGAPYLRKVDL  ++SY +LL +LE MF C T+ 
Sbjct  190  QVVGWPPVRSFRQKTLESCKYVKVAVDGAPYLRKVDLRTYNSYDELLKALEGMFNCFTVN  249

Query  535  CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
             N L G K+MD +   EYVPTYED DGDWML GDVPWKMF ESCKR+RLMKSSD  G+AP
Sbjct  250  GNFLEGSKVMDPATRMEYVPTYEDGDGDWMLAGDVPWKMFAESCKRIRLMKSSDAAGIAP  309

Query  355  TTPS  344
             TP+
Sbjct  310  RTPT  313



>ref|NP_001235069.1| uncharacterized protein LOC100500488 [Glycine max]
 gb|ACU15588.1| unknown [Glycine max]
Length=183

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 104/129 (81%), Gaps = 3/129 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVR+ RKN MK S K VKVAVDGAPYLRKVDL  + +Y+ L+  LE MF  L I
Sbjct  52   QVVGWPPVRASRKNAMKMSCKLVKVAVDGAPYLRKVDLEMYETYEHLMRELETMFCGLAI  111

Query  535  CN-VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
             N ++N +KLM++ +G EY+PTYEDKDGDWMLVGDVPWKMFVESCKR+RLM SS+ VGL 
Sbjct  112  RNHLMNERKLMESGNGIEYMPTYEDKDGDWMLVGDVPWKMFVESCKRIRLMISSEAVGLG  171

Query  358  P-TTPSKCS  335
            P +T SKC+
Sbjct  172  PRSTSSKCT  180



>ref|XP_010917602.1| PREDICTED: auxin-responsive protein IAA30 isoform X2 [Elaeis 
guineensis]
Length=238

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/152 (58%), Positives = 105/152 (69%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKNIM             KSA FVKV++DGAPYLRK+DL  + SYQ+L 
Sbjct  87   QVVGWPPVRSFRKNIMSVQSDKGNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQELS  146

Query  571  TSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
             +LE MF+  TI N           +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW+
Sbjct  147  VALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKDGDWMLVGDVPWE  206

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MF++SCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  MFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  238



>ref|XP_009623795.1| PREDICTED: auxin-responsive protein IAA1-like [Nicotiana tomentosiformis]
Length=222

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 110/135 (81%), Gaps = 6/135 (4%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNI--MKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLT  539
            QV+GWPPVRS RK I  +K  K+VKVAVDGAPYLRKVDL  + SY QLL +LE MFTCLT
Sbjct  88   QVIGWPPVRSNRKKIGVVKKCKYVKVAVDGAPYLRKVDLEMYSSYDQLLIALEHMFTCLT  147

Query  538  -ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
             ICN +N +KLMD  +G EY+PTYEDKDGDWMLVGDVPWKMFVESCKRLRLM+SS+ +GL
Sbjct  148  TICNFVNERKLMDPINGVEYLPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMRSSEAIGL  207

Query  361  APTTP---SKCSRTS  326
            AP T    +KCS TS
Sbjct  208  APRTNVLMAKCSSTS  222



>ref|XP_008785900.1| PREDICTED: auxin-responsive protein IAA1-like [Phoenix dactylifera]
Length=205

 Score =   179 bits (455),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 99/122 (81%), Gaps = 4/122 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            +VVGWPPVRSYRKN ++S  +VKVAVDGAPYLRKVDL  +  Y QLL +L++MF+C TI 
Sbjct  87   RVVGWPPVRSYRKNALRSCTYVKVAVDGAPYLRKVDLETYSGYHQLLIALQEMFSCFTIR  146

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            +    ++L+D   GT+Y+PTYEDKDGDWMLVGDVPWKMFV SCKRLRLMKSS+ V +AP 
Sbjct  147  D----RRLVDLVKGTDYIPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMKSSEAVNIAPR  202

Query  352  TP  347
             P
Sbjct  203  AP  204



>ref|XP_009802990.1| PREDICTED: auxin-responsive protein IAA1-like [Nicotiana sylvestris]
Length=217

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 106/124 (85%), Gaps = 3/124 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNI--MKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLT  539
            QV+GWPPVRS RKNI  +K  K+VKVAVDGAPYLRKVDL  + SY QLL +LE+MFTCLT
Sbjct  88   QVIGWPPVRSNRKNIGVVKKCKYVKVAVDGAPYLRKVDLEMYSSYDQLLIALENMFTCLT  147

Query  538  -ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
             ICN +N + LMD ++G EY+PTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSS+ +GL
Sbjct  148  TICNFVNERMLMDPTNGVEYLPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSEAIGL  207

Query  361  APTT  350
            AP T
Sbjct  208  APRT  211



>ref|XP_006451051.1| hypothetical protein CICLE_v10010410mg [Citrus clementina]
 gb|ESR64291.1| hypothetical protein CICLE_v10010410mg [Citrus clementina]
Length=220

 Score =   179 bits (454),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 3/128 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QV+GWPPVRS+RK  ++ S+K VKVAVDGAPYLRKVDL  + SYQ L  +LE+MFTC T 
Sbjct  93   QVIGWPPVRSFRKKTLEGSSKLVKVAVDGAPYLRKVDLQIYSSYQDLFRALEEMFTCFTT  152

Query  535  CNVLN--GKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
                N   +KL    +G EYVPTYEDKD DWML+GDVPWKMFVESCKR+RLMKSS+ VGL
Sbjct  153  RGDYNMEERKLTGALNGREYVPTYEDKDDDWMLLGDVPWKMFVESCKRIRLMKSSEAVGL  212

Query  361  APTTPSKC  338
            AP TP+ C
Sbjct  213  APRTPTNC  220



>ref|XP_007150685.1| hypothetical protein PHAVU_005G173000g [Phaseolus vulgaris]
 gb|ESW22679.1| hypothetical protein PHAVU_005G173000g [Phaseolus vulgaris]
Length=192

 Score =   178 bits (452),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 104/130 (80%), Gaps = 1/130 (1%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVR+ RKN +KS K VKVAVDGAPYLRKVDL  + SY+ L+  LE MF  L I 
Sbjct  63   QVVGWPPVRASRKNALKSWKLVKVAVDGAPYLRKVDLEMYESYEDLMRELESMFCGLAIR  122

Query  532  N-VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAP  356
            N ++N +KLM++ +G EY+PTYEDKDGDWMLVGDVPWKMFVESCKR+RL+ SS+ + L P
Sbjct  123  NHLMNERKLMESVNGIEYMPTYEDKDGDWMLVGDVPWKMFVESCKRIRLVISSEAIVLGP  182

Query  355  TTPSKCSRTS  326
             + SKCS ++
Sbjct  183  RSSSKCSGST  192



>dbj|BAJ84870.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92398.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF  551
            QVVGWPPVRS+RKNI+       +A FVKV++DGAPYLRKVDL  + +YQ L  +LE MF
Sbjct  111  QVVGWPPVRSFRKNILAEKSSPAAAAFVKVSMDGAPYLRKVDLSMYKTYQDLSKALEKMF  170

Query  550  TCLTICNV-------LNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLR  392
            +  TI N        +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR
Sbjct  171  SSFTIGNCGTQGMNGMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  230

Query  391  LMKSSDVVGLAPTTPSKCSRTS  326
            +MK S+ +GLAP    KC   S
Sbjct  231  IMKGSEAIGLAPRAMEKCKNRS  252



>dbj|BAK01326.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF  551
            QVVGWPPVRS+RKNI+       +A FVKV++DGAPYLRKVDL  + +YQ L  +LE MF
Sbjct  111  QVVGWPPVRSFRKNILAEKSSPAAAAFVKVSMDGAPYLRKVDLSMYKTYQDLSKALEKMF  170

Query  550  TCLTICNV-------LNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLR  392
            +  TI N        +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR
Sbjct  171  SSFTIGNCGTQGMNGMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLR  230

Query  391  LMKSSDVVGLAPTTPSKCSRTS  326
            +MK S+ +GLAP    KC   S
Sbjct  231  IMKGSEAIGLAPRAMEKCKNRS  252



>ref|XP_003546269.1| PREDICTED: auxin-responsive protein IAA17-like isoform X1 [Glycine 
max]
 gb|KHM98782.1| Auxin-responsive protein IAA17 [Glycine soja]
Length=189

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 103/129 (80%), Gaps = 3/129 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSA-KFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            Q+VGWPPVR+ RKN MKS  K VKVAVDGAPYLRKVDL  + SY+ L+  LE MF  L I
Sbjct  58   QLVGWPPVRASRKNAMKSCCKLVKVAVDGAPYLRKVDLDMYDSYEHLMRELETMFCGLAI  117

Query  535  CN-VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
             N ++N +KLMD  +G EY+PTYEDKDGDWMLVGDVPWKMFVESCKR+RLM SS+ VGL 
Sbjct  118  RNHLMNERKLMDPGNGIEYMPTYEDKDGDWMLVGDVPWKMFVESCKRIRLMISSEAVGLG  177

Query  358  P-TTPSKCS  335
            P +T SKC+
Sbjct  178  PRSTSSKCT  186



>ref|XP_006597139.1| PREDICTED: auxin-responsive protein IAA17-like isoform X2 [Glycine 
max]
Length=188

 Score =   177 bits (448),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 105/132 (80%), Gaps = 3/132 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSA-KFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            Q+VGWPPVR+ RKN MKS  K VKVAVDGAPYLRKVDL  + SY+ L+  LE MF  L I
Sbjct  57   QLVGWPPVRASRKNAMKSCCKLVKVAVDGAPYLRKVDLDMYDSYEHLMRELETMFCGLAI  116

Query  535  CN-VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
             N ++N +KLMD  +G EY+PTYEDKDGDWMLVGDVPWKMFVESCKR+RLM SS+ VGL 
Sbjct  117  RNHLMNERKLMDPGNGIEYMPTYEDKDGDWMLVGDVPWKMFVESCKRIRLMISSEAVGLG  176

Query  358  P-TTPSKCSRTS  326
            P +T SKC+ ++
Sbjct  177  PRSTSSKCTGST  188



>gb|ACF88333.1| unknown [Zea mays]
 tpg|DAA55066.1| TPA: IAA30-auxin-responsive Aux/IAA family member [Zea mays]
Length=271

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 104/157 (66%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK---------------------SAKFVKVAVDGAPYLRKVDLVA  596
            QVVGWPPVRS+RKNIM                       A FVKV++DGAPYLRKVDL  
Sbjct  115  QVVGWPPVRSFRKNIMSVQSDKGAAAANGDKSSPAAGGGAAFVKVSLDGAPYLRKVDLKM  174

Query  595  FHSYQQLLTSLEDMFTCLTIC-------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
            + SYQQL  +LE+MF+  TI        N +N  KL+D  +G+EYVPTYEDKDGDWMLVG
Sbjct  175  YRSYQQLSKALENMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDGDWMLVG  234

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  235  DVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  271



>ref|XP_003579189.1| PREDICTED: auxin-responsive protein IAA30-like [Brachypodium 
distachyon]
Length=249

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 103/144 (72%), Gaps = 15/144 (10%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------FVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED  557
            QVVGWPPVRS+RKNI+++ K        FVKV++DGAPYLRKVDL  + +YQ L  +L  
Sbjct  106  QVVGWPPVRSFRKNILQAEKSSSSSPAAFVKVSMDGAPYLRKVDLNMYKTYQDLSMALHK  165

Query  556  MFTCLTICNV-------LNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKR  398
            MF+  TI N        +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW+MFVESCKR
Sbjct  166  MFSSFTIGNCGSQGMNGMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCKR  225

Query  397  LRLMKSSDVVGLAPTTPSKCSRTS  326
            LR+MK S+ +GLAP    KC   S
Sbjct  226  LRIMKGSEAIGLAPRAMEKCKNRS  249



>ref|XP_008810170.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   177 bits (450),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 104/155 (67%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKNIM                 SA FVKV++DGAPYLRK+DL  + SYQ
Sbjct  87   QVVGWPPVRSFRKNIMSIQSDKGKKDEGEKSATSATFVKVSMDGAPYLRKIDLKMYSSYQ  146

Query  580  QLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +LE MF+  TI N           +N  KLMD  +G+EYVPTYEDKDGDWMLVGDV
Sbjct  147  ELSVALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDV  206

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  PWEMFVDSCKRLRIMKGSEAIGLAPKVMEKCKNQS  241



>gb|KHN44139.1| Auxin-responsive protein IAA17 [Glycine soja]
Length=270

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVR+ RKN MK S K VKVAVDGAPYLRKVDL  + +Y+ L+  LE MF  L I
Sbjct  52   QVVGWPPVRASRKNAMKMSCKLVKVAVDGAPYLRKVDLEMYETYEHLMRELETMFCGLAI  111

Query  535  CN-VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
             N ++N +KLM++ +G EY+PTYEDKDGDWMLVGDVPWKMFVESCKR+RLM SS+ VGL 
Sbjct  112  RNHLMNERKLMESGNGIEYMPTYEDKDGDWMLVGDVPWKMFVESCKRIRLMISSEAVGLG  171

Query  358  PTTPSKCS  335
            P + S  S
Sbjct  172  PRSTSSKS  179



>ref|XP_002517023.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
 gb|EEF45186.1| Auxin-responsive protein IAA7, putative [Ricinus communis]
Length=181

 Score =   173 bits (439),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 103/149 (69%), Gaps = 21/149 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVRSYRKNIM             SA FVKV +DGAPYLRKVDL  + SYQ+L  
Sbjct  33   QVVGWPPVRSYRKNIMAQKNTSEEGEKASSAAFVKVCMDGAPYLRKVDLKMYKSYQELSD  92

Query  568  SLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MFV
Sbjct  93   ALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFV  152

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            +SCKRLR+MK S+ +GLAP    KC SRT
Sbjct  153  DSCKRLRIMKGSEAIGLAPRAMEKCKSRT  181



>emb|CDP06818.1| unnamed protein product [Coffea canephora]
Length=245

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 104/154 (68%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+RKNI+                  +A FVKV+VDGAPYLRKVDL  F SY
Sbjct  92   QVVGWPPVRSFRKNILSVQKNSNTEAEKSGTGSAAAAFVKVSVDGAPYLRKVDLKNFKSY  151

Query  583  QQLLTSLEDMFTCLTIC--------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +L  MF+  TI         + +N +KL+D  +G+EYVPTYEDKDGDWMLVGDVP
Sbjct  152  QELSQALSKMFSSSTIGSYGSQEFKDFMNERKLIDLLNGSEYVPTYEDKDGDWMLVGDVP  211

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MFV+SCKRLR+MK S+ VGLAP    KC   S
Sbjct  212  WEMFVDSCKRLRIMKGSEAVGLAPRAVEKCKNRS  245



>ref|XP_009398568.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=248

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 104/155 (67%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKNI+                 +A FVKV +DGAPYLRKVDL  + SYQ
Sbjct  94   QVVGWPPVRSYRKNILAVQSEKASKEEGEKPGNTAAFVKVCMDGAPYLRKVDLKMYRSYQ  153

Query  580  QLLTSLEDMFTCLTICNV----LNGK------KLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +LE MF+  T  N     +NG+      KLMD  +G+EYVPTYEDKDGDWMLVGDV
Sbjct  154  ELSMALEKMFSSFTSANCGSQGMNGRDFTNEGKLMDLINGSEYVPTYEDKDGDWMLVGDV  213

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  214  PWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  248



>ref|NP_001042192.1| Os01g0178500 [Oryza sativa Japonica Group]
 sp|Q5VRD1.1|IAA1_ORYSJ RecName: Full=Auxin-responsive protein IAA1; AltName: Full=Indoleacetic 
acid-induced protein 1 [Oryza sativa Japonica Group]
 dbj|BAD67830.1| putative Nt-iaa4.1 deduced protein [Oryza sativa Japonica Group]
 dbj|BAD67992.1| putative Nt-iaa4.1 deduced protein [Oryza sativa Japonica Group]
 dbj|BAF04106.1| Os01g0178500 [Oryza sativa Japonica Group]
 dbj|BAG91334.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94770.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87314.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG98702.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70044.1| hypothetical protein OsI_00634 [Oryza sativa Indica Group]
Length=199

 Score =   173 bits (438),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-MFTCLTI  536
            +VVGWPPVRS+RKN + +AKFVKVAVDGAPYLRKVDL A+  Y QLL +L+D  F+  TI
Sbjct  76   RVVGWPPVRSFRKNAL-AAKFVKVAVDGAPYLRKVDLEAYSGYDQLLRALQDKFFSHFTI  134

Query  535  CNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
                +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMKSS+ V LA
Sbjct  135  RKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNLA  194

Query  358  P  356
            P
Sbjct  195  P  195



>gb|ACF87179.1| unknown [Zea mays]
 gb|ADX60115.1| AUX/IAA transcription factor [Zea mays]
Length=276

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 106/161 (66%), Gaps = 32/161 (20%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------------KSAK-------FVKVAVDGAPYLRKV  608
            QVVGWPPVRS+RKNIM                  KS+        FVKV++DGAPYLRKV
Sbjct  116  QVVGWPPVRSFRKNIMSVQSDKGAGKDAAAANGDKSSAAAGGGAAFVKVSLDGAPYLRKV  175

Query  607  DLVAFHSYQQLLTSLEDMFTCLTI-------CNVLNGKKLMDTSDGTEYVPTYEDKDGDW  449
            DL  + SYQQL  +LE+MF+  TI        N +N  KL+D  +G+EYVPTYEDKDGDW
Sbjct  176  DLKMYRSYQQLSKALENMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDGDW  235

Query  448  MLVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MLVGDVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  236  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  276



>ref|NP_001150626.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACG39802.1| IAA30 - auxin-responsive Aux/IAA family member [Zea mays]
Length=275

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 106/161 (66%), Gaps = 32/161 (20%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------------KSAK-------FVKVAVDGAPYLRKV  608
            QVVGWPPVRS+RKNIM                  KS+        FVKV++DGAPYLRKV
Sbjct  115  QVVGWPPVRSFRKNIMSVQSDKGAGKDAAAANGDKSSAAAGGGAAFVKVSLDGAPYLRKV  174

Query  607  DLVAFHSYQQLLTSLEDMFTCLTI-------CNVLNGKKLMDTSDGTEYVPTYEDKDGDW  449
            DL  + SYQQL  +LE+MF+  TI        N +N  KL+D  +G+EYVPTYEDKDGDW
Sbjct  175  DLKMYRSYQQLSKALENMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDGDW  234

Query  448  MLVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MLVGDVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  235  MLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  275



>ref|XP_010278165.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=251

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 104/151 (69%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKNI+               SA FVKV++DGAPYLRKVDL  + SYQ+L
Sbjct  101  QVVGWPPVRSFRKNILSVQKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQEL  160

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW+M
Sbjct  161  SDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEM  220

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK S+ +GLAP    KC + S
Sbjct  221  FVDSCKRLRIMKGSEAIGLAPRAVEKCKKRS  251



>ref|XP_006475755.1| PREDICTED: auxin-responsive protein IAA1-like [Citrus sinensis]
Length=221

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QV GWPPVRS+RK  ++ S+K VKVAVDGAPYLRKVDL  + SYQ L  +LE+MFTC T 
Sbjct  93   QVTGWPPVRSFRKKTLEGSSKLVKVAVDGAPYLRKVDLQIYSSYQDLFRALEEMFTCFTT  152

Query  535  C--NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
               + +  +KL    +G EYVPTYEDKD DWML+GDVPWKMFVESCKR+RLMKSS+ VGL
Sbjct  153  RGDDNMEERKLTGALNGREYVPTYEDKDDDWMLLGDVPWKMFVESCKRIRLMKSSEAVGL  212

