BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c7020_g1_i1 len=1332 path=[131:0-1331]

Length=1332
                                                                      Score     E

sp|P23547.1|E13G_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    409   7e-137   Nicotiana tabacum [American tobacco]
ref|XP_009775775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    407   3e-136   
gb|AAA34103.1|  PR2                                                     404   6e-135   Nicotiana tabacum [American tobacco]
ref|XP_009619948.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    403   1e-134   
ref|XP_009780913.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    400   2e-133   
sp|P52399.1|E13L_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    397   3e-132   Nicotiana tabacum [American tobacco]
ref|XP_009770429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    389   2e-129   
ref|XP_009790797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    389   2e-129   
ref|XP_009589771.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    386   5e-128   
sp|P23432.1|E13C_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    386   7e-128   Nicotiana tabacum [American tobacco]
sp|P52398.1|E13K_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    385   8e-128   Nicotiana tabacum [American tobacco]
gb|AAD33880.1|AF141653_1  beta-1,3-glucanase                            386   1e-127   Nicotiana tabacum [American tobacco]
ref|XP_009801409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    385   2e-127   
ref|XP_009607576.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    385   3e-127   
ref|XP_009796657.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        384   4e-127   
sp|P23433.1|E13D_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    382   2e-126   Nicotiana tabacum [American tobacco]
ref|XP_009592823.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    380   2e-125   
ref|XP_009764461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    379   3e-125   
ref|XP_009587943.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    379   5e-125   
ref|XP_009596559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        379   6e-125   
ref|XP_006365629.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    376   5e-124   
ref|XP_006367558.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    375   2e-123   
emb|CAE53273.1|  1,3-beta-glucan glucanohydrolase                       373   6e-123   Solanum tuberosum [potatoes]
ref|XP_004228512.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    372   2e-122   
emb|CAE52322.1|  1,3-beta-D-glucan glucanohydrolase precursor           372   2e-122   Solanum tuberosum [potatoes]
ref|XP_007211511.1|  hypothetical protein PRUPE_ppa007999mg             370   1e-121   
gb|AAN78309.1|  acidic class II 1,3-beta-glucanase precursor            370   1e-121   Solanum tuberosum [potatoes]
pdb|3UR7|A  Chain A, Higher-density Crystal Structure Of Potato E...    369   1e-121   
ref|XP_008227211.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    368   8e-121   
pdb|4GZI|A  Chain A, Active-site Mutant Of Potato Endo-1,3-beta-g...    366   2e-120   
ref|XP_006365633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    365   2e-120   
ref|NP_001234798.1|  glucan endo-1,3-beta-glucosidase A precursor       366   3e-120   
gb|AAN78310.1|  acidic class II 1,3-beta-glucanase precursor            366   3e-120   Solanum tuberosum [potatoes]
dbj|BAE53383.1|  beta-1,3-glucanase                                     366   3e-120   
ref|XP_007133418.1|  hypothetical protein PHAVU_011G177000g             365   5e-120   
ref|XP_008366411.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    363   4e-119   
emb|CAA08910.1|  glucan endo-1,3-beta-D-glucosidase                     362   3e-118   Solanum tuberosum [potatoes]
ref|NP_001275613.1|  glucan endo-1,3-beta-glucosidase, acidic iso...    358   4e-117   
ref|XP_009366077.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    358   5e-117   
gb|AFP23132.1|  beta-1,3-glucanase                                      358   7e-117   
ref|XP_007132239.1|  hypothetical protein PHAVU_011G077900g             357   1e-116   
sp|P52396.1|E13I_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    355   1e-116   Nicotiana tabacum [American tobacco]
ref|XP_008363318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    356   3e-116   
ref|XP_004232306.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    356   3e-116   
ref|XP_009374912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    355   6e-116   
ref|XP_010101245.1|  Glucan endo-1,3-beta-glucosidase                   353   2e-115   
ref|XP_006367559.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    354   2e-115   
ref|XP_010101247.1|  Glucan endo-1,3-beta-glucosidase                   353   3e-115   
gb|ABK95326.1|  unknown                                                 352   8e-115   Populus trichocarpa [western balsam poplar]
ref|XP_002299791.2|  3-glucanase family protein                         352   9e-115   Populus trichocarpa [western balsam poplar]
gb|ACU20860.1|  unknown                                                 351   3e-114   Glycine max [soybeans]
gb|KHN05499.1|  Glucan endo-1,3-beta-glucosidase, acidic isoform ...    349   2e-113   
dbj|BAE53384.1|  beta-1,3-glucanase                                     348   2e-113   
ref|XP_011045404.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    348   2e-113   
ref|XP_011001638.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    346   2e-112   
ref|NP_001237271.1|  endo-1,3-beta-glucanase precursor                  346   3e-112   
ref|XP_008223323.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    346   5e-112   
ref|XP_003607319.1|  Endo-beta-1 3-glucanase                            344   1e-111   
emb|CDO98259.1|  unnamed protein product                                344   1e-111   
ref|XP_007226561.1|  hypothetical protein PRUPE_ppa024457mg             343   2e-111   
ref|XP_003540349.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    343   2e-111   
ref|XP_006365201.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    343   2e-111   
dbj|BAG34628.1|  beta-1,3-glucanase                                     343   3e-111   Lotus japonicus
ref|XP_004251356.2|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    343   3e-111   
ref|XP_003607315.1|  Glucan endo-1,3-beta-glucosidase                   342   9e-111   
ref|XP_008356363.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    341   4e-110   
gb|KDP22122.1|  hypothetical protein JCGZ_25953                         339   9e-110   
gb|AFK41254.1|  unknown                                                 338   2e-109   
gb|AAF44667.2|AF239617_1  beta-1,3-glucanase                            339   3e-109   Vitis vinifera
ref|XP_006365200.1|  PREDICTED: uncharacterized protein LOC102593111    348   4e-109   
gb|KDO61190.1|  hypothetical protein CISIN_1g048190mg                   337   5e-109   
ref|XP_006470762.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    338   5e-109   
ref|NP_001267896.1|  class I beta-1,3-glucanase precursor               337   2e-108   
ref|XP_008373020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    336   3e-108   
ref|XP_006446183.1|  hypothetical protein CICLE_v10017983mg             335   3e-108   
gb|KEH30624.1|  glucan endo-1,3-beta-glucosidase                        335   4e-108   
ref|XP_003607316.1|  Glucan endo-1 3-beta-d-glucosidase                 335   5e-108   
gb|ACZ74626.1|  beta-1,3-glucanase form RRII Gln 3                      336   7e-108   Hevea brasiliensis [jebe]
gb|AFJ97274.1|  beta-1,3-glucanase                                      335   9e-108   
emb|CDP09617.1|  unnamed protein product                                335   1e-107   
gb|KHN03122.1|  Glucan endo-1,3-beta-glucosidase                        333   1e-107   
ref|XP_008227227.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    334   1e-107   
ref|XP_006423938.1|  hypothetical protein CICLE_v10029843mg             333   1e-107   
gb|ABN03966.1|  beta-1,3-glucanase                                      335   1e-107   Hevea brasiliensis [jebe]
ref|XP_010045033.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    333   2e-107   
gb|ABG49448.1|  beta-1,3-glucanase                                      335   2e-107   Hevea brasiliensis [jebe]
ref|XP_003548789.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    333   2e-107   
gb|ABN09655.1|  beta-1,3-glucanase                                      334   2e-107   Hevea brasiliensis [jebe]
gb|ACY91851.1|  beta-1,3-glucanase form RRII Gln 2                      334   2e-107   Hevea brasiliensis [jebe]
ref|XP_004505798.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    333   3e-107   
gb|AES89518.2|  glucan endo-1,3-beta-glucosidase                        336   3e-107   
emb|CAB38443.1|  beta-1,3-glucanase                                     333   3e-107   Hevea brasiliensis [jebe]
gb|AAR06588.1|  beta-1,3-glucanase                                      333   4e-107   Vitis riparia [frost grape]
gb|AAP87281.1|  beta-1,3-glucanase                                      333   7e-107   Hevea brasiliensis [jebe]
ref|XP_006480384.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    333   7e-107   
pdb|4HPG|A  Chain A, Crystal Structure Of A Glycosylated Beta-1,3...    331   1e-106   
gb|ABN09654.1|  beta-1,3-glucanase                                      332   2e-106   Hevea brasiliensis [jebe]
gb|AAG24921.1|AF311749_1  beta-1,3-glucanase                            330   2e-106   Hevea brasiliensis [jebe]
ref|XP_002513528.1|  Lichenase precursor, putative                      330   3e-106   Ricinus communis
gb|ABJ74161.1|  beta-1,3-glucanase                                      329   4e-106   Hevea brasiliensis [jebe]
ref|XP_004505795.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    330   5e-106   
ref|XP_002278123.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        330   6e-106   Vitis vinifera
ref|XP_007015141.1|  Glucan endo-1,3-beta-glucosidase, acidic, pu...    330   7e-106   
ref|NP_001266064.1|  glucan endo-1,3-beta-glucosidase-like precursor    329   9e-106   
ref|XP_007035767.1|  Glycosyl hydrolase superfamily protein             332   1e-105   
gb|ABN09653.1|  beta-1,3-glucanase                                      330   1e-105   Hevea brasiliensis [jebe]
ref|XP_003607321.1|  Endo-beta-1 3-glucanase                            330   2e-105   
emb|CDP20080.1|  unnamed protein product                                328   2e-105   
gb|AAA87456.1|  beta-1,3-glucanase                                      329   3e-105   Hevea brasiliensis [jebe]
ref|XP_003537741.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    327   4e-105   
ref|XP_006365202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    329   4e-105   
sp|P52407.2|E13B_HEVBR  RecName: Full=Glucan endo-1,3-beta-glucos...    328   8e-105   Hevea brasiliensis [jebe]
gb|AEV41413.1|  beta-1,3-glucanase                                      326   3e-104   
ref|XP_006599939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    333   6e-104   
gb|KHN05500.1|  Glucan endo-1,3-beta-glucosidase                        323   1e-103   
ref|XP_004297245.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    323   2e-103   
gb|AAL30420.1|AF434173_1  glucanase                                     323   2e-103   Sambucus nigra
ref|XP_004291760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    323   3e-103   
dbj|BAC66141.1|  beta-1,3-glucanase                                     323   3e-103   Fragaria x ananassa
ref|XP_007015136.1|  Glycosyl hydrolase superfamily protein, puta...    323   3e-103   
gb|AAO16642.1|  beta-1,3-glucanase                                      323   4e-103   Fragaria x ananassa
gb|AIT56224.1|  beta-1,3 glucanase 3                                    322   5e-103   
ref|XP_009414139.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    322   6e-103   
gb|AFJ97275.1|  beta-1,3-glucanase                                      323   7e-103   
gb|KHN05498.1|  Glucan endo-1,3-beta-glucosidase, basic vacuolar ...    322   8e-103   
gb|AAX81590.1|  beta-1,3-glucanase                                      321   1e-102   Fragaria x ananassa
gb|AIR93912.1|  glucanase                                               328   2e-102   
ref|XP_010063513.1|  PREDICTED: lichenase                               322   2e-102   
ref|XP_006430506.1|  hypothetical protein CICLE_v10012099mg             320   2e-102   
emb|CDP09619.1|  unnamed protein product                                320   3e-102   
dbj|BAC66185.1|  beta-1,3-glucanase                                     320   3e-102   Fragaria x ananassa
dbj|BAC66186.1|  beta-1,3-glucanase                                     320   3e-102   Fragaria x ananassa
ref|XP_010434858.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    320   5e-102   
ref|XP_008811754.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    319   6e-102   
gb|KHN03123.1|  Glucan endo-1,3-beta-glucosidase                        318   7e-102   
ref|XP_006482037.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    319   8e-102   
ref|NP_193361.4|  putative beta-1,3-endoglucanase                       319   8e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006599943.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    318   1e-101   
gb|AEE81082.1|  beta-1,3-glucanase                                      318   1e-101   
ref|XP_006414372.1|  hypothetical protein EUTSA_v10025628mg             318   2e-101   
gb|ADW08742.1|  1,3-beta-D-glucanase GH17_39                            318   2e-101   
ref|XP_006284042.1|  hypothetical protein CARUB_v10005163mg             318   2e-101   
ref|XP_010673693.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    317   3e-101   
ref|XP_010440186.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    318   3e-101   
ref|XP_002868146.1|  AT4g16260/dl4170c                                  317   4e-101   
gb|AAX81589.1|  beta-1,3-glucanase                                      316   6e-101   Fragaria x ananassa
emb|CDY34445.1|  BnaC01g21880D                                          317   7e-101   
ref|XP_010921891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    316   1e-100   
ref|XP_009391471.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    315   2e-100   
ref|XP_010921866.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    315   2e-100   
emb|CAA09765.1|  beta-1,3-glucanase                                     315   3e-100   Cichorium intybus x Cichorium endivia
ref|XP_008227224.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    316   4e-100   
ref|XP_010279591.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    314   6e-100   
ref|XP_010449818.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    314   7e-100   
ref|XP_009146295.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    313   2e-99    
gb|ADG56569.1|  beta-1,3-glucanase                                      312   3e-99    
ref|XP_004505796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    313   3e-99    
ref|XP_010907250.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    312   3e-99    
emb|CDY32230.1|  BnaA01g17540D                                          312   4e-99    
ref|XP_010921890.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    312   5e-99    
ref|XP_011083774.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    311   7e-99    
gb|AAQ90286.1|  beta-1,3-glucanase, basic                               311   1e-98    Coffea arabica x Coffea canephora
ref|XP_010692567.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    311   1e-98    
ref|XP_008811757.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    311   1e-98    
emb|CDP14179.1|  unnamed protein product                                310   2e-98    
gb|KFK36125.1|  hypothetical protein AALP_AA4G081000                    311   2e-98    
ref|XP_004505799.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    310   2e-98    
ref|XP_004505797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    309   2e-98    
ref|XP_010673702.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    310   3e-98    
ref|XP_006645316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    309   5e-98    
gb|AIS22073.1|  beta-1,3 glucanase 4                                    309   5e-98    
ref|XP_003607322.1|  Endo-1 3-beta-glucanase                            310   5e-98    
gb|AHW57401.1|  beta-1,3 glucanase 4                                    309   7e-98    
ref|XP_010907249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    308   1e-97    
ref|XP_010921893.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    308   1e-97    
gb|EYU35916.1|  hypothetical protein MIMGU_mgv1a009371mg                308   1e-97    
gb|AES89519.2|  glycoside hydrolase family 17 protein                   309   3e-97    
gb|ABD85024.1|  beta-1,3-glucanase                                      306   5e-97    Lilium hybrid division VII [oriental hybrid lilies]
emb|CDP14184.1|  unnamed protein product                                306   6e-97    
ref|XP_002459074.1|  hypothetical protein SORBIDRAFT_03g045460          306   7e-97    Sorghum bicolor [broomcorn]
gb|ABB04444.1|  pathogenesis-related protein 6                          305   2e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62688.1|  beta 1,3 glucanase                                      305   2e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33843.1|  pathogenesis-related protein 6                          305   2e-96    Zea diploperennis [chapule]
gb|ACJ62680.1|  beta 1,3 glucanase                                      305   3e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABA33840.1|  pathogenesis-related protein 6                          305   3e-96    Zea diploperennis [chapule]
ref|NP_001045372.1|  Os01g0944700                                       304   3e-96    Oryza sativa Japonica Group [Japonica rice]
gb|ABA33838.1|  pathogenesis-related protein 6                          304   5e-96    Zea diploperennis [chapule]
gb|AGQ89281.1|  beta-1,3-glucanase A                                    303   6e-96    
ref|XP_011090470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    306   6e-96    
emb|CAH17549.1|  beta-1,3-glucanase                                     304   6e-96    Olea europaea
ref|XP_010273332.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    304   6e-96    
gb|ABB04452.1|  pathogenesis-related protein 6                          303   7e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|EYU45079.1|  hypothetical protein MIMGU_mgv1a009451mg                304   7e-96    
gb|ACJ62694.1|  beta 1,3 glucanase                                      303   8e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62646.1|  beta 1,3 glucanase                                      303   8e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04443.1|  pathogenesis-related protein 6                          303   8e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62629.1|  beta 1,3 glucanase                                      303   8e-96    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62696.1|  beta 1,3 glucanase                                      303   9e-96    Zea mays subsp. parviglumis [Balsas teosinte]
tpg|DAA55874.1|  TPA: putative O-Glycosyl hydrolase superfamily p...    303   9e-96    
gb|ACJ62631.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62691.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62628.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62644.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04450.1|  pathogenesis-related protein 6                          303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62686.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_008811756.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    303   1e-95    
ref|XP_007212652.1|  hypothetical protein PRUPE_ppa018225mg             303   1e-95    
gb|ABB04451.1|  pathogenesis-related protein 6                          303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04446.1|  pathogenesis-related protein 6                          303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62668.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62657.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62639.1|  beta 1,3 glucanase                                      303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04445.1|  pathogenesis-related protein 6                          303   1e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62624.1|  beta 1,3 glucanase                                      303   2e-95    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004154643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    304   2e-95    
gb|ABK96486.1|  unknown                                                 304   2e-95    Populus trichocarpa x Populus deltoides
ref|XP_010269788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    302   2e-95    
ref|XP_011010204.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    303   2e-95    
ref|XP_010097796.1|  Glucan endo-1,3-beta-glucosidase, basic vacu...    303   2e-95    
ref|XP_008351633.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    302   3e-95    
gb|ABB04441.1|  pathogenesis-related protein 6                          302   3e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62630.1|  beta 1,3 glucanase                                      302   3e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62652.1|  beta 1,3 glucanase                                      302   3e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62647.1|  beta 1,3 glucanase                                      302   3e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|EAY77183.1|  hypothetical protein OsI_05153                          302   3e-95    Oryza sativa Indica Group [Indian rice]
ref|NP_001234805.1|  glucan endo-1,3-beta-glucosidase B precursor       303   3e-95    
ref|XP_004139045.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    304   3e-95    
gb|ACJ62633.1|  beta 1,3 glucanase                                      301   4e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62663.1|  beta 1,3 glucanase                                      301   4e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04447.1|  pathogenesis-related protein 6                          301   4e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62625.1|  beta 1,3 glucanase                                      301   4e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ABB04442.1|  pathogenesis-related protein 6                          301   4e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62674.1|  beta 1,3 glucanase                                      301   4e-95    Zea mays subsp. parviglumis [Balsas teosinte]
dbj|BAO09557.1|  beta-1,3-glucanase                                     301   5e-95    
gb|ACJ62661.1|  beta 1,3 glucanase                                      301   5e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62638.1|  beta 1,3 glucanase                                      301   5e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|AGT78193.1|  beta-1,3 glucanase 2                                    301   5e-95    
gb|ACJ62685.1|  beta 1,3 glucanase                                      301   5e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62645.1|  beta 1,3 glucanase                                      301   7e-95    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ACJ62632.1|  beta 1,3 glucanase                                      301   7e-95    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_011083775.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    301   7e-95    
gb|AFU52655.1|  beta-1,3-glucanase 22                                   302   8e-95    
gb|ACJ62655.1|  beta 1,3 glucanase                                      301   8e-95    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_010273331.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    301   8e-95    
gb|AEQ01058.1|  putative endo-beta-1,3-glucanase                        302   9e-95    
ref|XP_010090235.1|  Glucan endo-1,3-beta-glucosidase, basic isoform    301   9e-95    
ref|XP_010273330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    300   1e-94    
ref|XP_002277193.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    300   1e-94    Vitis vinifera
ref|XP_008811753.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    300   1e-94    
gb|AAL35900.1|AF443600_1  endo-1,3-beta-glucanase                       300   1e-94    Oryza sativa [red rice]
gb|AIT56229.1|  beta-1,3 glucanase 2                                    300   1e-94    
gb|ABA33845.1|  pathogenesis-related protein 6                          300   2e-94    Zea diploperennis [chapule]
ref|XP_002459073.1|  hypothetical protein SORBIDRAFT_03g045450          300   2e-94    Sorghum bicolor [broomcorn]
ref|NP_001274869.1|  glucan endo-1,3-beta-glucosidase, basic isof...    301   2e-94    
ref|XP_004295093.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    301   2e-94    
gb|ACJ62636.1|  beta 1,3 glucanase                                      300   2e-94    Zea mays subsp. parviglumis [Balsas teosinte]
gb|AEO27890.1|  beta-1,3-glucanase                                      300   2e-94    
gb|ACJ62642.1|  beta 1,3 glucanase                                      299   3e-94    Zea mays subsp. parviglumis [Balsas teosinte]
gb|ADW08743.1|  1,3-beta-D-glucanase GH17_44                            300   4e-94    
dbj|BAM28606.1|  beta-1,3-glucanase                                     299   4e-94    
gb|ACJ62690.1|  beta 1,3 glucanase                                      299   4e-94    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_003569324.2|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    299   4e-94    
ref|XP_008800262.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        299   5e-94    
ref|XP_002314934.2|  Glucan endo-1 family protein                       300   5e-94    Populus trichocarpa [western balsam poplar]
gb|ACJ62662.1|  beta 1,3 glucanase                                      298   5e-94    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_004962627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    298   5e-94    
ref|XP_006358202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    300   5e-94    
gb|ACJ62673.1|  beta 1,3 glucanase                                      298   6e-94    Zea mays subsp. parviglumis [Balsas teosinte]
ref|NP_001105947.1|  glucan endo-1,3-beta-glucosidase homolog1 pr...    298   7e-94    Zea mays [maize]
ref|XP_002878141.1|  hypothetical protein ARALYDRAFT_486169             298   7e-94    
ref|XP_009629906.1|  PREDICTED: lichenase                               299   9e-94    
gb|ABB04448.1|  pathogenesis-related protein 6                          298   1e-93    Zea mays subsp. parviglumis [Balsas teosinte]
ref|XP_007015119.1|  Glycosyl hydrolase superfamily protein, puta...    298   1e-93    
gb|AAC19114.1|  1,3-beta-glucan glucanohydrolase                        298   1e-93    Solanum tuberosum [potatoes]
gb|ADR71671.1|  beta-1,3-glucanase                                      298   2e-93    
gb|AAA34078.1|  beta(1,3)-glucanase regulator                           298   2e-93    Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|AIT56226.1|  beta-1,3 glucanase 6                                    297   3e-93    
ref|XP_010551091.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    297   3e-93    
gb|AAD28732.1|AF112965_1  beta-1,3-glucanase precursor                  296   3e-93    Triticum aestivum [Canadian hard winter wheat]
dbj|BAD93486.1|  pollen allergen CJP38                                  297   4e-93    
gb|ACU78080.1|  beta-1,3-glucanase                                      296   5e-93    
gb|EAY77184.1|  hypothetical protein OsI_05154                          296   5e-93    
ref|XP_002314939.2|  hypothetical protein POPTR_0010s15320g             296   5e-93    
gb|AAF08679.1|  beta-1,3-glucanase                                      296   5e-93    
gb|AAY96422.1|  beta-1,3-glucanase                                      296   5e-93    
ref|NP_191286.1|  beta-1,3-glucanase 1                                  296   5e-93    
gb|AAY88778.1|  beta-1,3-glucanase                                      296   6e-93    
emb|CDP14183.1|  unnamed protein product                                296   6e-93    
gb|AAB82772.2|  beta-1, 3-glucananse                                    296   6e-93    
gb|ABB04449.1|  truncated pathogenesis-related protein 6                295   6e-93    
gb|ABK28605.1|  unknown                                                 296   7e-93    
sp|P52400.1|E131_SOLTU  RecName: Full=Glucan endo-1,3-beta-glucos...    296   7e-93    
ref|XP_008443726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    296   8e-93    
ref|XP_009414181.1|  PREDICTED: lichenase-like                          296   8e-93    
gb|EAY77193.1|  hypothetical protein OsI_05162                          295   1e-92    
dbj|BAA77783.1|  beta 1,3-glucanase                                     295   1e-92    
ref|XP_009419800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    296   1e-92    
gb|AAM61105.1|  glucan endo-1,3-beta-D-glucosidase-like protein         295   1e-92    
sp|P07979.3|GUB_NICPL  RecName: Full=Lichenase; AltName: Full=End...    296   1e-92    
emb|CDM85343.1|  unnamed protein product                                295   1e-92    
emb|CAA30261.1|  beta-glucanase precursor                               296   2e-92    
ref|XP_010273335.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    295   2e-92    
ref|XP_010673697.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    294   2e-92    
gb|KHN03119.1|  Glucan endo-1,3-beta-glucosidase                        293   2e-92    
gb|ABJ98942.1|  beta-1,3-glucanase                                      295   2e-92    
ref|XP_004142554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    295   2e-92    
gb|AAD10381.1|  beta-1,3-glucanase precursor                            294   3e-92    
ref|XP_007015137.1|  Glycosyl hydrolase superfamily protein, puta...    295   3e-92    
ref|NP_001045373.2|  Os01g0944800                                       294   3e-92    
ref|XP_008360676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    294   4e-92    
ref|XP_010673696.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    294   4e-92    
sp|P23431.1|E13B_NICPL  RecName: Full=Glucan endo-1,3-beta-glucos...    295   5e-92    
gb|AFU52648.1|  beta-1,3-glucanase 13                                   294   5e-92    
ref|XP_007028622.1|  Glucan endo-1,3-beta-glucosidase                   294   7e-92    
gb|AGW45300.1|  beta-1,3-glucanase                                      293   8e-92    
ref|XP_004171028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    292   1e-91    
ref|XP_003607328.1|  Beta-1 3-glucanase                                 293   1e-91    
gb|KDP26103.1|  hypothetical protein JCGZ_21136                         293   1e-91    
ref|XP_008240769.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    293   1e-91    
gb|ACD45060.1|  beta-1,3-glucanase                                      293   2e-91    
sp|P27666.1|E13F_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    293   2e-91    
gb|ACF93731.1|  basic beta-1,3-glucanase                                293   2e-91    
dbj|BAJ93960.1|  predicted protein                                      292   2e-91    
ref|XP_009760304.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    293   2e-91    
ref|NP_001045358.1|  Os01g0941200                                       291   3e-91    
gb|AAL30426.1|AF435089_1  beta-1,3-glucanase                            292   3e-91    
dbj|BAD88028.1|  endo-1,3-beta-glucanase                                291   3e-91    
sp|P15797.2|E13B_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    293   3e-91    
ref|XP_006491499.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    291   4e-91    
ref|NP_001045384.2|  Os01g0946500                                       291   4e-91    
ref|XP_009626316.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    292   4e-91    
ref|XP_008231643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    291   6e-91    
ref|XP_008245641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    290   6e-91    
gb|KDO40853.1|  hypothetical protein CISIN_1g0197552mg                  290   8e-91    
ref|XP_010938656.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    290   9e-91    
ref|XP_009350958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    291   1e-90    
ref|XP_008240766.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    291   1e-90    
gb|ADG36438.1|  glucanase                                               289   1e-90    
gb|EAY77204.1|  hypothetical protein OsI_05173                          290   1e-90    
ref|XP_006292288.1|  hypothetical protein CARUB_v10018497mg             290   1e-90    
ref|XP_008240767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    290   1e-90    
ref|NP_001045385.1|  Os01g0946600                                       289   1e-90    
pdb|2CYG|A  Chain A, Crystal Structure At 1.45- Resolution Of The...    289   1e-90    
gb|EYU45078.1|  hypothetical protein MIMGU_mgv1a009249mg                290   1e-90    
ref|XP_002513812.1|  Lichenase precursor, putative                      290   2e-90    
ref|XP_007203676.1|  hypothetical protein PRUPE_ppa026579mg             289   2e-90    
ref|XP_008392341.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    289   3e-90    
gb|AAY34778.2|  beta-1,3-glucanase                                      286   3e-90    
sp|P23546.1|E13E_TOBAC  RecName: Full=Glucan endo-1,3-beta-glucos...    290   3e-90    
sp|P52408.1|E13B_PRUPE  RecName: Full=Glucan endo-1,3-beta-glucos...    290   3e-90    
ref|XP_010056683.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    289   4e-90    
gb|AAA63541.1|  basic beta-1,3-glucanase                                290   4e-90    
ref|XP_007203263.1|  hypothetical protein PRUPE_ppa025430mg             289   5e-90    
ref|XP_004303831.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    289   6e-90    
ref|XP_002456922.1|  hypothetical protein SORBIDRAFT_03g045630          288   6e-90    
ref|XP_009414358.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    288   7e-90    
ref|XP_003632274.2|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    288   7e-90    
emb|CAA03908.1|  beta-1,3-glucanase                                     288   7e-90    
dbj|BAJ33717.1|  unnamed protein product                                288   1e-89    
ref|XP_006351289.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    288   1e-89    
prf||1410344A  glucan endoglucosidase                                   288   1e-89 
ref|XP_007202324.1|  hypothetical protein PRUPE_ppa008126mg             288   1e-89    
gb|AAD10380.1|  beta-1,3-glucanase precursor                            288   1e-89    
gb|KDO39186.1|  hypothetical protein CISIN_1g018955mg                   288   1e-89    
ref|XP_009795195.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    288   1e-89    
gb|AAD10382.1|  beta-1,3-glucanase precursor                            287   1e-89    
ref|NP_001105734.1|  glucan endo-1,3-beta-glucosidase, acidic iso...    287   1e-89    
ref|XP_006421182.1|  hypothetical protein CICLE_v10005195mg             288   1e-89    
ref|XP_002459077.1|  hypothetical protein SORBIDRAFT_03g045490          287   2e-89    
ref|XP_006421176.1|  hypothetical protein CICLE_v10005181mg             288   2e-89    
gb|KDO39187.1|  hypothetical protein CISIN_1g018955mg                   287   2e-89    
gb|EMS67695.1|  Glucan endo-1,3-beta-glucosidase GIII                   287   2e-89    
ref|XP_006409034.1|  hypothetical protein EUTSA_v10003126mg             288   2e-89    
gb|EAY77194.1|  hypothetical protein OsI_05163                          286   2e-89    
ref|XP_006396056.1|  hypothetical protein EUTSA_v10007971mg             288   2e-89    
ref|XP_010673701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    286   2e-89    
gb|ABK23947.1|  unknown                                                 287   2e-89    
gb|AAD28734.1|AF112967_1  beta-1,3-glucanase precursor                  286   3e-89    
ref|NP_001045386.1|  Os01g0946700                                       286   3e-89    
ref|XP_006645312.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    295   5e-89    
gb|ABM74067.1|  beta-1,3-glucanase 1                                    286   5e-89    
gb|AHE76177.1|  beta-1,3-endoglucanase                                  285   5e-89    
ref|XP_010279592.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    286   5e-89    
emb|CAA77085.1|  glucan endo-1,3-beta-D-glucosidase                     286   6e-89    
gb|AIT56228.1|  beta-1,3 glucanase 3                                    285   8e-89    
ref|XP_009349227.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    285   9e-89    
emb|CDP14182.1|  unnamed protein product                                287   1e-88    
gb|AAC14399.1|  beta-1,3-glucanase 2                                    285   1e-88    
gb|EMT32042.1|  Glucan endo-1,3-beta-glucosidase GII                    285   1e-88    
ref|XP_009363234.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    285   1e-88    
gb|AAA32939.1|  (1-3)-beta-glucanase                                    285   2e-88    
ref|XP_006491503.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    285   2e-88    
gb|AAL40191.1|AF337174_1  endo-1,3-beta-glucanase                       284   2e-88    
emb|CAN71821.1|  hypothetical protein VITISV_027077                     285   2e-88    
dbj|BAF95876.1|  beta 1-3 glucanase                                     285   2e-88    
sp|P15737.1|E13B_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...    284   2e-88    
ref|XP_010036311.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    284   2e-88    
ref|XP_010056661.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    285   3e-88    
ref|XP_010921895.1|  PREDICTED: lichenase-2-like                        284   3e-88    
ref|XP_008245642.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   5e-88    
emb|CBH32608.1|  glucan endo-1,3-beta-glucosidase GII precursor,p...    283   5e-88    
ref|XP_008244290.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   6e-88    
gb|AAM75342.1|AF515785_1  beta-1,3-glucanase II                         283   7e-88    
ref|XP_008245692.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   7e-88    
dbj|BAK00288.1|  predicted protein                                      282   8e-88    
ref|NP_001268153.1|  beta 1-3 glucanase precursor                       283   9e-88    
emb|CDP20081.1|  unnamed protein product                                281   1e-87    
ref|XP_006491502.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    283   1e-87    
ref|XP_003565051.2|  PREDICTED: uncharacterized protein LOC100827257    293   1e-87    
gb|AHE76175.1|  beta-1,3-endoglucanase                                  281   1e-87    
ref|XP_004516619.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    282   2e-87    
ref|XP_009383245.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    282   2e-87    
ref|XP_008354184.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    283   2e-87    
ref|XP_004173972.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   2e-87    
sp|P52402.1|E133_SOLTU  RecName: Full=Glucan endo-1,3-beta-glucos...    281   2e-87    
emb|CAN66737.1|  hypothetical protein VITISV_024188                     281   3e-87    
ref|XP_004516618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    283   3e-87    
ref|XP_002277173.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    282   3e-87    
ref|XP_004135753.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    282   3e-87    
ref|XP_009611391.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   3e-87    
ref|XP_010036312.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   3e-87    
ref|XP_009336584.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   4e-87    
emb|CAJ58507.1|  glucan endo-1,3-beta-D-glucosidase                     281   4e-87    
gb|KDO43948.1|  hypothetical protein CISIN_1g018966mg                   281   4e-87    
gb|EAY77205.1|  hypothetical protein OsI_05174                          281   4e-87    
ref|XP_008375107.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    282   4e-87    
ref|XP_010232796.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    281   5e-87    
gb|ABC69706.1|  beta-1,3-glucanase                                      281   5e-87    
gb|AHE76176.1|  beta-1,3-endoglucanase                                  280   5e-87    
ref|XP_009348395.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   6e-87    
emb|CDP09618.1|  unnamed protein product                                280   6e-87    
ref|XP_009336583.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    281   6e-87    
ref|XP_009383246.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    280   8e-87    
ref|XP_010907251.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    280   8e-87    
ref|XP_009597885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    280   9e-87    
gb|AAP33176.1|  1,3-beta glucanase                                      280   1e-86    
emb|CAA38324.1|  glucan endo-1,3-beta-glucosidase                       280   1e-86    
gb|ACD45061.1|  beta-1,3-glucanase                                      280   1e-86    
ref|XP_009767610.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    280   1e-86    
ref|XP_010525511.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    280   1e-86    
ref|NP_191285.1|  beta 1,3-glucanase 2                                  280   2e-86    
gb|KDP26100.1|  hypothetical protein JCGZ_21133                         280   2e-86    
sp|Q02438.2|E13E_HORVU  RecName: Full=Glucan endo-1,3-beta-glucos...    278   2e-86    
ref|XP_010232797.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    279   2e-86    
ref|XP_007221161.1|  hypothetical protein PRUPE_ppa020503mg             279   2e-86    
gb|AAB86541.1|  glucanase                                               279   2e-86    
ref|XP_008240765.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    279   3e-86    
emb|CBH32609.1|  glucan endo-1,3-beta-glucosidase GII precursor,p...    279   3e-86    
ref|XP_008234119.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    280   4e-86    
ref|XP_004971233.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    278   4e-86    
pdb|1GHS|A  Chain A, The Three-Dimensional Structures Of Two Plan...    277   5e-86    
ref|XP_010525512.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        278   5e-86    
ref|XP_002442416.1|  hypothetical protein SORBIDRAFT_08g019670          278   7e-86    
ref|NP_001045359.1|  Os01g0941400                                       278   7e-86    
gb|ABU40624.1|  beta-1,3-glucananse                                     278   8e-86    
gb|KEH41572.1|  glycoside hydrolase family 17 protein                   280   9e-86    
prf||1607157A  endo-1,3-beta-glucanase                                  276   9e-86 
ref|XP_009587264.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    277   1e-85    
ref|XP_002878139.1|  beta-1,3-glucanase 3                               277   1e-85    
ref|XP_009349083.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    278   1e-85    
gb|AAY40462.1|  beta-1,3-glucanase class III                            277   1e-85    
ref|XP_006421178.1|  hypothetical protein CICLE_v10005316mg             278   1e-85    
ref|XP_010279588.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   1e-85    
ref|XP_010056673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    277   1e-85    
gb|ABQ45848.1|  beta-1,3-glucanase                                      277   1e-85    
ref|XP_007139000.1|  hypothetical protein PHAVU_009G256400g             278   1e-85    
gb|AAA34082.1|  prepro-beta-1,3-glucanase precursor                     276   2e-85    
ref|XP_010277204.1|  PREDICTED: putative glucan endo-1,3-beta-glu...    277   2e-85    
gb|ABK58141.1|  beta-1,3-glucanase                                      276   2e-85    
ref|XP_009760305.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   2e-85    
ref|XP_010090226.1|  Glucan endo-1,3-beta-glucosidase, basic isoform    275   2e-85    
ref|XP_010279589.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    277   2e-85    
ref|XP_009626317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   3e-85    
ref|XP_008459107.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   3e-85    
emb|CDM86338.1|  unnamed protein product                                276   3e-85    
gb|AAM63339.1|  beta-1,3-glucanase 2 (BG2) (PR-2)                       276   3e-85    
emb|CAJ58513.1|  glucan endo-1,3-beta-D-glucosidase precursor           275   3e-85    
ref|XP_009116429.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    276   4e-85    
ref|XP_002441397.1|  hypothetical protein SORBIDRAFT_09g025890          276   5e-85    
ref|XP_006644609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   6e-85    
ref|XP_007139001.1|  hypothetical protein PHAVU_009G256400g             276   7e-85    
ref|XP_006645325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    275   8e-85    
ref|XP_006491500.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    276   8e-85    
emb|CAJ58514.1|  glucan endo-1,3-beta-D-glucosidase precursor           274   9e-85    
ref|XP_010673694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    275   9e-85    
gb|EMS47932.1|  Glucan endo-1,3-beta-glucosidase GII                    275   9e-85    
ref|XP_003594774.1|  Glucan endo-1,3-beta-glucosidase                   276   9e-85    
gb|ABD32327.1|  Glycoside hydrolase, family 17                          276   1e-84    
ref|XP_010653914.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   1e-84    
ref|XP_008375719.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    275   1e-84    
emb|CAJ58509.1|  glucan endo-1,3-beta-D-glucosidase                     275   1e-84    
gb|ABK25991.1|  unknown                                                 275   1e-84    
ref|XP_006421179.1|  hypothetical protein CICLE_v10007126mg             275   1e-84    
ref|XP_009348394.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   1e-84    
ref|XP_006597705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   1e-84    
ref|XP_009348393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   2e-84    
dbj|BAJ94423.1|  predicted protein                                      273   2e-84    
emb|CDM86358.1|  unnamed protein product                                273   2e-84    
ref|XP_002878140.1|  beta-1,3-glucanase 2                               274   2e-84    
ref|XP_010653912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase,...    275   2e-84    