Query  361  -APTTPSKC  338
             AP TP+ C
Sbjct  213  AAPRTPTNC  221



>ref|XP_006643826.1| PREDICTED: auxin-responsive protein IAA1-like [Oryza brachyantha]
Length=204

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 102/131 (78%), Gaps = 10/131 (8%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM--------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED  557
            +VVGWPPVRS+RKN +        K+AKFVKVAVDGAPYLRKVDL A+  Y QLL +L+D
Sbjct  72   RVVGWPPVRSFRKNALADVAGAGGKAAKFVKVAVDGAPYLRKVDLEAYAGYDQLLRALQD  131

Query  556  -MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMK  383
              F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMK
Sbjct  132  KFFSHFTIRKFADDERKLVDAMNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMK  191

Query  382  SSDVVGLAPTT  350
            SS+ V LAP +
Sbjct  192  SSEAVNLAPRS  202



>ref|XP_004963100.1| PREDICTED: auxin-responsive protein IAA30-like [Setaria italica]
Length=264

 Score =   174 bits (442),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 103/160 (64%), Gaps = 31/160 (19%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------------SAKFVKVAVDGAPYLRKVD  605
            QVVGWPPVRS+RKNIM                          A FVKV++DGAPYLRKVD
Sbjct  105  QVVGWPPVRSFRKNIMSVQSEKGAGSKDATDGDKSSPAASGGAAFVKVSLDGAPYLRKVD  164

Query  604  LVAFHSYQQLLTSLEDMFTCLTIC-------NVLNGKKLMDTSDGTEYVPTYEDKDGDWM  446
            L  + SYQ+L  +LE MF+  TI        N +N  KL+D  +G+EYVPTYEDKDGDWM
Sbjct  165  LKMYKSYQELSKALEKMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDGDWM  224

Query  445  LVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            LVGDVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  225  LVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  264



>ref|XP_010917600.1| PREDICTED: auxin-responsive protein IAA30 isoform X1 [Elaeis 
guineensis]
Length=246

 Score =   174 bits (440),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 105/160 (66%), Gaps = 31/160 (19%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKNIM             KSA FVKV++DGAPYLRK+DL  + SYQ+L 
Sbjct  87   QVVGWPPVRSFRKNIMSVQSDKGNKEEGEKSATFVKVSMDGAPYLRKIDLKMYRSYQELS  146

Query  571  TSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW-  425
             +LE MF+  TI N           +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW 
Sbjct  147  VALEKMFSSFTIGNCSSQGIKGRDFMNESKLMDLINGSEYVPTYEDKDGDWMLVGDVPWD  206

Query  424  -------KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
                   +MF++SCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  DLLSIKFRMFIDSCKRLRIMKGSEAIGLAPKAMEKCKNKS  246



>gb|EEE53980.1| hypothetical protein OsJ_00603 [Oryza sativa Japonica Group]
Length=208

 Score =   172 bits (437),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-MFTCLTI  536
            +VVGWPPVRS+RKN + +AKFVKVAVDGAPYLRKVDL A+  Y QLL +L+D  F+  TI
Sbjct  85   RVVGWPPVRSFRKNAL-AAKFVKVAVDGAPYLRKVDLEAYSGYDQLLRALQDKFFSHFTI  143

Query  535  CNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
                +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMKSS+ V LA
Sbjct  144  RKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNLA  203

Query  358  P  356
            P
Sbjct  204  P  204



>ref|XP_006838867.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
 gb|ERN01436.1| hypothetical protein AMTR_s00002p00266760 [Amborella trichopoda]
Length=238

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 104/153 (68%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS-----------------AKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+R+N++ +                 A +VKV++DGAPYLRKVDL  + SY
Sbjct  86   QVVGWPPVRSFRRNMLATQSSKGNNRSEEGEKNAGATYVKVSMDGAPYLRKVDLNMYKSY  145

Query  583  QQLLTSLEDMFTCLTI-------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            Q L  SLE MF+C T+        N LN  KLMD  +G+EYVPTYED+DGDWMLVGDVPW
Sbjct  146  QDLSNSLEKMFSCFTMGQCGSQGINFLNESKLMDLLNGSEYVPTYEDRDGDWMLVGDVPW  205

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFV+SC+RLR+MK S+ +GLAP    KC   S
Sbjct  206  EMFVDSCRRLRIMKGSEAIGLAPRAVEKCKNRS  238



>ref|XP_010274203.1| PREDICTED: auxin-responsive protein IAA16-like [Nelumbo nucifera]
Length=252

 Score =   174 bits (440),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 103/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKNI+               SA FVKV++DGAPYLRKVDL  + SYQ+L
Sbjct  102  QVVGWPPVRSFRKNILSVHKSSTEEGEKVSSSAAFVKVSMDGAPYLRKVDLKMYKSYQEL  161

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N  KLMD  +G+EYVPTYEDKDGDWMLVGDVPW+M
Sbjct  162  SDALGKMFSSFTIGNCGPQGMKDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDVPWEM  221

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  222  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>gb|KDP40274.1| hypothetical protein JCGZ_02272 [Jatropha curcas]
Length=241

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 103/150 (69%), Gaps = 22/150 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRSYRKNIM              SA FVKV +DGAPYLRKVDL  + SYQ+L 
Sbjct  92   QVVGWPPVRSYRKNIMANQKNNSDEGEKSLSAAFVKVCMDGAPYLRKVDLKMYKSYQELS  151

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MF
Sbjct  152  DALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  211

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            V+SCKRLR+MK S+ +GLAP    KC SRT
Sbjct  212  VDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  241



>ref|XP_009774251.1| PREDICTED: auxin-responsive protein IAA16-like [Nicotiana sylvestris]
Length=195

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 102/139 (73%), Gaps = 10/139 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLT  539
            QVVGWPPVRS+RKNI+   +A  VKV++DGAPYLRKVDL  + +YQQL  +L +MF+  T
Sbjct  57   QVVGWPPVRSFRKNILHVAAAALVKVSMDGAPYLRKVDLNMYKNYQQLSDALSNMFSSFT  116

Query  538  ICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMK  383
            I N         +N +KLMD  +  ++VPT+EDKDGDWMLVGDVPW MFVESCKRLR+MK
Sbjct  117  IGNCEVQGMKDFMNERKLMDLLNSCDFVPTFEDKDGDWMLVGDVPWGMFVESCKRLRIMK  176

Query  382  SSDVVGLAPTTPSKCSRTS  326
             ++ +GLAP T  KC   S
Sbjct  177  GTEAIGLAPKTMEKCKNRS  195



>gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum]
Length=220

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++                A FVKV+VDGAPYLRKVDL  + SYQQL
Sbjct  70   QVVGWPPVRSFRKNVLTVQKKSTGNGESSSGGAAFVKVSVDGAPYLRKVDLKMYKSYQQL  129

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW+M
Sbjct  130  SDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  189

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  190  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  220



>ref|XP_006420094.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 ref|XP_006489503.1| PREDICTED: auxin-responsive protein IAA14-like [Citrus sinensis]
 gb|ESR33334.1| hypothetical protein CICLE_v10005789mg [Citrus clementina]
 gb|KDO53918.1| hypothetical protein CISIN_1g026811mg [Citrus sinensis]
Length=232

 Score =   172 bits (437),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 10/138 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QVVGWPPVRSYRKN M ++A FVKV +DGAPYLRKVDL  + SYQ+L  +L  MF+  T+
Sbjct  95   QVVGWPPVRSYRKNAMAETAAFVKVCMDGAPYLRKVDLKTYKSYQELSDALAKMFSSFTM  154

Query  535  CN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
             N         +N  KLMD  + ++YVPTYEDKDGDWMLVGDVPW+MFV+SCKR+R+MK 
Sbjct  155  GNYGSQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWEMFVDSCKRMRIMKG  214

Query  379  SDVVGLAPTTPSKC-SRT  329
            S+ +GLAP    KC SRT
Sbjct  215  SEAIGLAPRAMEKCKSRT  232



>ref|XP_003568814.1| PREDICTED: auxin-responsive protein IAA15-like [Brachypodium 
distachyon]
Length=199

 Score =   172 bits (435),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 11/130 (8%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSA---KFVKVAVDGAPYLRKVDLVAFH------SYQQLLTSLE  560
            +VVGWPPVRSYRKN + +A   KFVKVAVDGAPYLRKVDL A+       SY QLL +L+
Sbjct  66   RVVGWPPVRSYRKNALATAAASKFVKVAVDGAPYLRKVDLTAYAGYTSSTSYDQLLAALQ  125

Query  559  D-MFTCLTICNVLNGK-KLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLM  386
            D  F+ LT   + N + KL+DT  GTEYVPTYEDKDGDWMLVGDVPW+MFVE+C+RLRLM
Sbjct  126  DKFFSHLTFRKLGNQEMKLVDTVSGTEYVPTYEDKDGDWMLVGDVPWRMFVETCQRLRLM  185

Query  385  KSSDVVGLAP  356
            KSS+ V LAP
Sbjct  186  KSSEAVNLAP  195



>ref|NP_001275398.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
 gb|ACV31209.1| auxin/indole-3-acetic acid 3 [Solanum tuberosum]
Length=249

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 102/153 (67%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN+M                  A FVKV+VDGAPYLRKVDL  + SYQ
Sbjct  97   QVVGWPPVRSFRKNVMTVQKNTTGAGESSGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQ  156

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            QL  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW
Sbjct  157  QLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPW  216

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  217  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|NP_001275031.1| auxin-responsive protein IAA14-like [Solanum tuberosum]
 gb|ABK41009.1| auxin/indole-3-acetic acid [Solanum tuberosum]
Length=213

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 103/152 (68%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM---------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRS+RKNIM               K+  FVKV++DGAPYLRKVDL  + SYQQ
Sbjct  62   QVVGWPPVRSFRKNIMSQKGNNNVEISEKGEKTIAFVKVSMDGAPYLRKVDLKMYKSYQQ  121

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  SL  MF+  T+ N         +N +KLMD  + ++YVPTYEDKDGDWMLVGDVPW+
Sbjct  122  LSDSLTKMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDKDGDWMLVGDVPWQ  181

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  182  MFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  213



>ref|XP_009610435.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana tomentosiformis]
Length=240

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++                A FVKV+VDGAPYLRKVDL  + SYQQL
Sbjct  90   QVVGWPPVRSFRKNVLNVQKKSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQL  149

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW+M
Sbjct  150  SDALGKMFSSFTIGNCGNHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  209

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_009776553.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=244

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 103/152 (68%), Gaps = 27/152 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------------KSAKFVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVRSYRKNIM                    SA FVKV++DGAPYLRKVDL  + 
Sbjct  89   QVVGWPPVRSYRKNIMAQKGGSICEESENSKGGICSSAAFVKVSMDGAPYLRKVDLKMYK  148

Query  589  SYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            SYQQL  +L +MF+  T+ N         +N +KLMD  + ++YVPTYEDKDGDWMLVGD
Sbjct  149  SYQQLSDALANMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGD  208

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            VPW+MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  209  VPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKC  240



>ref|NP_001266049.1| IAA9 protein [Solanum lycopersicum]
 gb|AEX00359.1| IAA16 [Solanum lycopersicum]
Length=251

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 102/153 (67%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN+M                  A FVKV+VDGAPYLRKVDL  + SYQ
Sbjct  99   QVVGWPPVRSFRKNVMTVQKNTTGAGEISGTGTGAAFVKVSVDGAPYLRKVDLKMYKSYQ  158

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            QL  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW
Sbjct  159  QLSDALGKMFSSFTIGNCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPW  218

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  219  EMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_009413916.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=244

 Score =   172 bits (437),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 102/155 (66%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKNI+                 SA FVKV++DGAPYLRKVDL  + SYQ
Sbjct  90   QVVGWPPVRSFRKNILSVNSEKGSKEEGEKSSISAAFVKVSMDGAPYLRKVDLKMYRSYQ  149

Query  580  QLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +L+ MF   T  N           +N  K+MD  +G+EYVPTYEDKDGDWMLVGDV
Sbjct  150  ELFMALQKMFISFTGGNYGSQGLSGRDFMNESKVMDLLNGSEYVPTYEDKDGDWMLVGDV  209

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  PWEMFVDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  244



>ref|NP_001152494.1| IAA15 - auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACG47882.1| IAA15 - auxin-responsive Aux/IAA family member [Zea mays]
Length=217

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 9/128 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-  557
            +VVGWPPVRSYRKN +       K+AKFVKVAVDGAPYLRKVDL A+  Y QLL +L+D 
Sbjct  86   RVVGWPPVRSYRKNALADAAGSSKAAKFVKVAVDGAPYLRKVDLQAYAGYDQLLRALQDK  145

Query  556  MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
             F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMK 
Sbjct  146  FFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKG  205

Query  379  SDVVGLAP  356
            S+ V LAP
Sbjct  206  SEAVNLAP  213



>gb|KFK31703.1| hypothetical protein AALP_AA6G148100 [Arabis alpina]
Length=208

 Score =   171 bits (433),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 9/134 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS---AKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCL  542
            QVVGWPPVRSYRKN+M +   A FVKV++DGAPYLRK+DL  + SY  L  +L  MF+  
Sbjct  71   QVVGWPPVRSYRKNVMSATAEATFVKVSMDGAPYLRKIDLKMYKSYNDLSNALTTMFSSF  130

Query  541  TICNVLNGKKLMD------TSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
            T+ N   G+ ++D        DG+EYVP+YEDKDGDWMLVGDVPW+MFVESCKR+R+MK 
Sbjct  131  TMSNNKGGEGMIDFMKERKIMDGSEYVPSYEDKDGDWMLVGDVPWEMFVESCKRIRIMKG  190

Query  379  SDVVGLAPTTPSKC  338
            S+ +GLAP    KC
Sbjct  191  SEAIGLAPRAMEKC  204



>ref|NP_001132035.1| IAA15-auxin-responsive Aux/IAA family member [Zea mays]
 gb|ACF80714.1| unknown [Zea mays]
 gb|ACF85333.1| unknown [Zea mays]
 tpg|DAA53183.1| TPA: IAA15-auxin-responsive Aux/IAA family member [Zea mays]
 gb|AIB05664.1| AUX/IAA transcription factor, partial [Zea mays]
Length=220

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 100/128 (78%), Gaps = 9/128 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-  557
            +VVGWPPVRSYRKN +       K+AKFVKVAVDGAPYLRKVDL A+  Y QLL +L+D 
Sbjct  89   RVVGWPPVRSYRKNALADAAGSSKAAKFVKVAVDGAPYLRKVDLQAYAGYDQLLRALQDK  148

Query  556  MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
             F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMK 
Sbjct  149  FFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKG  208

Query  379  SDVVGLAP  356
            S+ V LAP
Sbjct  209  SEAVNLAP  216



>ref|XP_009611797.1| PREDICTED: auxin-responsive protein IAA14 [Nicotiana tomentosiformis]
Length=243

 Score =   172 bits (436),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 103/155 (66%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------------KSAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVRS+RKNIM                   SA FVKV++DGAPYLRKVDL  + S
Sbjct  89   QVVGWPPVRSFRKNIMAQKGSSICEESENSKGGSSSAAFVKVSMDGAPYLRKVDLKMYKS  148

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            YQQL  +L  MF+  T+ N         +N +KLMD  + ++YVPTYEDKDGDWMLVGDV
Sbjct  149  YQQLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDV  208

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  209  PWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum]
Length=240

 Score =   172 bits (435),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM--------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++                A FVKV+VDGAPYLRKVDL  + SYQQL
Sbjct  90   QVVGWPPVRSFRKNVLTVQKNSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQL  149

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW+M
Sbjct  150  SDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  209

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_004968415.1| PREDICTED: auxin-responsive protein IAA1-like isoform X2 [Setaria 
italica]
Length=216

 Score =   171 bits (433),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 101/131 (77%), Gaps = 12/131 (9%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            +VVGWPPVRSYRKN +          ++AKFVKVAVDGAPYLRKVDL A+  Y QLL +L
Sbjct  82   RVVGWPPVRSYRKNALADVAGSCKAKQAAKFVKVAVDGAPYLRKVDLEAYAGYDQLLRAL  141

Query  562  ED-MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRL  389
            +D  F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRL
Sbjct  142  QDKFFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRL  201

Query  388  MKSSDVVGLAP  356
            MKSS+ V LAP
Sbjct  202  MKSSEAVNLAP  212



>ref|XP_010936171.1| PREDICTED: auxin-responsive protein IAA30-like [Elaeis guineensis]
Length=251

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 103/155 (66%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN+M                 SA FVKV++DGAPYLRKVDL  + SY+
Sbjct  97   QVVGWPPVRSFRKNMMASHSDKGSKEAGEKSSNSAAFVKVSMDGAPYLRKVDLKMYSSYK  156

Query  580  QLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +LE MF+  T  N           +N  KLMD  +G+EYVPTYEDKDGDWMLVGDV
Sbjct  157  ELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDV  216

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  217  PWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  251



>ref|XP_009364490.1| PREDICTED: auxin-responsive protein IAA16 [Pyrus x bretschneideri]
Length=252

 Score =   172 bits (436),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/152 (56%), Positives = 101/152 (66%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK---------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            Q VGWPPVRS+RKNI+                +A FVKV+VDGAPYLRKVDL  + SYQ+
Sbjct  100  QAVGWPPVRSFRKNILAVQKNGSEEGEKTNSITAAFVKVSVDGAPYLRKVDLKLYKSYQE  159

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L T+L  MF+  TI N         +N  KL+D   G+EYVP+YEDKDGDWMLVGDVPW+
Sbjct  160  LSTALSKMFSSFTIGNCGSQGMKDFVNESKLIDLLSGSEYVPSYEDKDGDWMLVGDVPWE  219

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  220  MFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_009761467.1| PREDICTED: auxin-responsive protein IAA16 [Nicotiana sylvestris]
Length=240

 Score =   172 bits (435),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM--------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++                A FVKV+VDGAPYLRKVDL  + SYQQL
Sbjct  90   QVVGWPPVRSFRKNVLTVQKNSTGNGESSGGGAAFVKVSVDGAPYLRKVDLKMYKSYQQL  149

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW+M
Sbjct  150  SDALGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEM  209

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  FVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  240



>ref|XP_008218270.1| PREDICTED: auxin-responsive protein IAA16 [Prunus mume]
Length=256

 Score =   172 bits (436),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 103/153 (67%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKNI+                 SA FVKV++DGAPYLRKVDL  + SYQ
Sbjct  104  QVVGWPPVRSFRKNIVTVQKKSSEEAEKGNSNISAAFVKVSMDGAPYLRKVDLKLYKSYQ  163

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L T+L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW
Sbjct  164  ELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPW  223

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  224  GMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  256



>ref|XP_007223810.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
 gb|EMJ25009.1| hypothetical protein PRUPE_ppa010698mg [Prunus persica]
Length=239

 Score =   171 bits (434),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 101/152 (66%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK---------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKNIM                SA FVKV +DGAPYLRKVDL  + SYQ+
Sbjct  88   QVVGWPPVRSYRKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQE  147

Query  577  LLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  SL  MF+  T+         + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+
Sbjct  148  LSNSLAKMFSSFTMGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  207

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  208  MFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  239



>ref|XP_011027555.1| PREDICTED: auxin-responsive protein IAA14 isoform X2 [Populus 
euphratica]
 ref|XP_011029891.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 102/153 (67%), Gaps = 25/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKN+M                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  156  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  215

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            +MFV SCKRLRLMK S+ +GLAP    KC SRT
Sbjct  216  EMFVNSCKRLRLMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_008224185.1| PREDICTED: auxin-responsive protein IAA14 [Prunus mume]
Length=248

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 101/152 (66%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK---------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKNIM                SA FVKV +DGAPYLRKVDL  + SYQ+
Sbjct  97   QVVGWPPVRSYRKNIMAQKSSSEESTEKGSGCSAAFVKVCMDGAPYLRKVDLKMYKSYQE  156

Query  577  LLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  SL  MF+  T+         + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+
Sbjct  157  LSNSLAKMFSSFTMGYYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  216

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  217  MFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  248



>ref|XP_002443496.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
 gb|EES17334.1| hypothetical protein SORBIDRAFT_08g020580 [Sorghum bicolor]
Length=281

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 103/160 (64%), Gaps = 31/160 (19%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------------SAKFVKVAVDGAPYLRKVD  605
            QVVGWPPVRS+RKNIM                          A FVKV++DGAPYLRKVD
Sbjct  122  QVVGWPPVRSFRKNIMSVQSDKGAGGSKDADKSSPAAAAGGGAAFVKVSLDGAPYLRKVD  181

Query  604  LVAFHSYQQLLTSLEDMFTCLTI-------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWM  446
            L  + SYQ+L  +LE MF+  TI        N +N  KL+D  +G+EYVPTYEDKDGDWM
Sbjct  182  LKMYKSYQELSKALEKMFSSFTIGSCGSQGMNGMNESKLVDLLNGSEYVPTYEDKDGDWM  241

Query  445  LVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            LVGDVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  242  LVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  281



>ref|XP_010552451.1| PREDICTED: auxin-responsive protein IAA14-like [Tarenaya hassleriana]
Length=235

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 101/149 (68%), Gaps = 20/149 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------FVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVR+YRKN+M   K            FVKV++DGAPYLRKVDL  + SYQ+L  
Sbjct  87   QVVGWPPVRNYRKNMMAHQKSSAVEEEKAAAAFVKVSMDGAPYLRKVDLKMYKSYQELSD  146

Query  568  SLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MFV
Sbjct  147  ALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWQMFV  206

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +SCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  DSCKRLRIMKGSEAIGLAPRAVEKCKNRS  235



>emb|CDO99148.1| unnamed protein product [Coffea canephora]
Length=239

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 101/148 (68%), Gaps = 23/148 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM---------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRS+RKNIM                SA FVKV++DGAPYLRKVDL  + SYQ+
Sbjct  88   QVVGWPPVRSFRKNIMAQKSNTEEAAAEKAGSSAAFVKVSMDGAPYLRKVDLKMYKSYQE  147

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+
Sbjct  148  LSDALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWE  207

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  208  MFVDSCKRLRIMKGSEAIGLAPRAMEKC  235



>ref|XP_011026048.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN++                 +A FVKV++DGAPYLRKVDL  + +YQ
Sbjct  83   QVVGWPPVRSFRKNMLAVQKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQ  142

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +LE+MF+  TI N         LN  KL+D  +GT+YVPTYEDKDGDWMLVGDVPW
Sbjct  143  ELSGALEEMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPW  202

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             MFVESCKRLR+MK ++  GLAP    KC   S
Sbjct  203  DMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>ref|XP_009777122.1| PREDICTED: auxin-responsive protein IAA14-like [Nicotiana sylvestris]
Length=223

 Score =   171 bits (432),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 100/148 (68%), Gaps = 21/148 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKN+M              +A FVKV +DGAPYLRKVDL  + SYQQL 
Sbjct  74   QVVGWPPVRSFRKNVMAQKNNTEAEKSNATAAAFVKVCMDGAPYLRKVDLKMYKSYQQLS  133

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW MF
Sbjct  134  DALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWVMF  193

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSR  332
            V+SCKRLR+MK S+ +GLAP    KC R
Sbjct  194  VDSCKRLRIMKGSEAIGLAPRAMEKCKR  221



>emb|CBI35213.3| unnamed protein product [Vitis vinifera]
Length=170

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-------------FVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKNI+   K             FVKV++DGAPYLRKVDL  + SYQ+L 
Sbjct  21   QVVGWPPVRSFRKNILTVQKNSSEEEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELS  80

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW+MF
Sbjct  81   DALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  140

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VESCKRLR+MK S+ +GLAP    KC   S
Sbjct  141  VESCKRLRIMKGSEAIGLAPRAVEKCKNRS  170



>ref|XP_006605305.1| PREDICTED: uncharacterized protein LOC100499872 isoform X1 [Glycine 
max]
 gb|KHN04928.1| Auxin-induced protein AUX28 [Glycine soja]
Length=227

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/143 (59%), Positives = 102/143 (71%), Gaps = 14/143 (10%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAK--FVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVRS+RKNI+          KS K  FVKV++DGAPYLRKVD+  + SYQ+L  
Sbjct  85   QVVGWPPVRSFRKNIVQRNSNEEEAEKSTKNAFVKVSMDGAPYLRKVDIKLYKSYQELSD  144

Query  568  SLEDMFTCLTI--CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRL  395
            +L  MF+  TI  C     K  M+ ++G++YVPTYEDKDGDWMLVGDVPW+MFVESCKRL
Sbjct  145  ALAKMFSSFTIEKCGSQGMKDFMNETNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  204

Query  394  RLMKSSDVVGLAPTTPSKCSRTS  326
            R+MK S+ +GLAP    KC   S
Sbjct  205  RIMKGSEAIGLAPRAVEKCKNRS  227



>ref|XP_007143877.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
 gb|ESW15871.1| hypothetical protein PHAVU_007G109500g [Phaseolus vulgaris]
Length=244

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 101/154 (66%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-----------------KSAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRSYRKN+M                  S  FVKV++DGAPYLRKVDL  + SY
Sbjct  91   QVVGWPPVRSYRKNMMTQKVSTEDGAEKTTSSTASGAFVKVSMDGAPYLRKVDLTMYKSY  150

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            + L  +L  MF+  T+ N         +N +KLMD  + +EYVPTYEDKDGDWMLVGDVP
Sbjct  151  KDLSDALAKMFSSFTMGNYGAQGMIDFMNERKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  210

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  211  WEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  244



>ref|NP_001266039.1| IAA7 protein [Solanum lycopersicum]
 gb|AEX00351.1| IAA7 [Solanum lycopersicum]
Length=218

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 104/156 (67%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------------KSAKFVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVRS+RKN++                   K+  FVKV++DGAPYLRKVDL  + 
Sbjct  63   QVVGWPPVRSFRKNMLSQKGNNNNNNNEEISEKDEKTIAFVKVSMDGAPYLRKVDLKMYK  122

Query  589  SYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            SYQQL  SL +MF+  T+ N         +N +KLMD  + ++YVPTYEDKDGDWMLVGD
Sbjct  123  SYQQLSHSLTNMFSSFTMGNYGSQGMIDFMNERKLMDVLNSSDYVPTYEDKDGDWMLVGD  182

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  183  VPWQMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  218



>dbj|BAG55005.1| auxin-responsive Aux/IAA gene family member [Ipomoea nil]
Length=225

 Score =   170 bits (430),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 99/148 (67%), Gaps = 19/148 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-----------FVKVAVDGAPYLRKVDLVAFHSYQQLLTS  566
            QVVGWPPVRSYRKNI+   K            VKV+VDGAPYLRKVDL  + SY +L  +
Sbjct  78   QVVGWPPVRSYRKNILSGQKAAGESSGGGAALVKVSVDGAPYLRKVDLKMYKSYHELSEA  137

Query  565  LEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
            L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW MFV+
Sbjct  138  LGKMFSSFTIGNCGTHGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWNMFVD  197

Query  409  SCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            SCKRLR+MK S+ +GLAP    KC   S
Sbjct  198  SCKRLRIMKGSEAIGLAPRAVEKCKNRS  225



>gb|ADL36587.1| ARF domain class transcription factor [Malus domestica]
Length=175

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 99/142 (70%), Gaps = 23/142 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK---------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRS+RKNI+                SA FVKV++DGAPYLRKVDL  + SYQ+
Sbjct  24   QVVGWPPVRSFRKNILTVQKNSSEEGENTNSISAAFVKVSMDGAPYLRKVDLKLYKSYQE  83

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L T+L  MF+  TI N         +N  KL+D   G+EYVP+YEDKDGDWMLVGDVPW+
Sbjct  84   LSTALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDKDGDWMLVGDVPWE  143

Query  421  MFVESCKRLRLMKSSDVVGLAP  356
            MFV SCKRLR+MK S+ +GLAP
Sbjct  144  MFVNSCKRLRIMKGSEAIGLAP  165



>ref|XP_002311658.1| aux/IAA family protein [Populus trichocarpa]
 gb|ABK95711.1| unknown [Populus trichocarpa]
 gb|EEE89025.1| aux/IAA family protein [Populus trichocarpa]
Length=248

 Score =   171 bits (432),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 102/153 (67%), Gaps = 25/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKN+M                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  156  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  215

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            +MFV SCKRLR+MK S+ +GLAP    KC SRT
Sbjct  216  EMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|XP_009591035.1| PREDICTED: auxin-responsive protein IAA7-like [Nicotiana tomentosiformis]
Length=225

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 100/149 (67%), Gaps = 22/149 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN+M               +  FVKV +DGAPYLRKVDL  + SYQQL
Sbjct  75   QVVGWPPVRSFRKNVMAQKNNTEETEKSSATAVAFVKVCMDGAPYLRKVDLKMYKSYQQL  134

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+M
Sbjct  135  SDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  194

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSR  332
            FV+SCKRLR+MK S+ +GLAP    KC R
Sbjct  195  FVDSCKRLRIMKGSEAIGLAPRAMEKCKR  223



>gb|AFZ78617.1| hypothetical protein [Populus tomentosa]
Length=248

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 102/153 (67%), Gaps = 25/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKN+M                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSYRKNVMAQKNASEEGEKTSTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  156  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  215

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            +MFV SCKRLR+MK S+ +GLAP    KC SRT
Sbjct  216  EMFVNSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>ref|NP_001268036.1| uncharacterized protein LOC100250231 [Vitis vinifera]
 gb|ADR80321.1| indole-3-acetic acid-induced protein 16 [Vitis vinifera]
Length=238

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-------------FVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKNI+   K             FVKV++DGAPYLRKVDL  + SYQ+L 
Sbjct  89   QVVGWPPVRSFRKNILTVQKNSSEEEKASSSAAFVKVSMDGAPYLRKVDLKMYKSYQELS  148

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW+MF
Sbjct  149  DALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWEMF  208

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VESCKRLR+MK S+ +GLAP    KC   S
Sbjct  209  VESCKRLRIMKGSEAIGLAPRAVEKCKNRS  238



>ref|XP_010551700.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=234

 Score =   170 bits (430),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 99/147 (67%), Gaps = 18/147 (12%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------FVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVR+YRKN+M   K          FVKV++DGAPYLRKVDL  +  YQ L  +L
Sbjct  88   QVVGWPPVRNYRKNMMAQQKSSSAVEEEKAFVKVSMDGAPYLRKVDLKIYQCYQDLSDAL  147

Query  562  EDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVES  407
              MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW+MFVES
Sbjct  148  AKMFSSFTMGNYGSQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPWQMFVES  207

Query  406  CKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            CKRLR+MK S+ +GLAP    KC   S
Sbjct  208  CKRLRIMKGSEAIGLAPRAMEKCKNRS  234



>ref|NP_001280973.1| auxin-responsive protein IAA16 [Malus domestica]
 gb|ABI36494.1| AUX/IAA16 B [Malus domestica]
Length=251

 Score =   170 bits (431),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 102/152 (67%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM---------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRS+R NI+                SA FVKV++DGAPYLRKVDL  + SYQ+
Sbjct  100  QVVGWPPVRSFRXNILAVQKDVSDEGEKTNSXSAAFVKVSMDGAPYLRKVDLKLYKSYQE  159

Query  577  LLTSLEDMFTCLTIC--------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L T+L  MF+  TI         + +N  KL+D  +G+EYVPTYEDKDGDWMLVGDVPW+
Sbjct  160  LSTALGKMFSSFTIGSYGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVPWE  219

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFV SCKRLR+M+ S+ +GLAP    KC   S
Sbjct  220  MFVNSCKRLRIMRGSEAIGLAPRAVEKCKNRS  251



>gb|AEE25654.1| auxin-responsive protein [Gossypium hirsutum]
Length=246

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 102/163 (63%), Gaps = 34/163 (21%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------------------------FVKVAVDGAPYLRK  611
            QVVGWPPVRS+RKNIM   K                          FVKV++DGAPYLRK
Sbjct  84   QVVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAAITTTTAAAFVKVSMDGAPYLRK  143

Query  610  VDLVAFHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDG  455
            VDL  + SYQQL  +L  MF+  TI N         +N  KL+D  +G+EYVPTYEDKDG
Sbjct  144  VDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDKDG  203

Query  454  DWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DWMLVGDVPW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  204  DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>ref|XP_011030586.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Populus 
euphratica]
Length=248

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/153 (56%), Positives = 103/153 (67%), Gaps = 25/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKN++                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  156  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  215

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            +MFV+SCKRLR+MK S+ +GLAP    KC SRT
Sbjct  216  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  248



>gb|KHN05057.1| Auxin-responsive protein IAA14 [Glycine soja]
Length=245

 Score =   170 bits (430),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 101/156 (65%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------------KSAKFVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVRSYRKN+M                    S  FVKV++DGAPYLRKVDL  + 
Sbjct  90   QVVGWPPVRSYRKNMMAVQKVSTEDVAEKTTSSTANSGAFVKVSMDGAPYLRKVDLTMYK  149

Query  589  SYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            SY++L  +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGD
Sbjct  150  SYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGD  209

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  245



>dbj|BAJ97201.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=241

 Score =   169 bits (429),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 99/138 (72%), Gaps = 10/138 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI-  536
            Q VGWPPVRS+R+N++ +A  VKV++DGAPYLRKVD+  + SYQ+L  +LE MF+  TI 
Sbjct  105  QAVGWPPVRSFRRNMLAAA-LVKVSMDGAPYLRKVDMGTYKSYQELSKALEKMFSSFTIG  163

Query  535  --------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
                     N +N  KL D   G++YVPTYEDKDGDWMLVGDVPW+MFV SCKRLR+MK 
Sbjct  164  NDCSQARGINGMNETKLADLLTGSDYVPTYEDKDGDWMLVGDVPWEMFVASCKRLRIMKG  223

Query  379  SDVVGLAPTTPSKCSRTS  326
            S+ +GLAP    KC   S
Sbjct  224  SEAIGLAPRAMEKCKSRS  241



>gb|KHN22078.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=231

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (73%), Gaps = 14/143 (10%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF  551
            QVVGWPPVRS+RKNI++       A FVKV++DGAPYLRKVD+  + SYQ+L  +L  MF
Sbjct  89   QVVGWPPVRSFRKNIVQRNKNEEEAAFVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMF  148

Query  550  TCLTI--C------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRL  395
            +  TI  C      + +N  KL+D  +G++YVPTY+DKDGDWMLVGDVPW+MFVESC+RL
Sbjct  149  SSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDGDWMLVGDVPWEMFVESCQRL  208

Query  394  RLMKSSDVVGLAPTTPSKCSRTS  326
            R+MK S+ +GLAP    KC   S
Sbjct  209  RIMKGSEAIGLAPRAVEKCKNRS  231



>ref|NP_001239753.1| uncharacterized protein LOC100781847 [Glycine max]
 gb|ACU21611.1| unknown [Glycine max]
Length=231

 Score =   169 bits (428),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 104/143 (73%), Gaps = 14/143 (10%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF  551
            QVVGWPPVRS+RKNI++       A FVKV++DGAPYLRKVD+  + SYQ+L  +L  MF
Sbjct  89   QVVGWPPVRSFRKNIVQRNKNEEEAAFVKVSMDGAPYLRKVDIKLYKSYQELSDALAKMF  148

Query  550  TCLTI--C------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRL  395
            +  TI  C      + +N  KL+D  +G++YVPTY+DKDGDWMLVGDVPW+MFVESC+RL
Sbjct  149  SSFTIEKCGSQGMKDFMNETKLIDLLNGSDYVPTYQDKDGDWMLVGDVPWEMFVESCQRL  208

Query  394  RLMKSSDVVGLAPTTPSKCSRTS  326
            R+MK S+ +GLAP    KC   S
Sbjct  209  RIMKGSEAIGLAPRAVEKCKNRS  231



>ref|XP_004172452.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis sativus]
 gb|KGN61643.1| hypothetical protein Csa_2G200420 [Cucumis sativus]
Length=256

 Score =   169 bits (429),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 102/154 (66%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-----------------KSAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRSYRKN+M                  SA FVKV +DGAPYLRKVDL  + SY
Sbjct  103  QVVGWPPVRSYRKNVMAQKNTSGGEGTEKGNGGSSAAFVKVCMDGAPYLRKVDLKMYQSY  162

Query  583  QQLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +L  MF+  T+         + +N +KLMD  + +E+VPTYEDKDGDWMLVGDVP
Sbjct  163  QELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGDWMLVGDVP  222

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  223  WEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>ref|XP_008788131.1| PREDICTED: auxin-responsive protein IAA30-like [Phoenix dactylifera]
Length=241

 Score =   169 bits (428),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 102/155 (66%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN+M                 SA  VKV++DGAPYLRKVDL  + SY+
Sbjct  87   QVVGWPPVRSFRKNMMATHSDKGSKEAGEKFSNSAALVKVSMDGAPYLRKVDLKIYSSYK  146

Query  580  QLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +LE MF+  T  N           +N  KLMD  +G+EYVPTYEDKDGDWMLVGDV
Sbjct  147  ELSMALEKMFSSFTSGNCGSQGMNGRDFMNESKLMDLLNGSEYVPTYEDKDGDWMLVGDV  206

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  PWEMFVDSCKRLRMMKGSEAIGLAPRAMEKCKNRS  241



>ref|XP_010674855.1| PREDICTED: auxin-induced protein AUX28 [Beta vulgaris subsp. 
vulgaris]
Length=297

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 103/157 (66%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNI--------------------MKSAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVR++RKNI                    + SA FVKV++DGAPYLRKVDL  +
Sbjct  141  QVVGWPPVRAFRKNIVAVQKKSSEEQADQKASNNTIASAAFVKVSMDGAPYLRKVDLKLY  200

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVG
Sbjct  201  KSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  260

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  261  DVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKSRS  297



>ref|XP_003569702.1| PREDICTED: auxin-responsive protein IAA1-like [Brachypodium distachyon]
Length=200

 Score =   168 bits (425),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-MFTCL  542
            +VVGWPPVRS+RKN +   +AKFVKVAVDGAPYLRKV+L A+  Y QLL  L+D  F+  
Sbjct  74   RVVGWPPVRSFRKNALADAAAKFVKVAVDGAPYLRKVNLEAYAGYDQLLRGLQDKFFSHF  133

Query  541  TICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVG  365
            TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMK+S  V 
Sbjct  134  TIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVEACQRLRLMKNSKAVN  193

Query  364  LAP  356
            LAP
Sbjct  194  LAP  196



>gb|ABM53872.1| IAA4 [Cestrum elegans]
Length=149

 Score =   166 bits (420),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 100/149 (67%), Gaps = 21/149 (14%)
 Frame = -1

Query  709  VVGWPPVRSYRKNI-------------MKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            VVGWPPVRS+RKN+               +A FVKV+VDGAPYLRKVDL  + SYQQL  
Sbjct  1    VVGWPPVRSFRKNVSTVQRSSTGEISGTGAAAFVKVSVDGAPYLRKVDLKMYKSYQQLSD  60

Query  568  SLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW MFV
Sbjct  61   ALGKMFSSFTIENCGTQGFKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFV  120

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +SCKRLR+MK S+ +GLAP    KC   S
Sbjct  121  DSCKRLRIMKGSEAIGLAPRAVEKCKNRS  149