>sp|P23547.1|E13G_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GI9; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
AltName: Full=PR-2B; AltName: Full=PR-36; Flags: Precursor 
[Nicotiana tabacum]
 gb|AAA63542.1| acidic beta-1,3-glucanase [Nicotiana tabacum]
Length=343

 Score =   409 bits (1051),  Expect = 7e-137, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 241/316 (76%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK+ NNLPS+ D INL  +NGIR +R+Y  D  VFNA RGSN+ +I+DV    
Sbjct  30    QSIGVCYGKHANNLPSDQDVINLYNANGIRKMRIYNPDTNVFNALRGSNIEIILDVPLQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             LQ LTDP+RA  WVQ NI+ +   V FKYIAVGNEV  GN    +Y  FV PA++NV+NA
Sbjct  90    LQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPGN--NGQYAPFVAPAMQNVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAAAGLQ +IK +TATYS +L NTYPP   +FR +    +NP++QFL Q   PLLAN+YP
Sbjct  148   LAAAGLQDQIKVSTATYSGILANTYPPKDSIFRGEFNSFINPIIQFLVQHNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALFT++  NPAGY+NLFDALLDSMY AV+KAGG NV I+VSE+GW
Sbjct  208   YFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFAVEKAGGQNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYY NLI+HVK  AGTP KPG++IETYLFAM+DEN K GD  EK+F
Sbjct  268   PSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGKAIETYLFAMFDENNKEGDITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>ref|XP_009775775.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9 
[Nicotiana sylvestris]
Length=343

 Score =   407 bits (1046),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 198/316 (63%), Positives = 240/316 (76%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK+ NNLPS+ D INL  +NGIR +R+Y  D  VFNA RGSN+ +I+DV    
Sbjct  30    QSIGVCYGKHANNLPSDQDVINLYNANGIRKMRIYNPDTNVFNALRGSNIEIILDVPLQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             LQ LTDP+RA  WVQ NI+ +   V FKYIAVGNEV  GN    +Y  FV PA++NV+NA
Sbjct  90    LQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPGN--NGQYAPFVAPAMQNVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAAAGLQ +IK +TATYS +L NTYPP   +FR +    +NP++QFL Q   PLLAN+YP
Sbjct  148   LAAAGLQDQIKVSTATYSGILANTYPPKDSIFRGEFNSFINPIIQFLVQHNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALFT++  NPAGY+NLFDALLDSMY AV+KAGG NV I+VSE+GW
Sbjct  208   YFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFAVEKAGGQNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYY NLI+HVK  AGTP KPG +IETYLFAM+DEN K GD  EK+F
Sbjct  268   PSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGNAIETYLFAMFDENNKEGDITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>gb|AAA34103.1| PR2 [Nicotiana tabacum]
Length=343

 Score =   404 bits (1038),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 197/316 (62%), Positives = 239/316 (76%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK+ NNLPS+ D INL  +NGIR +R+Y  D  VFNA RGSN+ +I+DV    
Sbjct  30    QSIGVCYGKHANNLPSDQDVINLYDANGIRKMRIYNPDTNVFNALRGSNIEIILDVPLQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             LQ LTDP+RA  WVQ NI+ +   V FKYIAVGNEV  GN    +Y  FV PA++NV+NA
Sbjct  90    LQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPGN--NGQYAPFVAPAMQNVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAAAGLQ +IK +TATYS +L NT PP   +FR +    +NP++QFL Q   PLLAN+YP
Sbjct  148   LAAAGLQDQIKVSTATYSGILANTNPPKDSIFRGEFNSFINPIIQFLVQHNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALFT++  NPAGY+NLFDALLDSMY AV+KAGG NV I+VSE+GW
Sbjct  208   YFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFAVEKAGGQNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYY NLI+HVK  AGTP KPG +IETYLFAM+DEN K GD  EK+F
Sbjct  268   PSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGNAIETYLFAMFDENNKEGDITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>ref|XP_009619948.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9 
[Nicotiana tomentosiformis]
Length=343

 Score =   403 bits (1035),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 195/316 (62%), Positives = 242/316 (77%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK  NNLPS+ D INL  +NGI+ +R+Y  +  VFNA +GSN+ +I+DV N  
Sbjct  30    QSIGVCYGKIANNLPSDQDVINLYNANGIKRMRIYYPETNVFNALKGSNIEIILDVPNQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ LTDP+RA  WVQ NI+ +   V FKYIAVGNEV   N    +Y  FV PA++NV+NA
Sbjct  90    LESLTDPSRANGWVQDNIINHFPDVKFKYIAVGNEVSPTN--NGQYAPFVGPAMQNVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAAAGLQ +IK +TATYS +L NTYPP   +FR +    +NP++QFLA+   PLLAN+YP
Sbjct  148   LAAAGLQDQIKVSTATYSGLLANTYPPKDSIFRGEFNSFINPIIQFLARNNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALFT++  NPAGY+NLFDALLDSMY AV+KAGGPNV I+VSE+GW
Sbjct  208   YFGHIYNTADVPLSYALFTQQEANPAGYQNLFDALLDSMYFAVEKAGGPNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYYRNLI HVK  AGTP KPG++IETYLFAM+DEN K G+  EK+F
Sbjct  268   PSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKTIETYLFAMFDENDKKGEITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>ref|XP_009780913.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Nicotiana sylvestris]
Length=343

 Score =   400 bits (1028),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 193/316 (61%), Positives = 240/316 (76%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK  NNLPS+ D I L  +NGIR +R+Y  D  VFNA +GSN+ +I+DV N  
Sbjct  30    QSIGVCYGKIANNLPSDQDVIKLYNANGIRRMRIYYPDTNVFNALKGSNIEIILDVPNQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ LTDP+RA  WVQ NI+ +   V FKYI+VGNEV   N    +Y  FV PA++NV+NA
Sbjct  90    LESLTDPSRANGWVQDNIINHFPDVKFKYISVGNEVSPTN--NGQYAPFVAPAMQNVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAAAGL+ +IK +TATYS +L NTYPP   +FR +    +NP++QFL +   PLLAN+YP
Sbjct  148   LAAAGLKDQIKVSTATYSGILANTYPPKDSIFRGEFNSFINPIIQFLVRHNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALFT++  N AGY+NLFDALLDSMY AV+KAGG NV I+VSE+GW
Sbjct  208   YFGHIFNTADVPLSYALFTQQGTNSAGYQNLFDALLDSMYFAVEKAGGQNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYYRNLI+HVK  AGTP KPG++IETYLFAM+DEN KGGD  EK+F
Sbjct  268   PSEGNSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYLFAMFDENNKGGDITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>sp|P52399.1|E13L_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GL153; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAD33881.1|AF141654_1 beta-1,3-glucanase [Nicotiana tabacum]
 gb|AAA34079.1| GL153 [Nicotiana tabacum]
Length=356

 Score =   397 bits (1021),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 191/316 (60%), Positives = 237/316 (75%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK  NNLPSE D INL K+NGIR +R+Y  D  +F A +GSN+ +I+DV N  
Sbjct  30    QSIGVCYGKIANNLPSEQDVINLYKANGIRKMRIYYPDKNIFKALKGSNIEIILDVPNQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ L + + A  WVQ NI  +   V FKYI++GNEV   N    +Y  F++ A+ NV+NA
Sbjct  90    LEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPIN--NGQYSQFLLHAMENVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAA+GLQ KIK TTATYS +L NTYPP   +FR +    +NP++QFLAQ   PLLAN+YP
Sbjct  148   LAASGLQDKIKVTTATYSGLLANTYPPKASIFRGEFNSFINPIIQFLAQNNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALFT+R  N AGY+NLFDA+LDSMY AV+KAGGPNV I+VSE+GW
Sbjct  208   YFVHISNTADVPLSYALFTQRGKNSAGYQNLFDAILDSMYFAVEKAGGPNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYYRNLI HVK  AGTP KPG+SIETYLFAM+DEN+K G+  EK+F
Sbjct  268   PSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKSIETYLFAMFDENVKKGEITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>ref|XP_009770429.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=335

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 190/320 (59%), Positives = 236/320 (74%), Gaps = 1/320 (0%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             I  V+SIGVCYG+NGNNLPS  D INL K NGI  LR+Y  +P V NA RGSN+ +I+D+
Sbjct  15    ILGVQSIGVCYGRNGNNLPSPQDVINLYKDNGITNLRIYDPNPEVLNALRGSNVEIILDI  74

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  LQ LTDP  A  WV  NI+ Y  +V  KYIA GNEV  G P TA++  F++PA+ N
Sbjct  75    PNYNLQALTDPNAATNWVHTNIINYFPSVKIKYIAAGNEVSPGFPQTAQFAPFILPAMHN  134

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V  ALAA G+Q +IK +T  YS VLTNTYPP   +FRDD KG + P+VQFLAQ  +PLLA
Sbjct  135   VQRALAAYGVQNQIKVSTVMYSGVLTNTYPPWNAIFRDDLKGFIVPIVQFLAQNDSPLLA  194

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNP-AGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             NIYPYF+YRG+P+ + L YALFT+   +P +GY NLFDA+LD+ Y A++KA G N+ IVV
Sbjct  195   NIYPYFAYRGDPAHVALPYALFTQPGADPGSGYHNLFDAMLDAQYYALEKADGNNIEIVV  254

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             +E+GWPS GGF A+ +NA TYY NL +HVK   GTP KPG+ IETYLFAM+DENLK GD 
Sbjct  255   AESGWPSDGGFGASMENARTYYINLNNHVKLGGGTPHKPGKVIETYLFAMFDENLKEGDE  314

Query  307   VEKNFGVFRPDKSSKYQLNF  248
              EK++GVF P+K+ KY +NF
Sbjct  315   TEKHYGVFYPNKAKKYNINF  334



>ref|XP_009790797.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=340

 Score =   389 bits (1000),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 187/322 (58%), Positives = 233/322 (72%), Gaps = 1/322 (0%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I + + +GVCYG+NGNNLPS  D +NL K+NGI  +RVY   P   NA +GSN+++I+D
Sbjct  19    QIIDAQPLGVCYGRNGNNLPSSQDVVNLYKANGITNMRVYDPIPETLNALKGSNISIILD  78

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             +SN  LQ   TDP  A+ WV ANI  Y   V FKYI+VGNEV   N  T+++V FV+PAL
Sbjct  79    ISNDNLQSFSTDPKAAENWVIANIKSYFPQVKFKYISVGNEVSPKNVGTSQFVPFVLPAL  138

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             RNV  A+    +Q ++KATT   + +LTNTYPP + VF DD    +NP++ FL Q   PL
Sbjct  139   RNVQQAITKFRMQNQVKATTTIDTGLLTNTYPPAKSVFSDDVTSFINPIIGFLKQNNLPL  198

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             LANIYPY+ Y GNP Q+PL YALFT++ P+P GY NLFDA+LD+ Y AV+KAGG NV IV
Sbjct  199   LANIYPYYGYIGNPDQVPLPYALFTQKKPDPTGYHNLFDAMLDATYYAVEKAGGDNVQIV  258

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             V+E+GWPS GGF A+ +NA TYYRNLISHVK  AGTP KP ++IETYLFAM+DEN+K G 
Sbjct  259   VAESGWPSDGGFGASMKNAGTYYRNLISHVKLGAGTPHKPEKAIETYLFAMFDENIKIGA  318

Query  310   AVEKNFGVFRPDKSSKYQLNFN  245
               EK FGVF PDK+ KY L FN
Sbjct  319   ETEKYFGVFHPDKTQKYNLTFN  340



>ref|XP_009589771.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=335

 Score =   386 bits (991),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 185/320 (58%), Positives = 235/320 (73%), Gaps = 1/320 (0%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             I  V+SIGVCYG+NGNNLPS  D INL K NGI  LR+Y  +P V NA RGS++ +I+D+
Sbjct  15    ILGVQSIGVCYGRNGNNLPSPQDVINLYKDNGITNLRIYDPNPEVLNALRGSSIEIILDI  74

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  LQ L DP  A  WV  NI+ Y  +V  KYIAVGNEV  G P TA++  F++PA++N
Sbjct  75    PNYNLQALADPNAATNWVHTNIINYFPSVKIKYIAVGNEVSPGFPQTAQFAPFILPAMQN  134

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V  A+A  G+Q +IK +T  YS VL+NTYPP   VFRDD +G + P+VQFL   G+PLLA
Sbjct  135   VQRAVATYGVQNQIKVSTVMYSGVLSNTYPPWNAVFRDDLRGFIVPIVQFLTHNGSPLLA  194

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNP-AGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             NIYPYF+YRG+P+ + L YALFT+   +P +GY NLFDA+LD+ Y A++K GG N+ IVV
Sbjct  195   NIYPYFAYRGDPAHVALPYALFTQPGADPGSGYHNLFDAMLDAQYYALEKVGGNNIEIVV  254

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             +E+GWPS GGF A+ +NA TYY NL +HVK   GTP KPG+ IETYLFAM+DENLK GD 
Sbjct  255   AESGWPSDGGFGASMENAGTYYINLNNHVKSGGGTPHKPGKIIETYLFAMFDENLKEGDE  314

Query  307   VEKNFGVFRPDKSSKYQLNF  248
              EK++GVF P+K+ KY +NF
Sbjct  315   TEKHYGVFYPNKAKKYNINF  334



>sp|P23432.1|E13C_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA38302.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
 emb|CAA57255.1| (1-)-beta-glucanase [Nicotiana tabacum]
Length=351

 Score =   386 bits (992),  Expect = 7e-128, Method: Compositional matrix adjust.
 Identities = 184/314 (59%), Positives = 235/314 (75%), Gaps = 2/314 (1%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             +IGVCYGK  NNLPSE D INL K+NGIR +R+Y +D  +F +  GSN+ +I+DV N  L
Sbjct  35    NIGVCYGKIANNLPSEQDVINLYKANGIRKMRIYNSDTNIFKSLNGSNIEIILDVPNQDL  94

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             + L + + A  WVQ NI  +   V FKYI++GNEV   N    +Y  F++ A+ NV+NAL
Sbjct  95    EALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPSN--NGQYSQFLLHAMENVYNAL  152

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             AAAGLQ KIK TTATYS +L NTYPP   +FR++ K  +NP+++FLA+   PLLANIYPY
Sbjct  153   AAAGLQDKIKVTTATYSGLLANTYPPKDSIFREEFKSFINPIIEFLARNNLPLLANIYPY  212

Query  649   FSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWP  470
             F +  N   +PLSYALF ++  N  GY+NLFDALLDS+Y AV+KAGGPNV I+VSE+GWP
Sbjct  213   FGHIYNTVDVPLSYALFNQQGTNSTGYQNLFDALLDSIYFAVEKAGGPNVEIIVSESGWP  272

Query  469   SAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFG  290
             S G  AAT +NA TYYRNL++HVKG AGTP KPGR +ETYLFAM+DEN K G+  EK+FG
Sbjct  273   SEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGRIVETYLFAMFDENEKNGEVTEKHFG  332

Query  289   VFRPDKSSKYQLNF  248
             +F P++++KYQLNF
Sbjct  333   LFYPNRTAKYQLNF  346



>sp|P52398.1|E13K_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
GL161; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Flags: Precursor [Nicotiana tabacum]
 gb|AAA34053.1| beta-1,3-glucanase [Nicotiana tabacum]
Length=331

 Score =   385 bits (989),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 237/321 (74%), Gaps = 2/321 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I   +SIGVCYGK  NNLPS+ D INL  +NGIR LR+Y  D  +F A  GSN+ +I+ 
Sbjct  5     QIIGAQSIGVCYGKAANNLPSDQDVINLYNANGIRKLRIYYPDKNIFKALNGSNIEIILG  64

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L + + A  WVQ NI  +   V FKYI++GN+V   N D  +Y  F++ A++
Sbjct  65    VPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNKVSPTNND--QYSEFLLQAMK  122

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV+NALAAAGLQ  IK +T TYS VL NTYPP + +FR++ K  +NP++QFLA+   PLL
Sbjct  123   NVYNALAAAGLQDMIKVSTVTYSGVLANTYPPERSIFREEFKSFINPIIQFLARNNLPLL  182

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF +  N + + LSYALFT++  N AGY+NLFDA+LDSMY AV+KAGGPNV I+V
Sbjct  183   ANVYPYFVHVSNTADVSLSYALFTQQGTNSAGYQNLFDAILDSMYFAVEKAGGPNVEIIV  242

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  AAT +NA TYYRNLI+HVK  AGTP KPG++IETYLFAM+DEN K G+ 
Sbjct  243   SESGWPSEGSSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYLFAMFDENDKIGEI  302

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F PD+ +KYQLNFN
Sbjct  303   TEKHFGLFSPDQRAKYQLNFN  323



>gb|AAD33880.1|AF141653_1 beta-1,3-glucanase [Nicotiana tabacum]
Length=351

 Score =   386 bits (991),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 237/321 (74%), Gaps = 2/321 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I   +SIGVCYGK  NNLPS+ D INL  +NGIR LR+Y  D  +F A  GSN+ +I+ 
Sbjct  25    QIIGAQSIGVCYGKAANNLPSDQDVINLYNANGIRKLRIYYPDKNIFKALNGSNIEIILG  84

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L + + A  WVQ NI  +   V FKYI++GN+V   N D  +Y  F++ A++
Sbjct  85    VPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNKVSPTNND--QYSEFLLQAMK  142

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV+NALAAAGLQ  IK +T TYS VL NTYPP + +FR++ K  +NP++QFLA+   PLL
Sbjct  143   NVYNALAAAGLQDMIKVSTVTYSGVLANTYPPERSIFREEFKSFINPIIQFLARNNLPLL  202

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF +  N + + LSYALFT++  N AGY+NLFDA+LDSMY AV+KAGGPNV I+V
Sbjct  203   ANVYPYFVHVSNTADVSLSYALFTQQGTNSAGYQNLFDAILDSMYFAVEKAGGPNVEIIV  262

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  AAT +NA TYYRNLI+HVK  AGTP KPG++IETYLFAM+DEN K G+ 
Sbjct  263   SESGWPSEGSSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYLFAMFDENDKIGEI  322

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F PD+ +KYQLNFN
Sbjct  323   TEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009801409.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GL161 
[Nicotiana sylvestris]
Length=351

 Score =   385 bits (988),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 185/321 (58%), Positives = 237/321 (74%), Gaps = 2/321 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I   +SIGVCYGK  NNLPS+ D INL  +NGIR +R+Y  D  +F A  GSN+ +I+ 
Sbjct  25    QIIGAQSIGVCYGKAANNLPSDQDVINLYNANGIRKMRIYYPDKNIFKALNGSNIEIILG  84

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L + + A  WVQ NI  +   V FKYI++GN+V   N D  +Y  F++ A++
Sbjct  85    VPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNKVSPTNND--QYSEFLLQAMK  142

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV+NALAAAGLQ  IK +T TYS VL NTYPP + +FR++ K  +NP++QFLA+   PLL
Sbjct  143   NVYNALAAAGLQDMIKVSTVTYSGVLANTYPPERSIFREEFKSFINPIIQFLARNNLPLL  202

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF +  N + + LSYALFT++  N AGY+NLFDA+LDSMY AV+KAGGPNV I+V
Sbjct  203   ANVYPYFVHVSNTADVSLSYALFTQQGTNSAGYQNLFDAILDSMYFAVEKAGGPNVEIIV  262

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  AAT +NA TYYRNLI+HVK  AGTP KPG++IETYLFAM+DEN K G+ 
Sbjct  263   SESGWPSEGSSAATIENAQTYYRNLINHVKSGAGTPKKPGKTIETYLFAMFDENDKIGEI  322

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F PD+ +KYQLNFN
Sbjct  323   TEKHFGLFSPDQRAKYQLNFN  343



>ref|XP_009607576.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GL153 
[Nicotiana tomentosiformis]
Length=356

 Score =   385 bits (988),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 186/316 (59%), Positives = 232/316 (73%), Gaps = 2/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK  NNLPSE D INL K+NGI  +R+Y  D  +F A +GSN+ +I+DV N  
Sbjct  30    QSIGVCYGKIANNLPSEQDVINLYKANGITKMRIYYPDKNIFKALKGSNIEIILDVPNQD  89

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ L + + A  WVQ NI  +   V FKYI++GNEV   N    +Y  F++ A+ NV+NA
Sbjct  90    LEALANSSIASGWVQDNIRSHFPYVKFKYISIGNEVSPSN--NGQYSQFLLHAMENVYNA  147