>ref|XP_008654436.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF79419.1| unknown [Zea mays]
 gb|AFW80193.1| IAA1-auxin-responsive Aux/IAA family member [Zea mays]
Length=186

 Score =   167 bits (423),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 98/128 (77%), Gaps = 9/128 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-  557
            +VVGWPPVRSYRKN +       +SA FVKVAVDGA YLRKVDL A+  Y QLL +L+D 
Sbjct  55   RVVGWPPVRSYRKNALADSSKANRSASFVKVAVDGAAYLRKVDLQAYGGYDQLLRALQDK  114

Query  556  MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
             F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMK 
Sbjct  115  FFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCRRLRLMKG  174

Query  379  SDVVGLAP  356
            S+ V LAP
Sbjct  175  SEAVNLAP  182



>ref|XP_006366663.1| PREDICTED: auxin-responsive protein IAA16-like [Solanum tuberosum]
Length=214

 Score =   168 bits (425),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 12/137 (9%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKF--------VKVAVDGAPYLRKVDLVAFHSYQQLLTSLED  557
            Q+VGWPPVRS+RKNI+ S K         VKV++DGAPYLRKVDL  + SYQ+L  +L  
Sbjct  73   QIVGWPPVRSFRKNILTSQKLGQESDNILVKVSMDGAPYLRKVDLNMYKSYQELSDALAK  132

Query  556  MFTCLTIC----NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRL  389
            MF   TI     + +N +KLMD  + ++YVPTYEDKDGDWMLVGDVPW MFV+SCKRLR+
Sbjct  133  MFNSFTIVQGMKDFMNERKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRI  192

Query  388  MKSSDVVGLAPTTPSKC  338
            MK ++ +GLAP    KC
Sbjct  193  MKGTEAIGLAPRAMEKC  209



>ref|XP_004982376.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Setaria 
italica]
Length=267

 Score =   170 bits (430),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 99/154 (64%), Gaps = 26/154 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            Q VGWPPVRS+RKNI+                  +A FVKV++DGAPYLRKVDL  + SY
Sbjct  113  QAVGWPPVRSFRKNILSVQSCQKGGGDMDDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSY  172

Query  583  QQLLTSLEDMFTCLTICNVLNGK---------KLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            Q+L  +LE MF+  TI     G          KL D   G+EYVPTYEDKDGDWMLVGDV
Sbjct  173  QELSKALEKMFSSFTIAGSCGGSQGMKGMNETKLADLLSGSEYVPTYEDKDGDWMLVGDV  232

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRT  329
            PW+MFVESCKRLR+MK S+ VGLAP    KC  +
Sbjct  233  PWEMFVESCKRLRIMKGSEAVGLAPRAMEKCKNS  266



>ref|XP_004982377.1| PREDICTED: auxin-responsive protein IAA30-like isoform X2 [Setaria 
italica]
Length=266

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 101/153 (66%), Gaps = 25/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            Q VGWPPVRS+RKNI+                  +A FVKV++DGAPYLRKVDL  + SY
Sbjct  113  QAVGWPPVRSFRKNILSVQSCQKGGGDMDDGKSGAAAFVKVSMDGAPYLRKVDLRMYGSY  172

Query  583  QQLLTSLEDMFTCLTICNV--------LNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +LE MF+  TI +         +N  KL D   G+EYVPTYEDKDGDWMLVGDVP
Sbjct  173  QELSKALEKMFSSFTIGSCGGSQGMKGMNETKLADLLSGSEYVPTYEDKDGDWMLVGDVP  232

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRT  329
            W+MFVESCKRLR+MK S+ VGLAP    KC  +
Sbjct  233  WEMFVESCKRLRIMKGSEAVGLAPRAMEKCKNS  265



>gb|EYU30526.1| hypothetical protein MIMGU_mgv1a012831mg [Erythranthe guttata]
Length=239

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 103/153 (67%), Gaps = 28/153 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI+                     +A FVKV++DGAPYLRKVDL  +
Sbjct  83   QVVGWPPVRSFRKNILAVQKNSSSGATTEADKSSGGAAAAFVKVSLDGAPYLRKVDLKMY  142

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQQL  +L  MF+  TI N        ++N  KL+D  +G++YVPTYEDKDGDWMLVG
Sbjct  143  TSYQQLSDALGKMFSSFTIGNCGSEGIKDLMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  202

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            DVPW+MFV+SCKR+R+MK S+ +GLAP    KC
Sbjct  203  DVPWEMFVDSCKRIRIMKGSEAIGLAPRAVEKC  235



>gb|KHN31465.1| Auxin-responsive protein IAA16 [Glycine soja]
Length=243

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 104/157 (66%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI++                     A FVKV++DGAPYLRKVDL  +
Sbjct  87   QVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLY  146

Query  592  HSYQQLLTSLEDMFTCLTI--C------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+LL +L  MF+  TI  C      + +N  KL+D  +G++YVPTYEDKD DWMLVG
Sbjct  147  KSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWMLVG  206

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  DVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>ref|XP_009409331.1| PREDICTED: auxin-responsive protein IAA1-like isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=267

 Score =   169 bits (429),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = -1

Query  709  VVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFT-CLTIC  533
            VVGWPPVRSY KN ++S  FVKVAVDG PYLRKVDL  +  Y++LLT+++ MF+ C TI 
Sbjct  147  VVGWPPVRSYWKNTLRSRTFVKVAVDGTPYLRKVDLETYGGYRELLTAVQAMFSSCFTID  206

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N   G +L+D   GTEY+PTYEDKDGDWML+GDVPWKMFV SCKRLRLMKSS+ V L  T
Sbjct  207  N---GNRLVDLVKGTEYLPTYEDKDGDWMLIGDVPWKMFVSSCKRLRLMKSSEAVNLDAT  263

Query  352  TPS  344
            + S
Sbjct  264  SSS  266



>ref|XP_007034956.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
 gb|EOY05882.1| Indole-3-acetic acid 7 isoform 1 [Theobroma cacao]
Length=254

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 101/149 (68%), Gaps = 24/149 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------------FVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKNIM + K                FVKV++DGAPYLRKVDL  + SYQ
Sbjct  102  QVVGWPPVRSYRKNIMANQKNSCEESDKKASSGGAAFVKVSMDGAPYLRKVDLKMYKSYQ  161

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + ++YVPTYEDKDGDWMLVGDVPW
Sbjct  162  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPW  221

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            +MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  222  EMFVDSCKRLRIMKGSEAIGLAPRAMEKC  250



>ref|XP_011038568.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=246

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 101/150 (67%), Gaps = 25/150 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-----------------FVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPP+RS+RKN+M   K                 FVKV++DGAPYLRKVDL  + SY
Sbjct  93   QVVGWPPIRSFRKNVMAVQKNSNDNGEKSGSGGAGVAFVKVSMDGAPYLRKVDLKLYKSY  152

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +L  MF+  TI N         +N  KL+D  +G+EYVPTYEDKDGDWMLVGDVP
Sbjct  153  QELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLVGDVP  212

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            W+MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  213  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKC  242



>ref|XP_007030567.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
 gb|EOY11069.1| Indoleacetic acid-induced protein 16 [Theobroma cacao]
Length=249

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/160 (54%), Positives = 102/160 (64%), Gaps = 31/160 (19%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-----------------------FVKVAVDGAPYLRKVDL  602
            QVVGWPPVRS+RKNIM   K                       FVKV++DGAPYLRKVDL
Sbjct  90   QVVGWPPVRSFRKNIMAVQKNSSDVEGEKAGSSNTTTATVAAAFVKVSMDGAPYLRKVDL  149

Query  601  VAFHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWM  446
              + SYQ+L  +L  MF+  TI N         +N  KL+D  +G+EYVPTYEDKDGDWM
Sbjct  150  KLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWM  209

Query  445  LVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            LVGDVPW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  LVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_004302055.1| PREDICTED: auxin-responsive protein IAA16-like [Fragaria vesca 
subsp. vesca]
Length=254

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 102/152 (67%), Gaps = 28/152 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI+                     SA FVKV++DGAPYLRKVDL  +
Sbjct  98   QVVGWPPVRSFRKNIVAVQKKSTDQDQAAEKSGSTSTSAAFVKVSMDGAPYLRKVDLKLY  157

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+L T+L  MF+  TI N         +N  KL+D  +G+EYVP+YEDKDGDWMLVG
Sbjct  158  QSYQELSTALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPSYEDKDGDWMLVG  217

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSK  341
            DVPW+MFV+SCKRLR+MK S+ +GLAP    K
Sbjct  218  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK  249



>ref|XP_011091113.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=241

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 101/150 (67%), Gaps = 25/150 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+RKNIM                  +A FVKV++DGAPYLRKVDL  + SY
Sbjct  88   QVVGWPPVRSFRKNIMAHQKSSDEEAEKAACSSPTAAFVKVSMDGAPYLRKVDLKMYKSY  147

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVP
Sbjct  148  QELSDALAKMFSSFTMGNYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  207

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            W+MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  208  WQMFVDSCKRLRIMKGSEAIGLAPRAMEKC  237



>gb|EEE53551.1| hypothetical protein OsJ_36765 [Oryza sativa Japonica Group]
Length=183

 Score =   167 bits (422),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 102/158 (65%), Gaps = 29/158 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------------KSAKFVKVAVDGAPYLRKVDLV  599
            QVVGWPPVRSYRKNI+                       +A FVKV++DGAPYLRKVDL 
Sbjct  26   QVVGWPPVRSYRKNILAVQADKGKDAADGGGDKSGAGAAAAAFVKVSMDGAPYLRKVDLK  85

Query  598  AFHSYQQLLTSLEDMFTCLTICNV-------LNGKKLMDTSDGTEYVPTYEDKDGDWMLV  440
             + SY +L  +LE MF+  TI N        +N  K+ D  +G+EYVPTYEDKDGDWMLV
Sbjct  86   MYKSYLELSKALEKMFSSFTIGNCGSHGVNGMNESKIADLLNGSEYVPTYEDKDGDWMLV  145

Query  439  GDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            GDVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  146  GDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  183



>ref|XP_008465181.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=256

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 102/154 (66%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-----------------KSAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRSYRKN+M                  SA FVKV +DGAPYLRKVDL  + SY
Sbjct  103  QVVGWPPVRSYRKNVMAQKNTSGGEGAEKGSSGSSAAFVKVCMDGAPYLRKVDLKMYQSY  162

Query  583  QQLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +L  MF+  T+         + +N +KLMD  + +E+VPTYEDKDGDWMLVGDVP
Sbjct  163  QELSDALAKMFSSFTMGEYGTQGMIDFMNERKLMDLLNSSEFVPTYEDKDGDWMLVGDVP  222

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  223  WEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  256



>gb|EPS72871.1| hypothetical protein M569_01882 [Genlisea aurea]
Length=210

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 5/118 (4%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN   + K+VKVAVDGAPYLRKVDL  +  YQ LL +LE MF+CLTIC
Sbjct  86   QVVGWPPVRSFRKN---AVKYVKVAVDGAPYLRKVDLQLYTGYQHLLAALEQMFSCLTIC  142

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
            NV+N KK +     +++VPTYED DGDWML+GDVPWKMF++SCKR+RLMKSS+ VGL 
Sbjct  143  NVVNEKKSIWGC--SDHVPTYEDGDGDWMLLGDVPWKMFLDSCKRMRLMKSSEAVGLG  198



>gb|ACG41827.1| IAA15 - auxin-responsive Aux/IAA family member [Zea mays]
Length=220

 Score =   168 bits (425),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 99/128 (77%), Gaps = 9/128 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-  557
            +VVGWPPVRSYRKN +       K+AKFVKVAVDGAPYLRKVDL A+  Y QLL +L+D 
Sbjct  89   RVVGWPPVRSYRKNALADAAGSSKAAKFVKVAVDGAPYLRKVDLQAYAGYDQLLRALQDK  148

Query  556  MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
             F+  T     +  +KL+D  +GTEYVPTYEDKDGDW+LVGDVPWKMFVE+C+RLRLMK 
Sbjct  149  FFSHFTXRKFADDERKLVDAVNGTEYVPTYEDKDGDWILVGDVPWKMFVETCQRLRLMKG  208

Query  379  SDVVGLAP  356
            S+ V LAP
Sbjct  209  SEAVNLAP  216



>gb|KDO48905.1| hypothetical protein CISIN_1g026005mg [Citrus sinensis]
Length=245

 Score =   169 bits (427),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 101/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------------FVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVRS+RKNIM   K                  FVKV++DGAPYLRKVDL  + S
Sbjct  91   QVVGWPPVRSFRKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKS  150

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            YQ+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDV
Sbjct  151  YQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDV  210

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  211  PWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>ref|XP_003521753.1| PREDICTED: auxin-responsive protein IAA16-like [Glycine max]
Length=243

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 104/157 (66%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI++                     A FVKV++DGAPYLRKVDL  +
Sbjct  87   QVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLY  146

Query  592  HSYQQLLTSLEDMFTCLTI--C------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+LL +L  MF+  TI  C      + +N  KL+D  +G++YVPTYEDKD DWMLVG
Sbjct  147  KSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDADWMLVG  206

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  DVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS  243



>ref|XP_009337294.1| PREDICTED: auxin-responsive protein IAA14-like [Pyrus x bretschneideri]
Length=244

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 99/151 (66%), Gaps = 26/151 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------SAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVRSYRKNIM                   SA FVKV +DGAPYLRKVDL  + S
Sbjct  90   QVVGWPPVRSYRKNIMSQKNTSEEKTEKASGGGGCSAAFVKVCMDGAPYLRKVDLKMYKS  149

Query  586  YQQLLTSLEDMFTCLT--------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            YQ+L  +L  MF+  T        + + +N  KLMD  + +EYVPTYEDKDGDWMLVGDV
Sbjct  150  YQELSNALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDV  209

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            PW MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  210  PWGMFVDSCKRLRIMKGSEAIGLAPKAMEKC  240



>gb|KHG19190.1| Auxin-responsive IAA16 -like protein [Gossypium arboreum]
Length=246

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 102/163 (63%), Gaps = 34/163 (21%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------------------------FVKVAVDGAPYLRK  611
            QVVGWPPVRS+RKNIM   K                          FVKV++DGAPYLRK
Sbjct  84   QVVGWPPVRSFRKNIMAVQKASSEEEGGSKKAGNSAAATTTTTAAAFVKVSMDGAPYLRK  143

Query  610  VDLVAFHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDG  455
            VDL  + SYQQL  +L  MF+  TI N         +N  KL+D  +G+EYVPTYED+DG
Sbjct  144  VDLKLYKSYQQLSDALSKMFSSFTIGNCGSHGMKDFMNESKLIDLLNGSEYVPTYEDRDG  203

Query  454  DWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DWMLVGDVPW+MFV++CKRLR+MK S+ +GLAP    KC   S
Sbjct  204  DWMLVGDVPWEMFVDTCKRLRIMKGSEAIGLAPRAVEKCKNRS  246



>ref|XP_006432923.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
 ref|XP_006471684.1| PREDICTED: auxin-responsive protein IAA16-like isoform X1 [Citrus 
sinensis]
 gb|ESR46163.1| hypothetical protein CICLE_v10002290mg [Citrus clementina]
Length=245

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 101/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------------FVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVRS+RKNIM   K                  FVKV++DGAPYLRKVDL  + S
Sbjct  91   QVVGWPPVRSFRKNIMAVQKDNEEGDNKASSSSSSNVAFVKVSMDGAPYLRKVDLKLYKS  150

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            YQ+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDV
Sbjct  151  YQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDV  210

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  211  PWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  245



>ref|XP_010532600.1| PREDICTED: auxin-responsive protein IAA14 [Tarenaya hassleriana]
Length=229

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/150 (56%), Positives = 99/150 (66%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-------------FVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVR+YRKN+M + K             FVKV++DGAPYLRKVDL    SYQ L 
Sbjct  80   QVVGWPPVRNYRKNVMANQKNSAMEEEEKAAAAFVKVSMDGAPYLRKVDLKMHKSYQDLS  139

Query  571  TSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T+         + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW MF
Sbjct  140  DALAKMFSSFTMGSYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWLMF  199

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VESCKRLR+MK S+ +GLAP    KC   S
Sbjct  200  VESCKRLRIMKGSEAIGLAPRAMEKCKNRS  229



>ref|XP_009409330.1| PREDICTED: auxin-responsive protein IAA1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=268

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 96/123 (78%), Gaps = 4/123 (3%)
 Frame = -1

Query  709  VVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFT-CLTIC  533
            VVGWPPVRSY KN ++S  FVKVAVDG PYLRKVDL  +  Y++LLT+++ MF+ C TI 
Sbjct  147  VVGWPPVRSYWKNTLRSRTFVKVAVDGTPYLRKVDLETYGGYRELLTAVQAMFSSCFTID  206

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            N   G +L+D   GTEY+PTYEDKDGDWML+GDVPWKMFV SCKRLRLMKSS+ V L   
Sbjct  207  N---GNRLVDLVKGTEYLPTYEDKDGDWMLIGDVPWKMFVSSCKRLRLMKSSEAVNLVDA  263

Query  352  TPS  344
            T S
Sbjct  264  TSS  266



>ref|XP_002284133.1| PREDICTED: auxin-responsive protein IAA14 [Vitis vinifera]
Length=243

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 99/146 (68%), Gaps = 21/146 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKNIM               A FVKV +DGAPYLRKVDL  + SYQ+L 
Sbjct  94   QVVGWPPVRSFRKNIMAQKNSSEEGEKGSSGAAFVKVCMDGAPYLRKVDLKMYKSYQELS  153

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MF
Sbjct  154  DALGKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  213

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKC  338
            V+SCKRLR+MK S+ +GLAP    KC
Sbjct  214  VDSCKRLRIMKGSEAIGLAPRAMEKC  239



>gb|AEE25653.1| auxin-responsive protein [Gossypium hirsutum]
Length=249

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/145 (57%), Positives = 100/145 (69%), Gaps = 20/145 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------FVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVRSYRKNIM + K             VKV++DGAPYLRKVDL  + SYQ+L  
Sbjct  101  QVVGWPPVRSYRKNIMANQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSD  160

Query  568  SLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  T+ N         +N  KLMD  + ++YVP+YEDKDGDWMLVGDVPW+MFV
Sbjct  161  ALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFV  220

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKC  338
            +SCKRLR+MK S+ +GLAP    KC
Sbjct  221  DSCKRLRIMKGSEAIGLAPRAMEKC  245



>emb|CBI26357.3| unnamed protein product [Vitis vinifera]
Length=237

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 99/146 (68%), Gaps = 21/146 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKNIM               A FVKV +DGAPYLRKVDL  + SYQ+L 
Sbjct  88   QVVGWPPVRSFRKNIMAQKNSSEEGEKGSSGAAFVKVCMDGAPYLRKVDLKMYKSYQELS  147

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MF
Sbjct  148  DALGKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMF  207

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKC  338
            V+SCKRLR+MK S+ +GLAP    KC
Sbjct  208  VDSCKRLRIMKGSEAIGLAPRAMEKC  233



>gb|KDP23667.1| hypothetical protein JCGZ_23500 [Jatropha curcas]
Length=248

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/158 (53%), Positives = 102/158 (65%), Gaps = 29/158 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK---------------------FVKVAVDGAPYLRKVDLVA  596
            QVVGWPP+RS+RKN+M   K                     FVKV++DGAPYLRKVDL  
Sbjct  91   QVVGWPPIRSFRKNVMSVQKSNGDEAEKAATATAAGSSSAAFVKVSMDGAPYLRKVDLKL  150

Query  595  FHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLV  440
            + SYQ+L  +L  MF+  TI N         +N  KL+D  +G+EYVPTYEDKDGDWMLV
Sbjct  151  YKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWMLV  210