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             LAA+GLQ KIK TTA YS +L NTYPP   +FR +    +NP++QFLA+   PLLAN+YP
Sbjct  148   LAASGLQDKIKVTTAIYSGLLANTYPPKASIFRGEFNSFINPIIQFLARNNLPLLANVYP  207

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             Y  +  N + + LSYALFT+R  N AGY+NLFDA+LDSMY AV+KAGGPNV I+VSE+GW
Sbjct  208   YLVHISNTAGVALSYALFTQRGKNSAGYQNLFDAILDSMYFAVEKAGGPNVEIIVSESGW  267

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYYRNLI HVK  AGTP KPG+SIETYLFAM+DEN K G+  EK+F
Sbjct  268   PSEGNSAATIENAQTYYRNLIDHVKRGAGTPKKPGKSIETYLFAMFDENDKKGEITEKHF  327

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+ +KYQLNFN
Sbjct  328   GLFSPDQRAKYQLNFN  343



>ref|XP_009796657.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana sylvestris]
Length=351

 Score =   384 bits (987),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 187/321 (58%), Positives = 238/321 (74%), Gaps = 3/321 (1%)
 Frame = -3

Query  1207  HITEVES-IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIV  1031
              IT  +S IGVCYG+  NNLPSE D INL K+NGIR +R+Y  D  +F A  GSN+ +I+
Sbjct  28    QITGAQSNIGVCYGEIANNLPSEQDVINLYKANGIRKMRIYYPDTNIFKALNGSNIEIIL  87

Query  1030  DVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             DV N  L+ L + + A  WVQ NI  +   V FKYI++GNEV   N    +Y  F++ A+
Sbjct  88    DVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPTN--NGQYSQFLLHAM  145

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             +NV+NALAAAGLQ KIK +TATYS +L NTYPP   +FR++ K  +NP+++FLA+   PL
Sbjct  146   KNVYNALAAAGLQDKIKVSTATYSGLLANTYPPKDSIFREELKSFINPIIEFLARNNLPL  205

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             LANIYPYF +  N   +PLSYALF ++  N  GY+NLFDALLDS+Y AV+KAGGPNV I+
Sbjct  206   LANIYPYFGHIYNTVDVPLSYALFNQQETNSTGYQNLFDALLDSIYFAVEKAGGPNVEII  265

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPS G  AAT +NA TYYRNL++HVKG AGTP KPGR IETYLFAM+DEN K G+
Sbjct  266   VSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGRIIETYLFAMFDENEKQGE  325

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
               EK+FG+F P++++KYQLNF
Sbjct  326   ITEKHFGLFYPNRAAKYQLNF  346



>sp|P23433.1|E13D_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Nicotiana 
tabacum]
 emb|CAA38303.1| glucan endo-1,3-beta-glucosidase [Nicotiana tabacum]
Length=351

 Score =   382 bits (982),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 186/321 (58%), Positives = 238/321 (74%), Gaps = 3/321 (1%)
 Frame = -3

Query  1207  HITEVES-IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIV  1031
              IT  +S IGVCYG+  NNLPSE D INL K+NGIR +R+Y  D  +F A  GSN+ +I+
Sbjct  28    QITGAQSNIGVCYGEIANNLPSEQDVINLYKANGIRKMRIYYPDTNIFKALNGSNIEIIL  87

Query  1030  DVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             +V N  L+ L + + A  WVQ NI  +   V FKYI++GNEV   N    +Y  F++ A+
Sbjct  88    EVPNQDLEALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPTN--NGQYSQFLLHAM  145

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             +NV+NALAAAGLQ KIK +TATYS +L NTYPP   +FR++ K  +NP+++FLA+   PL
Sbjct  146   KNVYNALAAAGLQDKIKVSTATYSGLLANTYPPKDSIFREELKSFINPIIEFLARNNLPL  205

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             LANIYPYF +  N   +PLSYALF ++  N  GY+NLFDALLDS+Y AV+KAGGPNV I+
Sbjct  206   LANIYPYFGHIYNTVDVPLSYALFNQQETNSTGYQNLFDALLDSIYFAVEKAGGPNVEII  265

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPS G  AAT +NA TYYRNL++HVKG AGTP KPGR IETYLFAM+DEN K G+
Sbjct  266   VSESGWPSEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGRIIETYLFAMFDENEKQGE  325

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
               EK+FG+F P++++KYQLNF
Sbjct  326   ITEKHFGLFYPNRAAKYQLNF  346



>ref|XP_009592823.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=345

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 181/322 (56%), Positives = 234/322 (73%), Gaps = 1/322 (0%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I + + +GVCYG+NGNNLPS  D +NL K+NGI  +RVY   P    A +GSN+++I+D
Sbjct  19    QIIDAQPVGVCYGRNGNNLPSAQDVVNLYKANGITNMRVYDPIPETLTALKGSNISIILD  78

Query  1027  VSNPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             +SN  LQ  + DP  A+ WV ANI  Y   V FKYI+VGNEV   N  T+++V FV+PAL
Sbjct  79    ISNDNLQPFSIDPKAAENWVIANIKSYFPQVKFKYISVGNEVSPKNVGTSQFVPFVLPAL  138

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             RNV  A+    +Q ++KATT   + +LTNTYPP++ VF DD    +NP++ FL Q   PL
Sbjct  139   RNVQQAITKFRMQNQVKATTTIDTGLLTNTYPPSKSVFSDDVTSFINPIIGFLKQNNLPL  198

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             LAN+YPY+ Y G+P ++PL YALFT++NP+  GY NLFDA+LD+ Y AV+KAGG NV IV
Sbjct  199   LANVYPYYGYIGDPGRVPLPYALFTQKNPDLTGYHNLFDAMLDATYYAVEKAGGDNVQIV  258

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             V+E+GWPS GGF A+ +NA TYYRNLISHVK  AGT  KPG++IETYLFAM+DEN+K G 
Sbjct  259   VAESGWPSDGGFGASMENAGTYYRNLISHVKLGAGTIHKPGKAIETYLFAMFDENIKIGA  318

Query  310   AVEKNFGVFRPDKSSKYQLNFN  245
               EK+FGVF PD + KY LNF+
Sbjct  319   ETEKHFGVFHPDNTQKYNLNFD  340



>ref|XP_009764461.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana sylvestris]
Length=335

 Score =   379 bits (973),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 183/320 (57%), Positives = 228/320 (71%), Gaps = 2/320 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I E + IGVCYG+NGNNLPS  D +NL K+NGI  +RVY        A +GSN+ +I+D
Sbjct  18    QIIEAQPIGVCYGRNGNNLPSAQDVVNLYKANGITNMRVYDPIAETLTALKGSNIEIILD  77

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTDP  A  WV ANIV Y+  V FKYI VGNE+   N  T+++  F++PAL+
Sbjct  78    IPNDNLQALTDPNAATNWVNANIVAYSPDVKFKYINVGNEISPANSATSKFAPFLLPALQ  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV  A+    LQ  +K +TA  + +LTNTYPP+Q VFRDD    +NP++ FL Q   P+L
Sbjct  138   NVQQAITKFQLQ--VKVSTAIETGILTNTYPPSQSVFRDDISSFINPLIGFLKQNNLPVL  195

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF Y G+P+ +PL YALFT++NP+P+GYRNLFDA+LD+ Y AV+KAGG N+PIVV
Sbjct  196   ANIYPYFGYLGDPAHVPLPYALFTQQNPDPSGYRNLFDAMLDATYYAVEKAGGENLPIVV  255

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  A+  NA  YY NLISHVK  AGTP KPG  IE YLFAM+DEN+K G  
Sbjct  256   SESGWPSDGGDGASIDNAGIYYTNLISHVKSGAGTPHKPGTPIEIYLFAMFDENIKIGAE  315

Query  307   VEKNFGVFRPDKSSKYQLNF  248
              EK FGVF PDK+ KY L+F
Sbjct  316   TEKYFGVFHPDKTPKYNLSF  335



>ref|XP_009587943.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Nicotiana tomentosiformis]
Length=340

 Score =   379 bits (972),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 182/320 (57%), Positives = 229/320 (72%), Gaps = 2/320 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I E + IGVCYG+NGNNLPS  D +NL K+NGI  +RVY        A +GSN+ +I+D
Sbjct  19    QIIEAQPIGVCYGRNGNNLPSAQDVVNLYKANGITNMRVYDPIAETLTALKGSNIEIILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTDP  A  WV ANIV Y+  V FKYI VGNEV   N  T+++  F++PAL+
Sbjct  79    IPNDNLQALTDPNAATNWVNANIVAYSPDVKFKYINVGNEVSPANVATSKFAPFLIPALQ  138

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV  A+    LQ  +K +TA  + +L NTYPP+Q VF DD    +NP++ FL Q   P+L
Sbjct  139   NVQQAITKFQLQ--VKVSTAIETGILRNTYPPSQSVFSDDISSFINPLIGFLKQNNLPVL  196

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF Y G+P+ +PL YALFT++NP+P+GY NLFDA+LD+ Y AV+KAGG N+PIV+
Sbjct  197   ANIYPYFGYLGDPAHVPLPYALFTQQNPDPSGYHNLFDAMLDATYYAVEKAGGENLPIVI  256

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  A+  NA TYY NLISHVK  AGTP KPG +IETYLFA++DEN+K G  
Sbjct  257   SESGWPSDGGDGASIDNAGTYYSNLISHVKSGAGTPHKPGTAIETYLFAIFDENIKIGAE  316

Query  307   VEKNFGVFRPDKSSKYQLNF  248
              EK+FGVF PDK+ KY LNF
Sbjct  317   TEKHFGVFHPDKTPKYNLNF  336



>ref|XP_009596559.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=351

 Score =   379 bits (972),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 233/314 (74%), Gaps = 2/314 (1%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             +IGVCYGK  NNLPSE D INL K+NGIR +R+Y +D  +F +  GSN+ +I+DV N  L
Sbjct  35    NIGVCYGKIANNLPSEQDVINLYKANGIRKMRIYNSDTNIFKSLNGSNIEIILDVPNQDL  94

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             + L + + A  WVQ NI  +   V FKYI++GNEV   N    +Y  F++ A+ N++NAL
Sbjct  95    EALANSSIANGWVQDNIRSHFPYVKFKYISIGNEVSPSN--NGQYSQFLLHAMENIYNAL  152

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             AA+GLQ KIK +TA YS +L NTYPP   +FR++ K  +NP+++FLA+   PLLANIYPY
Sbjct  153   AASGLQDKIKVSTAIYSGLLANTYPPKDSIFREEIKSFINPIIEFLARNNLPLLANIYPY  212

Query  649   FSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWP  470
             F +  N   +PLSYALF ++  N  GY+NLFDALLDS+Y AV+KAGGPNV I+VSE+GWP
Sbjct  213   FGHIYNTVDVPLSYALFNQQGTNSTGYQNLFDALLDSIYFAVEKAGGPNVEIIVSESGWP  272

Query  469   SAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFG  290
             S G  AAT +NA TYYRNL++HVKG AGTP KPG  +ETYLFAM+DEN K G+  EK+FG
Sbjct  273   SEGNSAATIENAQTYYRNLVNHVKGGAGTPKKPGIIVETYLFAMFDENEKNGEVTEKHFG  332

Query  289   VFRPDKSSKYQLNF  248
             +F P++++KYQLNF
Sbjct  333   LFYPNRTAKYQLNF  346



>ref|XP_006365629.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=348

 Score =   376 bits (966),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 181/314 (58%), Positives = 232/314 (74%), Gaps = 5/314 (2%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             +IGVCYGK  NNLPS+ D INL K+NGIR +R+Y  D  VFNA +GS++ +I+DV N  L
Sbjct  35    NIGVCYGKIANNLPSDQDVINLYKANGIRKMRIYYPDTNVFNALKGSSIEIILDVPNQDL  94

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             + LT+P+ A  WVQ NI  +   V FKYI++GNEV  G     ++  FV+P ++NV+NAL
Sbjct  95    EALTNPSNANGWVQDNIKNHFPDVKFKYISIGNEVSNG-----QFSQFVLPVMKNVYNAL  149

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             +AAGLQ KIK +TATYS +L NTYPP    FR++ KG +NP+++FLA+   P+LANIYPY
Sbjct  150   SAAGLQDKIKVSTATYSGLLANTYPPKDSTFREEFKGFINPIIEFLARNNLPILANIYPY  209

Query  649   FSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWP  470
             F +  N   IPLSYALF ++  N  GY+NLFDALLDS Y A++KAGGPNV IVVSETGWP
Sbjct  210   FGHIYNMVDIPLSYALFNQQGENSIGYQNLFDALLDSTYFAIEKAGGPNVEIVVSETGWP  269

Query  469   SAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFG  290
             S G  +AT +NA  YYRNL++HVK   GTP KPGR IETYLFAM+DEN K G+  E +FG
Sbjct  270   SNGHPSATLENAQIYYRNLVNHVKSGVGTPKKPGRIIETYLFAMFDENQKQGEVTENHFG  329

Query  289   VFRPDKSSKYQLNF  248
             +F P++++KY L F
Sbjct  330   LFYPNQTAKYDLKF  343



>ref|XP_006367558.1| PREDICTED: glucan endo-1,3-beta-glucosidase A-like [Solanum tuberosum]
Length=352

 Score =   375 bits (962),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 186/334 (56%), Positives = 238/334 (71%), Gaps = 13/334 (4%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              +T  +SIGVCYGK  NNLPS+ D  NL  SNGI+ +R+Y  D  VFNA +GS++ +I+D
Sbjct  19    QMTGAQSIGVCYGKIANNLPSDQDVKNLYNSNGIKKMRIYYPDTNVFNALKGSDIEIILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEV--------FAGN---PDT-  884
             V N  L+ L +P+ A  WVQ NI+     V FKYIAVGNEV          GN   PDT 
Sbjct  79    VPNQDLEALANPSSANGWVQDNIISNFPDVKFKYIAVGNEVDPVKFKYIAVGNEIDPDTN  138

Query  883   -ARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNP  707
               +Y  +V PA+ NV+NAL +AGLQ +I  +TATY  +LTNTYPP+  +FR++ K  +NP
Sbjct  139   TGQYTQYVGPAMENVYNALTSAGLQDQINVSTATYLGLLTNTYPPSDSIFREEYKSFINP  198

Query  706   VVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAA  527
             +++FLA+   PLLANIYPYF +  N + +PLSYALF ++  N AGY+NLFDALLDSMY A
Sbjct  199   IIEFLARNNLPLLANIYPYFGHIDNTNDVPLSYALFNDQGTNSAGYQNLFDALLDSMYFA  258

Query  526   VQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYL  347
              +K GG N+ I+VSE+GWPS G  A T +NA TYY NLI+HVKG  GTP KPGR+IETYL
Sbjct  259   TEKLGGQNIEIIVSESGWPSEGHPAITLENAQTYYTNLINHVKGGVGTPKKPGRAIETYL  318

Query  346   FAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             FAM+DEN K G + E++FG+F PD+ +KYQLNFN
Sbjct  319   FAMFDENQKDGQSSEQHFGLFYPDQRAKYQLNFN  352



>emb|CAE53273.1| 1,3-beta-glucan glucanohydrolase [Solanum tuberosum]
Length=338

 Score =   373 bits (957),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 182/321 (57%), Positives = 232/321 (72%), Gaps = 1/321 (0%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +SIGVCYGK  NNLP + D I L  +N I+ +R+Y  D  VFNA +GSN+ +I+D
Sbjct  19    QITGAQSIGVCYGKIANNLPLDQDVIKLYNANNIKKMRIYYPDTNVFNALKGSNIEIILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G  D+ +Y  FV P + 
Sbjct  79    VPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-DSGKYARFVGPTME  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NAL++AGLQ +IK +TATYS +LTNTYPP   +FR++ K  +NP++ FLA+   PLL
Sbjct  138   NIYNALSSAGLQNQIKVSTATYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLL  197

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF +  N + +PLSYALF ++  N AGY+NLFDALLDSMY A++K G  N+ I+V
Sbjct  198   ANIYPYFGHTDNTNDVPLSYALFNQQGTNSAGYQNLFDALLDSMYFAMEKLGAQNIEIIV  257

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  AAT +NA TYY NLI+HVKG    P  PGR+IETYLFAM+DEN K G+ 
Sbjct  258   SESGWPSVGHPAATLENARTYYTNLINHVKGGVEPPKNPGRTIETYLFAMFDENQKDGNP  317

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E++FG+F PDK SKYQLNFN
Sbjct  318   SEQHFGLFYPDKRSKYQLNFN  338



>ref|XP_004228512.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=348

 Score =   372 bits (956),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/314 (57%), Positives = 231/314 (74%), Gaps = 5/314 (2%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             +IGVCYGK  NNLPS+ D INL K+NGIR +R+Y  D  VFNA +GSN+ +I+DV N  L
Sbjct  35    NIGVCYGKIANNLPSDQDVINLYKANGIRKMRIYYPDTNVFNALKGSNIEIILDVPNQDL  94

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             + LT P+ A  WVQ NI  +   V FKYI++GNEV  G     +   FV+P ++N++N L
Sbjct  95    EALTFPSNANNWVQDNIKNHFPDVKFKYISIGNEVSNG-----QISKFVLPVMKNIYNEL  149

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             +AAGLQ KIK +TATYS +L NTYPP   +FR++ KG +NP+++FLA+   P+LANIYPY
Sbjct  150   SAAGLQDKIKVSTATYSGLLANTYPPKDSIFREEFKGFINPIIEFLARNNLPILANIYPY  209

Query  649   FSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWP  470
             F +  N   I LSYALF +++ N  GY+NLFDALLDS+Y A++KAGGPNV IVVSETGWP
Sbjct  210   FGHIYNMVDISLSYALFNQQDENSIGYQNLFDALLDSIYFALEKAGGPNVEIVVSETGWP  269

Query  469   SAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFG  290
             S G  +AT +NA  YYRNL++HVK   GTP KPGR IETYLFAM+DEN K G+  E +FG
Sbjct  270   SKGHPSATLENAQIYYRNLVNHVKSGVGTPKKPGRIIETYLFAMFDENQKQGEVTENHFG  329

Query  289   VFRPDKSSKYQLNF  248
             +F P++++KY L F
Sbjct  330   LFYPNQTAKYDLKF  343



>emb|CAE52322.1| 1,3-beta-D-glucan glucanohydrolase precursor [Solanum tuberosum]
Length=338

 Score =   372 bits (954),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 234/321 (73%), Gaps = 1/321 (0%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  + IGVCYGK  NNLPS+ D I L  +N I+ +R+Y     VFNA +GSN+ +I+D
Sbjct  19    QITGAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G  ++ +Y  FV PA+ 
Sbjct  79    VPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-ESGKYARFVGPAME  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NAL++AGLQ +IK +T+TYS +LTNTYPP   +FR++ K  +NP++ FLA+   PLL
Sbjct  138   NIYNALSSAGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLL  197

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF +  N + +PLSYALF ++  N  GY+NLFDAL+DSMY A +K GG N+ I+V
Sbjct  198   ANIYPYFGHIDNTNAVPLSYALFNQQRRNDTGYQNLFDALVDSMYFATEKLGGQNIEIIV  257

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  AAT +NA TYY NLI+HVK  AGTP KPG++IETYLFAM+DEN K G+A
Sbjct  258   SESGWPSEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKKGEA  317

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F PD+  KYQLNFN
Sbjct  318   SEKHFGLFNPDQRPKYQLNFN  338



>ref|XP_007211511.1| hypothetical protein PRUPE_ppa007999mg [Prunus persica]
 gb|EMJ12710.1| hypothetical protein PRUPE_ppa007999mg [Prunus persica]
Length=349

 Score =   370 bits (950),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/323 (55%), Positives = 234/323 (72%), Gaps = 7/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLPSE+D + L KSNGI  +R+Y  + P + A +GSN+ + V 
Sbjct  30    QITGAQSVGVCYGRNGNNLPSESDVVGLYKSNGIGRMRIYEPNDPTYQALKGSNIELTVT  89

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             +   +LQ LTD A A  WVQ N+  Y+  V FKYIAVGNEV   +P+T     +++PA++
Sbjct  90    ILKSQLQGLTDAAAATDWVQKNVQAYSPDVKFKYIAVGNEVRPTDPET----QYLLPAIQ  145

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+HNA+ AA LQG+IK +TA  + ++ N YPP+ G + D AK  + PV+ FLA  G PLL
Sbjct  146   NIHNAIVAANLQGQIKVSTAIDTTLVDNAYPPSAGKYSDAAKSFITPVINFLASNGAPLL  205

Query  667   ANIYPYFSYRGNPSQIPLSYALFTER---NPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPY SY  NPSQI ++YALFT +    P+   Y+NLFDALLD+ Y+A++KA  PNV 
Sbjct  206   VNVYPYVSYTENPSQIDIAYALFTSQGITTPDGVKYQNLFDALLDAQYSALEKANAPNVE  265

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS G  AATTQNA T+Y+NLI+HVKG  GTP +PG++IETYLFAM+DEN+K 
Sbjct  266   IVVSESGWPSEGSDAATTQNAQTFYQNLINHVKGTTGTPKRPGKAIETYLFAMFDENIKD  325

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G  VE++FG+F P+K  KYQL F
Sbjct  326   GAEVERHFGLFSPNKQPKYQLTF  348



>gb|AAN78309.1| acidic class II 1,3-beta-glucanase precursor [Solanum tuberosum]
Length=337

 Score =   370 bits (949),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 234/321 (73%), Gaps = 1/321 (0%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  + IGVCYGK  NNLPS+ D I L  +N I+ +R+Y     VFNA +GSN+ +I+D
Sbjct  18    QITGAQPIGVCYGKIANNLPSDQDAIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILD  77

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G  ++ +Y  FV PA+ 
Sbjct  78    VPNQDLESLANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-ESGKYARFVGPAME  136

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NAL++ GLQ +IK +T+TYS +LTNTYPP   +FR++ K  +NP++ FLA+   PLL
Sbjct  137   NIYNALSSVGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKTFINPIIGFLARHNLPLL  196

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF++  N + +PLSYALF ++  N AGY+ LFDAL+DSMY A +K GG N+ I+V
Sbjct  197   ANIYPYFAHIDNTNAVPLSYALFNQQGRNDAGYQYLFDALVDSMYFATEKLGGQNIEIIV  256

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  AAT +NA TYY NLI+HVK  AGTP KPGR+IETYLFAM+DEN K G+A
Sbjct  257   SESGWPSEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGRTIETYLFAMFDENEKKGEA  316

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F PD+  KYQLNFN
Sbjct  317   SEKHFGLFNPDQRPKYQLNFN  337



>pdb|3UR7|A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR7|B Chain B, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR8|A Chain A, Lower-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
 pdb|3UR8|B Chain B, Lower-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Length=323

 Score =   369 bits (947),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 179/316 (57%), Positives = 232/316 (73%), Gaps = 1/316 (0%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             + IGVCYGK  NNLPS+ D I L  +N I+ +R+Y     VFNA +GSN+ +I+DV N  
Sbjct  1     QPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILDVPNQD  60

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G  ++ +Y  FV PA+ N++NA
Sbjct  61    LEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-ESGKYARFVGPAMENIYNA  119

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L++AGLQ +IK +T+TYS +LTNTYPP   +FR++ K  +NP++ FLA+   PLLANIYP
Sbjct  120   LSSAGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLLANIYP  179

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALF ++  N  GY+NLFDAL+DSMY A +K GG N+ I+VSE+GW
Sbjct  180   YFGHIDNTNAVPLSYALFNQQRRNDTGYQNLFDALVDSMYFATEKLGGQNIEIIVSESGW  239

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYY NLI+HVK  AGTP KPG++IETYLFAM+DEN K G+A EK+F
Sbjct  240   PSEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKKGEASEKHF  299

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+  KYQLNFN
Sbjct  300   GLFNPDQRPKYQLNFN  315



>ref|XP_008227211.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=336

 Score =   368 bits (944),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/325 (55%), Positives = 237/325 (73%), Gaps = 10/325 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLPS T+ ++L KSNGI  +R+Y  + P + A +GSN+ +IV 
Sbjct  16    QITGAQSVGVCYGQNGNNLPSPTEVVDLYKSNGIGRMRIYEPNDPTYQALKGSNIELIVT  75

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N KLQ LTD A A  WVQ N+  + + V FKYIAVGNEV  G+P T     +++PA++
Sbjct  76    ILNDKLQGLTDAAAATDWVQKNVQAFPD-VKFKYIAVGNEVHPGDPQT----QYLLPAIQ  130

Query  847   NVHNALAAAGLQGKIKATTATYSAVL--TNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNP  674
             N+HNA+ AA LQG+IK +TA  + ++  T+ YPP+ G + D AK  + PV+ FLA  G P
Sbjct  131   NIHNAIVAANLQGQIKVSTAIDTTLVDSTSAYPPSAGKYSDAAKSFITPVINFLASNGAP  190

Query  673   LLANIYPYFSYRGNPSQIPLSYALFTER---NPNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             LL N+YPYFSY  NP+QI L+YALFT +    P+   Y+NLFDALLD+ Y+A++KA  P+
Sbjct  191   LLVNVYPYFSYHDNPAQIELAYALFTSQGITTPDGVKYQNLFDALLDAQYSALEKANAPD  250

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             V IVVSE+GWPS G   AT QNA T+Y+NLI+HVKG  GTP +PG++IETYLFAM+DEN 
Sbjct  251   VEIVVSESGWPSEGDDVATPQNAQTFYQNLINHVKGTTGTPKRPGKAIETYLFAMFDENT  310

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNF  248
             KGGD VE++FG+F P+K  KYQL F
Sbjct  311   KGGDEVERHFGLFSPNKQPKYQLTF  335



>pdb|4GZI|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase 
In Complex With Laminaratriose
 pdb|4GZJ|A Chain A, Active-site Mutant Of Potato Endo-1,3-beta-glucanase 
In Complex With Laminaratriose And Laminaratetrose
Length=323

 Score =   366 bits (940),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 178/316 (56%), Positives = 231/316 (73%), Gaps = 1/316 (0%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             + IGVCYGK  NNLPS+ D I L  +N I+ +R+Y     VFNA +GSN+ +I+DV N  
Sbjct  1     QPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPHTNVFNALKGSNIEIILDVPNQD  60

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G  ++ +Y  FV PA+ N++NA
Sbjct  61    LEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-ESGKYARFVGPAMENIYNA  119

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L++AGLQ +IK +T+TYS +LTNTYPP   +FR++ K  +NP++ FLA+   PLLANIYP
Sbjct  120   LSSAGLQNQIKVSTSTYSGLLTNTYPPRDSIFREEYKSFINPIIGFLARHNLPLLANIYP  179

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF +  N + +PLSYALF ++  N  GY+NLFDAL+DSMY A +K GG N+ I+VS +GW
Sbjct  180   YFGHIDNTNAVPLSYALFNQQRRNDTGYQNLFDALVDSMYFATEKLGGQNIEIIVSASGW  239

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  AAT +NA TYY NLI+HVK  AGTP KPG++IETYLFAM+DEN K G+A EK+F
Sbjct  240   PSEGHPAATLKNARTYYTNLINHVKRGAGTPKKPGKTIETYLFAMFDENEKKGEASEKHF  299

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PD+  KYQLNFN
Sbjct  300   GLFNPDQRPKYQLNFN  315



>ref|XP_006365633.1| PREDICTED: glucan endo-1,3-beta-glucosidase A-like, partial [Solanum 
tuberosum]
Length=316

 Score =   365 bits (938),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 180/316 (57%), Positives = 232/316 (73%), Gaps = 3/316 (1%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             + IGVCYGK  NNLPS+ D I L  +N I+ +R+Y  D  VFNA +GSN+ +I+DV N  
Sbjct  4     QPIGVCYGKIANNLPSDQDVIKLYNANNIKKMRIYYPDTNVFNALKGSNIEIILDVPNQD  63

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G   + +Y  FV PA+ N++NA
Sbjct  64    LEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRA-SGKYARFVGPAMENIYNA  122

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L++AGLQ +IK +TATY  +LTNTYPP  G+FR++ K  +NP++ FLA+   PLLANIYP
Sbjct  123   LSSAGLQNQIKVSTATYLGLLTNTYPPRDGIFREEYKSFINPIIGFLARHNLPLLANIYP  182

Query  652   YFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGW  473
             YF++  +   +PLSYALF ++  N AGY+NLFDAL+DSMY A +K GG N+ I+VSE+GW
Sbjct  183   YFAHADD--NVPLSYALFKQQGLNDAGYQNLFDALVDSMYFATEKLGGQNIEIIVSESGW  240

Query  472   PSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNF  293
             PS G  +AT +NA TYY NLI+HVKG AGTP KPG++IETYLFAM+DEN K G   E++F
Sbjct  241   PSEGHPSATLENARTYYTNLINHVKGGAGTPKKPGKTIETYLFAMFDENRKDGKPSEQHF  300

Query  292   GVFRPDKSSKYQLNFN  245
             G+F PDK  KYQLNFN
Sbjct  301   GLFYPDKRPKYQLNFN  316



>ref|NP_001234798.1| glucan endo-1,3-beta-glucosidase A precursor [Solanum lycopersicum]
 sp|Q01412.1|E13A_SOLLC RecName: Full=Glucan endo-1,3-beta-glucosidase A; AltName: Full=(1->3)-beta-glucan 
endohydrolase A; Short=(1->3)-beta-glucanase 
A; AltName: Full=Acidic beta-1,3-glucanase; AltName: 
Full=Beta-1,3-endoglucanase A; Flags: Precursor [Solanum lycopersicum]
 gb|AAA03617.1| beta-1,3-glucanase [Solanum lycopersicum]
Length=336