Query  439  GDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            GDVPW+MF++SCKRLR+MK S+ +GLAP    KC   S
Sbjct  211  GDVPWEMFIDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  248



>ref|XP_006664171.1| PREDICTED: auxin-responsive protein IAA30-like [Oryza brachyantha]
Length=248

 Score =   168 bits (426),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 100/145 (69%), Gaps = 16/145 (11%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTS  566
            QVVGWPPVRS+RKNI+           K    VKV++DGAPYLRKVDL  + SY  L  +
Sbjct  104  QVVGWPPVRSFRKNILGLGLPEKKEKEKEKALVKVSMDGAPYLRKVDLSIYTSYLDLSNA  163

Query  565  LEDMFTCLTIC-----NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCK  401
            L++MFT +  C     N +N  K+ D  +G+EYVPTYEDKDGDWMLVGDVPW+MFVESCK
Sbjct  164  LQNMFTSIGNCGSQGMNGMNESKIADLLNGSEYVPTYEDKDGDWMLVGDVPWEMFVESCK  223

Query  400  RLRLMKSSDVVGLAPTTPSKCSRTS  326
            RLR+MK S+ +GLAP    KC   S
Sbjct  224  RLRIMKGSEAIGLAPRAMEKCKNRS  248



>ref|NP_001266070.1| IAA14 [Solanum lycopersicum]
 gb|AEX00357.1| IAA14 [Solanum lycopersicum]
Length=236

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/144 (58%), Positives = 99/144 (69%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTS  566
            QVVGWPPVRS+RKN+M            +A FVKV +DGAPYLRKVDL  + SYQ+L  +
Sbjct  89   QVVGWPPVRSFRKNVMAQKSNTEESEKTTAAFVKVCMDGAPYLRKVDLKMYKSYQELSDA  148

Query  565  LEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
            L  MF+  T  N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MFV+
Sbjct  149  LAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  208

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            SCKRLR+MK S+ +GLAP    KC
Sbjct  209  SCKRLRIMKGSEAIGLAPRAMEKC  232



>ref|XP_008362015.1| PREDICTED: auxin-responsive protein IAA14-like [Malus domestica]
Length=244

 Score =   168 bits (425),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/156 (55%), Positives = 100/156 (64%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-------------------SAKFVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVRSYRKNIM                    SA FVKV +DGAPYLRKVDL  + 
Sbjct  89   QVVGWPPVRSYRKNIMAQKNTSEENTEKATVGGGGCSAAFVKVCMDGAPYLRKVDLKMYK  148

Query  589  SYQQLLTSLEDMFTCLT--------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            SYQ+L  +L  MF+  T        + + +N  KLMD  + +EYVPTYEDKDGDWMLVGD
Sbjct  149  SYQELSNALAKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGD  208

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  209  VPWGMFVDSCKRLRIMKGSEAIGLAPKAXEKCKGRS  244



>ref|XP_004288427.1| PREDICTED: auxin-responsive protein IAA14-like [Fragaria vesca 
subsp. vesca]
Length=238

 Score =   167 bits (424),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 101/150 (67%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKN+M             + A FVKV +DGAPYLRKVDL  + SY++L 
Sbjct  89   QVVGWPPVRSFRKNVMAQKSTGEESSTTTEKAAFVKVCMDGAPYLRKVDLKMYKSYKELS  148

Query  571  TSLEDMFTCLT--------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T        + + +N  KLMD  + TEYVPTYEDKDGDWMLVGDVPW+MF
Sbjct  149  DALSKMFSSFTTGYYGAQGMIDFMNESKLMDLLNSTEYVPTYEDKDGDWMLVGDVPWEMF  208

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            V+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  209  VDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  238



>ref|XP_002531288.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
 gb|EEF31101.1| Auxin-responsive protein IAA16, putative [Ricinus communis]
Length=257

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 102/164 (62%), Gaps = 35/164 (21%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK---------------------------SAKFVKVAVDGAPYLR  614
            QVVGWPP+RS+RKN+M                            SA FVKV++DGAPYLR
Sbjct  94   QVVGWPPIRSFRKNVMAVQKNSTDEGEKGTATSAPAAAATSGSTSAAFVKVSMDGAPYLR  153

Query  613  KVDLVAFHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKD  458
            KVDL  + SYQ+L  +L  MF+  TI N         +N  KL+D  +G+EYVPTYEDKD
Sbjct  154  KVDLKLYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKD  213

Query  457  GDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            GDWMLVGDVPW+MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  214  GDWMLVGDVPWEMFVNSCKRLRIMKGSEAIGLAPRAVEKCKNRS  257



>gb|ACG46110.1| IAA1 - auxin-responsive Aux/IAA family member [Zea mays]
Length=186

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 98/128 (77%), Gaps = 9/128 (7%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED-  557
            +VVGWPPVRSY KN +       ++A FVKVAVDGAPYLRKVDL A+  Y QLL +L+D 
Sbjct  55   RVVGWPPVRSYLKNALADSSKASRAANFVKVAVDGAPYLRKVDLQAYGGYDQLLRALQDK  114

Query  556  MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
             F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRLMK 
Sbjct  115  FFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCRRLRLMKD  174

Query  379  SDVVGLAP  356
            S+ V LAP
Sbjct  175  SEAVNLAP  182



>ref|XP_010025014.1| PREDICTED: auxin-responsive protein IAA16-like [Eucalyptus grandis]
 gb|KCW61599.1| hypothetical protein EUGRSUZ_H04335 [Eucalyptus grandis]
Length=270

 Score =   168 bits (426),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 100/159 (63%), Gaps = 30/159 (19%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------------KSAKFVKVAVDGAPYLRKVDLV  599
            QVVGWPPVRS+RKNIM                        A FVKV++DGAPYLRKVDL 
Sbjct  112  QVVGWPPVRSFRKNIMAVQKSGSDEAEKGGSSGNGAATSGAAFVKVSMDGAPYLRKVDLK  171

Query  598  AFHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWML  443
             + SYQ L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWML
Sbjct  172  LYKSYQDLSDALAKMFSSFTIGNCGSGGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWML  231

Query  442  VGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VGDVPW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  232  VGDVPWDMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  270



>ref|NP_001267662.1| auxin-induced protein AUX28-like [Cucumis sativus]
 dbj|BAA81687.1| unnamed protein product [Cucumis sativus]
 gb|KGN44763.1| hypothetical protein Csa_7G378520 [Cucumis sativus]
Length=230

 Score =   167 bits (423),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 97/138 (70%), Gaps = 11/138 (8%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN M +  FVKV++DGAPYLRKVDL  + SY+QL  +L  MF   T  
Sbjct  95   QVVGWPPVRSFRKNNMLA--FVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFGSFTTI  152

Query  532  ---------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
                     + +N  KLMD   G++YVPTYEDKDGDWMLVGDVPW+MFVESCKRLR+MK 
Sbjct  153  GNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKG  212

Query  379  SDVVGLAPTTPSKCSRTS  326
             + +GLAP    KC   S
Sbjct  213  KEAIGLAPRAMEKCKNRS  230



>ref|XP_011079949.1| PREDICTED: auxin-induced protein AUX28-like [Sesamum indicum]
Length=244

 Score =   167 bits (424),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 102/153 (67%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN+M                 +A FVKV++DGAPYLRKVDL  + SYQ
Sbjct  92   QVVGWPPVRSFRKNVMAVQKVSDSEETEKGSGGAAAFVKVSMDGAPYLRKVDLKMYKSYQ  151

Query  580  QLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  TI         + +N  KLMD  +G++YVPTYEDKDGDWMLVGDVPW
Sbjct  152  ELSDALGKMFSSFTIGKCDSQGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPW  211

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFVESCKRLR+MK ++  GLAP    KC   S
Sbjct  212  EMFVESCKRLRIMKGTEAKGLAPRAMEKCKSRS  244



>emb|CDY63072.1| BnaCnng41350D [Brassica napus]
Length=398

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 102/148 (69%), Gaps = 19/148 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS----------AKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M S          A FVKV++DGAPYLRKVDL  + SY +L  +L
Sbjct  246  QVVGWPPVRSYRKNVMGSCQKSSSSAETAAFVKVSMDGAPYLRKVDLKMYKSYDELSDAL  305

Query  562  EDMFTCLTICN---------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+ N          +N +K+MDT    +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  306  SNMFSSFTMGNNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDGDWMLVGDVPWPMFVD  365

Query  409  SCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +CKRLRLMK SD +GLAP    KC  TS
Sbjct  366  TCKRLRLMKGSDAIGLAPRAMEKCKSTS  393



>ref|XP_006304183.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
 gb|EOA37081.1| hypothetical protein CARUB_v10010236mg [Capsella rubella]
Length=224

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 102/144 (71%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRKVDL  + SY +L T+L
Sbjct  77   QVVGWPPVRSYRKNVMVSCQKASSGPEAAAFVKVSMDGAPYLRKVDLRMYKSYDELSTAL  136

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  137  SNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  196

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  197  TCKRLRLMKGSDAIGLAPRAMEKC  220



>gb|KHG04941.1| Auxin-induced AUX28 [Gossypium arboreum]
Length=235

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 102/150 (68%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVRS+RKN++            + A FVKV++DGAPYLRKVDL  + +YQQL  
Sbjct  86   QVVGWPPVRSFRKNMLATQKSSGSEDSGEKAAFVKVSMDGAPYLRKVDLRMYKTYQQLSD  145

Query  568  SLEDMFTCLTICN---------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
            +L  MF+  TI N          +N  KLMD  +G++YVPTYEDKDGD MLVGDVPW+MF
Sbjct  146  ALAKMFSSFTIGNCGSQGLLKDFMNESKLMDLLNGSDYVPTYEDKDGDLMLVGDVPWEMF  205

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +ESCKRLR+MK ++ +GLAP    KC   S
Sbjct  206  IESCKRLRIMKGTEAIGLAPRAMEKCKNRS  235



>ref|XP_002281771.1| PREDICTED: auxin-responsive protein IAA16-like [Vitis vinifera]
Length=244

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++               +A FVKV++DGAPYLRKVDL  + SYQ+L
Sbjct  94   QVVGWPPVRSFRKNMLAGQKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQEL  153

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L +MF+  TI N         +N  KLMD  +G ++VPTYEDKDGDWMLVGDVPW+M
Sbjct  154  SNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGDWMLVGDVPWEM  213

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK  + +GLAP    KC   S
Sbjct  214  FVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  244



>ref|XP_007205640.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
 gb|EMJ06839.1| hypothetical protein PRUPE_ppa009254mg [Prunus persica]
Length=299

 Score =   169 bits (428),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 101/149 (68%), Gaps = 24/149 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKNI                  SA FVKV++DGAPYLRKVDL  + SYQ
Sbjct  147  QVVGWPPVRSFRKNIATVQKKSSDEGEKSNSNISAAFVKVSMDGAPYLRKVDLKLYKSYQ  206

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L T+L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVPW
Sbjct  207  ELSTALGKMFSSFTIGNCGSDGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVPW  266

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
             MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  267  GMFVDSCKRLRIMKGSEAIGLAPRAVEKC  295



>gb|AFS44507.1| auxin repressor, partial [Fragaria x ananassa]
Length=231

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 101/150 (67%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRSYRKN+M             + A FVKV +DGAPYLRKVDL  + SY++L 
Sbjct  82   QVVGWPPVRSYRKNVMAQKSTGEESSTTTEKAAFVKVCMDGAPYLRKVDLKMYKSYKELS  141

Query  571  TSLEDMFTCLT--------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  T        + + +N  KLMD  + T+YVPTYEDKDGDWMLVGDVPW+MF
Sbjct  142  DALSKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSTDYVPTYEDKDGDWMLVGDVPWEMF  201

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            V+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  202  VDSCKRLRIMKGSEAIGLAPKAMEKCKNRS  231



>gb|EAZ27868.1| hypothetical protein OsJ_11821 [Oryza sativa Japonica Group]
Length=240

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 7/132 (5%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTC  545
            QVVGWPPVRS+RKN++    K+A  VKV++DGAPYLRK+D+  + SY +L  + ++MFT 
Sbjct  107  QVVGWPPVRSFRKNVLAEKCKAAALVKVSMDGAPYLRKIDVAMYKSYPELSMAFQNMFTS  166

Query  544  LTICNVLNGKKLMDTS---DGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSD  374
             TI    + ++L +++   D  EYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR+MK S+
Sbjct  167  FTIGKCGSHQQLKESNKLRDDLEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSE  226

Query  373  VVGLAPTTPSKC  338
             +GLAP    KC
Sbjct  227  AIGLAPRAVEKC  238



>ref|XP_009420668.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=241

 Score =   167 bits (423),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 102/155 (66%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN++                 SA FVKV++DGAPYLRKVDL  + SY 
Sbjct  87   QVVGWPPVRSFRKNVLSVHSVKGGKEEGEKSGTSAAFVKVSMDGAPYLRKVDLKMYRSYH  146

Query  580  QLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +L+ MF+  T  N           +N  K+MD  +G+EYVPTYEDKDGDWMLVGDV
Sbjct  147  ELSMALQKMFSTFTGGNCGSQGMSGRDFMNESKVMDLLNGSEYVPTYEDKDGDWMLVGDV  206

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  207  PWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  241



>ref|XP_002315736.1| aux/IAA family protein [Populus trichocarpa]
 gb|EEF01907.1| aux/IAA family protein [Populus trichocarpa]
Length=277

 Score =   168 bits (426),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 103/153 (67%), Gaps = 25/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPP+RSYRKN++                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  125  QVVGWPPLRSYRKNVLTQKNASEEGDKASTGGSSAAFVKVCMDGAPYLRKVDLKMYKSYQ  184

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  185  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  244

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC-SRT  329
            +MFV+SCKRLR+MK S+ +GLAP    KC SRT
Sbjct  245  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRT  277



>ref|XP_009418923.1| PREDICTED: auxin-responsive protein IAA30-like [Musa acuminata 
subsp. malaccensis]
Length=243

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 102/156 (65%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS-----------------AKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+RKNI+ +                 A FVKV++DGAPYLRKVDL  + SY
Sbjct  88   QVVGWPPVRSFRKNILSAHSEKGSKEGGEKPGNPVAAFVKVSMDGAPYLRKVDLKMYRSY  147

Query  583  QQLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            Q+L   L+ MF   T  N           +N +++MD  +G+EYVPTYEDKDGDWMLVGD
Sbjct  148  QELSMGLQKMFGSFTSGNCGSQGMSGRDFMNEREVMDLLNGSEYVPTYEDKDGDWMLVGD  207

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  208  VPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKCKNRS  243



>ref|NP_001237212.1| uncharacterized protein LOC100499872 [Glycine max]
 gb|ACU13989.1| unknown [Glycine max]
Length=228

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 100/142 (70%), Gaps = 14/142 (10%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAK--FVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVRS+RKNI+          KS K  FVKV++DGAPYLRKVD+  + SYQ+L  
Sbjct  85   QVVGWPPVRSFRKNIVQRNSNEEEAEKSTKNAFVKVSMDGAPYLRKVDIKLYKSYQELSD  144

Query  568  SLEDMFTCLTI--CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRL  395
            +L  MF+  TI  C     K  M+ ++G++YVPTYEDKDGDWMLVGDVPW+MFVESCKRL
Sbjct  145  ALAKMFSSFTIEKCGSQGMKDFMNETNGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRL  204

Query  394  RLMKSSDVVGLAPTTPSKCSRT  329
            R+MK S+ +GLAP       R 
Sbjct  205  RIMKGSEAIGLAPRAVESADRA  226



>ref|XP_002302075.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|EEE81348.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|AFZ78622.1| hypothetical protein [Populus tomentosa]
Length=237

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 101/153 (66%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN++                 +A FVKV++DGAPYLRKVDL  + +YQ
Sbjct  83   QVVGWPPVRSFRKNMLAVQKSSTDQECEKVPGGNATFVKVSMDGAPYLRKVDLKMYKTYQ  142

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  TI N         LN  KL+D  +GT+YVPTYEDKDGDWMLVGDVPW
Sbjct  143  ELSDALGKMFSSFTIGNCGSHGLKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPW  202

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             MFVESCKRLR+MK ++  GLAP    KC   S
Sbjct  203  DMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>ref|XP_002319075.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
 gb|EEE94998.1| hypothetical protein POPTR_0013s03870g [Populus trichocarpa]
Length=246

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 101/150 (67%), Gaps = 25/150 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-----------------FVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPP+RS+RKN+M   K                 FVKV++DGAPYLRKVDL  + SY
Sbjct  93   QVVGWPPIRSFRKNVMAVQKNSNDNGEKSGSSGTGVAFVKVSMDGAPYLRKVDLKLYKSY  152

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVGDVP
Sbjct  153  QELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVGDVP  212

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            W+MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  213  WEMFVDSCKRLRIMKGSEAIGLAPRAVEKC  242



>ref|XP_004493739.1| PREDICTED: auxin-induced protein AUX28-like [Cicer arietinum]
Length=246

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 100/151 (66%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------------FVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRSYRKN++   K              FVKV++DGAPYLRKVDL  ++SY QL
Sbjct  95   QVVGWPPVRSYRKNMLAMQKSSNDVVGEENNAISFVKVSMDGAPYLRKVDLKIYNSYSQL  154

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              SL  MF+  TI N         +N  KLMD  + ++YVPTYEDKDGDWM+VGDVPW+M
Sbjct  155  SDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDWMVVGDVPWEM  214

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FVESCKRLR+MK  + +G+AP    KC   S
Sbjct  215  FVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  245



>emb|CAN63268.1| hypothetical protein VITISV_013635 [Vitis vinifera]
 emb|CBI17932.3| unnamed protein product [Vitis vinifera]
Length=235

 Score =   167 bits (422),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 102/151 (68%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++               +A FVKV++DGAPYLRKVDL  + SYQ+L
Sbjct  85   QVVGWPPVRSFRKNMLAGQKGGSEEGEKVSCNAAFVKVSMDGAPYLRKVDLKMYTSYQEL  144

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L +MF+  TI N         +N  KLMD  +G ++VPTYEDKDGDWMLVGDVPW+M
Sbjct  145  SNALGNMFSSFTIGNYGSQGMKDFMNESKLMDLLNGFDHVPTYEDKDGDWMLVGDVPWEM  204

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FV+SCKRLR+MK  + +GLAP    KC   S
Sbjct  205  FVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS  235



>gb|KHF98789.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=249

 Score =   167 bits (423),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 100/145 (69%), Gaps = 20/145 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------FVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            Q+VGWPPVRSYRKNIM + K             VKV++DGAPYLRKVDL  + SYQ+L  
Sbjct  101  QMVGWPPVRSYRKNIMANQKNSSEESGNSGAALVKVSMDGAPYLRKVDLKMYKSYQELSD  160

Query  568  SLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  T+ N         +N  KLMD  + ++YVP+YEDKDGDWMLVGDVPW+MFV
Sbjct  161  ALAKMFSSFTMGNYGPQGMIDFMNESKLMDLLNSSDYVPSYEDKDGDWMLVGDVPWQMFV  220

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKC  338
            +SCKRLR+MK S+ +GLAP    KC
Sbjct  221  DSCKRLRIMKGSEAIGLAPRAMEKC  245



>ref|XP_007013279.1| Indoleacetic acid-induced protein 16, putative [Theobroma cacao]
 gb|EOY30898.1| Indoleacetic acid-induced protein 16, putative [Theobroma cacao]
Length=232

 Score =   166 bits (421),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 100/146 (68%), Gaps = 18/146 (12%)
 Frame = -1