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 233/321 (73%), Gaps = 3/321 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  + IGVCYGK  NNLPS+ D I L  SN I+ +R+Y  +  VFNA +GSN+ +I+D
Sbjct  19    QITGAQPIGVCYGKIANNLPSDQDVIKLYNSNNIKKMRIYFPETNVFNALKGSNIEIILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L +P++ + WVQ NI  +   V FKYIAVGNEV  G  D+ +Y  FV PA+ 
Sbjct  79    VPNQDLEALANPSKRQGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-DSGKYARFVGPAME  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NAL++AGLQ +IK +TATY  +LTNTYPP   +FRD+ K  +NP++ FL++   PLL
Sbjct  138   NIYNALSSAGLQNQIKVSTATYLGLLTNTYPPRDSIFRDEYKSFINPIIGFLSRHNLPLL  197

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF +  +   +PL YALF ++  N AGY+NLFDAL+DSMY A +K GG N+ I+V
Sbjct  198   ANIYPYFGHADD--NVPLPYALFKQQGLNDAGYQNLFDALVDSMYFATEKLGGQNIEIIV  255

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  +AT +NA TYY NLI+HVKG AGTP KPGR+IETYLFAM+DEN K G  
Sbjct  256   SESGWPSEGHPSATLENAMTYYTNLINHVKGGAGTPKKPGRTIETYLFAMFDENRKDGKP  315

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E++FG+F+PD+  KYQL F+
Sbjct  316   SEQHFGLFKPDQRPKYQLKFD  336



>gb|AAN78310.1| acidic class II 1,3-beta-glucanase precursor [Solanum tuberosum]
Length=326

 Score =   366 bits (939),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/321 (56%), Positives = 232/321 (72%), Gaps = 3/321 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  + IGVCYGK  NNLPS+ D I L  +N I+ LR+Y  D  VFNA +GSN+ +I+D
Sbjct  9     QITGAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKLRIYYPDTNVFNALKGSNIEIILD  68

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G   + +Y  FV PA+ 
Sbjct  69    VPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGRA-SGKYARFVGPAME  127

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NAL++AGLQ +IK +TATY  +LTNTYPP   +FR++ K  +NP++ FLA+   PLL
Sbjct  128   NIYNALSSAGLQNQIKVSTATYLGLLTNTYPPKDSIFREEYKSFINPIIGFLARHNLPLL  187

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF++  +   +PLSYALF ++  N AGY+NLFDAL+DSMY A +K GG N+ I+V
Sbjct  188   ANIYPYFAHADD--NVPLSYALFKQQGLNDAGYQNLFDALVDSMYFATEKLGGQNIEIIV  245

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  +AT +NA TYY NLI+HVKG AGTP KPG++IETYLF M+DEN K G  
Sbjct  246   SESGWPSEGHPSATLENARTYYTNLINHVKGGAGTPKKPGKTIETYLFTMFDENRKDGKP  305

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E++FG+F PDK  KYQLNFN
Sbjct  306   SEQHFGLFYPDKRPKYQLNFN  326



>dbj|BAE53383.1| beta-1,3-glucanase [Sesbania rostrata]
Length=343

 Score =   366 bits (940),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/321 (56%), Positives = 234/321 (73%), Gaps = 6/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG+NG+NLP++ +T++L KSNGI  +R+Y  D     A +GSN+ +I+ 
Sbjct  29    EFTAAQSVGVCYGRNGDNLPTQQETVDLYKSNGIGRMRIYDPDERSLQALKGSNIELILG  88

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N KLQ L D   A  W+  N+  Y++ V FKYIAVGNEV   N + A+YV   +PA+R
Sbjct  89    VPNDKLQSLNDAGAATDWINTNVKAYSSDVKFKYIAVGNEV-EPNANEAQYV---LPAMR  144

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+++A LQ +IK +TA  S+++TN+YPPN GVF D A G + P+V FL     PLL
Sbjct  145   NIQNAISSANLQDQIKVSTAIKSSLVTNSYPPNNGVFSDSASGYIKPIVDFLVSNRAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYFS+  N   +PL+YALFT++  N AGY+NLFDALLDS+YAA++KAG  NV +VV
Sbjct  205   ANLYPYFSHVENQQTVPLNYALFTQQGTNDAGYQNLFDALLDSLYAALEKAGASNVNVVV  264

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG AA   NA TYYRNLI+HVKG  GTP +P   IETYLFAM+DEN K G+ 
Sbjct  265   SESGWPSDGGVAANVDNAGTYYRNLINHVKG--GTPKRPNGPIETYLFAMFDENRKDGEE  322

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+FRPDKS KYQL++N
Sbjct  323   SEKHFGLFRPDKSPKYQLSYN  343



>ref|XP_007133418.1| hypothetical protein PHAVU_011G177000g [Phaseolus vulgaris]
 gb|ESW05412.1| hypothetical protein PHAVU_011G177000g [Phaseolus vulgaris]
Length=337

 Score =   365 bits (938),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 237/320 (74%), Gaps = 6/320 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             I   E+IGVCYG  GNNLPS+ + ++L KSNGI  +R+Y  +    +A RGS + +I+DV
Sbjct  24    IAGAEAIGVCYGVLGNNLPSKQEVVDLYKSNGIGKMRIYFPEAETLDALRGSGIELIMDV  83

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             +   LQ +TD   A  WV+ N+VPYA  VNFKYI+VGNEV   N + A+Y+   + A+RN
Sbjct  84    ARESLQAMTDQNAATDWVRTNVVPYAQDVNFKYISVGNEVRP-NQNEAQYI---LSAMRN  139

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + NA+++A LQG+IK +TA  S +++N+YPPN GVF  +++  + P+++FL   G+PLLA
Sbjct  140   IQNAISSANLQGQIKVSTAIDSTLISNSYPPNDGVF--NSESYVRPIIEFLKSNGSPLLA  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y  +   IPL YALFT++  N  GY+NLFDA+LDS YAA++K G  +V IVVS
Sbjct  198   NVYPYFAYIYDKQNIPLDYALFTQQGQNSVGYQNLFDAMLDSTYAALEKMGASDVKIVVS  257

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPSAGG AA+TQNAATYY NLISH KG  GTP +PG SIETYLFAM+DEN K G+  
Sbjct  258   ESGWPSAGGDAASTQNAATYYANLISHAKGGNGTPKRPGGSIETYLFAMFDENNKNGEES  317

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             E++FG+F PDKS KYQL+FN
Sbjct  318   ERHFGLFTPDKSPKYQLSFN  337



>ref|XP_008366411.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=348

 Score =   363 bits (933),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 181/323 (56%), Positives = 232/323 (72%), Gaps = 7/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLP+E + ++L KSNGI  +R+Y  +     A RGSN+ + V 
Sbjct  29    QITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTVT  88

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +LQ L D A A AWVQ N+ PY+  V FKYIAVGNEV   +PD A  V F++PA++
Sbjct  89    ILNNELQALNDAAAATAWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-VGFLLPAIQ  144

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++TN YPP+ GV+ D A   + PV+ FL   G PLL
Sbjct  145   NIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGVYTDPANQFIKPVIDFLVSNGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  NP  I L+YALFT +    P+   Y +LFDALLD+ YAA++KAG PNV 
Sbjct  205   VNVYPYFSYNDNPGSIDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNVE  264

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG  AT QNAAT+Y+NLI HV    GTP +PG++IETYLFAM+DENLK 
Sbjct  265   IVVSESGWPSEGGNQATPQNAATFYQNLIKHVTSTTGTPKRPGKAIETYLFAMFDENLKE  324

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G+A EK+FG+F PDK  KYQL F
Sbjct  325   GNADEKHFGIFSPDKQPKYQLTF  347



>emb|CAA08910.1| glucan endo-1,3-beta-D-glucosidase [Solanum tuberosum]
Length=347

 Score =   362 bits (928),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/328 (55%), Positives = 233/328 (71%), Gaps = 3/328 (1%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  + IGVCYGK  NNLPS+ D I L  +N I+ LR+Y  D  VFNA +GSN+ +I+D
Sbjct  19    QITGAQPIGVCYGKIANNLPSDQDVIKLYNANNIKKLRIYYPDTNVFNALKGSNIEIILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ L +P+ A  WVQ NI  +   V FKYIAVGNEV  G  D+A+Y  FV PA+ 
Sbjct  79    VPNQDLEALANPSNANGWVQDNIRNHFPDVKFKYIAVGNEVDPGR-DSAKYARFVGPAME  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NAL++AGLQ +IK +TATY  +LTNTYPP   +FR+D +  +NP++ FLA+   PLL
Sbjct  138   NIYNALSSAGLQNQIKVSTATYLGLLTNTYPPRNSIFREDYRSFINPIIGFLARHNLPLL  197

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             ANIYPYF++  +   +PLSYALF ++  N AGY+NLFDAL+DSMY A +K GG N+ I+V
Sbjct  198   ANIYPYFAHADD--NVPLSYALFNQQGRNDAGYQNLFDALVDSMYFATEKLGGQNIEIIV  255

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS G  +AT +NA TYY NLI+HVKG  GTP KPG++IETYLFAM+DEN K G  
Sbjct  256   SESGWPSEGHPSATLENARTYYTNLINHVKGGTGTPKKPGKTIETYLFAMFDENRKDGKP  315

Query  307   VEKNFGVFRPDKSSKYQLNFN*GIS*LI  224
              E++FG+F PDK  K    F   I+ LI
Sbjct  316   SEQHFGLFYPDKRPKVSTQFQLMITCLI  343



>ref|NP_001275613.1| glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like precursor 
[Solanum tuberosum]
 gb|AFU52661.1| beta-1,3-glucanase 28 [Solanum tuberosum]
Length=345

 Score =   358 bits (920),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 188/334 (56%), Positives = 236/334 (71%), Gaps = 6/334 (2%)
 Frame = -3

Query  1243  MAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFN  1064
             M AL +LL+  + +T V S+GVCYG+  +NLPSE+D +N   +NGI+ +R+Y  D  V N
Sbjct  16    MVALFVLLMCGIQMTGVHSVGVCYGRMADNLPSESDVVNHCHANGIKKIRLYYPDTNVLN  75

Query  1063  AARGSNLAVIVDVSNPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPD  887
             A R SN+ V+VDV N  ++ L  DP +A+ WV  NI  Y  +V F+YIAVGNE+      
Sbjct  76    ALRESNIEVLVDVPNEHVKTLAQDPNQARNWVNNNIKAYFPSVKFRYIAVGNEI--SPIK  133

Query  886   TARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNP  707
                +  FV PA+ NVHNA+  AGLQ +IK +TATYSA+LTNT+PP   +F  D +G  +P
Sbjct  134   HVEFAPFVGPAIENVHNAIVEAGLQDQIKVSTATYSALLTNTWPPQNSMFNPDWRGFTDP  193

Query  706   VVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAA  527
             +V+ L     PLL NIYPYFSY  N   IPLSYALFT+  PN AGY+NLFDAL+DSMY A
Sbjct  194   IVKLLKDNNLPLLVNIYPYFSYIYNMKDIPLSYALFTDSGPNSAGYQNLFDALVDSMYYA  253

Query  526   VQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYL  347
             ++K+G PNV IVVSETGWPS G  AATT NA TYY NLI HV+   GTP KPGR IET+L
Sbjct  254   LEKSGAPNVEIVVSETGWPSYGHPAATTDNARTYYTNLIDHVRN--GTPKKPGRGIETFL  311

Query  346   FAMYDENLKGGDAVEKNFGVFRPDKSSKY-QLNF  248
             FAM+DE  KGGD  E++FG+F PD++SKY QLNF
Sbjct  312   FAMFDERGKGGDETERHFGLFYPDRNSKYGQLNF  345



>ref|XP_009366077.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=348

 Score =   358 bits (919),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 230/323 (71%), Gaps = 7/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLP+E + ++L KSNGI  +R+Y  +     A RGSN+ + V 
Sbjct  29    QITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTVT  88

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +LQ L D A A AWVQ N+ PY+  V FKYIAVGNEV  G    A  V F++PA++
Sbjct  89    ILNNELQALNDAAAATAWVQKNVQPYSADVKFKYIAVGNEVRPG----AAEVGFLLPAIQ  144

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++TN YPP+ GV+ D A   + PV+ FL   G PLL
Sbjct  145   NIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGVYTDPANQFIKPVIDFLVSNGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  NP  I L+YALFT +    P+   Y +LFDALLD+ YAA++KAG PNV 
Sbjct  205   VNVYPYFSYNDNPGSIDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNVE  264

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG  AT +NAAT+Y+NLI HV    GTP +PG++IETYLFAM+DENLK 
Sbjct  265   IVVSESGWPSEGGNQATPENAATFYQNLIKHVTSTTGTPKRPGKAIETYLFAMFDENLKA  324

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G+A EK+FG+F P+K  KYQL F
Sbjct  325   GNADEKHFGIFTPNKQPKYQLTF  347



>gb|AFP23132.1| beta-1,3-glucanase [Pyrus pyrifolia]
Length=348

 Score =   358 bits (918),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 178/323 (55%), Positives = 229/323 (71%), Gaps = 7/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLP+E + ++L KSNGI  +R+Y  +     A RGSN+ + V 
Sbjct  29    QITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTVT  88

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +LQ L D A A AWVQ N+ PY+  V FKYIAVGNEV  G    A  V F++PA++
Sbjct  89    ILNNELQALNDAAAATAWVQKNVQPYSADVKFKYIAVGNEVRPG----AAEVGFLLPAIQ  144

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++TN YPP+ GV+ D A   + PV+ FL   G PLL
Sbjct  145   NIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGVYTDPANQFIKPVIDFLVSNGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  NP  I L+YALFT +    P+   Y +LFDALLD+ YAA++KAG PNV 
Sbjct  205   VNVYPYFSYNDNPGSIDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNVE  264

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWP  GG  AT +NAAT+Y+NLI HV    GTP +PG++IETYLFAM+DENLK 
Sbjct  265   IVVSESGWPFEGGNQATPENAATFYQNLIKHVTSTTGTPKRPGKAIETYLFAMFDENLKA  324

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G+A EK+FG+F PDK  KYQL F
Sbjct  325   GNADEKHFGIFTPDKQPKYQLTF  347



>ref|XP_007132239.1| hypothetical protein PHAVU_011G077900g [Phaseolus vulgaris]
 gb|ESW04233.1| hypothetical protein PHAVU_011G077900g [Phaseolus vulgaris]
Length=332

 Score =   357 bits (915),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/320 (56%), Positives = 225/320 (70%), Gaps = 6/320 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +T VES+GVCYG NGNNLP++   +NL KSNGI  +R+Y  D     A RGSN+ VI+ V
Sbjct  19    LTGVESVGVCYGGNGNNLPTKQAVVNLYKSNGIGKIRLYYPDEGALQALRGSNIEVILAV  78

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N +LQ +++   A  WV   + PYA  V  KYIAVGNEV  G+         V+PAL++
Sbjct  79    PNDQLQSVSNNGGATNWVNKYVKPYAGNVKLKYIAVGNEVHPGDALAGS----VLPALQS  134

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + NA++AA LQG+IK +TA  + +L N+YPP  GVF + A   + P++ FLA+ G PLLA
Sbjct  135   IQNAISAANLQGQIKVSTAIDTTLLGNSYPPKDGVFSNSASSYITPIINFLAKNGAPLLA  194

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y  N   I L YALFT++  N  GY+NLFDAL+DS+YAA++K G  NV +VVS
Sbjct  195   NVYPYFAYVNNQQNIGLDYALFTKQGNNEVGYQNLFDALVDSLYAALEKVGASNVKVVVS  254

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG  AT QNA TYYRNLI HVKG  GTP +P   IETYLFAM+DEN KGG   
Sbjct  255   ESGWPSQGGVGATVQNAGTYYRNLIKHVKG--GTPKRPNGPIETYLFAMFDENQKGGAET  312

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             EK+FG+FRPDKS KYQL+FN
Sbjct  313   EKHFGLFRPDKSPKYQLSFN  332



>sp|P52396.1|E13I_TOBAC RecName: Full=Glucan endo-1,3-beta-glucosidase, acidic isoform 
PR-N; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase, 
partial [Nicotiana tabacum]
 gb|AAA34105.1| PRN, partial [Nicotiana tabacum]
Length=275

 Score =   355 bits (910),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 173/276 (63%), Positives = 211/276 (76%), Gaps = 2/276 (1%)
 Frame = -3

Query  1072  VFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGN  893
             VFNA RGSN+ +I+DV    LQ LTDP+RA  WVQ NI+ +   V FKYIAVGN+V  GN
Sbjct  2     VFNALRGSNIEIILDVPLQDLQSLTDPSRANGWVQDNIINHFPDVKFKYIAVGNKVSPGN  61

Query  892   PDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLM  713
                 +Y  FV PA++NV+NALAAAGLQ +IK +TATYS +L NTYPP   +FR +    +
Sbjct  62    --NGQYAPFVAPAMQNVYNALAAAGLQDQIKVSTATYSGILANTYPPKDSIFRGEFNSFI  119

Query  712   NPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMY  533
             NP++QFL Q   PLLAN+YPYF +  N + +PLSYALFT++  NPAGY+NLFDALLDSMY
Sbjct  120   NPIIQFLVQHNLPLLANVYPYFGHIFNTADVPLSYALFTQQEANPAGYQNLFDALLDSMY  179

Query  532   AAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIET  353
              AV+KAGG NV I+VSE+GWPS G  AAT +NA TYY NLI+HVK  AGTP KPG++IET
Sbjct  180   FAVEKAGGQNVEIIVSESGWPSEGNSAATIENAQTYYENLINHVKSGAGTPKKPGKAIET  239

Query  352   YLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             YLFAM+DEN K GD  EK+FG+F PD+ +KYQLNFN
Sbjct  240   YLFAMFDENNKEGDITEKHFGLFSPDQRAKYQLNFN  275



>ref|XP_008363318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=348

 Score =   356 bits (914),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 233/323 (72%), Gaps = 7/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NG+NLP+E + ++L KSNGI  +R+Y  +   F A RGSN+ + + 
Sbjct  29    EITGAQSVGVCYGRNGDNLPAEGEVVDLYKSNGIGRMRMYEPNEATFQALRGSNIELTLT  88

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +L  L D A A AWVQ N+ PY+  V FKYIAVGNEV   +P TA    F++PA++
Sbjct  89    ILNSELSALNDAAAATAWVQKNVQPYSADVRFKYIAVGNEV---HPGTAE-AGFLLPAIQ  144

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++TN YPP+ G++ D A   + P++ FL   G PLL
Sbjct  145   NIHSAIVAANLQGQIKVSTAIDTTLVTNAYPPSDGIYTDAANPFITPIINFLVSNGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY G+P+ I L YALFT +    P+   Y +LFDALLD+ Y+A++KAG PN+ 
Sbjct  205   VNVYPYFSYNGDPNNIDLGYALFTSQGVVVPDGTRYPSLFDALLDAQYSALEKAGAPNIE  264

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG  AT QNAAT+Y+NLISHV    GTP +PGR+IETYLFA++DENLKG
Sbjct  265   IVVSESGWPSEGGNQATAQNAATFYQNLISHVTSTTGTPKRPGRAIETYLFALFDENLKG  324

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
              + VEK+FGVF P+K  KYQL F
Sbjct  325   PEPVEKHFGVFSPNKQHKYQLTF  347



>ref|XP_004232306.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N-like 
[Solanum lycopersicum]
Length=345

 Score =   356 bits (913),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 191/334 (57%), Positives = 237/334 (71%), Gaps = 6/334 (2%)
 Frame = -3

Query  1243  MAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFN  1064
             M AL +LL+  L IT V S+GVCYG+  +NLPSE D +N   +NGI  +R+Y  D  V+N
Sbjct  16    MVALFILLMCGLQITGVYSVGVCYGRMADNLPSEYDVVNHCHANGINKIRIYYPDTNVYN  75

Query  1063  AARGSNLAVIVDVSNPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPD  887
             A RGSN+ V+VDV N  ++ L  DP +A+ WV  NI  Y  +V F+YIAVGNE+      
Sbjct  76    ALRGSNIEVLVDVPNEHVKTLAQDPNQARNWVNNNIKAYFPSVKFRYIAVGNEI--SPIK  133

Query  886   TARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNP  707
               +   FV PA+ NVHNA+  AGLQ +IK +TATYSA+LTNT+PP   +F  D +G  +P
Sbjct  134   NVQLATFVGPAIENVHNAIVEAGLQDQIKVSTATYSALLTNTWPPQNSMFNPDWRGFTDP  193

Query  706   VVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAA  527
             +V+ L     PLL NIYPYFSY  N   IPLSYALFT+   N AGY+NLFDAL+DSMY A
Sbjct  194   IVKLLRDNNLPLLVNIYPYFSYIYNTKDIPLSYALFTDSGTNSAGYQNLFDALVDSMYYA  253

Query  526   VQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYL  347
             ++K+G PNV IVVSETGWPS G  AATT NA TYY N+I+HV GN GTP KPGR IET+L
Sbjct  254   LEKSGAPNVEIVVSETGWPSYGHPAATTDNARTYYTNVINHV-GN-GTPKKPGREIETFL  311

Query  346   FAMYDENLKGGDAVEKNFGVFRPDKSSKY-QLNF  248
             FAM+DE  KGGD  E++FG+F PD++SKY QLNF
Sbjct  312   FAMFDERGKGGDETERHFGLFYPDRNSKYDQLNF  345



>ref|XP_009374912.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=335

 Score =   355 bits (911),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 175/323 (54%), Positives = 234/323 (72%), Gaps = 7/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NG+NLP+E + ++L KSNGI  +R+Y  +   F A RGSN+ + V 
Sbjct  16    EITGAQSVGVCYGRNGDNLPAEGEVVDLYKSNGIGRMRMYEPNEATFQALRGSNIELTVT  75

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +L  L D A A AWVQ N+ P++  V FKYIAVGNEV   +P TA    F++PA++
Sbjct  76    ILNNELSALNDAAAATAWVQKNVQPFSADVRFKYIAVGNEV---HPGTAE-AGFLLPAIQ  131

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++TN YPP+ G++ +DA   + P++ FL   G PLL
Sbjct  132   NIHSAIVAANLQGQIKVSTAIDATLVTNPYPPSDGIYTEDANPFITPIINFLVSNGAPLL  191

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  +P+ I L YALFT +    P+   Y +LFDALLD+ Y+A++KAG PN+ 
Sbjct  192   VNVYPYFSYNDDPNNIDLGYALFTSQGVVVPDGTRYPSLFDALLDAQYSALEKAGAPNIE  251

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG  AT QNAAT+Y+NLISHV  N GTP +PGR+IETYLFA++DENLKG
Sbjct  252   IVVSESGWPSEGGNQATAQNAATFYQNLISHVTSNTGTPKRPGRAIETYLFALFDENLKG  311

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
              + VEK+FGVF P+K  KYQL F
Sbjct  312   PEPVEKHFGVFSPNKQPKYQLTF  334



>ref|XP_010101245.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB88169.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=326

 Score =   353 bits (907),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 178/317 (56%), Positives = 232/317 (73%), Gaps = 9/317 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYGK  NNLP+E++ INL KSN I  +R+Y+ D     A +GSN+ +IVDV+N K
Sbjct  18    QSIGVCYGKLANNLPTESEVINLYKSNNIGKMRIYSPDQATLQALKGSNIELIVDVTNEK  77

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             LQ LTD   A  WVQ NIV +++ V+FKYIAVGNE+  G+ +     NFV+PA++NV +A
Sbjct  78    LQSLTDAGAASDWVQRNIVSFSSGVSFKYIAVGNEIHPGDGE----ANFVLPAMKNVQSA  133

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             + +A LQGKIK +T+  +++L  +YPPN G F D AKG + P+  FL Q G+PLLAN+YP
Sbjct  134   INSASLQGKIKVSTSIDTSLLGKSYPPNDGAFSDAAKGYIKPIANFLTQNGSPLLANVYP  193

Query  652   YFSYRGNPSQIPLSYALFTER-NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             YF+Y G+ S I L YALF  + + N  GY+NLFDA LD++YAA++K   P+V IVVSE+G
Sbjct  194   YFAYTGDRS-IDLQYALFNSKGSSNGTGYQNLFDAQLDALYAALEKVKAPDVKIVVSESG  252

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPS G  AATT NA TYYRNLI+HVKG  GTP KP   IETYLFAM++EN K G A E++
Sbjct  253   WPSEGDSAATTNNAGTYYRNLIAHVKG--GTPKKPQGPIETYLFAMFNENQKDG-AQEQH  309

Query  295   FGVFRPDKSSKYQLNFN  245
             +G+F PDK  KYQL+F+
Sbjct  310   YGLFSPDKQPKYQLSFS  326



>ref|XP_006367559.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=346

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 174/314 (55%), Positives = 221/314 (70%), Gaps = 7/314 (2%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             +IGVCYGK  NNLPS  D INL K+NGIR +R+Y  D  VFNA +GSN+ +I+DV N  L
Sbjct  35    NIGVCYGKIANNLPSHQDVINLYKANGIRKMRIYYPDTNVFNALKGSNIEIILDVPNQDL  94

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             + LT+P+ A  WVQ NI  +   V FKYI++GNEV  G     +   FV+  + NV+N L
Sbjct  95    EALTNPSNANGWVQDNIKSHFPNVKFKYISIGNEVSNG-----QISQFVLSVMENVYNEL  149

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             +A GLQ KIK +TATYS +L NTYPP   +FR++ KG +NP+++FLA+   P+LANI+PY
Sbjct  150   SAVGLQDKIKVSTATYSGLLANTYPPKDSIFREEFKGFINPIIEFLARNNLPILANIFPY  209

Query  649   FSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWP  470
             F +  N   IPLSYALF   N    GY+NLFDALLDS Y A++KAGGPNV IVVSET WP
Sbjct  210   FGHIYNMVDIPLSYALFNHENS--IGYQNLFDALLDSTYFAIEKAGGPNVEIVVSETSWP  267

Query  469   SAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFG  290
             S G  +A  +NA  YYRNL++HVK   GTP KPGR IETYLFAM+DEN K G+  E +FG
Sbjct  268   SNGHPSAMPENAQIYYRNLVNHVKSGVGTPKKPGRIIETYLFAMFDENQKQGEVTENHFG  327

Query  289   VFRPDKSSKYQLNF  248
             +  P++++ Y L F
Sbjct  328   LSYPNQTANYDLKF  341



>ref|XP_010101247.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB88171.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=341

 Score =   353 bits (907),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 178/322 (55%), Positives = 231/322 (72%), Gaps = 9/322 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I+  +SIGVCYGK GNNLP+E++ INL KSN I  +R+Y+ D     A +GSN+ +IVD
Sbjct  28    EISGAQSIGVCYGKLGNNLPTESEVINLYKSNNIGKMRIYSPDQATLQALKGSNIELIVD  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V   KLQ L D   A  WVQ NIV +++ VNFKYIAVGNE+  G+ +     N+V+PA++
Sbjct  88    VPKDKLQSLNDAGAASDWVQTNIVSFSSDVNFKYIAVGNEIHPGDGE----ANYVLPAMK  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV +A+ +A LQGKIK +TA  +++L  +YPPN GVF D A G + P+  FLA+ G+PLL
Sbjct  144   NVQSAINSASLQGKIKVSTAIDTSLLDKSYPPNDGVFSDAANGYITPIANFLAENGSPLL  203

Query  667   ANIYPYFSYRGNPSQIPLSYALFTER-NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             AN+YPYF+Y  N   I L YALF  + + +  GY+NLFDA LD++YAA++K   P+V IV
Sbjct  204   ANVYPYFAYT-NDRSIDLQYALFNSKGSSDGTGYQNLFDAQLDALYAALEKVNAPDVKIV  262

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPS G  AATT NA TYYRNLI+HVKG  GTP +P   IETYLFAM+DEN K G 
Sbjct  263   VSESGWPSEGDSAATTNNAGTYYRNLIAHVKG--GTPKRPQGPIETYLFAMFDENQKDG-  319

Query  310   AVEKNFGVFRPDKSSKYQLNFN  245
             A E++FG+F PDK  KYQL+F+
Sbjct  320   AQEQHFGLFSPDKQPKYQLSFS  341



>gb|ABK95326.1| unknown [Populus trichocarpa]
Length=338

 Score =   352 bits (904),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 232/323 (72%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +++ +SIGVCYGKNGNNLPS+ + ++L ++N I  +R+Y  +     A RGSN+ V++ V
Sbjct  22    LSDAQSIGVCYGKNGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLEALRGSNIEVVLGV  81

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQ LTD + A  WVQ N+V Y++ V F+YIAVGNEV  G+ +       V+PA++N
Sbjct  82    PNDKLQSLTDASAATTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANAQS----VLPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +HNA+A+A LQ +IK +TA  + +L ++YPP+ G F D A   +NP++ FL   G+PLLA
Sbjct  138   IHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSDSASSYINPIINFLRTNGSPLLA  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP  I LSYALFT           GY+NLFDALLDS+YAA++KAG P++ 
Sbjct  198   NVYPYFSYTGNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAALEKAGAPDLN  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG AAT  NA T+YRNLI+HVK   GTP + G++IETYLFAM+DENLK 
Sbjct  258   IVVSESGWPSEGGTAATADNAGTFYRNLINHVK--QGTPRRSGQAIETYLFAMFDENLKA  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FG+F P+K  KYQL F
Sbjct  316   A-GIEQHFGLFLPNKQPKYQLTF  337



>ref|XP_002299791.2| 3-glucanase family protein [Populus trichocarpa]
 gb|EEE84596.2| 3-glucanase family protein [Populus trichocarpa]
Length=338

 Score =   352 bits (903),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 232/323 (72%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +++ +SIGVCYGKNGNNLPS+ + ++L ++N I  +R+Y  +     A RGSN+ V++ V
Sbjct  22    LSDAQSIGVCYGKNGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLEALRGSNIEVVLGV  81

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQ LTD + A  WVQ N+V Y++ V F+YIAVGNEV  G+ +       V+PA++N
Sbjct  82    PNDKLQSLTDASAATTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANAQS----VLPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +HNA+A+A LQ +IK +TA  + +L ++YPP+ G F D A   +NP++ FL   G+PLLA
Sbjct  138   IHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSDSASSYINPIINFLRTNGSPLLA  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP  I LSYALFT           GY+NLFDALLDS+YAA++KAG P++ 
Sbjct  198   NVYPYFSYTGNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAALEKAGAPDLN  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG AAT  NA T+YRNLI+HVK   GTP + G++IETYLFAM+DENLK 
Sbjct  258   IVVSESGWPSEGGTAATADNAGTFYRNLINHVK--QGTPRRSGQAIETYLFAMFDENLKA  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FG+F P+K  KYQL F
Sbjct  316   A-GIEQHFGLFLPNKQPKYQLTF  337



>gb|ACU20860.1| unknown [Glycine max]
Length=340

 Score =   351 bits (900),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 221/321 (69%), Gaps = 6/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NGNNLP++   ++L KSN I  +R+Y  D  V  A RGSN+ VI+ 
Sbjct  26    EFTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNRIGKIRLYYPDEGVLQALRGSNIEVILG  85

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N +LQ LT+   A  WV   +  Y+  V FKYIAVGNE+  G+         V+PAL 
Sbjct  86    VPNDQLQSLTNAGAATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGS----VLPALE  141

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+  A++AA LQG++K +TA  + +L N+YPP  GVF   A   + P+V FLA+ G PLL
Sbjct  142   NIQKAISAANLQGQMKVSTAIDTTLLGNSYPPKDGVFSSSASSYIRPIVNFLARNGAPLL  201

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF+Y  N   I L YALFT+   N  GY+NLFDALLDS+YAA++K G PNV +VV
Sbjct  202   ANVYPYFAYVNNQQSIGLDYALFTKHGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVV  261

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  AT QNA TYYRNLI+H KG  GTP++P   IETYLFAM+DEN K G  
Sbjct  262   SESGWPSEGGVGATVQNAGTYYRNLINHAKG--GTPMRPSGPIETYLFAMFDENQKDGPE  319

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +E++FG+FRPDKS KYQL+FN
Sbjct  320   IERHFGLFRPDKSPKYQLSFN  340



>gb|KHN05499.1| Glucan endo-1,3-beta-glucosidase, acidic isoform GL153 [Glycine 
soja]
Length=340

 Score =   349 bits (895),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/321 (54%), Positives = 220/321 (69%), Gaps = 6/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NGNNLP++   ++L KSN I  +R+Y  D  V  A RGSN+ VI+ 
Sbjct  26    EFTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNRIGKIRLYYPDEGVLQALRGSNIEVILG  85

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N +LQ LT+   A  WV   +  Y+  V FKYIAVGNE+  G+         V+PAL 
Sbjct  86    VPNDQLQSLTNAGAATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGS----VLPALE  141

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+  A++AA LQG++K +TA  + +L N+YPP  GVF   A   + P+V FLA+ G PLL
Sbjct  142   NIQKAISAANLQGQMKVSTAIDTTLLGNSYPPKDGVFSSSASSYIRPIVNFLARNGAPLL  201

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF+Y  N   I L YALFT+   N  GY+NLFDALLDS+YAA++K G PNV +VV
Sbjct  202   ANVYPYFAYVNNQQSIGLDYALFTKHGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVV  261

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  AT QNA TYYRNLI+H KG  GTP +P   IETYLFAM+DEN K G  
Sbjct  262   SESGWPSEGGVGATVQNAGTYYRNLINHAKG--GTPKRPSGPIETYLFAMFDENQKDGPE  319

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +E++FG+FRPDKS KYQL+FN
Sbjct  320   IERHFGLFRPDKSPKYQLSFN  340



>dbj|BAE53384.1| beta-1,3-glucanase [Sesbania rostrata]
Length=339

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 175/320 (55%), Positives = 222/320 (69%), Gaps = 7/320 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
              T  +S+GVCYG NGNNLP++   ++L KSNGI  +R+Y  D     A RGSN+ VI+ V
Sbjct  27    FTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNGIGKIRLYYPDEGALQALRGSNIEVILGV  86

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQ LT+   A  WV   +  Y+N V  KYIAVGNEV  G+         V+PA+RN
Sbjct  87    PNDKLQSLTNAGAASDWVNRYVKAYSN-VKIKYIAVGNEVHPGDAVAGS----VLPAMRN  141

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + +A+++A LQG+IK +TA  + +L N+YPP  GVF + A G + P++ FL   G PLLA
Sbjct  142   IQSAISSANLQGQIKVSTAIDTTLLGNSYPPKDGVFSNSASGYIRPIITFLVNNGAPLLA  201

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y  N   I L YALFT++  N  GY+NLFDALLDS+YAA++K G PNV +VVS
Sbjct  202   NVYPYFAYVNNQQSIGLDYALFTKQGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVVS  261

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG  AT QNA TYYRNLI H KG  GTP +P   IETYLFAM+DEN K G  +
Sbjct  262   ESGWPSEGGTGATVQNAGTYYRNLIRHAKG--GTPKRPNGPIETYLFAMFDENQKQGPEI  319

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             E++FG+FRPDKS KYQL+FN
Sbjct  320   ERHFGLFRPDKSPKYQLSFN  339



>ref|XP_011045404.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=338

 Score =   348 bits (894),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 174/323 (54%), Positives = 231/323 (72%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +++ +SIGVCYGK+GNNLPS+ + ++L ++N I  +R+Y  +     A RGSN+ VI+ V
Sbjct  22    LSDAQSIGVCYGKDGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLEALRGSNIEVILGV  81

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQ LTD + AK WVQ N+V Y++ V F+YIAVGNEV  G+ +       V+PA++N
Sbjct  82    PNDKLQSLTDASAAKTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANAQS----VLPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             VHNA+A+A LQ +IK +TA  + +L ++YPP+ G F   A   +NP++ FL   G+PLLA
Sbjct  138   VHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSTGASPYINPIINFLRTNGSPLLA  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP  I LSYALFT           GY+NLFDALLDS+YAA++KAG PN+ 
Sbjct  198   NVYPYFSYTGNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAALEKAGAPNLN  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG AAT  NA T+YRNLI+H K   GTP + G++IETYLFAM+DENLK 
Sbjct  258   IVVSESGWPSEGGTAATVDNAGTFYRNLINHAK--QGTPRRSGQAIETYLFAMFDENLKA  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FG+F P+K  KYQL F
Sbjct  316   A-GIEQHFGLFLPNKQPKYQLTF  337



>ref|XP_011001638.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=338

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 230/323 (71%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +++ +SIGVCYGK+GNNLPS+ + ++L ++N I  +R+Y  +     A RGSN+ VI+ V
Sbjct  22    LSDAQSIGVCYGKDGNNLPSDQEVVSLFQTNVIGRMRIYDPNRDTLEALRGSNIEVILGV  81

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQ LTD + AK WVQ N+V Y++ V F+YIAVGNEV  G+ +       V+PA++N
Sbjct  82    PNDKLQSLTDASAAKTWVQDNVVAYSSNVKFRYIAVGNEVHPGDANAQS----VLPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             VHNA+A+A LQ +IK +TA  + +L ++YPP+ G F   A   +NP++ FL   G+PLLA
Sbjct  138   VHNAIASANLQDQIKVSTAIDTTLLGSSYPPSDGSFSTGASPYINPIINFLRTNGSPLLA  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY  NP  I LSYALFT           GY+NLFDALLDS+YAA++KAG PN+ 
Sbjct  198   NVYPYFSYTDNPQSIDLSYALFTSPGVVVQDGQYGYQNLFDALLDSLYAALEKAGAPNLN  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG AAT  NA T+YRNLI+H K   GTP + G++IETYLFAM+DENLK 
Sbjct  258   IVVSESGWPSEGGTAATVDNAGTFYRNLINHAK--QGTPRRSGQAIETYLFAMFDENLKA  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FG+F P+K  KYQL F
Sbjct  316   A-GIEQHFGLFLPNKQPKYQLTF  337



>ref|NP_001237271.1| endo-1,3-beta-glucanase precursor [Glycine max]
 gb|AAR26001.1| endo-1,3-beta-glucanase [Glycine max]
Length=340

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 173/321 (54%), Positives = 219/321 (68%), Gaps = 6/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NGNNLP++   ++L KSN I  +R+Y  D  V  A RGSN+ VI+ 
Sbjct  26    EFTGAQSVGVCYGGNGNNLPTKQAVVDLYKSNRIGKIRLYYPDEGVLQALRGSNIEVILG  85

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N +LQ LT+   A  WV   +  Y+  V FKYIAVGNE+  G+         V+PAL 
Sbjct  86    VPNDQLQSLTNAGAATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGS----VLPALE  141

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+  A++AA LQG++K +TA  + +L N+YPP  GVF   A   + P+V FLA+ G PLL
Sbjct  142   NIQKAISAANLQGQMKVSTAIDTTLLGNSYPPKDGVFSSSASSYIRPIVNFLARNGAPLL  201

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF+Y  N   I L YALFT+   N  GY+NLFDALLDS+YAA++K G PNV +VV
Sbjct  202   ANVYPYFAYVNNQQSIGLDYALFTKHGNNEVGYQNLFDALLDSLYAALEKVGAPNVKVVV  261

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  AT QNA TYYRNLI+H KG  GTP +P   IETYLFAM+D N K G  
Sbjct  262   SESGWPSEGGVGATVQNAGTYYRNLINHAKG--GTPKRPSGPIETYLFAMFDGNQKDGPE  319

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +E++FG+FRPDKS KYQL+FN
Sbjct  320   IERHFGLFRPDKSPKYQLSFN  340



>ref|XP_008223323.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Prunus mume]
Length=369

 Score =   346 bits (888),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 229/324 (71%), Gaps = 7/324 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             IT V+S+GVCYG  GNNLPS  + I+L KSN I+ +R+Y  +     A RGSN+ +++ V
Sbjct  32    ITGVQSVGVCYGMLGNNLPSHAEVISLYKSNNIKQMRIYDPNQSALQALRGSNIELMLGV  91

Query  1024  SNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
              N  L+ L T+P+ A+ WVQ N++ +  +V FKYIAVGNEV     DT R   FV+PA++
Sbjct  92    PNQDLERLATNPSEAQTWVQTNVLNFRQSVRFKYIAVGNEVSPVYGDTTRLAQFVLPAMK  151

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N++NA+ +AGLQ +IK +TA  + ++ N+YPP+QG FR D +  ++P++ FL    +PLL
Sbjct  152   NIYNAIRSAGLQDQIKVSTAIETGLIGNSYPPSQGAFRGDVRAYLDPIIGFLVYAKSPLL  211

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
             ANIY YFSY GNP  I L YALFT  +        GY+NLFDA+LD++Y+AV++AGG ++
Sbjct  212   ANIYTYFSYIGNPRDISLPYALFTSPSVMAWDGDKGYQNLFDAMLDALYSAVERAGGGSL  271

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              +VVSE+GWPSAG F A+T NA TYY NLI HVK   GTP +P RSIETYLFA++DEN K
Sbjct  272   EVVVSESGWPSAGAFGASTDNARTYYSNLIRHVK--EGTPKRPKRSIETYLFAVFDENNK  329

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G+  E++FGVF P K  KY LNF
Sbjct  330   LGEETERHFGVFFPTKEPKYNLNF  353



>ref|XP_003607319.1| Endo-beta-1 3-glucanase [Medicago truncatula]
 gb|AES89516.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 170/319 (53%), Positives = 223/319 (70%), Gaps = 7/319 (2%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+S+GVCYG  GNNLPS  + ++L KSNGI  +R+Y  D     A +GSN+ +I+DV+
Sbjct  18    TVVQSVGVCYGVLGNNLPSSQEVVDLYKSNGIDKMRIYFPDEQALQALKGSNIELILDVA  77

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
                L  LTD   A  WVQ  + PYA  V  KYI VGNE+   N + A+Y+     A++N+
Sbjct  78    KETLSSLTDGNEATNWVQKYVTPYAQDVKIKYITVGNEI-KPNDNEAQYI---ATAMQNI  133

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
              NA+++A LQG+IK +TA    ++  +YPPN G F D AK  + P++ FL   G PLLAN
Sbjct  134   QNAISSANLQGQIKVSTAIDMTLIGTSYPPNDGAFTDQAKQYLQPIIDFLKNNGAPLLAN  193

Query  661   IYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSE  482
             +YPYF+Y GN   I L YALF ++  N  GY+NLFDA LDS+YAA++K GG +V IVVSE
Sbjct  194   VYPYFAYIGNKQSISLDYALFKQQGNNDVGYQNLFDAQLDSVYAALEKVGGTDVKIVVSE  253

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPS GG +A+T NA+TYY+NLI+HVK   GTP +PG +IETYLFAM+DEN K G A E
Sbjct  254   SGWPSDGGDSASTDNASTYYQNLINHVKN--GTPKRPG-AIETYLFAMFDENQKTGAATE  310

Query  301   KNFGVFRPDKSSKYQLNFN  245
             ++FG+F PDKSSKYQ +FN
Sbjct  311   QHFGLFNPDKSSKYQTSFN  329



>emb|CDO98259.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   344 bits (882),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 176/321 (55%), Positives = 226/321 (70%), Gaps = 10/321 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYG NGN+LPS  D INL    GI  +R+YA  P V NA RGSN+ +IVDV+N  
Sbjct  23    QSIGVCYGLNGNDLPSTQDVINLYNEKGIAKMRIYAPFPQVLNALRGSNIELIVDVANED  82

Query  1012  LQELTDPARAKA-WVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             ++ L   A A A WVQ NI+ Y+  V FKYIAVGNEV   N D A+Y+   +PA+ N+ N
Sbjct  83    IEPLASDASAAAHWVQDNILRYSPDVQFKYIAVGNEVLP-NFDNAKYI---LPAMENLQN  138

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             A+ AAGLQ +IK +TATY+A+L  + PP+QG F +D+K  M P++ FL Q   PLL NIY
Sbjct  139   AIIAAGLQDQIKVSTATYTALLAVSSPPSQGSFGNDSKLFMKPIINFLVQNNAPLLVNIY  198

Query  655   PYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKA-GGPNVPIV  491
             PYF Y G+P+ I L YALFT           GY+NLFDA+LD+ Y A+++  GG  V IV
Sbjct  199   PYFGYIGDPANIGLEYALFTSPGIVVQDGLLGYQNLFDAMLDAHYTALEREEGGNTVEIV  258

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSETGWPS G  A++ +NA TYY+NLI+HVKG +GTP +PG++IETYLFAM+DEN K GD
Sbjct  259   VSETGWPSEGSSASSVENAGTYYKNLINHVKGGSGTPRRPGKAIETYLFAMFDENEKTGD  318

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
               EK+FG+F P+K  KY ++F
Sbjct  319   ETEKHFGLFTPNKQPKYAVSF  339



>ref|XP_007226561.1| hypothetical protein PRUPE_ppa024457mg, partial [Prunus persica]
 gb|EMJ27760.1| hypothetical protein PRUPE_ppa024457mg, partial [Prunus persica]
Length=335

 Score =   343 bits (881),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 228/322 (71%), Gaps = 7/322 (2%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V+S+GVCYG  GNNLPS  + I+L KSN I+ +R+Y  +     A +GSN+ +++ V N 
Sbjct  1     VQSVGVCYGMLGNNLPSHAEVISLYKSNNIKQMRIYDPNQSALQALQGSNIELMLGVPNQ  60

Query  1015  KLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              L+ L T+P+ A+ WVQ N++ +  +V FKYIAVGNEV     DT R   FV+PA++N++
Sbjct  61    DLERLATNPSEAQTWVQTNVLNFRQSVRFKYIAVGNEVSPVYGDTTRLAQFVLPAMKNIY  120

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+ +AGLQ +IK +TA  + ++ N+YPP+QG FR D +  ++P++ FL    +PLLANI
Sbjct  121   NAIRSAGLQDQIKVSTAIETGLIGNSYPPSQGAFRGDVRAYLDPIIGFLVYAKSPLLANI  180

Query  658   YPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             Y YFSY GNP  I L YALFT  +        GY+NLFDA+LD++Y+AV++AGG ++ +V
Sbjct  181   YTYFSYIGNPRDISLPYALFTSPSVMAWDGDKGYQNLFDAMLDALYSAVERAGGGSLEVV  240

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAG F A+T NA TYY NLI HVK   GTP +P RSIETYLFAM+DEN K G+
Sbjct  241   VSESGWPSAGAFGASTDNARTYYSNLIRHVK--EGTPKRPKRSIETYLFAMFDENNKLGE  298

Query  310   AVEKNFGVFRPDKSSKYQLNFN  245
               E++FGVF P K  KY LNF+
Sbjct  299   ETERHFGVFFPTKEPKYNLNFD  320



>ref|XP_003540349.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
 gb|KHN20625.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=326

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 174/333 (52%), Positives = 229/333 (69%), Gaps = 7/333 (2%)
 Frame = -3

Query  1243  MAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFN  1064
             M+A+ LL+  L  IT  +SIGVCYG  G+NLPS  + ++L K+NGI  +R+Y  D     
Sbjct  1     MSAIFLLVGMLSSITVAQSIGVCYGVIGDNLPSRQEVVDLYKTNGIGRMRIYYPDEEALQ  60

Query  1063  AARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDT  884
             A RGS + +I+DV+   LQ LTD   A  WV   + PY+  VNFKYIAVGNE+   +P+T
Sbjct  61    ALRGSGIELIMDVAKETLQSLTDSNAATDWVNKYVTPYSQDVNFKYIAVGNEI---HPNT  117

Query  883   ARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPV  704
                  +++ A+ N+ NA+++A LQ  IK +TA  S ++TN+YPPN GVF  DA+  + P+
Sbjct  118   NE-AQYILSAMTNIQNAISSANLQ--IKVSTAIDSTLITNSYPPNDGVFTSDAEPYIKPI  174

Query  703   VQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAV  524
             + FL   G PLLAN+YPYF+Y  N   IPL+YALFT++  N  GY+NLFDA+LDS+YAA+
Sbjct  175   INFLVSNGAPLLANVYPYFAY-ANDQSIPLAYALFTQQGNNDVGYQNLFDAMLDSIYAAL  233

Query  523   QKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLF  344
             +K G  N+ IVVSE+GWPS GG  A+  NA TYY NLI H     GTP +PG SIETYLF
Sbjct  234   EKVGASNLQIVVSESGWPSEGGAGASIDNAGTYYANLIRHASSGNGTPKRPGESIETYLF  293

Query  343   AMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             AM+DEN K G   E++FG+F PDKS KYQL+FN
Sbjct  294   AMFDENQKQGADTERHFGLFNPDKSPKYQLSFN  326



>ref|XP_006365201.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Solanum tuberosum]
Length=333

 Score =   343 bits (880),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 163/318 (51%), Positives = 213/318 (67%), Gaps = 1/318 (0%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             EV+ +GVCYG+NGNNLP   D +NL KSNGI  +RVY   P   NA + SNL +++ + N
Sbjct  16    EVQCVGVCYGRNGNNLPLAEDVVNLYKSNGITSMRVYDPIPETLNALKDSNLQIMLCIPN  75

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              KLQ LTDP  A  WV AN++ Y   V  +YI+VGNE+      ++++V F++PA+ NV 
Sbjct  76    DKLQALTDPKEAYNWVVANVINYIKQVRIRYISVGNEISPLIARSSQFVPFLLPAMENVQ  135

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
               + +  L  ++K +TA    +L NTYPP+Q  FR D    + P+++FL Q   PLLANI
Sbjct  136   RVITSFRLNDRVKISTAIEMGLLANTYPPSQSTFRGDVTSFIKPIIEFLKQNNAPLLANI  195

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPN-VPIVVSE  482
             YPYF+Y G+P  + LSYA+F +  P+ +GY NLFDA+LDS+Y A+ K  G N V IVVSE
Sbjct  196   YPYFAYIGDPEHVSLSYAIFAQPEPDSSGYTNLFDAMLDSIYYAIGKVIGENKVEIVVSE  255

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPS GGF  +   A  YYRNLI H K  AGT  KPG+ IETYLFAM+DENLK G   E
Sbjct  256   SGWPSEGGFGGSMGIATIYYRNLIGHAKSKAGTIHKPGKPIETYLFAMFDENLKIGAETE  315

Query  301   KNFGVFRPDKSSKYQLNF  248
             ++FGVF PDK+ KY L F
Sbjct  316   RHFGVFHPDKTQKYNLTF  333



>dbj|BAG34628.1| beta-1,3-glucanase [Lotus japonicus]
Length=330

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 169/321 (53%), Positives = 223/321 (69%), Gaps = 7/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NG+NLPS  + ++L KS GI  +R+Y  D     A RGSN+ VI+ 
Sbjct  17    EFTGAQSVGVCYGANGDNLPSRQEVVDLYKSKGISRMRIYDQDEEALQALRGSNIEVILG  76

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N KLQ LTD   A  WV   +  Y++ V  KYIAVGNEV  G+         V+PA+R
Sbjct  77    VPNDKLQSLTDAGAANDWVNKYVKAYSD-VKIKYIAVGNEVPPGDAAAGS----VLPAMR  131

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+++A LQG+IK + A  ++++ N YPP  GVF D+A+  + P+V FL   G PLL
Sbjct  132   NIQNAISSANLQGQIKVSLAIKTSLVANPYPPENGVFSDEARSYITPIVDFLKSNGAPLL  191

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+Y YF++  +P    L+YALFT++  N AGY+NLFDA+LD +YAA++KAG P++ +VV
Sbjct  192   ANVYTYFAHVDDPQHNSLNYALFTQQEKNDAGYQNLFDAILDGVYAALEKAGTPDMKVVV  251

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSAGG AA  QNA +YY+NLI HVKG  GTP +P   IETYLFAM+DEN K    
Sbjct  252   SESGWPSAGGDAANVQNAESYYKNLIQHVKG--GTPKRPNGPIETYLFAMFDENRKPDPE  309

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E+NFG+FRPDKS+KYQ+NFN
Sbjct  310   TERNFGLFRPDKSAKYQINFN  330



>ref|XP_004251356.2| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-N 
[Solanum lycopersicum]
Length=339

 Score =   343 bits (880),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 218/321 (68%), Gaps = 1/321 (0%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I + + IGVCYGKNGN+LPS  D ++L  +N I  ++ Y        A +GS + VI+D
Sbjct  19    QIIDAQGIGVCYGKNGNDLPSTIDVVSLYLANNITKMKTYDPINETLPALKGSEIEVILD  78

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +LQ L DP +A +WV +N+V Y   V  KYI VGNEV   N  T+++V F++PAL 
Sbjct  79    IPNSQLQSLGDPQQADSWVTSNVVNYVQQVKIKYINVGNEVSPVNNGTSQFVPFLLPALT  138

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV  ++  +GLQ ++K TTA  + +L  TYPP++  FR+D  G + P+++ L Q   PL 
Sbjct  139   NVQQSITKSGLQDQVKVTTAIETGLLATTYPPSESAFREDTIGFIKPIIELLKQNNAPLQ  198

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGP-NVPIV  491
             ANIYPYF Y G+P+ + L YALFT+  P+P+GY NLFDA+LDS+Y A+ KA G  N+ IV
Sbjct  199   ANIYPYFGYIGDPAHVTLPYALFTQEQPDPSGYTNLFDAMLDSVYYAIDKAIGENNIEIV  258

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPS GG  AT +NAAT+Y  LI H K N GT  +PG+ I+TYLFAM+DENLK G 
Sbjct  259   VSESGWPSEGGLGATVENAATFYTKLIEHAKSNNGTLHRPGKPIQTYLFAMFDENLKIGA  318

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
               EK+FGVF P+K+ KY + F
Sbjct  319   ETEKHFGVFHPNKTQKYNITF  339



>ref|XP_003607315.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES89512.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score =   342 bits (876),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 172/321 (54%), Positives = 224/321 (70%), Gaps = 7/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T VESIGVCYG  GNNLPS  D +NL KS GI  +R++  D P   A RGSN+ +I+D
Sbjct  16    QFTAVESIGVCYGMIGNNLPSRQDVVNLYKSRGINQMRIFFPDEPALQALRGSNIELILD  75

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V+   L  L +   A  WV   + PYA  V  KYI+VGNE+   N + A+Y+   +PA++
Sbjct  76    VAKETLPSLRNANEATNWVNKYVRPYAQNVKIKYISVGNEI-KPNDNEAQYI---LPAMQ  131

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+++A LQG+IK +TA    ++  ++PPN GVF D AK  + P++ FL   G PLL
Sbjct  132   NIQNAISSANLQGQIKVSTAIDMTLIGKSFPPNDGVFSDQAKPYIQPIINFLNNNGAPLL  191

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF+Y G+   IPL YALF ++  N  GY+NLFDA LDS+YAA++K G   V IVV
Sbjct  192   ANVYPYFAYIGDKVNIPLDYALFRQQGNNAVGYQNLFDAQLDSVYAALEKVGASGVKIVV  251

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSA G +A+T NAATYYRNLI+HVK   GTP +PG +IETYLFAM+DEN K G A
Sbjct  252   SESGWPSAAGDSASTDNAATYYRNLINHVKN--GTPKRPG-AIETYLFAMFDENQKTGAA  308

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E++FG+F PDKS KYQ++FN
Sbjct  309   TEQHFGLFNPDKSPKYQISFN  329



>ref|XP_008356363.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=347

 Score =   341 bits (874),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 229/323 (71%), Gaps = 9/323 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLP+E + ++L KSNGI  +R+Y  +     A RGSN+ + V 
Sbjct  30    QITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTVT  89

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +L  L D A A AWVQ N+ PY+  V FKYIAVGNE+   + +    V  ++PA++
Sbjct  90    ILNSELPALNDAAAATAWVQKNVQPYSADVRFKYIAVGNEIHHXSAE----VGSLLPAIQ  145

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++ N +PP+ GV+ D A   + PV+ FL  +G PLL
Sbjct  146   NIHSAIVAANLQGQIKVSTAIDTTLVANPFPPSDGVY-DAANQFIXPVIDFLVSSGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  NPS I L+YALFT +    P+   Y +LFDALLD+ YAA++KAG PN+ 
Sbjct  205   VNVYPYFSYXDNPS-IDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNME  263

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG  AT QNAAT+Y+NLI+HV    GTP +PG++IETYLFAM+DENLK 
Sbjct  264   IVVSESGWPSEGGDQATPQNAATFYQNLINHVTSTTGTPKRPGKAIETYLFAMFDENLKD  323

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G  VEK+FGVF P+K  KYQL F
Sbjct  324   GKPVEKHFGVFSPNKQPKYQLTF  346



>gb|KDP22122.1| hypothetical protein JCGZ_25953 [Jatropha curcas]
Length=333

 Score =   339 bits (870),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 229/323 (71%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             + + +SIGVCYG NGNNLP + + ++L KSNGI  +R+Y  D     A +GSN+ +++ V
Sbjct  17    VIDAQSIGVCYGMNGNNLPPQQEVVDLYKSNGIGRMRIYHPDEATLQALKGSNIELMLAV  76

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQE++D + A  WVQ NIV YA+ V F+Y++VGNEV  G+ +     NFV+PA++N
Sbjct  77    PNDKLQEVSDASAATTWVQNNIVAYASDVKFRYVSVGNEVHPGDGNA----NFVLPAMQN  132

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V NA+A+AGLQ +IK +TA  + ++  ++PP+ G+F D A G + P++ FL + G PLL 
Sbjct  133   VQNAIASAGLQNQIKVSTAIDTTLIGKSFPPSDGIFSDSASGYIKPIIDFLVKNGAPLLV  192

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFS+  N   + L YALFT           GY+NLFDALLDS+YAA++K+GG ++ 
Sbjct  193   NVYPYFSHINNKQDVSLEYALFTSPGVVVQDGQYGYQNLFDALLDSVYAALEKSGGGSLQ  252

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG AAT  NA TYY+NLISHVK   GTP K G++IETYLFA++DEN K 
Sbjct  253   IVVSESGWPSEGGDAATPDNAGTYYKNLISHVK--QGTPKKAGQAIETYLFALFDENQKE  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FGVF P+K  KYQ++F
Sbjct  311   A-GIEQHFGVFLPNKQPKYQISF  332



>gb|AFK41254.1| unknown [Lotus japonicus]
Length=343

 Score =   338 bits (868),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 167/321 (52%), Positives = 221/321 (69%), Gaps = 7/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NG+NLPS  + ++L KS GI  +R+Y  D     A RGSN+ VI+ 
Sbjct  30    EFTGAQSVGVCYGANGDNLPSRQEVVDLYKSKGINRMRIYDQDEEALQALRGSNIEVILG  89

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N KLQ LTD   A  WV   +  Y++ V  KYIAVGNEV  G+         V+PA+R
Sbjct  90    VPNDKLQSLTDAGAANDWVNKYVKAYSD-VKIKYIAVGNEVPPGDAAAGS----VLPAMR  144