Query  712  QVVGWPPVRSYRKN-IMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            QV+GWPPVRS RK  I +S K+VKVAVDGAPYLRKV+L  + +Y  L+  LE++FTC  I
Sbjct  86   QVIGWPPVRSSRKKAINESCKYVKVAVDGAPYLRKVNLGVYSNYHDLMKDLENLFTCCII  145

Query  535  -----------CNVLNGK------KLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVES  407
                       C  LN K      K+MD   G EYVPTYEDKDGDWMLVGDVPWKMF+ES
Sbjct  146  REYQLISLSLICIHLNRKADREESKVMDAVKGMEYVPTYEDKDGDWMLVGDVPWKMFIES  205

Query  406  CKRLRLMKSSDVVGLAPTTPSKCSRT  329
            CKR+RLMKSS+   LAP    KCS T
Sbjct  206  CKRIRLMKSSEAAVLAPKASLKCSGT  231



>ref|XP_004134096.1| PREDICTED: auxin-responsive protein IAA14-like isoform 1 [Cucumis 
sativus]
 ref|XP_004162257.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA14-like 
[Cucumis sativus]
 gb|KGN56916.1| hypothetical protein Csa_3G143570 [Cucumis sativus]
Length=237

 Score =   167 bits (422),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 99/153 (65%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS---------------AKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKN M                 A FVKV +DGAPYLRKVDL  + SYQ+
Sbjct  85   QVVGWPPVRSYRKNAMSQKSSEAGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQE  144

Query  577  LLTSLEDMFTCLTIC---------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            L  +L  MF+  T+          + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW
Sbjct  145  LSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  204

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  205  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  237



>ref|NP_001067209.1| Os12g0601300 [Oryza sativa Japonica Group]
 sp|P0C132.1|IAA30_ORYSJ RecName: Full=Auxin-responsive protein IAA30; AltName: Full=Indoleacetic 
acid-induced protein 30 [Oryza sativa Japonica Group]
 gb|ABA99793.1| Auxin-induced protein AUX28, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF30228.1| Os12g0601300 [Oryza sativa Japonica Group]
 gb|EAY83785.1| hypothetical protein OsI_39001 [Oryza sativa Indica Group]
 dbj|BAG90803.1| unnamed protein product [Oryza sativa Japonica Group]
Length=277

 Score =   167 bits (424),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 102/158 (65%), Gaps = 29/158 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------------KSAKFVKVAVDGAPYLRKVDLV  599
            QVVGWPPVRSYRKNI+                       +A FVKV++DGAPYLRKVDL 
Sbjct  120  QVVGWPPVRSYRKNILAVQADKGKDAADGGGDKSGAGAAAAAFVKVSMDGAPYLRKVDLK  179

Query  598  AFHSYQQLLTSLEDMFTCLTICNV-------LNGKKLMDTSDGTEYVPTYEDKDGDWMLV  440
             + SY +L  +LE MF+  TI N        +N  K+ D  +G+EYVPTYEDKDGDWMLV
Sbjct  180  MYKSYLELSKALEKMFSSFTIGNCGSHGVNGMNESKIADLLNGSEYVPTYEDKDGDWMLV  239

Query  439  GDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            GDVPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  240  GDVPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  277



>ref|XP_006657103.1| PREDICTED: auxin-responsive protein IAA23-like [Oryza brachyantha]
Length=148

 Score =   163 bits (413),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 96/127 (76%), Gaps = 3/127 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS-AKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF-TCLT  539
            + VGWPPVR+YR+N ++  A+ VKVAVDGAPYLRKVDL A   Y  LL +L  MF +CL 
Sbjct  22   RAVGWPPVRAYRRNALREDARLVKVAVDGAPYLRKVDLAAHGGYAPLLRALHGMFASCLA  81

Query  538  ICNVLNGK-KLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
            I     G  KL+D+  G EYVPTYED+DGDWMLVGDVPWKMFVESCKR+RLMKSS+ V L
Sbjct  82   IRGDGEGTTKLVDSITGAEYVPTYEDRDGDWMLVGDVPWKMFVESCKRIRLMKSSEAVNL  141

Query  361  APTTPSK  341
            +P   S+
Sbjct  142  SPRRSSR  148



>ref|XP_010925299.1| PREDICTED: auxin-responsive protein IAA1-like [Elaeis guineensis]
Length=199

 Score =   165 bits (418),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 94/122 (77%), Gaps = 10/122 (8%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            +VVGWPPVRSYRKN ++   +VKVAVDGAPYLRKVDL  +  Y QLLT+L++MF+C TI 
Sbjct  87   RVVGWPPVRSYRKNALRGCTYVKVAVDGAPYLRKVDLEIYSGYHQLLTALQEMFSCFTIR  146

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLAPT  353
            +    ++L+D   GT+Y+PTYEDKDGDWMLVGDVPWKMFV SCKRLRLM       +AP 
Sbjct  147  D----RRLVDPVKGTDYIPTYEDKDGDWMLVGDVPWKMFVASCKRLRLMN------IAPR  196

Query  352  TP  347
             P
Sbjct  197  AP  198



>ref|XP_004495392.1| PREDICTED: auxin-responsive protein IAA14-like isoform X2 [Cicer 
arietinum]
Length=240

 Score =   166 bits (421),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-------------------SAKFVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVRSYRKN+M                    +  FVKV++DGAPYLRKVDL  ++
Sbjct  85   QVVGWPPVRSYRKNMMAQKVNNSDQDGNEKTTSSTTAGTFVKVSMDGAPYLRKVDLTMYN  144

Query  589  SYQQLLTSLEDMFTCLT--------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            +Y+ L  +L  MF+  T        + + +N  KLMD  + +EYVPTYEDKDGDWMLVGD
Sbjct  145  TYKDLSDALAKMFSSFTTGKYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGD  204

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  205  VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  240



>ref|XP_011027545.1| PREDICTED: auxin-responsive protein IAA14 isoform X1 [Populus 
euphratica]
 ref|XP_011029890.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   167 bits (422),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 102/155 (66%), Gaps = 27/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKN+M                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSYRKNVMAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  156  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  215

Query  424  KMFVESCKRLRLMKSSDVVGL--APTTPSKC-SRT  329
            +MFV SCKRLRLMK S+ +GL  AP    KC SRT
Sbjct  216  EMFVNSCKRLRLMKGSEAIGLVSAPRAMEKCKSRT  250



>ref|NP_001240213.1| auxin-induced protein ali50 [Glycine max]
 gb|ACR39367.1| Aux/IAA protein [Glycine max]
Length=239

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 99/157 (63%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM--------------------KSAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRSYRKN+M                     S  FVKV++DGAPYLRKVDL  +
Sbjct  83   QVVGWPPVRSYRKNMMAVQKVSNEEVAEKTTSSTIANSGAFVKVSMDGAPYLRKVDLTMY  142

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SY+ L  +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVG
Sbjct  143  KSYKDLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVG  202

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  203  DVPWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKSRS  239



>ref|XP_003556389.2| PREDICTED: auxin-responsive protein IAA14-like [Glycine max]
Length=331

 Score =   169 bits (428),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 101/156 (65%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-------------------FVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVRSYRKN+M   K                   FVKV++DGAPYLRKVDL  + 
Sbjct  176  QVVGWPPVRSYRKNMMAVQKVSTEDVAEKTTSSTANPGAFVKVSMDGAPYLRKVDLTMYK  235

Query  589  SYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            SY++L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGD
Sbjct  236  SYKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGD  295

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  296  VPWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKSRS  331



>ref|XP_006418150.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 gb|ESQ36503.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=229

 Score =   166 bits (420),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF  551
            QVVGWPPVRSYRKN++      ++A FVKV++DGAPYLRKVDL  + SY +L  +L +MF
Sbjct  86   QVVGWPPVRSYRKNVLVSSQKSEAAAFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMF  145

Query  550  TCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKR  398
            +  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  146  SSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  205

Query  397  LRLMKSSDVVGLAPTTPSKC  338
            LRLMK SD +GLAP    KC
Sbjct  206  LRLMKGSDAIGLAPRAMEKC  225



>ref|XP_010024036.1| PREDICTED: auxin-responsive protein IAA14-like [Eucalyptus grandis]
 gb|KCW60450.1| hypothetical protein EUGRSUZ_H03170 [Eucalyptus grandis]
Length=243

 Score =   166 bits (421),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 102/152 (67%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK---------------FVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKN+M + K               FVKV++DGAPYLRKVDL  + SY+Q
Sbjct  92   QVVGWPPVRSYRKNMMVAQKSTDPEEEKEKAAAAAFVKVSMDGAPYLRKVDLKNYSSYKQ  151

Query  577  LLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  +L  MF+  T+         + +N  KLMD  + ++YVPTYEDKDGDWMLVGDVPW+
Sbjct  152  LSDALGKMFSSFTMGSYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWE  211

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  212  MFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  243



>ref|XP_010102292.1| Auxin-responsive protein IAA16 [Morus notabilis]
 gb|EXB93235.1| Auxin-responsive protein IAA16 [Morus notabilis]
Length=257

 Score =   167 bits (422),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 102/155 (66%), Gaps = 30/155 (19%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------------------FVKVAVDGAPYLRKVDLV  599
            QVVGWPPVRS+RKNI+ + K                      FVKV++DGAPYLRKVDL 
Sbjct  99   QVVGWPPVRSFRKNIVSAQKNSGDHEAVKAGGGGGGSSSSAAFVKVSMDGAPYLRKVDLK  158

Query  598  AFHSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWML  443
             + SYQ+L  +L  MF+  TI N         +N  KL+D  +G+EYVPTYEDKDGDWML
Sbjct  159  LYKSYQELSDALGKMFSSFTIGNCGSQGMKDFMNESKLIDLLNGSEYVPTYEDKDGDWML  218

Query  442  VGDVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            VGDVPW+MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  219  VGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKC  253



>sp|Q75GK0.1|IAA11_ORYSJ RecName: Full=Auxin-responsive protein IAA11; AltName: Full=Indoleacetic 
acid-induced protein 11 [Oryza sativa Japonica Group]
 gb|AAS07281.1| putative auxin-responsive protein [Oryza sativa Japonica Group]
 gb|AAU89153.1| Auxin-responsive protein, putative [Oryza sativa Japonica Group]
 gb|ABF97770.1| Auxin-responsive protein IAA17, putative, expressed [Oryza sativa 
Japonica Group]
Length=233

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 7/132 (5%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTC  545
            QVVGWPPVRS+RKN++    K+A  VKV++DGAPYLRK+D+  + SY +L  + ++MFT 
Sbjct  100  QVVGWPPVRSFRKNVLAEKCKAAALVKVSMDGAPYLRKIDVAMYKSYPELSMAFQNMFTS  159

Query  544  LTICNVLNGKKLMDTS---DGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSD  374
             TI    + ++L +++   D  EYVPTYEDKDGDWMLVGDVPW+MFVESCKRLR+MK S+
Sbjct  160  FTIGKCGSHQQLKESNKLRDDLEYVPTYEDKDGDWMLVGDVPWEMFVESCKRLRIMKGSE  219

Query  373  VVGLAPTTPSKC  338
             +GLAP    KC
Sbjct  220  AIGLAPRAVEKC  231



>ref|XP_006418149.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
 dbj|BAJ33922.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36502.1| hypothetical protein EUTSA_v10008679mg [Eutrema salsugineum]
Length=226

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 15/140 (11%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMF  551
            QVVGWPPVRSYRKN++      ++A FVKV++DGAPYLRKVDL  + SY +L  +L +MF
Sbjct  83   QVVGWPPVRSYRKNVLVSSQKSEAAAFVKVSMDGAPYLRKVDLKMYKSYDELSNALSNMF  142

Query  550  TCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKR  398
            +  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV++CKR
Sbjct  143  SSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVDTCKR  202

Query  397  LRLMKSSDVVGLAPTTPSKC  338
            LRLMK SD +GLAP    KC
Sbjct  203  LRLMKGSDAIGLAPRAMEKC  222



>ref|XP_010923478.1| PREDICTED: auxin-responsive protein IAA30-like isoform X1 [Elaeis 
guineensis]
Length=250

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 100/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKNI+                 S   VKV++DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSFRKNILATHSDKGSKVEGEKSSNSVALVKVSMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN----------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            +L  +LE MF+  T  N           +N  KLMD  +G+EYVPTYEDKDGD MLVGDV
Sbjct  156  ELSMALEKMFSSFTSGNCGSQGMSGRDFMNESKLMDLLNGSEYVPTYEDKDGDLMLVGDV  215

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  216  PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  250



>ref|XP_008451270.1| PREDICTED: auxin-induced protein AUX28-like [Cucumis melo]
Length=230

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 97/138 (70%), Gaps = 11/138 (8%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTIC  533
            QVVGWPPVRS+RKN M +  FVKV++DGAPYLRKVDL  + SY+QL  +L  MF   T  
Sbjct  95   QVVGWPPVRSFRKNNMLA--FVKVSMDGAPYLRKVDLKMYKSYKQLSDALAAMFGSFTTI  152

Query  532  ---------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKS  380
                     + +N  KLMD   G++YVPTYEDKDGDWMLVGDVPW+MFVESCKR+R+MK 
Sbjct  153  GNCGSQEMKDFMNESKLMDLLSGSDYVPTYEDKDGDWMLVGDVPWEMFVESCKRVRIMKG  212

Query  379  SDVVGLAPTTPSKCSRTS  326
             + +GLAP    KC   S
Sbjct  213  KEAIGLAPRAMEKCKNRS  230



>gb|EYU33008.1| hypothetical protein MIMGU_mgv1a012321mg [Erythranthe guttata]
Length=254

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 100/150 (67%), Gaps = 25/150 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-----------------FVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+RKNI+ S +                 FVKV++DGAPYLRKVDL  + SY
Sbjct  101  QVVGWPPVRSFRKNIVMSHQKNSSSDEEAGGGGAAAAFVKVSMDGAPYLRKVDLKMYKSY  160

Query  583  QQLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q+   +L  MF+  T+         + +N +KLMD  + TEYVPTYEDKDGDWMLVGDVP
Sbjct  161  QEFSDALAKMFSSFTMGKYGSEGMIDFMNERKLMDVLNSTEYVPTYEDKDGDWMLVGDVP  220

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            W+MFV SCKRLR+MK S+ +GLAP    KC
Sbjct  221  WEMFVNSCKRLRIMKGSEAIGLAPRAMEKC  250



>ref|NP_001266055.1| IAA10 protein [Solanum lycopersicum]
 gb|AEX00360.1| IAA17 [Solanum lycopersicum]
Length=208

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 98/137 (72%), Gaps = 12/137 (9%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKF--------VKVAVDGAPYLRKVDLVAFHSYQQLLTSLED  557
            QVVGWPPVRS+RKNI+ S K         VKV++DGAPYLRKVDL  + SYQ+L  +L  
Sbjct  67   QVVGWPPVRSFRKNILTSQKLDRENDNILVKVSMDGAPYLRKVDLNMYKSYQELFDALTK  126

Query  556  MFTCLTIC----NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRL  389
            MF   TI     + ++  KLMD  + ++YVPTYEDKDGDWMLVGDVPW MFV+SCKRLR+
Sbjct  127  MFNSFTIVQGMKDFMHEGKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWGMFVDSCKRLRI  186

Query  388  MKSSDVVGLAPTTPSKC  338
            MK ++ +GLAP    KC
Sbjct  187  MKGTEAIGLAPRAMEKC  203



>gb|ABI36493.1| AUX/IAA16 A [Malus domestica]
Length=149

 Score =   163 bits (413),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 98/149 (66%), Gaps = 23/149 (15%)
 Frame = -1

Query  703  GWPPVRSYRKNIMK---------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            GWPPVRS+RKNI+                SA FVKV++DGAPYLRKVDL  + SYQ+L T
Sbjct  1    GWPPVRSFRKNILTVQKNSSEEGENTNSISAAFVKVSMDGAPYLRKVDLKLYKSYQELST  60

Query  568  SLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  TI N         +N  KL+D   G+EYVP+YEDKDGDWMLVGDVPW+MFV
Sbjct  61   ALSKMFSSFTIGNCGSQGMKDFMNESKLIDLLSGSEYVPSYEDKDGDWMLVGDVPWEMFV  120

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             SCKRLR+MK S+ +GLAP    K    S
Sbjct  121  NSCKRLRIMKGSEAIGLAPRAVEKYKNRS  149



>ref|XP_008438588.1| PREDICTED: auxin-responsive protein IAA14-like [Cucumis melo]
Length=237

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 99/153 (65%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS---------------AKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKN M                 A FVKV +DGAPYLRKVDL  + SYQ+
Sbjct  85   QVVGWPPVRSYRKNAMSQKSPDSGEKGGSSGGSAMFVKVCMDGAPYLRKVDLKMYKSYQE  144

Query  577  LLTSLEDMFTCLTIC---------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            L  +L  MF+  T+          + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW
Sbjct  145  LSNALAKMFSSFTMAGDYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  204

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  205  EMFVDSCKRLRIMKGSEAIGLAPRAMEKCKSRS  237



>gb|AFK44192.1| unknown [Medicago truncatula]
Length=253

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 102/157 (65%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI+                     +  FVKV++DGAPYLRKVDL  +
Sbjct  97   QVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLY  156

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVG
Sbjct  157  KSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  216

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  217  DVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>ref|XP_004960835.1| PREDICTED: auxin-responsive protein IAA1-like isoform X2 [Setaria 
italica]
Length=188

 Score =   164 bits (416),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 2/121 (2%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTC-LTI  536
            +VVGWPPV   R+N +   KFVKVAV GAPY RKVDL A+  Y+QLL +L+DMFT   T+
Sbjct  64   RVVGWPPVSRNRRNALPRGKFVKVAVAGAPYQRKVDLEAYAGYEQLLAALQDMFTAHFTV  123

Query  535  CNVLNGK-KLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
                N + +L+D   G EYVPTYEDKDGDWMLVGDVPW+MFVE+C+RLRLMKSS+VV LA
Sbjct  124  RRGANEEMELIDAVSGVEYVPTYEDKDGDWMLVGDVPWRMFVETCQRLRLMKSSEVVNLA  183

Query  358  P  356
            P
Sbjct  184  P  184



>ref|XP_004495802.1| PREDICTED: auxin-responsive protein IAA16-like [Cicer arietinum]
Length=252

 Score =   166 bits (421),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 101/157 (64%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------------------FVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI+   K                    FVKV++DGAPYLRKVDL  +
Sbjct  96   QVVGWPPVRSFRKNIVNVQKSNNEVEAEKKTSGSGGGNGAFVKVSMDGAPYLRKVDLKLY  155

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVG
Sbjct  156  KSYQELSDALAKMFSSFTIGNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  215

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  216  DVPWEMFVGSCKRLRIMKGSEAIGLAPRAVEKCKNRS  252



>gb|ACU19136.1| unknown [Glycine max]
Length=243

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 103/157 (66%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI++                     A FVKV++DGAPYLRKVDL  +
Sbjct  87   QVVGWPPVRSFRKNIVQRSNNNEGEKAATSSSNNVNTGAAFVKVSMDGAPYLRKVDLKLY  146

Query  592  HSYQQLLTSLEDMFTCLTI--C------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+LL +L  MF+  TI  C      + +N  KL+D  +G++YVPTYEDKD DWMLVG
Sbjct  147  KSYQELLDALAKMFSSFTIDKCGSQGMKDFMNESKLIDFFNGSDYVPTYEDKDADWMLVG  206

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFVESCKRLR+MK  + +GLAP    KC   S
Sbjct  207  DVPWEMFVESCKRLRIMKGFEAIGLAPRAVEKCKNRS  243



>gb|KHG01271.1| Auxin-responsive IAA14 -like protein [Gossypium arboreum]
Length=248