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+++  LQG+IK + A  ++++ N YPP  GVF D+A+  + P+V FL   G PLL
Sbjct  145   NIQNAISSTNLQGQIKVSLAIKTSLVANPYPPENGVFSDEARSYITPIVDFLKSNGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+Y YF++  +P    L+YALFT++  N AGY+NLFDA+LD +YAA++KAG P + +VV
Sbjct  205   ANVYTYFAHVDDPQHNSLNYALFTQQEKNDAGYQNLFDAILDGVYAALEKAGAPYMKVVV  264

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSAGG AA  QNA +YY+NLI HVKG  GTP +P   IETYLFAM+DEN K    
Sbjct  265   SESGWPSAGGDAANVQNAESYYKNLIQHVKG--GTPKRPNGPIETYLFAMFDENRKPDPE  322

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E+NFG+FRPDKS+KYQ++FN
Sbjct  323   TERNFGLFRPDKSAKYQISFN  343



>gb|AAF44667.2|AF239617_1 beta-1,3-glucanase [Vitis vinifera]
Length=360

 Score =   339 bits (869),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 230/326 (71%), Gaps = 8/326 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT V+S+GVCYG  GNNLP  +  + L KS  I  +R+Y  +     A RGSN+ +++ 
Sbjct  16    QITGVKSVGVCYGMLGNNLPPASQVVALYKSRNIDRMRIYDPNQAALQALRGSNIQLMLG  75

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V N  LQ L T+P++A++WVQ N+  Y   V+F+YIAVGNEV   N  T+R+  FV+PA+
Sbjct  76    VPNSDLQGLATNPSQAQSWVQRNVRNYWPGVSFRYIAVGNEVSPVNGGTSRFAQFVLPAM  135

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             RN+  ALA+AGLQ ++K +TA    +L N+YPP+QG FR D +G ++P+++FL    +PL
Sbjct  136   RNIRAALASAGLQDRVKVSTAIDLTLLGNSYPPSQGAFRGDVRGYLDPIIRFLVDNKSPL  195

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             LANIYPYFSY GNP  I L YALFT  +        GY+NLFDA+LD++Y+A+++AGG +
Sbjct  196   LANIYPYFSYSGNPKDISLPYALFTANSVVVWDGQRGYKNLFDAMLDALYSALERAGGAS  255

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             + +V+SE+GWPSAGGF  T  NA TY  NLI HVKG  GTP +PGR+IETYLFAM+DEN 
Sbjct  256   LEVVLSESGWPSAGGFGTTVDNARTYNSNLIRHVKG--GTPKRPGRAIETYLFAMFDEN-  312

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNFN  245
             K    +EK+FG+F P+K  KY +NF+
Sbjct  313   KKEPQLEKHFGLFFPNKQPKYSINFS  338



>ref|XP_006365200.1| PREDICTED: uncharacterized protein LOC102593111 [Solanum tuberosum]
Length=671

 Score =   348 bits (894),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 165/318 (52%), Positives = 216/318 (68%), Gaps = 1/318 (0%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             + + IGVCYG NGN+LPS  D + L K+N I  +R Y        A +GS + VI+D+ N
Sbjct  354   DAQVIGVCYGMNGNDLPSPIDVVALYKANNITKMRTYDPITETLPALKGSEIEVILDIPN  413

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              KLQ L DP  A  WV  N++ YA  V  +YI VGNE+   N  T+++V F++PAL NV 
Sbjct  414   SKLQSLGDPQEADNWVTTNVMSYAKEVKIRYINVGNEISPVNNGTSQFVPFLLPALTNVQ  473

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              ++  +GLQ ++K +TA  + +L NTYPP+Q  FR+D  G + P+++FL Q   PL ANI
Sbjct  474   QSITKSGLQDQVKVSTAIETGLLANTYPPSQSAFREDTMGFIKPIIEFLKQNNAPLQANI  533

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGP-NVPIVVSE  482
             YPYF Y G+P  + L YALFT+  P+P+GY NLFDA+LDS+Y A+ KA G  NV IVVSE
Sbjct  534   YPYFGYIGDPEHVQLPYALFTQEQPDPSGYTNLFDAMLDSVYYAIDKAIGENNVEIVVSE  593

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPS GG  A+ +NAATYY+NL+ H K   GT  +PG+ IETYLFAM+DENLK G   E
Sbjct  594   SGWPSDGGVGASVENAATYYKNLMDHAKSTKGTIYRPGKPIETYLFAMFDENLKIGADTE  653

Query  301   KNFGVFRPDKSSKYQLNF  248
             K+FGVF PDK+ KY L F
Sbjct  654   KHFGVFHPDKTQKYNLTF  671



>gb|KDO61190.1| hypothetical protein CISIN_1g048190mg [Citrus sinensis]
Length=336

 Score =   337 bits (865),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/316 (51%), Positives = 229/316 (72%), Gaps = 10/316 (3%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             IGVCYG+  NNLPS+ + ++L  +NGI  +R+Y  + P   A RGSN+ +++ V+N  +Q
Sbjct  26    IGVCYGRVANNLPSDQEVVDLYHANGITKMRIYDPNEPTLQALRGSNIELMLGVANGDIQ  85

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              L+DP+ A +WVQ NI+ +   V F+YIAVGNE+   +    +  +FV+PA++N++NA+ 
Sbjct  86    ALSDPSAASSWVQNNILAFTPDVVFRYIAVGNEISPSD----QAASFVLPAMQNIYNAIV  141

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +A LQ +IK +TA  +++L N+YPP+ G F DDA   + P+VQFL QTG PLLAN+YPYF
Sbjct  142   SANLQDQIKVSTAIQTSLLGNSYPPSAGSFADDANSYIGPIVQFLKQTGAPLLANVYPYF  201

Query  646   SYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             SY G+   I L YALFT +         GY+NLFDA LD++Y+A++KAG P++ +VVSET
Sbjct  202   SYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGVPDLEVVVSET  261

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPS GG AAT  NA+TYY+N+I+HV  +AGTP +PG+ IETYLFAM+DEN KG    E+
Sbjct  262   GWPSEGGEAATVDNASTYYKNVINHV--SAGTPKRPGKVIETYLFAMFDENQKGPAETER  319

Query  298   NFGVFRPDKSSKYQLN  251
             +FG+F P+K SKY+L+
Sbjct  320   HFGLFSPNKQSKYELD  335



>ref|XP_006470762.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=347

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 230/320 (72%), Gaps = 10/320 (3%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             +   IGVCYG+  NNLPS+ + ++L  +NGI  +R+Y  + P   A RGSN+ +++ V+N
Sbjct  33    QTRPIGVCYGRVANNLPSDQEVVDLYHANGITKMRIYDPNEPTLQALRGSNIELMLGVAN  92

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
               +Q L+DP+ A +WVQ NI+ +   V F+YIAVGNE+   +    +  +FV+PA++N++
Sbjct  93    GDIQALSDPSAASSWVQNNILAFTPDVVFRYIAVGNEISPSD----QAASFVLPAMQNIY  148

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+ +A LQ +IK +TA  +++L N+YPP+ G F DDA   + P+VQFL QTG PLLAN+
Sbjct  149   NAIVSANLQDQIKVSTAIQTSLLGNSYPPSAGSFADDANSYIGPIVQFLKQTGAPLLANV  208

Query  658   YPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSY G+   I L YALFT +         GY+NLFDA LD++Y+A++KAG P++ +V
Sbjct  209   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGVPDLEVV  268

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSETGWPS GG AAT  NA+TYY+N+I+HV  +AGTP +PG+ IETYLFAM+DEN KG  
Sbjct  269   VSETGWPSEGGEAATVDNASTYYKNVINHV--SAGTPKRPGKVIETYLFAMFDENQKGPA  326

Query  310   AVEKNFGVFRPDKSSKYQLN  251
               E++FG+F P+K SKY+L+
Sbjct  327   ETERHFGLFSPNKQSKYELD  346



>ref|NP_001267896.1| class I beta-1,3-glucanase precursor [Vitis vinifera]
 gb|ABB82365.1| class I beta-1,3-glucanase [Vitis vinifera]
 gb|ADG35963.1| chitinase [Vitis hybrid cultivar]
Length=360

 Score =   337 bits (863),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 228/326 (70%), Gaps = 8/326 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT V+S+GVCYG  GNNLP  +  + L KS  I  +R+Y  +     A RGSN+ +++ 
Sbjct  16    QITGVKSVGVCYGMLGNNLPPASQVVALYKSRNIDRMRIYDPNQAALQALRGSNIQLMLG  75

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V N  LQ L T+P++A++WVQ N+  Y   V+F+YIAVGNEV   N  T+R+  FV+PA+
Sbjct  76    VPNSDLQGLATNPSQAQSWVQRNVRNYWPGVSFRYIAVGNEVSPVNGGTSRFAQFVLPAM  135

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             RN+  ALA+AGLQ ++K +TA    +L N+YPP+QG FR D +G ++P+++FL    +PL
Sbjct  136   RNIRAALASAGLQDRVKVSTAIDLTLLGNSYPPSQGAFRGDVRGYLDPIIRFLVDNKSPL  195

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             LANIYPYF Y GNP  I L YALFT  +        GY+NLFDA+LD++Y+A+ +AGG +
Sbjct  196   LANIYPYFGYSGNPKDISLPYALFTANSVVVWDGQRGYKNLFDAMLDALYSALGRAGGAS  255

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             + +VVSE+GWPSAGGF  T  NA TY  NLI HVKG  GTP +PGR+IETYLFAM+DEN 
Sbjct  256   LEVVVSESGWPSAGGFGTTVDNARTYNSNLIRHVKG--GTPKRPGRAIETYLFAMFDEN-  312

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNFN  245
             K    +EK+FG+F P+K  KY +NF+
Sbjct  313   KKEPQLEKHFGLFFPNKQPKYSINFS  338



>ref|XP_008373020.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=347

 Score =   336 bits (861),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 173/323 (54%), Positives = 229/323 (71%), Gaps = 9/323 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLP+E + ++L KSNGI  +R+Y  +     A RGSN+ + V 
Sbjct  30    QITGAQSVGVCYGRNGNNLPAEGEVVDLYKSNGIGRMRIYEPNEATLQALRGSNIELTVT  89

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N +L  L D A A AWVQ N+ PY+  V FKYIAVGNE+   + +    V  ++PA++
Sbjct  90    ILNXELXALNDAAAATAWVQKNVQPYSADVXFKYIAVGNEIHHXSAE----VGSLLPAIQ  145

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  + ++ N +PP+ GV+ D A   + PV+ FL  +G PLL
Sbjct  146   NIHSAIVAANLQGQIKVSTAIDTTLVANPFPPSDGVY-DAANQFIXPVIDFLVSSGAPLL  204

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  NPS I L+YALFT +    P+   Y +LFDALLD+ YAA++KAG PN+ 
Sbjct  205   VNVYPYFSYXDNPS-IDLAYALFTSQGVVVPDGTRYPSLFDALLDAQYAALEKAGAPNME  263

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG  AT QNAAT+Y+NLI+HV    GTP +PG++IETYLFAM+DENLK 
Sbjct  264   IVVSESGWPSEGGDQATPQNAATFYQNLINHVTSTTGTPKRPGKAIETYLFAMFDENLKD  323

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G  VEK+FGVF P+K  KYQL F
Sbjct  324   GKPVEKHFGVFSPNKQPKYQLTF  346



>ref|XP_006446183.1| hypothetical protein CICLE_v10017983mg, partial [Citrus clementina]
 gb|ESR59423.1| hypothetical protein CICLE_v10017983mg, partial [Citrus clementina]
Length=316

 Score =   335 bits (858),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 229/316 (72%), Gaps = 10/316 (3%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             IGVCYG+  NNLPS+ + ++L  +NGI  +R+Y  + P   A RGSN+ +++ V+N  +Q
Sbjct  6     IGVCYGRVANNLPSDQEVVDLYHANGITKMRIYDPNEPTLQALRGSNIELMLGVANGDIQ  65

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              L+DP+ A +WVQ NI+ +   V F+YIAVGNE+   +    +  +FV+PA++N++NA+ 
Sbjct  66    ALSDPSAASSWVQNNILAFTPDVVFRYIAVGNEISPSD----QAASFVLPAMQNIYNAIV  121

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +A LQ +IK +TA  +++L N+YPP+ G F D+A   + P+VQFL QTG PLLAN+YPYF
Sbjct  122   SANLQDQIKVSTAMQTSLLGNSYPPSAGSFADNANSYIGPIVQFLKQTGAPLLANVYPYF  181

Query  646   SYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             SY G+   I L YALFT +         GY+NLFDA LD++Y+A++KAG P++ +VVSET
Sbjct  182   SYIGDTKDIRLDYALFTSQGTLVQDGSLGYQNLFDASLDALYSALEKAGVPDLEVVVSET  241

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPS GG AAT  NA+TYY+N+I+HV  +AGTP +PG+ IETYLFAM+DEN KG    E+
Sbjct  242   GWPSEGGEAATVDNASTYYKNVINHV--SAGTPKRPGKVIETYLFAMFDENQKGPAETER  299

Query  298   NFGVFRPDKSSKYQLN  251
             +FG+F P+K SKY+L+
Sbjct  300   HFGLFSPNKQSKYELD  315



>gb|KEH30624.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=331

 Score =   335 bits (859),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 220/321 (69%), Gaps = 7/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NGNNLP++   ++L KS GI  +R+Y  D  +  A R SN+ VI+ 
Sbjct  18    EFTGAQSVGVCYGGNGNNLPTKKAVVDLYKSKGIGKIRIYNPDEGILQALRSSNIEVILG  77

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  L+ LT+   A  WV   +  Y+  V  KYIAVGNEV  G+ +++     V+PA++
Sbjct  78    VPNNVLKSLTNAQTASDWVNKYVKAYS-IVKIKYIAVGNEVHPGSAESSS----VLPAMQ  132

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+  A+++A LQG+IK +TA  + ++  +YPP  GVF D A G + P+V FL   G+PLL
Sbjct  133   NIQKAISSANLQGQIKVSTAIDTTLIGKSYPPKDGVFSDAASGYIKPIVNFLVSNGSPLL  192

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYF+Y  N   I L YALFT++  N  GY+NLFDA+LDS+YAA++K GG NV IVV
Sbjct  193   ANVYPYFAYVNNQQSIGLDYALFTKQGKNEVGYQNLFDAMLDSIYAALEKVGGSNVKIVV  252

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  A+  NA TYY NLI HVKG  GTP +P   IETYLFAM+DEN K G  
Sbjct  253   SESGWPSQGGTGASAGNAGTYYGNLIKHVKG--GTPKRPNGPIETYLFAMFDENQKPGSE  310

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +E++FG+FRPDKS KYQ++FN
Sbjct  311   IERHFGLFRPDKSPKYQISFN  331



>ref|XP_003607316.1| Glucan endo-1 3-beta-d-glucosidase [Medicago truncatula]
 gb|AES89513.1| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=329

 Score =   335 bits (858),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 167/320 (52%), Positives = 219/320 (68%), Gaps = 7/320 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +T VESIGVCYG  GNNLPS  D +NL +S GI  +R+Y  D     A RGSN+ +I+DV
Sbjct  17    LTAVESIGVCYGMIGNNLPSRQDVVNLYRSRGINQMRLYFPDEQALQALRGSNIELILDV  76

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             +   L  L +   A  WV   + PYA  V  KYI VGNE+   + +       ++PA++N
Sbjct  77    ARETLNSLRNANEATNWVNRYVKPYARDVKIKYITVGNEIKPYDSEAQS----ILPAMQN  132

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + NA++AA LQG+IK + A    ++ N+YPPN GVF D AK  + P++ FL   G PLLA
Sbjct  133   IQNAISAANLQGQIKVSIAIDMTLIGNSYPPNNGVFTDQAKPYIQPIINFLKNNGAPLLA  192

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y  N   I L YALF ++  N  GYRNLFDA LDS+YAA++K G   V IVVS
Sbjct  193   NVYPYFAYINNKQSISLDYALFRQQGNNQVGYRNLFDAQLDSVYAALEKVGASGVKIVVS  252

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPSAGG +A+T NAATYYRNLI+HV+   GTP +PG +IETYLFAM+DEN K G A 
Sbjct  253   ESGWPSAGGDSASTDNAATYYRNLINHVRN--GTPKRPG-AIETYLFAMFDENQKTGAAT  309

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             E++FG+F P+++ KYQ++FN
Sbjct  310   EQHFGLFNPNRTPKYQISFN  329



>gb|ACZ74626.1| beta-1,3-glucanase form RRII Gln 3 [Hevea brasiliensis]
Length=374

 Score =   336 bits (861),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 227/324 (70%), Gaps = 8/324 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             IT+ + +GVCYGK GNNLP  ++ I L K + I+ +R+Y  +  V  A RGSN+ +I+ V
Sbjct  33    ITDAQ-VGVCYGKLGNNLPPASEVIALYKQSNIKRMRIYDPNQEVLQALRGSNIELILGV  91

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  LQ LT+P+ A +WVQ N+  + ++V  +YIAVGNE+   N  TA    FV+PA+RN
Sbjct  92    PNSDLQSLTNPSNANSWVQKNVRDFWSSVRLRYIAVGNEISPVNGGTAWLAQFVLPAMRN  151

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +H+A+ +AGLQ +IK +TA    ++ NTYPP+ G FRDD +  ++P++ FL+   +PLLA
Sbjct  152   IHDAIRSAGLQDQIKVSTAIDLTLMGNTYPPSAGAFRDDVRSYLDPIIGFLSSIRSPLLA  211

Query  664   NIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             NIYPYF+Y GNP  I L YALFT  +        GY+NLFDA LD++Y+A+++A G ++ 
Sbjct  212   NIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLE  271

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +P R+IETYLFAM+DEN K 
Sbjct  272   VVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPDRAIETYLFAMFDENQKQ  329

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
              + VEK+FG+F PDK  KY LNF+
Sbjct  330   PE-VEKHFGLFFPDKRPKYNLNFS  352



>gb|AFJ97274.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   335 bits (860),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 237/342 (69%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L++     L IT+ + +GVCYG  GNNLPS ++ I L K + I+ +R+Y  
Sbjct  14    LPSRTTVMLLLIFFTASLGITDAQ-VGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ A +WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NRAVLEALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ KIK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNGGTAWLAQFVLPAMRNIHDAIRSAGLQDKIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+ + +PLLANIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSSRSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK+FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHFGLFFPDKRPKYNLNF  351



>emb|CDP09617.1| unnamed protein product [Coffea canephora]
Length=384

 Score =   335 bits (860),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 227/324 (70%), Gaps = 10/324 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NGNNLPS+   INL K NGI+ +R+Y  DP V NA +G+N+ ++VDV 
Sbjct  64    TGVQSIGVCYGLNGNNLPSKQAVINLYKRNGIQRMRIYGPDPEVLNALKGTNIELLVDVP  123

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  +Q++ T+P+ A  WVQ NI  Y+ AV F+YI+VGNEV  G+   ARYV    PA+  
Sbjct  124   NESIQDVATNPSAAANWVQNNIKKYSPAVKFRYISVGNEVPVGSA-VARYVG---PAMEK  179

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +  A+A+AGLQ +IK +T+  + ++TN+YPP+ G F ++AK  + P++ FL Q   PLL 
Sbjct  180   IQKAIASAGLQNQIKVSTSILTGLVTNSYPPSHGSFSNEAKPFIKPIINFLVQNNAPLLV  239

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNP----NPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY G+ + IPL YALFT +         GY+NLFDA+LD  Y+A++K GG  V 
Sbjct  240   NVYPYFSYIGSRNTIPLDYALFTSQKTVVQDGKLGYQNLFDAMLDGHYSALEKEGGSKVN  299

Query  496   IVVSETGWPSAGG-FAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
             IVVSETGWPSAG   AA++ NA TYY+N+I HV    GTP KPG  IETYLFAM+DEN K
Sbjct  300   IVVSETGWPSAGNPPAASSANAGTYYKNVIRHVMSGKGTPKKPGAGIETYLFAMFDENQK  359

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G+  EK+FG+F P++  KY ++F
Sbjct  360   RGEETEKHFGLFSPNQQPKYGISF  383



>gb|KHN03122.1| Glucan endo-1,3-beta-glucosidase, partial [Glycine soja]
Length=316

 Score =   333 bits (854),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/313 (52%), Positives = 217/313 (69%), Gaps = 6/313 (2%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             + + +G+CYG NGNNLPS+ + ++L KS GI  +R+Y+ D     A RGSN+ + +DV+ 
Sbjct  10    QTQVVGICYGVNGNNLPSKQEVVDLYKSKGISRMRIYSPDEETLQALRGSNIELTMDVAG  69

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
               LQ LTDP  A  WV   +  Y+  VNFKYI VGNEV   N D A Y+   +PA+ N+ 
Sbjct  70    ETLQSLTDPNVATDWVHRYVTSYSQDVNFKYIVVGNEVHP-NYDVAPYI---LPAMINIQ  125

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+++A LQ K+  +TA  + +LTN+YPPN GVF  DA   + P++ FL + G PLLAN+
Sbjct  126   NAISSANLQTKV--STAIDATLLTNSYPPNNGVFTADASPYIGPIINFLVKNGAPLLANV  183

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             YPYF+Y  +   I L YALFT++  N  GY+NLFDA+LDS+YAA++K G PN+ IVVSE+
Sbjct  184   YPYFAYVNDQQDINLPYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGAPNLEIVVSES  243

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAGG  A  +NA  YY NLISH    +GTP +PGR I+T+LFAM+DEN K G   E+
Sbjct  244   GWPSAGGDGALVENAHAYYYNLISHANSGSGTPKRPGRPIQTFLFAMFDENQKPGAETER  303

Query  298   NFGVFRPDKSSKY  260
             +FG+F PDKSSKY
Sbjct  304   HFGLFNPDKSSKY  316



>ref|XP_008227227.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=343

 Score =   334 bits (856),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/315 (52%), Positives = 222/315 (70%), Gaps = 7/315 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S+GVCYG+NGNNLPS T+ ++L KSNGI  +R+Y  + P + A +GSN+ + V 
Sbjct  16    QITGAQSVGVCYGQNGNNLPSPTEVVDLYKSNGIGRMRIYEPNYPTYEALKGSNIELTVT  75

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             +   KLQ L D   A  WV+ N+  Y   V FKYIAVGNEV   +P  A    +++PA++
Sbjct  76    IPIDKLQGLNDADAATDWVEKNVQAYLPDVKFKYIAVGNEV---HPTDAE-AQYLLPAIQ  131

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+H+A+ AA LQG+IK +TA  ++ + N YPP+ G + D AK  + PV+ FLA  G PLL
Sbjct  132   NIHSAIVAANLQGQIKVSTAIDTSHVDNDYPPSAGKYSDAAKSFITPVINFLASNGAPLL  191

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
              N+YPYFSY  NP+ I L+YALFT +    P+   Y+NLFDALLD+ Y+A++KA   NV 
Sbjct  192   VNVYPYFSYTANPADIDLAYALFTSQGVTMPDGVKYQNLFDALLDAQYSALEKANASNVE  251

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG AAT +NA T+Y+NLI+HV G +GTP +PG++IETYLFAM+DEN+K 
Sbjct  252   IVVSESGWPSKGGDAATPKNAQTFYQNLINHVTGTSGTPKRPGKAIETYLFAMFDENIKA  311

Query  316   GDAVEKNFGVFRPDK  272
             G  V ++FG+F P K
Sbjct  312   GSEVVRHFGIFYPTK  326



>ref|XP_006423938.1| hypothetical protein CICLE_v10029843mg [Citrus clementina]
 gb|ESR37178.1| hypothetical protein CICLE_v10029843mg [Citrus clementina]
 gb|KDO56353.1| hypothetical protein CISIN_1g048613mg [Citrus sinensis]
Length=336

 Score =   333 bits (855),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 226/320 (71%), Gaps = 10/320 (3%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             +   IGVCYG+  NNLPS+ + +NL  SNGI  +R+Y  + P   A RGSN+ +++ + N
Sbjct  22    QTRPIGVCYGRVANNLPSDQEVVNLYHSNGITKMRIYDPNEPTLQALRGSNIELMLGIPN  81

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
               LQ L++P+ A +WVQ NI+ +   V F+Y+AVGNE+   +       +FV+PA++N++
Sbjct  82    GDLQALSNPSVASSWVQNNILAFTPDVKFRYVAVGNEISPSD----EAASFVLPAMQNIY  137

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+A+A LQ + K +TA  +++L N+YPP+ G F D+A   + P+VQFL QTG PLLANI
Sbjct  138   NAIASANLQAQTKVSTAIQTSLLGNSYPPSAGSFADNANSYIGPIVQFLKQTGAPLLANI  197

Query  658   YPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSY G+   I L YALFT +         GY+NLFDA LD++Y+A++KAG P+V +V
Sbjct  198   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGAPDVEVV  257

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSETGWPS GG AAT  NA TYY+N+I+HV  +AGTP +PG+ IETYLFAM+DEN KG  
Sbjct  258   VSETGWPSEGGDAATVDNANTYYKNMINHV--SAGTPKRPGKVIETYLFAMFDENQKGPA  315

Query  310   AVEKNFGVFRPDKSSKYQLN  251
               E++FG+F P+K  KY+L+
Sbjct  316   ETERHFGLFSPNKQPKYKLD  335



>gb|ABN03966.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   335 bits (859),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 236/343 (69%), Gaps = 8/343 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L+      + IT+ + +GVCYG  GNNLP  ++ I L K + I  +R+Y  
Sbjct  14    LPSRTTVMLLLFFFTASVGITDAQ-VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVRNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               +NP+++FL+   +PLLANIYPYF+Y GNP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVK   GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             P R+IETYLFAM+DEN K  + VEK+FG+F P+K  KY LNF+
Sbjct  311   PKRAIETYLFAMFDENKKQPE-VEKHFGLFFPNKWQKYNLNFS  352



>ref|XP_010045033.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=339

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/324 (52%), Positives = 224/324 (69%), Gaps = 11/324 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              +T  +SIGVCYG+NG+NLPS+ + I L K+N I  +R+Y  D     A +GSN+ +I+ 
Sbjct  22    ELTGAQSIGVCYGRNGDNLPSQAEVIELYKANSIGRMRIYDPDQATLQALKGSNIELILG  81

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             V N  LQ LTDPA A  WVQ N+V +++ V  KYIAVGNEV  G+        +V+PA++
Sbjct  82    VLNDNLQALTDPAAASNWVQNNVVAFSSDVKIKYIAVGNEVPPGDTKA----QYVLPAMQ  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NALA+A LQG+IK +TA  S++L  +YPP+ G F D A   ++P++ FL   G+PLL
Sbjct  138   NIQNALASANLQGQIKVSTAIDSSLLAVSYPPSSGAFSDPANQFISPIISFLVNNGSPLL  197

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
             ANIYPY SY  N   I L+YALFT            Y+NLFDAL+DS+Y+A++KAGG ++
Sbjct  198   ANIYPYVSYVQNMQSIDLAYALFTSPGVVVTDGSYQYQNLFDALVDSLYSALEKAGGSSL  257

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
             PIVVSE+GWPS GG AA+ +NA TYY NLISHVK   GTP K G++IE YLFAM+DENLK
Sbjct  258   PIVVSESGWPSEGGTAASPENAGTYYANLISHVK--QGTPKKAGQAIEAYLFAMFDENLK  315

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
                  E++FG+F P K  KYQ++F
Sbjct  316   AA-GTEQHFGLFTPSKQPKYQISF  338



>gb|ABG49448.1| beta-1,3-glucanase [Hevea brasiliensis]
 gb|ABN03965.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   335 bits (858),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 236/342 (69%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L++     L IT+ + +GVCYG  GNNLPS ++ I L K + I+ +R+Y  
Sbjct  14    LPSRTTVMLLLIFFTASLGITDAQ-VGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ A +WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNGGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+   +PLLANIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSIRSPLLANIYPYFTYADNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK+FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHFGLFFPDKRPKYNLNF  351



>ref|XP_003548789.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Glycine max]
Length=331

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/313 (52%), Positives = 217/313 (69%), Gaps = 6/313 (2%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             + + +G+CYG NGNNLPS+ + ++L KS GI  +R+Y+ D     A RGSN+ + +DV+ 
Sbjct  25    QTQVVGICYGVNGNNLPSKQEVVDLYKSKGISRMRIYSPDEETLQALRGSNIELTMDVAG  84

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
               LQ LTDP  A  WV   +  Y+  VNFKYI VGNEV   N D A Y+   +PA+ N+ 
Sbjct  85    ETLQSLTDPNVATDWVHRYVTSYSQDVNFKYIVVGNEVHP-NYDVAPYI---LPAMTNIQ  140

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+++A LQ K+  +TA  + +LTN+YPPN GVF  DA   + P++ FL + G PLLAN+
Sbjct  141   NAISSANLQTKV--STAIDATLLTNSYPPNNGVFTADASPYIGPIINFLVKNGAPLLANV  198

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             YPYF+Y  +   I L YALFT++  N  GY+NLFDA+LDS+YAA++K G PN+ IVVSE+
Sbjct  199   YPYFAYVNDQQDINLPYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGAPNLEIVVSES  258

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAGG  A  +NA  YY NLI+H    +GTP +PGR I+T+LFAM+DEN K G   E+
Sbjct  259   GWPSAGGDGALVENAHAYYYNLINHANSGSGTPKRPGRPIQTFLFAMFDENQKPGAETER  318