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 101/151 (67%), Gaps = 26/151 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------------FVKVAVDGAPYLRKVDLVAFHS  587
            QV+GWPPVRSYRKNIM + K                  FVKV +DGAPYLRKVDL  ++S
Sbjct  94   QVLGWPPVRSYRKNIMANQKNNSDEISDRASSGSGGAAFVKVCMDGAPYLRKVDLKMYNS  153

Query  586  YQQLLTSLEDMFT--------CLTICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            YQ+L  +L  MF+        C  + + +N  KLMD  + ++YVPTYEDKDGDWMLVGDV
Sbjct  154  YQKLSDALAKMFSSFTMGSYGCEGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDV  213

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            PW+MFVESCKRLR+MK S+ +GLAP    KC
Sbjct  214  PWEMFVESCKRLRIMKGSEAIGLAPRAMEKC  244



>ref|XP_003591806.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AES62057.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=236

 Score =   166 bits (419),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 99/154 (64%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRSYRKN+M                  +A FVKV++DGAPYLRKVDL  + +Y
Sbjct  83   QVVGWPPVRSYRKNMMAQKVNNTEDTEKTTSNTTAAAFVKVSMDGAPYLRKVDLTMYKTY  142

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            + L  +L  MF+  T  N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVP
Sbjct  143  KDLSDALAKMFSSFTTGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  202

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  203  WEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  236



>gb|AFK42876.1| unknown [Medicago truncatula]
 gb|KEH23853.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=250

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 99/152 (65%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM---------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKN++                +  FVKV++DGAPYLRKVDL  + SY Q
Sbjct  99   QVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAITFVKVSMDGAPYLRKVDLKMYTSYSQ  158

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  SL  MF+  TI N         +N  KLMD  + ++YVPTYEDKDGDWMLVGDVPW+
Sbjct  159  LSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDWMLVGDVPWE  218

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFVESCKRLR+MK  + +G+AP    KC   S
Sbjct  219  MFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_009409328.1| PREDICTED: auxin-responsive protein IAA1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=297

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 94/117 (80%), Gaps = 4/117 (3%)
 Frame = -1

Query  709  VVGWPPVRSYRKNIMKSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFT-CLTIC  533
            VVGWPPVRSY KN ++S  FVKVAVDG PYLRKVDL  +  Y++LLT+++ MF+ C TI 
Sbjct  147  VVGWPPVRSYWKNTLRSRTFVKVAVDGTPYLRKVDLETYGGYRELLTAVQAMFSSCFTID  206

Query  532  NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGL  362
            N   G +L+D   GTEY+PTYEDKDGDWML+GDVPWKMFV SCKRLRLMKSS+ V L
Sbjct  207  N---GNRLVDLVKGTEYLPTYEDKDGDWMLIGDVPWKMFVSSCKRLRLMKSSEAVNL  260



>gb|EMT29956.1| Auxin-responsive protein IAA15 [Aegilops tauschii]
Length=199

 Score =   164 bits (415),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 13/130 (10%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSA-----KFVKVAVDGAPYLRKVDLVAFH------SYQQLLTS  566
            QVVGWPPVRS+RKN + +A     KFVKVAVDGAPYLRKVDL A+       SY QLL +
Sbjct  63   QVVGWPPVRSFRKNALAAAASSKTKFVKVAVDGAPYLRKVDLKAYAGYTSSASYDQLLAT  122

Query  565  LEDMF-TCLTICNVLNGK-KLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLR  392
            L+D F + LT+  + N + KL+D   GTEYVPTYEDKDGDWMLVGDVPW+MFVE+C+R+R
Sbjct  123  LQDKFISHLTVRKLGNEEMKLVDAVSGTEYVPTYEDKDGDWMLVGDVPWRMFVETCQRIR  182

Query  391  LMKSSDVVGL  362
            LMKSS+VV L
Sbjct  183  LMKSSEVVNL  192



>gb|AFK37379.1| unknown [Medicago truncatula]
Length=236

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 100/154 (65%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRSY+KN+M                  +A FVKV++DGAPYLRKVDL  + +Y
Sbjct  83   QVVGWPPVRSYKKNMMAQKVNNTEDTEKTTSNTTAAVFVKVSMDGAPYLRKVDLTMYKTY  142

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            + L  +L  MF+  TI N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVP
Sbjct  143  KDLSDALAKMFSSFTIGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVP  202

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  203  WEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  236



>ref|XP_004981820.1| PREDICTED: auxin-responsive protein IAA13-like isoform X2 [Setaria 
italica]
Length=233

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------------------KSAKFVKVAVDGAPYLRKVD  605
            Q VGWPPVRSYR+N+M                         S+ FVKV++DGAPYLRKVD
Sbjct  81   QAVGWPPVRSYRRNVMTVQTVKSKKEEEPEKQQPAANASSNSSAFVKVSMDGAPYLRKVD  140

Query  604  LVAFHSYQQLLTSLEDMFTCLTICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            L  ++SY+ L  +L++MF+  T  N +N  KL+D   G + V TYEDKDGDWMLVGDVPW
Sbjct  141  LKMYNSYKDLSIALKEMFSTFTTGNNMNEGKLVDPVSGADVVTTYEDKDGDWMLVGDVPW  200

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFVESCKRLR+MKSS+ +GLAP T  KC   S
Sbjct  201  EMFVESCKRLRIMKSSEAIGLAPRTKDKCKNKS  233



>emb|CAH59413.1| auxin resistance protein [Plantago major]
Length=227

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 102/149 (68%), Gaps = 20/149 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLT  569
            QVVGWPPVR++RKN+M             SA FVKV++DGAPYLRKVDL  + +Y++L  
Sbjct  79   QVVGWPPVRNFRKNVMAVQKTEKAEESGGSAAFVKVSMDGAPYLRKVDLKMYKTYEELSD  138

Query  568  SLEDMFTCLTIC--------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFV  413
            +L  MF+  T+         + +N  KLMD  +G++YVPTYEDKDGDWMLVGDVPW+MFV
Sbjct  139  ALGKMFSSFTMSKCDAQGMMDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWEMFV  198

Query  412  ESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             SCKRLR+MK ++ +GLAP    KC   S
Sbjct  199  GSCKRLRIMKGTEAIGLAPRAMEKCKSRS  227



>ref|XP_010483317.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=229

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRKVDL  + SY +L  +L
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSSGPEAAAFVKVSMDGAPYLRKVDLRMYKSYDELSNAL  141

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  142  SNMFSSFTLGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  201

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  202  TCKRLRLMKGSDAIGLAPRAMEKC  225



>ref|XP_004968414.1| PREDICTED: auxin-responsive protein IAA1-like isoform X1 [Setaria 
italica]
Length=258

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 99/129 (77%), Gaps = 12/129 (9%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            +VVGWPPVRSYRKN +          ++AKFVKVAVDGAPYLRKVDL A+  Y QLL +L
Sbjct  82   RVVGWPPVRSYRKNALADVAGSCKAKQAAKFVKVAVDGAPYLRKVDLEAYAGYDQLLRAL  141

Query  562  ED-MFTCLTICNVLNG-KKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRL  389
            +D  F+  TI    +  +KL+D  +GTEYVPTYEDKDGDWMLVGDVPWKMFVE+C+RLRL
Sbjct  142  QDKFFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRL  201

Query  388  MKSSDVVGL  362
            MKSS+ V L
Sbjct  202  MKSSEAVNL  210



>gb|KDO68557.1| hypothetical protein CISIN_1g026823mg [Citrus sinensis]
Length=232

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 101/149 (68%), Gaps = 24/149 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN++                 +A FVKV++DGAPYLRKVDL  +++YQ
Sbjct  80   QVVGWPPVRSFRKNMLGVVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYQ  139

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
             L  +L  MF+  TI N         +N  KLMD  +G++YVPTYEDKDGDWMLVGDVPW
Sbjct  140  DLYHALGKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPW  199

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
             MFVESCKRLR++K ++ +GLAP    KC
Sbjct  200  GMFVESCKRLRIVKGTEAIGLAPRAMEKC  228



>gb|KEH43017.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=253

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 102/157 (65%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------------------SAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKNI+                     +  FVKV++DGAPYLRKVDL  +
Sbjct  97   QVVGWPPVRSFRKNIVNVHQKSNSETEVDKSISGGGGNGAFVKVSMDGAPYLRKVDLKLY  156

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SYQ+L  +L  MF+  TI N         +N  KL+D  +G++YVPTYEDKDGDWMLVG
Sbjct  157  KSYQELSDALAKMFSSFTIDNCGSQVTKDFMNESKLIDLLNGSDYVPTYEDKDGDWMLVG  216

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  217  DVPWEMFVQSCKRLRIMKGSEAIGLAPRAVEKCKNRS  253



>ref|XP_008382962.1| PREDICTED: auxin-induced protein AUX28-like [Malus domestica]
Length=257

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 101/157 (64%), Gaps = 28/157 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM--------------------KSAKFVKVAVDGAPYLRKVDLVAF  593
            QVVGWPPVRS+RKN+                      +A  VKV++DGAPYLRKVDL  +
Sbjct  101  QVVGWPPVRSFRKNMFTAVQKSTNDGESEQMNKGSNNNAVLVKVSMDGAPYLRKVDLKMY  160

Query  592  HSYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
             SY +L  +L  MF+  TI N         +N +KLMD  +G++Y+PTYEDKDGDWMLVG
Sbjct  161  KSYPELSDALAKMFSSFTIGNCGSQGMKDFMNERKLMDVLNGSDYIPTYEDKDGDWMLVG  220

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            DVPW+MFVESCKRLR+MKS + VGLAP    KC   S
Sbjct  221  DVPWEMFVESCKRLRIMKSKEAVGLAPRAMEKCKNRS  257



>ref|XP_006362195.1| PREDICTED: auxin-responsive protein IAA14-like [Solanum tuberosum]
Length=238

 Score =   165 bits (418),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 98/144 (68%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTS  566
            QVVGWPPVRS+RKN+M            +  FVKV +DGAPYLRKVDL  + SYQ+L  +
Sbjct  91   QVVGWPPVRSFRKNVMAQKSNTEESEKTTVAFVKVCMDGAPYLRKVDLKMYKSYQELSDA  150

Query  565  LEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
            L  MF+  T  N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+MFV+
Sbjct  151  LAKMFSSFTNGNYGSQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEMFVD  210

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            SCKRLR+MK S+ +GLAP    KC
Sbjct  211  SCKRLRIMKGSEAIGLAPRAMEKC  234



>ref|XP_002889499.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65758.1| hypothetical protein ARALYDRAFT_470401 [Arabidopsis lyrata subsp. 
lyrata]
Length=229

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRKVDL  + SY +L  +L
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKVDLRMYKSYDELSNAL  141

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  142  SNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  201

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  202  TCKRLRLMKGSDAIGLAPRAMEKC  225



>ref|XP_010457463.1| PREDICTED: auxin-responsive protein IAA17 [Camelina sativa]
Length=229

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRKVDL  + SY +L  +L
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSSGPEAAAFVKVSMDGAPYLRKVDLRMYKSYDELSNAL  141

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  142  SNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  201

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  202  TCKRLRLMKGSDAIGLAPRAMEKC  225



>ref|XP_009111119.1| PREDICTED: auxin-responsive protein IAA17 [Brassica rapa]
Length=229

 Score =   165 bits (417),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 100/144 (69%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS----------AKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M S          A FVKV++DGAPYLRK+DL  + SY +L  +L
Sbjct  82   QVVGWPPVRSYRKNVMGSCQKSSSSADTAAFVKVSMDGAPYLRKIDLKMYKSYDELSDAL  141

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +K+MDT    +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  142  SNMFSSFTMGKNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDGDWMLVGDVPWPMFVD  201

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  202  TCKRLRLMKGSDAIGLAPRAMEKC  225



>ref|XP_006382798.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
 gb|ABK94241.1| unknown [Populus trichocarpa]
 gb|ERP60595.1| hypothetical protein POPTR_0005s05560g [Populus trichocarpa]
Length=250

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 101/156 (65%), Gaps = 27/156 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-------------------SAKFVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPP+RS+RKN+M                    +A FVKV++DGAPYLRKVDL  + 
Sbjct  95   QVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGTTGTAAFVKVSMDGAPYLRKVDLKLYK  154

Query  589  SYQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGD  434
            SY++L  +L  MF+  TI N         +N  KL+D  + +EYVPTYEDKDGDWMLVGD
Sbjct  155  SYRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGD  214

Query  433  VPWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VPW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  215  VPWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  250



>ref|XP_004965976.1| PREDICTED: auxin-responsive protein IAA23-like isoform X2 [Setaria 
italica]
Length=179

 Score =   163 bits (413),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLEDMFTCLTI  536
            + VGWPPVR+YR+N ++  AK VKVAVDGAPYLRKVDL A   Y+ LL +L  MF     
Sbjct  57   RAVGWPPVRAYRRNALRDEAKLVKVAVDGAPYLRKVDLAAHDGYEGLLRALHGMFAS---  113

Query  535  CNVLNGK-KLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVESCKRLRLMKSSDVVGLA  359
            C   NG  +L+D + G EYVPTYEDKDGDWMLVGDVP+KMFV+SCKR+RLMKSS+ V L+
Sbjct  114  CLGANGAGRLVDAATGAEYVPTYEDKDGDWMLVGDVPFKMFVDSCKRIRLMKSSEAVNLS  173

Query  358  PTTPSK  341
            P T S+
Sbjct  174  PRTSSQ  179



>emb|CDY15493.1| BnaA08g27770D [Brassica napus]
Length=229

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 100/144 (69%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKS----------AKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M S          A FVKV++DGAPYLRK+DL  + SY +L  +L
Sbjct  82   QVVGWPPVRSYRKNVMGSCQKSSSSADTAAFVKVSMDGAPYLRKIDLKMYKSYDELSDAL  141

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +K+MDT    +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  142  SNMFSSFTMGKNGGEEGMIDFMNERKVMDTVSSWDYVPSYEDKDGDWMLVGDVPWPMFVD  201

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  202  TCKRLRLMKGSDAIGLAPRAMEKC  225



>ref|XP_010475075.1| PREDICTED: auxin-responsive protein IAA17-like [Camelina sativa]
Length=230

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRKVDL  + SY +L  +L
Sbjct  83   QVVGWPPVRSYRKNVMVSCQKPSSGPEAAAFVKVSMDGAPYLRKVDLRMYKSYDELSNAL  142

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  143  SNMFSSFTMGKYGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  202

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  203  TCKRLRLMKGSDAIGLAPRAMEKC  226



>gb|ADJ68049.1| auxin responsive protein [Catharanthus roseus]
Length=242

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 99/153 (65%), Gaps = 28/153 (18%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-------------------FVKVAVDGAPYLRKVDLVAFH  590
            QVVGWPPVR++RKNIM                       FVKV++DGAPYLRKVDL  + 
Sbjct  86   QVVGWPPVRAFRKNIMAQKNNTEVEAGEKGSSSSSSSVAFVKVSMDGAPYLRKVDLKIYK  145

Query  589  SYQQLLTSLEDMFTCLTICN---------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVG  437
            SYQ+L  +L  MF+  T+ N          +N  KLMD  + +EYVPTYEDKDGDWMLVG
Sbjct  146  SYQELADALAKMFSSFTMGNYGTQQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVG  205

Query  436  DVPWKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            DVPW+MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  206  DVPWEMFVDSCKRLRIMKGSEAIGLAPRAMEKC  238



>gb|AEE25650.1| auxin-responsive protein [Gossypium hirsutum]
Length=253

 Score =   166 bits (419),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 101/150 (67%), Gaps = 21/150 (14%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM-------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKN++             + A  VKV++DGAPYLRKVDL  + SY QL 
Sbjct  104  QVVGWPPVRSFRKNMLATTTQKSSSEESGEKAALVKVSMDGAPYLRKVDLRMYTSYHQLS  163

Query  571  TSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMF  416
             +L  MF+  TI N         +N  KLMD  +G++YVPTYEDKDGD MLVGDVPW+MF
Sbjct  164  DALAKMFSSFTIGNCGSQGMKDFMNESKLMDLLNGSDYVPTYEDKDGDRMLVGDVPWEMF  223

Query  415  VESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            VESCKRLR+MK ++ +GLAP    KC + S
Sbjct  224  VESCKRLRIMKGTEAIGLAPKAVEKCKKRS  253



>gb|ABM53874.1| IAA6 [Cestrum elegans]
Length=153

 Score =   162 bits (410),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 99/149 (66%), Gaps = 25/149 (17%)
 Frame = -1

Query  709  VVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            VVGWPPVRS+RKN+M                  +A FVKV +DGAPYLRKVDL  + SY+
Sbjct  1    VVGWPPVRSFRKNVMAQKSNTDQENEKNSITTAAAAFVKVCMDGAPYLRKVDLKMYKSYK  60

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            QL  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  61   QLSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNTSEYVPSYEDKDGDWMLVGDVPW  120

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            +MFV+SCKRLR+MK S+ +GLAP    KC
Sbjct  121  EMFVDSCKRLRIMKGSEAIGLAPRAMEKC  149



>gb|AAM21317.1|AF373100_1 auxin-regulated protein [Populus tremula x Populus tremuloides]
Length=249

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 100/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------SAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPP+RS+RKN+M                    A FVKV++DGAPYLRKVDL  + S
Sbjct  95   QVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKS  154

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            Y++L  +L  MF+  TI N         +N  KL+D  + +EYVPTYEDKDGDWMLVGDV
Sbjct  155  YRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDV  214

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  215  PWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_011032399.1| PREDICTED: auxin-responsive protein IAA16-like [Populus euphratica]
Length=249

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 100/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------SAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPP+RS+RKN+M                    A FVKV++DGAPYLRKVDL  + S
Sbjct  95   QVVGWPPIRSFRKNVMAVQKNNNDEGEKASSSGTTGAAFVKVSMDGAPYLRKVDLKLYKS  154

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            Y++L  +L  MF+  TI N         +N  KL+D  + +EYVPTYEDKDGDWMLVGDV
Sbjct  155  YRELSDALGKMFSSFTIGNCGSQGTKDFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDV  214

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  215  PWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  249



>ref|XP_010556884.1| PREDICTED: auxin-responsive protein IAA17 [Tarenaya hassleriana]
Length=238

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 99/143 (69%), Gaps = 18/143 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK--------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSLED  557
            QVVGWPPVRSYRKN+          SA FVKV++DGAPYLRKVDL  ++SY+ L  +L  
Sbjct  92   QVVGWPPVRSYRKNMTAMSQKASGGSATFVKVSMDGAPYLRKVDLKMYNSYEDLSNALAK  151

Query  556  MFTCLT----------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVES  407
            MF+  T          + + +N  KLMD  + ++YVPTYEDKDGDWMLVGDVPW MFVES
Sbjct  152  MFSSFTTEKGNYGAQGMIDFMNESKLMDLLNSSDYVPTYEDKDGDWMLVGDVPWLMFVES  211

Query  406  CKRLRLMKSSDVVGLAPTTPSKC  338
            CKRLR+MK S+ +GLAP    KC
Sbjct  212  CKRLRIMKGSEAIGLAPRAMEKC  234



>ref|XP_011030585.1| PREDICTED: auxin-responsive protein IAA14-like isoform X1 [Populus 
euphratica]
Length=250

 Score =   165 bits (418),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 103/155 (66%), Gaps = 27/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRSYRKN++                 SA FVKV +DGAPYLRKVDL  + SYQ
Sbjct  96   QVVGWPPVRSYRKNVLAQKNASEEGEKASTGGSSAAFVKVCMDGAPYLRKVDLKMYRSYQ  155

Query  580  QLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+ N         +N  KLMD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  156  ELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPSYEDKDGDWMLVGDVPW  215

Query  424  KMFVESCKRLRLMKSSDVVGL--APTTPSKC-SRT  329
            +MFV+SCKRLR+MK S+ +GL  AP    KC SRT
Sbjct  216  EMFVDSCKRLRIMKGSEAIGLVSAPRAMEKCKSRT  250



>ref|NP_171921.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 sp|P93830.2|IAA17_ARATH RecName: Full=Auxin-responsive protein IAA17; AltName: Full=Auxin 
response 3; AltName: Full=Indoleacetic acid-induced protein 
17 [Arabidopsis thaliana]
 gb|AAG53997.1|AF336916_1 auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAB84354.1| IAA17 [Arabidopsis thaliana]
 gb|AAC39439.1| IAA17/AXR3 protein [Arabidopsis thaliana]
 gb|AAB70451.2| Identical to Arabidopsis gb|AF040632 and gb|U49073 IAA17/AXR3 
gene. ESTs gb|H36782 and gb|F14074 come from this gene [Arabidopsis 
thaliana]
 gb|AAL49831.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AAM51258.1| auxin-induced protein IAA17/AXR3-1 [Arabidopsis thaliana]
 gb|AEE27674.1| auxin-responsive protein IAA17 [Arabidopsis thaliana]
 gb|AGZ13682.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17]
 gb|AGZ59820.1| IAA17 [Cloning vector pAW8ENdeI-cHAIAA17-spo5DSR]
Length=229

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRK+DL  + SY +L  +L
Sbjct  82   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNAL  141

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  142  SNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  201

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  202  TCKRLRLMKGSDAIGLAPRAMEKC  225



>ref|XP_006383686.1| auxin-induced protein aux28 [Populus trichocarpa]
 gb|ERP61483.1| auxin-induced protein aux28 [Populus trichocarpa]
Length=237

 Score =   165 bits (417),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 100/154 (65%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+RKN++                  +A FVKV++DGAPYLRKVDL  + +Y
Sbjct  82   QVVGWPPVRSFRKNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTY  141

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
             +L  +L  MF+  TI N         LN  KL+D  +GT+YVPTYEDKDGDWMLVGDVP
Sbjct  142  HELSDALGKMFSSFTIGNCGSHGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVP  201

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W MFVESCKRLR+MK ++  GLAP    KC   S
Sbjct  202  WDMFVESCKRLRIMKGTEATGLAPRAMEKCKNRS  235



>gb|AAM64837.1| putative auxin-induced protein, IAA17/AXR3-1 [Arabidopsis thaliana]
Length=228

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 101/144 (70%), Gaps = 19/144 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQLLTSL  563
            QVVGWPPVRSYRKN+M          ++A FVKV++DGAPYLRK+DL  + SY +L  +L
Sbjct  81   QVVGWPPVRSYRKNVMVSCQKSSGGPEAAAFVKVSMDGAPYLRKIDLRMYKSYDELSNAL  140

Query  562  EDMFTCLTI---------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVE  410
             +MF+  T+          + +N +KLMD  +  +YVP+YEDKDGDWMLVGDVPW MFV+
Sbjct  141  SNMFSSFTMGKHGGEEGMIDFMNERKLMDLVNSWDYVPSYEDKDGDWMLVGDVPWPMFVD  200

Query  409  SCKRLRLMKSSDVVGLAPTTPSKC  338
            +CKRLRLMK SD +GLAP    KC
Sbjct  201  TCKRLRLMKGSDAIGLAPRAMEKC  224



>ref|XP_010450026.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   164 bits (416),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 101/153 (66%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------------FVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVR+YRKN+M + K                FVKV++DGAPYLRKVDL  ++SY+
Sbjct  73   QVVGWPPVRNYRKNVMANQKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYK  132

Query  580  QLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
             L  +L  MF+  T+         + +N  K+MD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  133  DLSDALAKMFSSFTMESYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPW  192

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  193  PMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  225



>gb|ACJ84642.1| unknown [Medicago truncatula]
Length=250

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 98/152 (64%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM---------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRSYRKN++                +  FVKV++DGAPYLRKVDL  + SY Q
Sbjct  99   QVVGWPPVRSYRKNMLAMQKSESEKNSSSNFNAITFVKVSMDGAPYLRKVDLKMYTSYSQ  158

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  SL  MF+  TI N         +N  KLMD  + ++YVPTYEDKDGDWMLVGDVPW 
Sbjct  159  LSDSLGKMFSSFTIGNCESQGMKDFMNESKLMDLLNNSDYVPTYEDKDGDWMLVGDVPWG  218

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFVESCKRLR+MK  + +G+AP    KC   S
Sbjct  219  MFVESCKRLRIMKGKEAIGIAPRAMEKCKNRS  250



>ref|XP_011073485.1| PREDICTED: auxin-responsive protein IAA14 [Sesamum indicum]
Length=251

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 99/147 (67%), Gaps = 22/147 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-------------SAKFVKVAVDGAPYLRKVDLVAFHSYQQLL  572
            QVVGWPPVRS+RKN M               A FVKV++DGAPYLRKVDL  + SYQ+L 
Sbjct  101  QVVGWPPVRSFRKNAMSHQKSDKEEAACSGGAAFVKVSMDGAPYLRKVDLKMYKSYQELS  160

Query  571  TSLEDMFTCLTIC---------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
             +L  MF+  T+          + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW+M
Sbjct  161  DALVKMFSAFTMAGNYGSQGMIDFMNEGKLMDLLNSSEYVPTYEDKDGDWMLVGDVPWEM  220

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKC  338
            FV+SCKRLR+MK S+ +GLAP    KC
Sbjct  221  FVDSCKRLRIMKGSEAIGLAPRAMEKC  247



>gb|ABH01143.1| auxin-regulated protein [Populus tomentosa]
Length=258

 Score =   165 bits (418),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 100/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------SAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPP+RS+RKN+M                    A FVKV++DGAPYLRKVDL  + S
Sbjct  97   QVVGWPPIRSFRKNVMAVQKNSNDEGEKASSSGATGAAFVKVSMDGAPYLRKVDLKLYKS  156

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            Y++L  +L  MF+  TI N         +N  KL+D  + +EYVPTYEDKDGDWMLVGDV
Sbjct  157  YRELSDALGKMFSSFTIGNCGSQGTKEFMNESKLIDLLNSSEYVPTYEDKDGDWMLVGDV  216

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW MFV+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  217  PWGMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS  251



>ref|XP_010435110.1| PREDICTED: auxin-responsive protein IAA14 [Camelina sativa]
Length=228

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 101/153 (66%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------------FVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVR+YRKN+M + K                FVKV++DGAPYLRKVDL  ++SY+
Sbjct  76   QVVGWPPVRNYRKNVMANHKNGEPDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYK  135

Query  580  QLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
             L  +L  MF+  T+         + +N  K+MD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  136  DLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPW  195

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             MFVESCKRLR+MK S+ VGLAP    KC   S
Sbjct  196  PMFVESCKRLRIMKGSEAVGLAPRAMEKCKNRS  228



>ref|NP_001280875.1| auxin-responsive protein IAA14-like [Malus domestica]
 gb|ADL36585.1| ARF domain class transcription factor [Malus domestica]
Length=244

 Score =   165 bits (417),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 99/155 (64%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK------------------SAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVRSYRKNIM                   +A FVKV +DGAPYLRKVDL  + S
Sbjct  90   QVVGWPPVRSYRKNIMAQKNTSEEKTKKASGGGGCTAAFVKVCMDGAPYLRKVDLKMYKS  149

Query  586  YQQLLTSLEDMFTCLT--------ICNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            YQ+L  +L  MF+  T        + + +N  KLMD  + +EYVPTYEDKDGDWMLVGDV
Sbjct  150  YQELSNALAKMFSSFTTGYYGTQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDV  209

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW M V+SCKRLR+MK S+ +GLAP    KC   S
Sbjct  210  PWGMLVDSCKRLRIMKGSEAIGLAPKAMEKCKGRS  244



>gb|AFK44393.1| unknown [Lotus japonicus]
Length=242

 Score =   164 bits (416),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 98/155 (63%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM------------------KSAKFVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVRSYRKN+M                      F KV++DGAPYLRKVDL  + S
Sbjct  88   QVVGWPPVRSYRKNMMVQKVNNEDQGTEKTTSSTAGGAFAKVSMDGAPYLRKVDLTMYKS  147

Query  586  YQQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            Y++L  +L  MF+  T+ N         +N  KLMD  + +EYVPTYEDKDGDWMLVGDV
Sbjct  148  YKELSDALAKMFSSFTMGNYGAQGMIDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDV  207

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW+MFV SCKRLR+MK S+ +GLAP    KC   S
Sbjct  208  PWEMFVGSCKRLRIMKGSEAIGLAPRAMEKCKNRS  242



>ref|XP_010440448.1| PREDICTED: auxin-responsive protein IAA14-like [Camelina sativa]
Length=225

 Score =   164 bits (415),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 101/153 (66%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------------FVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVR+YRKN+M + K                FVKV++DGAPYLRKVDL  ++SY+
Sbjct  73   QVVGWPPVRNYRKNVMANQKNGETDEAMSSAGGTVAFVKVSMDGAPYLRKVDLKMYNSYK  132

Query  580  QLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
             L  +L  MF+  T+         + +N  K+MD  + +EYVP+YEDKDGDWMLVGDVPW
Sbjct  133  NLSDALAKMFSSFTMGSYGAQGMIDFMNESKVMDLLNSSEYVPSYEDKDGDWMLVGDVPW  192

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
             MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  193  PMFVESCKRLRIMKGSESIGLAPRAMEKCKNRS  225



>ref|XP_011042427.1| PREDICTED: auxin-induced protein AUX28-like [Populus euphratica]
Length=237

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 100/154 (65%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMK-----------------SAKFVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRS+RKN++                  +A FVKV++DGAPYLRKVDL  + +Y
Sbjct  82   QVVGWPPVRSFRKNMLAVQKSSTDQESTDKVPGGNATFVKVSMDGAPYLRKVDLKMYKTY  141

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
             +L  +L +MF+  TI N         LN  KL+D   GT+YVPTYEDKDGDWMLVGDVP
Sbjct  142  HELSDALGEMFSSFTIGNCGSHGMKDFLNESKLIDLLTGTDYVPTYEDKDGDWMLVGDVP  201

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W MFVESCKRLR+MK ++  GLAP    KC   S
Sbjct  202  WDMFVESCKRLRIMKGTEATGLAPRAMEKCKSRS  235



>gb|KFK24541.1| hypothetical protein AALP_AAs58011U000100 [Arabis alpina]
Length=230

 Score =   164 bits (415),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 101/155 (65%), Gaps = 26/155 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK------------------FVKVAVDGAPYLRKVDLVAFHS  587
            QVVGWPPVR+YRKNIM + K                  FVKV++DGAPYLRKVDL  ++S
Sbjct  76   QVVGWPPVRNYRKNIMANQKSSEEAEEAMSGGGGGTVAFVKVSMDGAPYLRKVDLKMYNS  135

Query  586  YQQLLTSLEDMFTCLTI--------CNVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDV  431
            Y+ L  +L  MF+  T+         + +N  K+MD  + +EYVP+YEDKDGDWMLVGDV
Sbjct  136  YKDLSDALAKMFSSFTMGSYGAQGMIDFMNETKVMDLLNSSEYVPSYEDKDGDWMLVGDV  195

Query  430  PWKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            PW MFVESCKRLR+MK S+ +GLAP    KC   S
Sbjct  196  PWPMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS  230



>ref|XP_002520980.1| Auxin-induced protein AUX28, putative [Ricinus communis]
 gb|EEF41397.1| Auxin-induced protein AUX28, putative [Ricinus communis]
Length=244

 Score =   164 bits (416),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 98/141 (70%), Gaps = 22/141 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------------FVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RK+++   K              FVKV++DGAPYLRKVDL  + SYQ+L
Sbjct  94   QVVGWPPVRSFRKHMLTVQKSSNEETEKLGLNPTFVKVSMDGAPYLRKVDLKMYKSYQEL  153

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         LN  KL+D  +GT+YVPTYEDKDGDWMLVGDVPWKM
Sbjct  154  SDALGKMFSSFTIGNCGSQGMKDFLNESKLIDLLNGTDYVPTYEDKDGDWMLVGDVPWKM  213

Query  418  FVESCKRLRLMKSSDVVGLAP  356
            FVESCKRLR+MK ++  GLAP
Sbjct  214  FVESCKRLRIMKGTEATGLAP  234



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 101/154 (66%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNI---------------MKSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPP+RS+RKN                M  A F+KV++DGAPYLRKVDL  + +YQ+
Sbjct  202  QVVGWPPIRSFRKNTLATTSKNNDEVDGKAMAGALFIKVSMDGAPYLRKVDLRNYSAYQE  261

Query  577  LLTSLEDMFTCLTICNV----------LNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            L ++LE MF+C TI             ++  KL D   G+EYV TYEDKDGDWMLVGDVP
Sbjct  262  LSSALEKMFSCFTIGQYGAHGALGMEKMSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVP  321

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MF++SCKRLR+MKSSD +GLAP    KC   S
Sbjct  322  WEMFIDSCKRLRIMKSSDAIGLAPRAVEKCRNRS  355



>ref|XP_011082603.1| PREDICTED: auxin-responsive protein IAA14-like [Sesamum indicum]
Length=215

 Score =   163 bits (413),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/153 (54%), Positives = 100/153 (65%), Gaps = 24/153 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK----------------FVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKNIM   K                FVKV++DGAPYLRK+DL  + +YQ
Sbjct  63   QVVGWPPVRSFRKNIMAVKKSGDSEDNEKGSGGGGAFVKVSMDGAPYLRKIDLKMYKTYQ  122

Query  580  QLLTSLEDMFTCLTIC--------NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPW  425
            +L  +L  MF+  T+         + +N  KLMD  + +EYVPTYEDKDGDWMLVGDVPW
Sbjct  123  ELSDALGKMFSSFTMGKCDTQGMMDFMNESKLMDLLNSSEYVPTYEDKDGDWMLVGDVPW  182

Query  424  KMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            +MFVESCKRLR+MK ++  GLAP    KC   S
Sbjct  183  QMFVESCKRLRVMKGTEAKGLAPRAMEKCKSRS  215



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score =   167 bits (423),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 101/154 (66%), Gaps = 25/154 (16%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNI---------------MKSAKFVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPP+RS+RKN                M  A F+KV++DGAPYLRKVDL  + +YQ+
Sbjct  202  QVVGWPPIRSFRKNTLATTSKNNDEVDGKAMAGALFIKVSMDGAPYLRKVDLRNYSAYQE  261

Query  577  LLTSLEDMFTCLTICNV----------LNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            L ++LE MF+C TI             ++  KL D   G+EYV TYEDKDGDWMLVGDVP
Sbjct  262  LSSALEKMFSCFTIGQYGAHGALGMEKMSESKLKDLLHGSEYVLTYEDKDGDWMLVGDVP  321

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            W+MF++SCKRLR+MKSSD +GLAP    KC   S
Sbjct  322  WEMFIDSCKRLRIMKSSDAIGLAPRAVEKCRNRS  355



>ref|XP_006443920.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
 gb|ESR57160.1| hypothetical protein CICLE_v10022032mg [Citrus clementina]
Length=226

 Score =   164 bits (414),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 101/143 (71%), Gaps = 18/143 (13%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIM----------------KSAKFVKVAVDGAPYLRKVDLVAFHSYQ  581
            QVVGWPPVRS+RKN++                 +A FVKV++DGAPYLRKVDL  +++Y+
Sbjct  80   QVVGWPPVRSFRKNMLGVVQKSSGEESDMAGGNNAAFVKVSMDGAPYLRKVDLRMYNTYK  139

Query  580  QLLTSLEDMFTCLTIC--NVLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKMFVES  407
             L  +L  MF+  TI   + +N  KLMD  +G++YVPTYEDKDGDWMLVGDVPW MFVES
Sbjct  140  DLYDALGKMFSSFTIGMKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWGMFVES  199

Query  406  CKRLRLMKSSDVVGLAPTTPSKC  338
            CKRLR++K ++ +GLAP    KC
Sbjct  200  CKRLRIVKGTEAIGLAPRAMEKC  222



>gb|AAM96891.1| auxin-responsive protein IAA1 [Mirabilis jalapa]
Length=194

 Score =   162 bits (411),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 97/150 (65%), Gaps = 25/150 (17%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK-----------------FVKVAVDGAPYLRKVDLVAFHSY  584
            QVVGWPPVRSYRKN++   K                  VKV++DGAPYLRKVDL  + SY
Sbjct  41   QVVGWPPVRSYRKNMLAVQKSTGAPESESEKPAANGGLVKVSMDGAPYLRKVDLKLYKSY  100

Query  583  QQLLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVP  428
            Q L  +L  MF+  T+ N         +N  KLMD  +G++YVPTYEDKDGDWMLVGDVP
Sbjct  101  QDLSDALGKMFSSFTLGNYGSQGMIDFMNESKLMDLINGSDYVPTYEDKDGDWMLVGDVP  160

Query  427  WKMFVESCKRLRLMKSSDVVGLAPTTPSKC  338
            W+MFVESCKRLR+MK  +  GLAP    KC
Sbjct  161  WEMFVESCKRLRIMKGKEAAGLAPRAMEKC  190



>ref|XP_004289900.1| PREDICTED: auxin-induced protein AUX28-like [Fragaria vesca subsp. 
vesca]
Length=250

 Score =   164 bits (415),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 100/151 (66%), Gaps = 22/151 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK--------------FVKVAVDGAPYLRKVDLVAFHSYQQL  575
            QVVGWPPVRS+RKN++ + K               VKV++DGAPYLRKVDL  + +Y QL
Sbjct  100  QVVGWPPVRSFRKNMLSAQKSSTTDESKAGGNAALVKVSMDGAPYLRKVDLNMYKTYPQL  159

Query  574  LTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWKM  419
              +L  MF+  TI N         +N +KLMD  + ++Y+PTYEDKDGDWMLVGDVPW+M
Sbjct  160  SDALAKMFSSFTIGNCGSQGTIDFMNERKLMDLLNDSDYIPTYEDKDGDWMLVGDVPWEM  219

Query  418  FVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            FVESCKRLR+MK  + VGLAP    KC   S
Sbjct  220  FVESCKRLRIMKGKEAVGLAPRAMEKCKNRS  250



>ref|XP_007050421.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
 gb|EOX94578.1| Indole-3-acetic acid inducible 14 isoform 1 [Theobroma cacao]
Length=305

 Score =   166 bits (419),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 100/152 (66%), Gaps = 23/152 (15%)
 Frame = -1

Query  712  QVVGWPPVRSYRKNIMKSAK---------------FVKVAVDGAPYLRKVDLVAFHSYQQ  578
            QVVGWPPVRS+RKN+  + K               FVKV++DGAPYLRKVDL  + +Y +
Sbjct  154  QVVGWPPVRSFRKNMFATQKSSSEESEKGGAGNAAFVKVSMDGAPYLRKVDLRMYKTYLE  213

Query  577  LLTSLEDMFTCLTICN--------VLNGKKLMDTSDGTEYVPTYEDKDGDWMLVGDVPWK  422
            L  +L  MF+  TI N         +N  KLMD  +G++YVPTYEDKDGDWMLVGDVPW 
Sbjct  214  LSDALAKMFSSFTIGNCGSQGVKDFMNESKLMDLLNGSDYVPTYEDKDGDWMLVGDVPWD  273

Query  421  MFVESCKRLRLMKSSDVVGLAPTTPSKCSRTS  326
            MFVESCKRLR+MK ++ +GLAP    KC   S
Sbjct  274  MFVESCKRLRIMKGTEAIGLAPRAMEKCKNRS  305



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1154079434412