Query  298   NFGVFRPDKSSKY  260
             +FG+F PDKSSKY
Sbjct  319   HFGLFNPDKSSKY  331



>gb|ABN09655.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 236/343 (69%), Gaps = 8/343 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L+      + IT+ + +GVCYG  GNNLP  ++ I L K + I  +R+Y  
Sbjct  14    LPSRTTVMLLLFFFTASVGITDAQ-VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               +NP+++FL+   +PLLANIYPYF+Y GNP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVK   GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             P R+IETYLFAM+DEN K  + VEK+FG+F P+K  KY LNF+
Sbjct  311   PKRAIETYLFAMFDENKKQPE-VEKHFGLFFPNKWQKYNLNFS  352



>gb|ACY91851.1| beta-1,3-glucanase form RRII Gln 2 [Hevea brasiliensis]
Length=374

 Score =   334 bits (857),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/343 (49%), Positives = 236/343 (69%), Gaps = 8/343 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L+      + IT+ + +GVCYG  GNNLP  ++ I L K + I  +R+Y  
Sbjct  14    LPSRTTVMLLLFFFTASVGITDAQ-VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               +NP+++FL+   +PLLANIYPYF+Y GNP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVK   GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             P R+IETYLFAM+DEN K  + VEK+FG+F P+K  KY LNF+
Sbjct  311   PKRAIETYLFAMFDENKKQPE-VEKHFGLFFPNKWQKYNLNFS  352



>ref|XP_004505798.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=342

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 218/317 (69%), Gaps = 5/317 (2%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  +SIGVCYG   NNLP   + I L K+NGI  +R+Y  D     A R SN+ +++ V 
Sbjct  24    TAAQSIGVCYGIVANNLPPAAEVIELFKTNGIAKMRIYNPDQATLEALRRSNIELVIGVP  83

Query  1021  NPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  +Q ++ D + A +WVQ NI+ Y+N V F+YI VGNE+   +P +     FV+PA++N
Sbjct  84    NEDMQSISNDVSSATSWVQNNIINYSNDVIFRYIVVGNEINPNDPTS----QFVLPAMQN  139

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA A LQ +IK +TA    +L ++YPP+QG F  DA   + P+V FL   G PLLA
Sbjct  140   IYAALATANLQNQIKISTAIQVGLLGSSYPPSQGEFSPDAIPYLTPIVNFLVTNGAPLLA  199

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y GN + IPL YALFT++     GY+NLFDA+LD++YAA  K G  N+ IVVS
Sbjct  200   NVYPYFAYIGNEADIPLEYALFTQQGTTDIGYQNLFDAMLDALYAAALKIGASNLQIVVS  259

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPSAGG  ATT+NAA YY NLI+HV    GTP++PG+ IETYLFAM+DENLK G A 
Sbjct  260   ESGWPSAGGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLFAMFDENLKPGAAS  319

Query  304   EKNFGVFRPDKSSKYQL  254
             E+ FG+F PDKS KY +
Sbjct  320   EQYFGLFTPDKSQKYNI  336



>gb|AES89518.2| glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=421

 Score =   336 bits (861),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 219/322 (68%), Gaps = 10/322 (3%)
 Frame = -3

Query  1207  HITEVE----SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLA  1040
             HI++V     +IGVCYG  GNNLPS+ + ++L KS GI  +R+Y  D  V  A RGSN+ 
Sbjct  86    HISQVSVTFSTIGVCYGVLGNNLPSKQEVVDLYKSKGIGKMRIYYPDQEVLQALRGSNIE  145

Query  1039  VIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVM  860
             +I+ V+   L  LTD   A  WVQ  + PYA  V  KYI VGNE+   N + A+Y+    
Sbjct  146   LILGVTKETLSSLTDAGEATNWVQKYVTPYAQDVKIKYITVGNEI-KPNDNEAQYI---A  201

Query  859   PALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTG  680
              A++N+ NA+++A LQG+IK +TA    ++ N+YPPN GVF D A   + P++ FL + G
Sbjct  202   TAMQNIQNAISSANLQGQIKVSTAIDMTLIGNSYPPNAGVFTDQANSYIQPIINFLVKNG  261

Query  679   NPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              PLLAN+YPYF+Y GN   I L Y LF ++  N  GY N+FDA+LDS+YAA++K GG NV
Sbjct  262   APLLANVYPYFAYIGNKQSISLDYVLFKQQGNNEVGYNNIFDAMLDSVYAALEKVGGSNV  321

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPS GG +A+  NAATYY NLI+H+K   GTP +PG +IETYLFAM+DEN K
Sbjct  322   KIVVSESGWPSKGGDSASIDNAATYYSNLINHIKN--GTPKRPGAAIETYLFAMFDENQK  379

Query  319   GGDAVEKNFGVFRPDKSSKYQL  254
              G   E+++G+F PDKS KY +
Sbjct  380   TGATTEQHYGLFNPDKSPKYHV  401



>emb|CAB38443.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=352

 Score =   333 bits (855),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 233/342 (68%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L+      + IT+ + +GVCYG  GNNLP  ++ I L K + I  +R+Y  
Sbjct  14    LPSRTTVMLLLFFFAASVGITDAQ-VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NRAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVLFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               +NP+++FL+   +PLLANIYPYF+Y GNP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLNPIIRFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD +Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVK   GTP +
Sbjct  253   ATLDVLYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKQFGLFFPDKWQKYNLNF  351



>gb|AAR06588.1| beta-1,3-glucanase [Vitis riparia]
Length=344

 Score =   333 bits (853),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 178/321 (55%), Positives = 228/321 (71%), Gaps = 9/321 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYG NG+NLPS +  INL KSNGI  +R+Y  +     A +GS + +I+DV N  
Sbjct  28    QSIGVCYGTNGDNLPSASQVINLYKSNGIGSMRIYDPNSDTLQALKGSGIELILDVPNTS  87

Query  1012  LQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             LQ L +D + A  WVQ N+V YA+ V F+YIA GNEV     + A+Y  +V+PA++NV +
Sbjct  88    LQSLASDASDASTWVQNNVVNYASDVKFRYIAAGNEVLPTGSN-AQYAQYVLPAMKNVQS  146

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             A+ +AGLQG+IK +TATYS+VL  +YPP+ G F  D    +NP++ FLA+ G+PLLANIY
Sbjct  147   AITSAGLQGQIKVSTATYSSVLGTSYPPSAGSFSSDVSSFINPIISFLAENGSPLLANIY  206

Query  655   PYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             PYFSY GN   I L YALFT            Y+NLFDALLD++YAA+ KAGG N+ IVV
Sbjct  207   PYFSYTGNTQSIQLDYALFTSPEVVVKDGSYQYQNLFDALLDALYAALGKAGGSNLKIVV  266

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG AAT  NA TYY+NLI+HVKG  GTP K G +IETYLFAM+DEN K G  
Sbjct  267   SESGWPSEGGTAATVDNARTYYKNLINHVKG--GTPRKSG-AIETYLFAMFDENQKTGLE  323

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F P + SKYQ++F+
Sbjct  324   TEKHFGLFTPSQESKYQISFS  344



>gb|AAP87281.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   333 bits (854),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 236/342 (69%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L++     L IT+ + +GVCYG  GNNLP  ++ I L K + I+ +R+Y  
Sbjct  14    LPSRTTVMLLLIFFTASLGITDAQ-VGVCYGMQGNNLPPVSEVIALYKQSNIKRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ A +WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NRAVLEALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVLFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNGGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+   +PLLANIYPYF+Y GNP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSIRSPLLANIYPYFTYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK+FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHFGLFFPDKRPKYNLNF  351



>ref|XP_006480384.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=378

 Score =   333 bits (855),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 226/320 (71%), Gaps = 10/320 (3%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             +   IGVCYG+  NNLPS+ + +NL  SNGI  +R+Y  + P   A RGSN+ +++ + N
Sbjct  64    QTRPIGVCYGRVANNLPSDQEVVNLYHSNGITKMRIYDPNEPTLQALRGSNIELMLGIPN  123

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
               LQ L++P+ A +WVQ NI+ +   V F+Y+AVGNE+   +       +FV+PA++N++
Sbjct  124   GDLQALSNPSVASSWVQNNILAFTPDVKFRYVAVGNEISPSD----EAASFVLPAMQNIY  179

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+A+A LQ + K +TA  +++L N+YPP+ G F D+A   + P+VQFL QTG PLLANI
Sbjct  180   NAIASANLQAQTKVSTAIQTSLLGNSYPPSAGSFADNANSYIGPIVQFLKQTGAPLLANI  239

Query  658   YPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSY G+   I L YALFT +         GY+NLFDA LD++Y+A++KAG P+V +V
Sbjct  240   YPYFSYIGDTKDIRLDYALFTSQGTPVQDGSLGYQNLFDASLDALYSALEKAGAPDVEVV  299

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSETGWPS GG AAT  NA TYY+N+I+HV  +AGTP +PG+ IETYLFAM+DEN KG  
Sbjct  300   VSETGWPSEGGDAATVDNANTYYKNMINHV--SAGTPKRPGKVIETYLFAMFDENQKGPA  357

Query  310   AVEKNFGVFRPDKSSKYQLN  251
               E++FG+F P+K  KY+L+
Sbjct  358   ETERHFGLFSPNKQPKYKLD  377



>pdb|4HPG|A Chain A, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4HPG|B Chain B, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4HPG|C Chain C, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4HPG|D Chain D, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis
 pdb|4IIS|A Chain A, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
 pdb|4IIS|B Chain B, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
 pdb|4IIS|C Chain C, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
 pdb|4IIS|D Chain D, Crystal Structure Of A Glycosylated Beta-1,3-glucanase 
(hev B 2), An Allergen From Hevea Brasiliensis (space Group 
P41)
Length=316

 Score =   331 bits (848),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/318 (52%), Positives = 223/318 (70%), Gaps = 7/318 (2%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +GVCYG  GNNLP  ++ I L K + I  +R+Y  +  V  A RGSN+ +I+ V N  LQ
Sbjct  2     VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNQAVLEALRGSNIELILGVPNSDLQ  61

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+   N  TA    FV+PA+RN+H+A+ 
Sbjct  62    SLTNPSNAKSWVQKNVRGFWSSVRFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIR  121

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +AGLQ +IK +TA    ++ N+YPP+ G FRDD +  +NP+++FL+   +PLLANIYPYF
Sbjct  122   SAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYF  181

Query  646   SYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             +Y GNP  I L YALFT  +        GY+NLFDA LD++Y+A+++A G ++ +VVSE+
Sbjct  182   TYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSES  241

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAG FAAT  N  TY  NLI HVK   GTP +P R+IETYLFAM+DEN K  + VEK
Sbjct  242   GWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPKRAIETYLFAMFDENKKQPE-VEK  298

Query  298   NFGVFRPDKSSKYQLNFN  245
             +FG+F P+K  KY LNF+
Sbjct  299   HFGLFFPNKWQKYNLNFS  316



>gb|ABN09654.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   332 bits (851),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 170/342 (50%), Positives = 237/342 (69%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L++     L IT+ + +GVCYG  GNNLPS ++ I L K + I+ +R+Y  
Sbjct  14    LPSRTTVMLLLIFFTASLGITDAQ-VGVCYGMQGNNLPSVSEVIALYKKSNIKRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ A +WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNGGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+ + +PLLANIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSSXSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK+FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHFGLFFPDKRPKYNLNF  351



>gb|AAG24921.1|AF311749_1 beta-1,3-glucanase [Hevea brasiliensis]
Length=316

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/317 (52%), Positives = 220/317 (69%), Gaps = 7/317 (2%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +GVCYG  GNNLP  ++ I L K + I  +R+Y  +  V  A RGSN+ +I+ V N  LQ
Sbjct  2     VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDPNRAVLEALRGSNIELILGVPNSDLQ  61

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+   N  TA    FV+PA+RN+H+A+ 
Sbjct  62    SLTNPSNAKSWVQKNVRGFWSSVLFRYIAVGNEISPVNRGTAWLAQFVLPAMRNIHDAIR  121

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +AGLQ +IK +TA    ++ N+YPP+ G FRDD +  +NP+++FL+   +PLLANIYPYF
Sbjct  122   SAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLNPIIRFLSSIRSPLLANIYPYF  181

Query  646   SYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             +Y GNP  I L YALFT  +        GY+NLFDA LD +Y+A+++A G ++ +VVSE+
Sbjct  182   TYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDVLYSALERASGGSLEVVVSES  241

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAG FAAT  N  TY  NLI HVK   GTP +P R+IETYLFAM+DEN K  + VEK
Sbjct  242   GWPSAGAFAATFDNGRTYLSNLIQHVK--RGTPKRPNRAIETYLFAMFDENKKQPE-VEK  298

Query  298   NFGVFRPDKSSKYQLNF  248
              FG+F PDK  KY LNF
Sbjct  299   QFGLFFPDKWQKYNLNF  315



>ref|XP_002513528.1| Lichenase precursor, putative [Ricinus communis]
 gb|EEF48931.1| Lichenase precursor, putative [Ricinus communis]
Length=343

 Score =   330 bits (847),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 225/323 (70%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             IT+ +SIG CYGKNGNNLPSE + ++L ++N I  +R+Y  D P   A +GSN+ +I+ V
Sbjct  27    ITDAQSIGACYGKNGNNLPSEQEVVSLYQANRIGRMRIYHPDQPTLQALKGSNIELILGV  86

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  L++L D + A  WV+ N+V +A+ V  +YIAVGNEV  G+ + A    FV+PA++N
Sbjct  87    PNDNLRDLADASAATNWVRDNVVAFASEVKIRYIAVGNEVPPGDSNAA----FVLPAMQN  142

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + NA+ +A LQG+IK +TA  + +L  ++PP+ G+F D+A   + P++ FL   G PLLA
Sbjct  143   IQNAIVSANLQGQIKVSTAIDTTLLGKSFPPSDGIFSDNANSYITPIINFLKANGAPLLA  202

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+Y YFSY  NP  I L YALFT        +P  Y+NLFDAL+D++YAA++KAG  ++ 
Sbjct  203   NVYTYFSYTENPQSISLEYALFTSPGVVVTDDPYKYQNLFDALMDALYAALEKAGAADMQ  262

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS G  AAT QNA TYY NLI+HV  N GTP K G++IETYLFAM+DENLK 
Sbjct  263   IVVSESGWPSEGSGAATAQNAGTYYSNLINHV--NQGTPRKSGQAIETYLFAMFDENLKE  320

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FG+F P K  KY++ F
Sbjct  321   A-GIEQHFGLFSPSKQPKYKITF  342



>gb|ABJ74161.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=321

 Score =   329 bits (844),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/317 (52%), Positives = 222/317 (70%), Gaps = 7/317 (2%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +GVCYG  GNNLP  ++ I L K + I+ +R+Y  +  V  A RGSN+ +I+ V N  LQ
Sbjct  2     VGVCYGMQGNNLPPVSEVIALYKQSNIKRMRIYDPNRAVLEALRGSNIELILGVPNSDLQ  61

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              LT+P+ A +WVQ N+  + ++V F+YIAVGNE+   N  TA    FV+PA+RN+H+A+ 
Sbjct  62    SLTNPSNANSWVQKNVRGFWSSVLFRYIAVGNEISPVNGGTAWLAQFVLPAMRNIHDAIR  121

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +AGLQ +IK +TA    ++ N+YPP+ G FRDD +  ++P++ FL+   +PLLANIYPYF
Sbjct  122   SAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVRSYLDPIIGFLSSIRSPLLANIYPYF  181

Query  646   SYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             +Y GNP  I L YALFT  +        GY+NLFDA LD++Y+A+++A G ++ +VVSE+
Sbjct  182   TYAGNPRDISLPYALFTSPSVVVWDGQRGYKNLFDATLDALYSALERASGGSLEVVVSES  241

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAG FAAT  N  TY  NLI HVKG  GTP +P R+IETYLFAM+DEN K  + VEK
Sbjct  242   GWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPNRAIETYLFAMFDENKKQPE-VEK  298

Query  298   NFGVFRPDKSSKYQLNF  248
             +FG+F PDK  KY LNF
Sbjct  299   HFGLFFPDKRPKYNLNF  315



>ref|XP_004505795.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=339

 Score =   330 bits (845),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/317 (51%), Positives = 216/317 (68%), Gaps = 5/317 (2%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  +S+GVCYG   NNLP   + I+L K+NGI  +R+Y  D     A RGSN+ +++ + 
Sbjct  24    TAAQSVGVCYGIVANNLPPAAEVIDLFKTNGIARMRIYNPDQATLEALRGSNIELVIGIP  83

Query  1021  NPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  +Q +  D + A +WVQ NI+ Y+N V F+YI VGNE+   +P +     FV+PA++N
Sbjct  84    NEDMQSIANDVSSATSWVQNNIINYSNNVIFRYIVVGNEINPSDPTS----QFVLPAMQN  139

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA A LQ +IK +TA    +L ++YPP+QG F  DA   + P+V FL   G PLLA
Sbjct  140   IYAALATADLQNQIKISTAIQVGLLGSSYPPSQGEFSPDAIPYLTPIVNFLVTNGAPLLA  199

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y GN   IPL YALFT++     GY+NLFDA+LD++YAA  K G  N+ IVVS
Sbjct  200   NVYPYFAYIGNEQDIPLEYALFTKQGTTDIGYQNLFDAMLDALYAAALKIGASNLQIVVS  259

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPSAGG  ATT+NAA YY NLI+HV    GTP++PG+ IETYLFAM+DEN K G A 
Sbjct  260   ESGWPSAGGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLFAMFDENQKPGAAT  319

Query  304   EKNFGVFRPDKSSKYQL  254
             E+ FG+F PDK  KY +
Sbjct  320   EQYFGLFTPDKLQKYNI  336



>ref|XP_002278123.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 sp|A7PQW3.2|E13B_VITVI RecName: Full=Glucan endo-1,3-beta-glucosidase; AltName: Full=(1->3)-beta-glucan 
endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; Flags: Precursor [Vitis 
vinifera]
Length=344

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 180/321 (56%), Positives = 231/321 (72%), Gaps = 9/321 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYG+NGNNLPS +  INL KSNGI  +R+Y  +     A RGS++ +I+DV N  
Sbjct  28    QSIGVCYGRNGNNLPSASQVINLYKSNGIGSMRIYDPNSDTLQALRGSDIELILDVPNTD  87

Query  1012  LQELTDPARAK-AWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             LQ L   A A   WVQ N+V YA+ V F+YIAVGNEV     + A+Y  +V+PA++NV +
Sbjct  88    LQSLASDASAAATWVQNNVVNYASEVKFRYIAVGNEVLPTGSN-AQYAQYVLPAMKNVQS  146

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             A+ +AGLQ +IK +TAT+SAVL  +YPP++G F DD    +NP++ FLA+ G+PLLANIY
Sbjct  147   AITSAGLQDQIKVSTATFSAVLGKSYPPSEGSFSDDVSSFINPIISFLAENGSPLLANIY  206

Query  655   PYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             PYFSY G+   I L YALFT            Y+NLFDALLD++YAA++KAGG N+ IVV
Sbjct  207   PYFSYTGDTQNIRLDYALFTASGVVVQDGSYQYQNLFDALLDALYAALEKAGGSNLKIVV  266

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG AAT  NA TYY+NLI+HVKG  GTP K G +IETYLFAM+DEN K G  
Sbjct  267   SESGWPSEGGTAATVDNARTYYKNLINHVKG--GTPRKSG-AIETYLFAMFDENQKTGLE  323

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F P + SKYQ++F+
Sbjct  324   TEKHFGLFTPGQESKYQISFS  344



>ref|XP_007015141.1| Glucan endo-1,3-beta-glucosidase, acidic, putative [Theobroma 
cacao]
 gb|EOY32760.1| Glucan endo-1,3-beta-glucosidase, acidic, putative [Theobroma 
cacao]
Length=345

 Score =   330 bits (845),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 178/351 (51%), Positives = 239/351 (68%), Gaps = 14/351 (4%)
 Frame = -3

Query  1279  MALQHPLPCKSSMAAlilllvglLHITEV---ESIGVCYGKNGNNLPSETDTINLMKSNG  1109
             MA   P   ++SMAA++LLL  L+  TE+   +SIGVCYG+NG+NLP   + ++L +SNG
Sbjct  1     MASFKPRNTRASMAAVLLLLGLLVSQTEITGAQSIGVCYGRNGDNLPGAAEVVSLYQSNG  60

Query  1108  IRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFK  929
             I  +R+Y  +    NA RGSN+ +I+DV   KL++L+D A A  WVQ N+V ++  V F+
Sbjct  61    IGRMRIYDPNQETLNALRGSNIELILDVPLDKLRDLSDAAAANDWVQRNVVSFSPDVKFR  120

Query  928   YIAVGNEVFAGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPN  749
             YIA+GNEV   +   A    FV+PA+ NVHNALAAAGLQ +IK +TA  S+V+  + PP+
Sbjct  121   YIAIGNEVSPSDQLAA----FVLPAMTNVHNALAAAGLQDQIKVSTAVASSVIGTSSPPS  176

Query  748   QGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTE----RNPN  581
              G F D +   + P++ FLA  G PLLANIYPYFSY G+P+ I L +ALFT         
Sbjct  177   AGSFSDTSSPFITPIISFLASNGAPLLANIYPYFSYTGDPTNIGLDFALFTAPGVVVQDG  236

Query  580   PAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHV  401
                Y+NLFDAL+DS+Y+A++K  G NV IVVSE+GWPS GG AA   NA  YYRNLI+HV
Sbjct  237   QYSYQNLFDALVDSLYSALEKTEGANVNIVVSESGWPSEGGNAANVDNAGKYYRNLINHV  296

Query  400   KGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
                 GTP + G++IETYLFAM+DENLK     E++FG+F P++  KYQ+N 
Sbjct  297   T--QGTPKRSGQAIETYLFAMFDENLKAA-GFEQHFGLFLPNRQPKYQINL  344



>ref|NP_001266064.1| glucan endo-1,3-beta-glucosidase-like precursor [Cicer arietinum]
 emb|CAA10167.1| glucan endo-1,3-beta-d-glucosidase [Cicer arietinum]
Length=331

 Score =   329 bits (843),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 168/321 (52%), Positives = 215/321 (67%), Gaps = 7/321 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
               T  +S+GVCYG NGNNLP++   ++L KS GI  +R+Y  D     A + SN+ VI+ 
Sbjct  18    EFTGAQSVGVCYGANGNNLPTKQAVVDLYKSKGIGKIRLYNPDEGALQALKDSNIEVILG  77

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             VSN  L  LT+   A  WV   +  Y+  V  KYI+VGNE+   +P+     N V+PAL+
Sbjct  78    VSNDALNSLTNAQSATDWVNKYVKAYSPNVKIKYISVGNEIHPDSPEA----NSVLPALQ  133

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+++A L G+IK +TA  + ++  +YPPN GVF D A G + P+V FL   G+PLL
Sbjct  134   NIQNAISSANL-GQIKVSTAIDTTLIGKSYPPNDGVFSDAASGYIKPIVNFLVSNGSPLL  192

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             AN+YPYFSY  N   I L YALFT++  N  GY+NLFDA+LDS+YAA++K GG NV IVV
Sbjct  193   ANVYPYFSYVNNQQSIGLDYALFTKQGNNEVGYQNLFDAILDSIYAALEKVGGSNVKIVV  252

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPS GG  A+  NA TYY NLI H KG  GTP +P   IETYLFAM+DENLK    
Sbjct  253   SESGWPSQGGTGASVGNAQTYYGNLIKHAKG--GTPKRPNGPIETYLFAMFDENLKTDPE  310

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              E+ FG+F PDKS KYQLNFN
Sbjct  311   TERYFGLFNPDKSPKYQLNFN  331



>ref|XP_007035767.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
 gb|EOY06693.1| Glycosyl hydrolase superfamily protein [Theobroma cacao]
Length=426

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/326 (52%), Positives = 223/326 (68%), Gaps = 7/326 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             IT  ES+GVCYG  GNNLPS  + I L KS  IR +R+Y  +P    A RGSN+ V++ V
Sbjct  85    ITGAESVGVCYGMLGNNLPSAWEVIELYKSRNIRRMRLYDPNPAALQALRGSNIEVMLGV  144

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  LQ L +P+ A++WVQ N+V Y  +V F+YIAVGNEV   N  TA    FV+PAL N
Sbjct  145   PNSDLQNLANPSNAQSWVQRNVVSYWPSVRFRYIAVGNEVSPVNGGTAWLAQFVLPALVN  204

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V NA+ +AGL   IK + A    ++ N+YPP+ G FR D +  ++P++  LA    PLLA
Sbjct  205   VFNAVRSAGLHNDIKVSIAIDMTLIGNSYPPSAGAFRGDVRSYLDPIIGHLAWASTPLLA  264

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNP----NPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             NIYPYFS+ GNP  I L YALFT  +P       GY+NLFDA+LD++Y+A++ AG P++ 
Sbjct  265   NIYPYFSHAGNPRDISLPYALFTSPSPVAWDQGRGYQNLFDAMLDALYSALENAGQPSLG  324

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGGFA + +NA TY   LI HV+G  GTP +PGR+IETYLFA++DEN K 
Sbjct  325   VVVSESGWPSAGGFATSVENAQTYLSKLIGHVQG--GTPKRPGRAIETYLFALFDENQKE  382

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN*G  239
              + +EK+FG+F P+K  KY L+F  G
Sbjct  383   PE-LEKHFGLFSPNKQPKYPLSFGGG  407



>gb|ABN09653.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   330 bits (845),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 167/342 (49%), Positives = 234/342 (68%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L++     + IT+ + +GVCYG  GNNLPS ++ I L K + I+ +R+Y  
Sbjct  14    LPSRTTVMLLLIFFTASIGITDAQ-VGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ A +WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNGGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+   +PLL NIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSIRSPLLTNIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFA +DEN K  + VEK+FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFATFDENKKQPE-VEKHFGLFFPDKRPKYNLNF  351



>ref|XP_003607321.1| Endo-beta-1 3-glucanase [Medicago truncatula]
Length=398

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 160/310 (52%), Positives = 212/310 (68%), Gaps = 6/310 (2%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG  GNNLPS+ + ++L KS GI  +R+Y  D  V  A RGSN+ +I+ V+   L  
Sbjct  75    GVCYGVLGNNLPSKQEVVDLYKSKGIGKMRIYYPDQEVLQALRGSNIELILGVTKETLSS  134

Query  1003  LTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALAA  824
             LTD   A  WVQ  + PYA  V  KYI VGNE+   N + A+Y+     A++N+ NA+++
Sbjct  135   LTDAGEATNWVQKYVTPYAQDVKIKYITVGNEI-KPNDNEAQYI---ATAMQNIQNAISS  190

Query  823   AGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYFS  644
             A LQG+IK +TA    ++ N+YPPN GVF D A   + P++ FL + G PLLAN+YPYF+
Sbjct  191   ANLQGQIKVSTAIDMTLIGNSYPPNAGVFTDQANSYIQPIINFLVKNGAPLLANVYPYFA  250

Query  643   YRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWPSA  464
             Y GN   I L Y LF ++  N  GY N+FDA+LDS+YAA++K GG NV IVVSE+GWPS 
Sbjct  251   YIGNKQSISLDYVLFKQQGNNEVGYNNIFDAMLDSVYAALEKVGGSNVKIVVSESGWPSK  310

Query  463   GGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFGVF  284
             GG +A+  NAATYY NLI+H+K   GTP +PG +IETYLFAM+DEN K G   E+++G+F
Sbjct  311   GGDSASIDNAATYYSNLINHIKN--GTPKRPGAAIETYLFAMFDENQKTGATTEQHYGLF  368

Query  283   RPDKSSKYQL  254
              PDKS KY +
Sbjct  369   NPDKSPKYHV  378



>emb|CDP20080.1| unnamed protein product [Coffea canephora]
Length=339

 Score =   328 bits (841),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 171/326 (52%), Positives = 228/326 (70%), Gaps = 10/326 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             ITEV+SIGVCYG NGNNLPS+ D INL    GI+ +R+YA D  V NA RG+N+ ++VDV
Sbjct  18    ITEVQSIGVCYGLNGNNLPSKQDVINLYNRYGIQRMRIYAPDHEVLNALRGTNIELLVDV  77

Query  1024  SNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             +N  +  + T+P+ A  WVQ NI  Y+ AV F+YIAVGNEV + +   A+YV    PA+ 
Sbjct  78    ANEDIPSIATNPSAAANWVQNNIKNYSPAVKFRYIAVGNEV-SLSSSIAQYVG---PAME  133

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
              + +ALA+AGLQ +IK +T+  + +L+ + PP+QG F ++AK  + P++  L Q   PLL
Sbjct  134   RIQSALASAGLQNQIKVSTSVAANLLSVSSPPSQGSFSNEAKPFIKPIINLLVQNNAPLL  193

Query  667   ANIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              N+YPYFSY G+P  I L YALFT +         GYRN+FDA+LD+ Y+A++K GG NV
Sbjct  194   VNVYPYFSYIGDPVNIHLDYALFTSQGIVVQDGSFGYRNIFDAILDAHYSALEKEGGSNV  253

Query  499   PIVVSETGWPSAGG-FAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
              IVVSETGWPS G   AA++ NA TYYRN+ISHVK   GTP +P   IETYLFAM+DEN 
Sbjct  254   DIVVSETGWPSDGNPPAASSGNAGTYYRNVISHVKSGQGTPRRPRTGIETYLFAMFDENQ  313

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNFN  245
             K G   E++FG+F P++ SKY ++FN
Sbjct  314   KLGAETERHFGLFFPNQQSKYGISFN  339



>gb|AAA87456.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   329 bits (843),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 168/342 (49%), Positives = 233/342 (68%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
              P ++++  L+      + IT+ + +GVCYG  GNNLP  ++ I L K + I  +R+Y  
Sbjct  14    FPSRTTVMLLLFFFAASVGITDAQ-VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NRAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVLFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+   +PLLANIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSIRSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK+FG+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHFGLFFPDKRPKYNLNF  351



>ref|XP_003537741.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
Length=338

 Score =   327 bits (839),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 173/342 (51%), Positives = 232/342 (68%), Gaps = 9/342 (3%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             L   ++M++++LL+  L  IT  +SIGVCYG  GNNLPS  + ++L K+NGI  +R+Y  
Sbjct  3     LKKSTAMSSILLLVGMLSSITVAQSIGVCYGVLGNNLPSRQEVVDLYKTNGIGRMRIYYP  62

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             D     A RGS + +I+DV+   LQ +TDP  A  WV   +  Y+  VNFKYIAVGNE+ 
Sbjct  63    DEEALQALRGSGIELIMDVAKETLQSMTDPNAATDWVNKYVTAYSQDVNFKYIAVGNEI-  121

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLT-NTYPPNQGVFRDDA  725
               +P+T     +++ A+ N+ NA+++A LQ  IK +TA  S  +   +YPPN  VF  DA
Sbjct  122   --HPNTNE-AQYILSAMTNIQNAISSANLQ--IKVSTAIDSTFIAPPSYPPNDAVFTSDA  176

Query  724   KGLMNPVVQFLAQTGNPLLANIYPYFSYRGNPS-QIPLSYALFTERNPNPAGYRNLFDAL  548
             +  + P++ FL +   PLLAN+YPYF+Y  +    IPL+YALFT++  N AGY+NLFDA+
Sbjct  177   EPYVKPIIDFLVRNEAPLLANVYPYFAYANDQQNSIPLAYALFTQQGNNDAGYQNLFDAM  236

Query  547   LDSMYAAVQKAGGPNVPIVVSETGWPS-AGGFAATTQNAATYYRNLISHVKGNAGTPLKP  371
             LDS+YAAV+K G  N+ IVVSE+GWPS  GG  A+  NA TY  NLISH  G +GTP +P
Sbjct  237   LDSIYAAVEKVGASNLQIVVSESGWPSEGGGTGASIDNAGTYNANLISHASGGSGTPKRP  296

Query  370   GRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             G SIETYLFAM+DEN K     E++FG+FRPDKS KYQLNFN
Sbjct  297   GGSIETYLFAMFDENQKQDAETERHFGLFRPDKSPKYQLNFN  338



>ref|XP_006365202.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Solanum tuberosum]
Length=380

 Score =   329 bits (843),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 210/318 (66%), Gaps = 1/318 (0%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             EV+ +GVCYG+NGNNLP   D +NL K+NGI  +RVY       NA + SN+ +++ + N
Sbjct  63    EVQCVGVCYGRNGNNLPLAEDVVNLYKANGITSMRVYDPILETLNALKDSNIQIMLCIPN  122

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              KLQ LTDP  A  WV AN++ Y   V  +YI+VGNE+      +++++ F++PA+ NV 
Sbjct  123   DKLQALTDPKEAYNWVVANVINYIKQVRIRYISVGNEISPLIAGSSQFIPFLLPAMENVQ  182

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
               + +  L  ++K +TA  + +L NTYPP+Q  F  D    +  +++FL Q   PLLANI
Sbjct  183   RVITSFRLNDRVKISTAIETGLLANTYPPSQSTFHGDVTSFIKSIIEFLKQNNVPLLANI  242

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPN-VPIVVSE  482
             YPYF+Y G+P  + LSYA+F +  P+ +GY NLFDA+LDS+Y A+ KA G N V IVVSE
Sbjct  243   YPYFAYIGDPDHVSLSYAIFAQPEPDSSGYTNLFDAMLDSIYYAIGKAIGENKVEIVVSE  302

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWP  G F  +   A  YYRNLI H K  AGT  KPG+ IETYLFAM+DENLK G   E
Sbjct  303   SGWPPDGDFGGSMGIATIYYRNLIGHAKSKAGTIHKPGKPIETYLFAMFDENLKIGAETE  362

Query  301   KNFGVFRPDKSSKYQLNF  248
             K+FGVF PDK+ KY L F
Sbjct  363   KHFGVFYPDKTQKYNLTF  380



>sp|P52407.2|E13B_HEVBR RecName: Full=Glucan endo-1,3-beta-glucosidase, basic vacuolar 
isoform; AltName: Full=(1->3)-beta-glucan endohydrolase; Short=(1->3)-beta-glucanase; 
AltName: Full=Beta-1,3-endoglucanase; 
Contains: RecName: Full=Glucan endo-1,3-beta-glucosidase 
minor form 3; Contains: RecName: Full=Glucan endo-1,3-beta-glucosidase 
minor form 2; Contains: RecName: Full=Glucan endo-1,3-beta-glucosidase 
minor form 1; Contains: RecName: Full=Glucan 
endo-1,3-beta-glucosidase major form; Flags: Precursor 
[Hevea brasiliensis]
Length=374

 Score =   328 bits (840),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 167/343 (49%), Positives = 234/343 (68%), Gaps = 8/343 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
              P ++++  L+      + IT+ + +GVCYG  GNNLP  ++ I L K + I  +R+Y  
Sbjct  14    FPSRTTVMLLLFFFAASVGITDAQ-VGVCYGMQGNNLPPVSEVIALYKKSNITRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ AK+WVQ N+  + ++V F+YIAVGNE+ 
Sbjct  73    NRAVLEALRGSNIELILGVPNSDLQSLTNPSNAKSWVQKNVRGFWSSVLFRYIAVGNEIS  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNRGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+   +PLLANIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSIRSPLLANIYPYFTYAYNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             P R+IETYLFAM+DEN K  + VEK+FG+F P+K  KY LNF+
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHFGLFFPNKWQKYNLNFS  352



>gb|AEV41413.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=373

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 223/323 (69%), Gaps = 8/323 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             IT+ + +GVCYG  GNNLP  +  I+L K   I+ +R+Y  +     A RGSN+ +++ V
Sbjct  32    ITDAQ-VGVCYGMLGNNLPPASQVISLYKQANIKRMRIYDPNQAALQALRGSNIQLMLGV  90

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  LQ LT+P+ A +W+Q N+  +  +V F+YIAVGNE+   N  TA    FV+PA+RN
Sbjct  91    PNSDLQSLTNPSNANSWIQRNVRAFWPSVRFRYIAVGNEISPVNGGTASLAKFVLPAMRN  150

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++NA+ +AGLQ +IK +TA    ++ N+YPP+ G FR D +  ++P++ FL+   +PLLA
Sbjct  151   IYNAIRSAGLQDQIKVSTAIDMTLIGNSYPPSAGAFRGDVRSYLDPIIGFLSSIRSPLLA  210

Query  664   NIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             NIYPYFSY GNP  I L YALFT  +        GY+NLFDA+LD++Y+A+++AGG ++ 
Sbjct  211   NIYPYFSYAGNPRDISLPYALFTSPSIVVWDGQRGYKNLFDAMLDALYSALERAGGGSLE  270

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +PGR IETYLFAM+DEN K 
Sbjct  271   VVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKRPGRFIETYLFAMFDENQKQ  328

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
              +  EK+FG+F P+K  KY LNF
Sbjct  329   PE-FEKHFGLFFPNKQQKYNLNF  350



>ref|XP_006599939.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Glycine max]
Length=587

 Score =   333 bits (853),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/313 (51%), Positives = 215/313 (69%), Gaps = 6/313 (2%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             + + +G+CYG NGNNLPS+ + ++L KS GI  +R+Y+ D     A RGSN+ + +DV+ 
Sbjct  281   QTQVVGICYGVNGNNLPSKQEVVDLYKSKGIPRMRIYSPDEETLQALRGSNIELTMDVTG  340

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
               LQ LTDP  A  WV   +  Y+  VNFKYI VGNEV   N D A Y+   +PA+ N+ 
Sbjct  341   ETLQSLTDPNVATDWVHRYVTSYSQDVNFKYIVVGNEVHP-NYDVAPYI---LPAMTNIQ  396

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA+++A LQ K+  +TA  + ++T++YPPN GVF  DA   + P++ FL   G PLLAN+
Sbjct  397   NAISSANLQTKV--STAIDTTLVTDSYPPNNGVFTADASPYIGPIINFLVNNGAPLLANV  454

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             YPYF+Y  N   I L YALFT++  N  GY+NLFDA+LDS+YAA++K G PN+ IVVSE+
Sbjct  455   YPYFAYVNNQQDISLPYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGAPNLEIVVSES  514

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAGG  A   NA  YY NL++H  G  GTP +PGR I+T+LFAM+DEN K G   E+
Sbjct  515   GWPSAGGDGALVDNARIYYYNLLNHANGEIGTPKRPGRPIQTFLFAMFDENQKPGAETER  574

Query  298   NFGVFRPDKSSKY  260
             +FG+F PDKSSKY
Sbjct  575   HFGLFNPDKSSKY  587



>gb|KHN05500.1| Glucan endo-1,3-beta-glucosidase, partial [Glycine soja]
Length=316

 Score =   323 bits (828),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 166/319 (52%), Positives = 219/319 (69%), Gaps = 9/319 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYG  GNNLPS  + ++L K+NGI  +R+Y  D     A RGS + +I+DV+   
Sbjct  4     QSIGVCYGVLGNNLPSRQEVVDLYKTNGIGRMRIYYPDEEALQALRGSGIELIMDVAKET  63

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             LQ +TDP  A  WV   +  Y+  VNFKYIAVGNE+   +P+T     +++ A+ N+ NA
Sbjct  64    LQSMTDPNAATDWVNKYVTAYSQDVNFKYIAVGNEI---HPNTNE-AQYILSAMTNIQNA  119

Query  832   LAAAGLQGKIKATTATYSAVLT-NTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             +++A LQ  IK +TA  S  +   +YPPN  VF  DA+  + P++ FL +   PLLAN+Y
Sbjct  120   ISSANLQ--IKVSTAIDSTFIAPPSYPPNDAVFTSDAEPYVKPIIDFLVRNEAPLLANVY  177

Query  655   PYFSYRGN-PSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             PYF+Y  +  + IPL+YALFT++  N AGY+NLFDA+LDS+YAAV+K G  N+ IVVSE+
Sbjct  178   PYFAYANDQQNSIPLAYALFTQQGNNDAGYQNLFDAMLDSIYAAVEKVGASNLQIVVSES  237

Query  478   GWPS-AGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             GWPS  GG  A+  NA TY  NLISH  G +GTP +PG SIETYLFAM+DEN K     E
Sbjct  238   GWPSEGGGTGASIDNAGTYNANLISHASGGSGTPKRPGGSIETYLFAMFDENQKQDAETE  297

Query  301   KNFGVFRPDKSSKYQLNFN  245
             ++FG+FRPDKS KYQLNFN
Sbjct  298   RHFGLFRPDKSPKYQLNFN  316



>ref|XP_004297245.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=335

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 223/325 (69%), Gaps = 11/325 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NGNNLPS+T+ ++L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  16    QITGAQSAGVCYGRNGNNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  75

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++
Sbjct  76    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AKYLLPAIQ  131

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYP-PNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             N+ NA+ AA LQG+IK +TA  +  L   +  P+ G F D A   + P++ FL+  G PL
Sbjct  132   NIQNAVTAANLQGQIKVSTAIDTTFLLPDFVLPSNGAFSDAANSFITPIITFLSNNGAPL  191

Query  670   LANIYPYFSYRGNPSQIPLSYALFT----ERNPNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             L NIYPYF+Y G+P  I L YALFT    E      GY+N+FDALLD+ Y+A++KAG PN
Sbjct  192   LVNIYPYFAYIGDPVNIKLEYALFTSPGVELQDGSNGYQNIFDALLDTHYSALEKAGAPN  251

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             + IVVSE+GWPS GG AATT NA TYY  LI+HVK   GTP +P  +IETYLFAM+DENL
Sbjct  252   MAIVVSESGWPSEGGDAATTGNAGTYYSKLINHVK--TGTPKRPNGAIETYLFAMFDENL  309

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNF  248
             K G  VEK+FG+F P+K  KYQL F
Sbjct  310   KDGAEVEKHFGIFSPNKQPKYQLTF  334



>gb|AAL30420.1|AF434173_1 glucanase [Sambucus nigra]
Length=340

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 166/330 (50%), Positives = 224/330 (68%), Gaps = 16/330 (5%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I   +S+GVCYG+ GNNLPS+ D +NL K  GIR +RVY    P+  A RG ++ +I+D
Sbjct  16    QIAGAQSVGVCYGQKGNNLPSQRDVVNLYKKYGIRRMRVYDPAEPILQALRGKSIEIILD  75

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V N  LQ L ++P+ A  WVQ NI  Y+  V F+YIAVGNEV   N +  +Y++FV+P +
Sbjct  76    VPNSDLQNLASNPSAAVTWVQNNIRNYSRDVRFRYIAVGNEVDPYN-ENVQYISFVLPTM  134

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             RNVH+A+ AAGLQG+IK +TATY+ VL  T PP+ G++R + +  ++P++ FL Q   PL
Sbjct  135   RNVHDAIVAAGLQGQIKVSTATYTGVLIVTSPPSAGLYRPNVRSFIDPIINFLVQNNLPL  194

Query  670   LANIYPYFSYRGNPSQIPLSYALFT---------ERNPNPAGYRNLFDALLDSMYAAVQK  518
             L N+YP+ +  GN S I L YALFT         +RN     YRNLF A+LD+ YAA++K
Sbjct  195   LVNVYPHIAITGN-SDIQLPYALFTAPGVVVTDSDRN---LEYRNLFVAILDAHYAALEK  250

Query  517   AGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAM  338
             AGGPNV IVVSE+GWP+ G   AT  NA TY  NLI HVKG +GTP +PGR IETY+FAM
Sbjct  251   AGGPNVEIVVSESGWPTQGHPVATIDNAKTYNNNLIRHVKGRSGTPRRPGRDIETYIFAM  310

Query  337   YDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             +DE  K  D + ++FG+F P++   Y ++F
Sbjct  311   FDETQKPSD-MARHFGLFSPNQKLIYPISF  339



>ref|XP_004291760.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=346

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 223/324 (69%), Gaps = 10/324 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NG+NLPS+T+ I+L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  28    QITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++
Sbjct  88    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AQYLLPAIQ  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+ AA LQG+IK +TA  + +L  ++PP+ G F   A   + P++ FL   G PLL
Sbjct  144   NIQNAVTAANLQGQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLL  203

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              NIYPYF+Y G+P+ I L YALFT           GY+N+FDA+LD+ Y+A++KAG PN+
Sbjct  204   VNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGAPNM  263

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPS G  AAT  NA TYY NLI+HVK   GTP +P  +IETYLFAM+DENLK
Sbjct  264   VIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFAMFDENLK  321

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G  VEK+FG+F P+K  KYQL F
Sbjct  322   DGAEVEKHFGIFSPNKQPKYQLTF  345



>dbj|BAC66141.1| beta-1,3-glucanase [Fragaria x ananassa]
 dbj|BAC66184.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 171/324 (53%), Positives = 223/324 (69%), Gaps = 10/324 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NG+NLPS+T+ I+L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  28    QITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++
Sbjct  88    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AQYLLPAIQ  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+ AA LQG+IK +TA  + +L  ++PP+ G F   A   + P++ FL   G PLL
Sbjct  144   NIQNAVKAANLQGQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLL  203

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              NIYPYF+Y G+P+ I L YALFT           GY+N+FDA+LD+ Y+A++KAG PN+
Sbjct  204   VNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGAPNM  263

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPS G  AAT  NA TYY NLI+HVK   GTP +P  +IETYLFAM+DENLK
Sbjct  264   VIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFAMFDENLK  321

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G  VEK+FG+F P+K  KYQL F
Sbjct  322   DGAEVEKHFGIFSPNKQPKYQLTF  345



>ref|XP_007015136.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
 gb|EOY32755.1| Glycosyl hydrolase superfamily protein, putative [Theobroma cacao]
Length=347

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/318 (50%), Positives = 223/318 (70%), Gaps = 10/318 (3%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             SIGVC G+  ++LPSE D +N  K NGI  +R+Y  +     A +G+N+ +I+ + N  L
Sbjct  35    SIGVCNGRIADDLPSEQDVVNFYKINGIGAMRIYDPNQFTLQALKGTNIQLILGIPNAAL  94

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             Q LTDP+ A  +V+ NIV ++ AV F+YI+VGNEV   +P+      FV+PA+RN++NAL
Sbjct  95    QSLTDPSAASDFVKRNIVSFSPAVKFRYISVGNEVKPTDPEA----QFVLPAMRNIYNAL  150

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
              +A L+G+IK +T+    +L N+YPP+ G+F + A+  + P+++FLA  G+PLLANIY Y
Sbjct  151   VSANLKGQIKVSTSVEPTLLGNSYPPSAGLFSEAARPYIIPIIKFLASNGSPLLANIYTY  210

Query  649   FSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSE  482
             FSY G+   I L +ALFT         P+GY+NLFDA LDS+Y+A++K G  N+ IVVSE
Sbjct  211   FSYIGDTKNIDLGFALFTSPGVVVQDGPSGYQNLFDATLDSLYSALEKIGAANLEIVVSE  270

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPSAGG AAT +NA+TYY+NLI HVK   GTP +PG+ IETYLFAM+DEN KG    E
Sbjct  271   SGWPSAGGTAATVENASTYYKNLIKHVKN--GTPKRPGKPIETYLFAMFDENQKGPAETE  328

Query  301   KNFGVFRPDKSSKYQLNF  248
             ++FG+F P+K  KY + F
Sbjct  329   RHFGLFSPNKQPKYPIKF  346



>gb|AAO16642.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=347

 Score =   323 bits (827),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 174/325 (54%), Positives = 223/325 (69%), Gaps = 11/325 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NGNNLPS+T+ ++L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  28    QITGAQSAGVCYGRNGNNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++
Sbjct  88    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AKYLLPAIQ  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYP-PNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             N+ NA+ AA LQG+IK +TA  +  L   +  P+ G F D A   + P++ FL+  G PL
Sbjct  144   NIQNAVTAANLQGQIKVSTAIDTTFLPPDFVLPSNGAFSDAANSFITPIITFLSNNGAPL  203

Query  670   LANIYPYFSYRGNPSQIPLSYALFT----ERNPNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             L NIYPYF+Y G+P  I L YALFT    E      GY+N+FDALLD+ Y+A++KAG PN
Sbjct  204   LVNIYPYFAYIGDPVNIKLEYALFTSPGVELQDGSNGYQNIFDALLDTHYSALEKAGAPN  263

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             + IVVSE+GWPS GG AATT NA TYY  LI+HVK   GTP +P  +IETYLFAM+DENL
Sbjct  264   MAIVVSESGWPSEGGDAATTGNAGTYYSKLINHVK--TGTPKRPNGAIETYLFAMFDENL  321

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNF  248
             K G  VEK+FG+F P+K  KYQL F
Sbjct  322   KDGAEVEKHFGIFSPNKQPKYQLTF  346



>gb|AIT56224.1| beta-1,3 glucanase 3 [Musa AB Group]
Length=332

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/322 (52%), Positives = 227/322 (70%), Gaps = 13/322 (4%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V++IGVCYG+ G+NLP  ++ ++L KSN I  +R+Y  +  V  A +GSN+ ++V V N 
Sbjct  19    VQAIGVCYGRLGDNLPQPSEVVDLYKSNNIGSMRIYDPNHDVLEALQGSNIQLLVGVPND  78

Query  1015  KLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
             +LQ L +D + A AWVQ+N+V Y  +V+F+YIAVGNEV  G  D A YV   +PA++NV 
Sbjct  79    QLQSLASDSSAANAWVQSNVVAYWPSVSFRYIAVGNEVIPG--DNAPYV---LPAMQNVQ  133

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NALA+A LQG+IK +T+  + VL  +YPP++G F  DA+  MNP+VQFL   G PLL N+
Sbjct  134   NALASANLQGQIKVSTSVSTGVLGVSYPPSEGSFSSDAQTYMNPIVQFLVNNGAPLLLNV  193

Query  658   YPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSYR N +QI LSYALFT      N    GY+NLFDA++D+ YA+++K GG +V IV
Sbjct  194   YPYFSYRDNQAQISLSYALFTSPDVVVNDGSYGYQNLFDAIVDATYASLEKVGGSSVAIV  253

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAG    T  NA TY +NLI+HV    GTP +PG +IE Y+FAM++EN K  +
Sbjct  254   VSESGWPSAGDVETTIDNARTYNQNLINHV--GQGTPRRPGSAIEAYIFAMFNENQKDSE  311

Query  310   AVEKNFGVFRPDKSSKYQLNFN  245
              +E+NFG+F PDK   Y +NF+
Sbjct  312   -LERNFGLFYPDKQPVYLINFS  332



>ref|XP_009414139.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=338

 Score =   322 bits (824),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 228/324 (70%), Gaps = 13/324 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V++IGVCYG+ G+NLP  ++ ++L KSN I  +R+Y  +  V  A RGSN+ ++V V 
Sbjct  23    TSVQAIGVCYGRLGDNLPQPSEVVDLYKSNNIGSMRIYDPNHDVLEALRGSNIQLLVGVP  82

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N +LQ L +D + A AWVQ+N+V Y  +V+F+YIAVGNEV  G  D A YV   +PA++N
Sbjct  83    NDQLQSLASDSSAANAWVQSNVVAYWPSVSFRYIAVGNEVIPG--DDAPYV---LPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V NALA+A LQG+IK +T+  + VL  +YPP++G F  D +  MNP+VQFL   G PLL 
Sbjct  138   VQNALASANLQGQIKVSTSVSTRVLGVSYPPSEGSFSSDTQADMNPIVQFLVNNGAPLLL  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY+ N +QI LSYALFT      N  P GY+NLFDA++D+ YA+++K GG +V 
Sbjct  198   NVYPYFSYKYNQAQISLSYALFTSPDVVVNDGPYGYQNLFDAIVDAAYASLEKVGGSSVE  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSAG    T  NA TY +NLI+HV    GTP +PG +IE Y+FAM++EN K 
Sbjct  258   IVVSESGWPSAGDVETTIDNAGTYNQNLINHV--GQGTPRRPGSAIEAYIFAMFNENQKD  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
              + +E+NFG+F P+K   Y ++F+
Sbjct  316   SE-LERNFGLFYPNKQPVYSIHFS  338



>gb|AFJ97275.1| beta-1,3-glucanase [Hevea brasiliensis]
Length=374

 Score =   323 bits (827),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 232/342 (68%), Gaps = 8/342 (2%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAA  1082
             LP ++++  L++     L IT+ + +GVCYG  GNNLPS ++ I L K + I+ +R+Y  
Sbjct  14    LPSRTTVMLLLIFFTASLGITDAQ-VGVCYGMQGNNLPSVSEVIALYKQSNIKRMRIYDP  72

Query  1081  DPPVFNAARGSNLAVIVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
             +  V  A RGSN+ +I+ V N  LQ LT+P+ A +WVQ N+  + ++V  +YIAV  ++ 
Sbjct  73    NQAVLEALRGSNIELILGVPNSDLQSLTNPSNANSWVQKNVRGFWSSVRIRYIAVATKLV  132

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
               N  TA    FV+PA+RN+H+A+ +AGLQ +IK +TA    ++ N+YPP+ G FRDD +
Sbjct  133   PVNGGTAWLAQFVLPAMRNIHDAIRSAGLQDQIKVSTAIDLTLVGNSYPPSAGAFRDDVR  192

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFD  554
               ++P++ FL+   +PLLANIYPYF+Y  NP  I L YALFT  +        GY+NLFD
Sbjct  193   SYLDPIIGFLSSIRSPLLANIYPYFTYADNPRDISLPYALFTSPSVVVWDGQRGYKNLFD  252

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             A LD++Y+A+++A G ++ +VVSE+GWPSAG FAAT  N  TY  NLI HVKG  GTP +
Sbjct  253   ATLDALYSALERASGGSLEVVVSESGWPSAGAFAATFDNGRTYLSNLIQHVKG--GTPKR  310

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             P R+IETYLFAM+DEN K  + VEK+ G+F PDK  KY LNF
Sbjct  311   PNRAIETYLFAMFDENKKQPE-VEKHSGLFFPDKRPKYNLNF  351



>gb|KHN05498.1| Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform [Glycine 
soja]
Length=345

 Score =   322 bits (824),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 167/329 (51%), Positives = 216/329 (66%), Gaps = 18/329 (5%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             + +S+GVCYG  GNNLP     ++L KSN I  +R+Y  D     A RGSN+ VI+ V N
Sbjct  23    QFQSVGVCYGGKGNNLPKMQAVVDLYKSNRIDKIRLYHPDEGALQALRGSNIEVILGVPN  82

Query  1018  PKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              +LQ L + A A  WV   +  Y+  V FKYIAVGNE+  G+         V+PAL N+ 
Sbjct  83    DQLQSLINVANATNWVNKYVKAYSQNVKFKYIAVGNEIHPGDSLAGS----VLPALENIQ  138

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA++AA LQ ++K +TA  + +L  +YPPN GVF   A   + P+V FLA+ G PLLAN+
Sbjct  139   NAISAANLQCQVKVSTAIDTTLLGYSYPPNDGVFSSSASSYIRPIVNFLARNGAPLLANV  198

Query  658   YPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             YPYF+Y  NP  I L YALFT++  N  GY+NLFDA+LDS+YAA++K G PNV +VVSE+
Sbjct  199   YPYFAYVNNPQNIALDYALFTKQGNNVVGYQNLFDAMLDSVYAALEKVGAPNVTVVVSES  258

Query  478   GWPSAGG-FAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             GWPS GG  AAT QNA TYYRNLISH KG  GTP +P   IE YL+AM+DEN K G  ++
Sbjct  259   GWPSEGGAVAATVQNAGTYYRNLISHAKG--GTPKRPNGPIEIYLYAMFDENQKQGQEIQ  316

Query  301   KNFGVFRPDKS-----------SKYQLNF  248
             ++FG+FR DKS            K++LNF
Sbjct  317   QHFGLFRLDKSPVPTFEIMRPNPKFKLNF  345



>gb|AAX81590.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 220/324 (68%), Gaps = 10/324 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NG+NLPS+T+ ++L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  28    QITGAQSAGVCYGRNGDNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV  G    A    +++PA++
Sbjct  88    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEVHPG----AAEAQYLLPAIQ  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+ AA LQG+IK +TA  + +L  ++PP+ G F   A   + P++ FL   G PLL
Sbjct  144   NIQNAVTAANLQGQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLL  203

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              NIYPYF+Y G+P+ I L YALFT           GY+N+FDA+LD+ Y+A++KAG  N+
Sbjct  204   VNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGASNM  263

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPS G  AAT  NA TYY NLISHVK   GTP +P  +IETYLFAM+DENLK
Sbjct  264   AIVVSESGWPSEGSDAATNGNAGTYYSNLISHVK--TGTPKRPNGAIETYLFAMFDENLK  321

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G  +EK+FG+F P+K  KYQL F
Sbjct  322   DGAEIEKHFGIFSPNKQPKYQLTF  345



>gb|AIR93912.1| glucanase [Cicer arietinum]
Length=575

 Score =   328 bits (842),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/314 (51%), Positives = 215/314 (68%), Gaps = 5/314 (2%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +S+GVCYG   NNLP   + I+L K+NGI  +R+Y  D     A RGSN+ +++ + N  
Sbjct  262   QSVGVCYGIVANNLPPAAEVIDLFKTNGIARMRIYNPDQATLEALRGSNIELVIGIPNED  321

Query  1012  LQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             +Q +  D + A +WVQ NI+ Y+N V F+YI VGNE+   +P +     FV+PA++N++ 
Sbjct  322   MQSIANDVSSATSWVQNNIINYSNNVIFRYIVVGNEINPSDPTS----QFVLPAMQNIYA  377

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             ALA A LQ +IK +TA    +L ++YPP+QG F  DA   + P+V FL   G PLLAN+Y
Sbjct  378   ALATADLQNQIKISTAIQVGLLGSSYPPSQGEFSPDAIPYLTPIVNFLVTNGAPLLANVY  437

Query  655   PYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             PYF+Y GN   IPL YALFT++     GY+NLFDA+LD++YAA  K G  N+ IVVSE+G
Sbjct  438   PYFAYIGNEQDIPLEYALFTKQGTTDIGYQNLFDAMLDALYAAALKIGASNLQIVVSESG  497

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG  ATT+NAA YY NLI+HV    GTP++PG+ IETYLFAM+DEN K G A E+ 
Sbjct  498   WPSAGGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLFAMFDENQKPGAATEQY  557

Query  295   FGVFRPDKSSKYQL  254
             FG+F PDK  KY +
Sbjct  558   FGLFTPDKLQKYNI  571


 Score =   261 bits (666),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/272 (49%), Positives = 183/272 (67%), Gaps = 7/272 (3%)
 Frame = -3

Query  1099  LRVYAADPPVFNAARGSNLAVIVDVSNPKLQELT-DPARAKAWVQANIVPYANAVNFKYI  923
             +R+Y  +     A RGSN+ + + VSN  +Q +  D + A +WVQ NI+ YAN V F+YI
Sbjct  1     MRIYNPNQATLEALRGSNIELAIGVSNEDIQSIANDISSATSWVQINIINYANDVIFRYI  60

Query  922   AVGNEVFAGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQG  743
              VGNE+   +P +     FV+ A++N++ AL    LQ +IK +T    ++L ++YPP+QG
Sbjct  61    IVGNEISHNDPTS----QFVLRAMQNIYGALG--NLQNQIKISTTIQLSLLGSSYPPSQG  114

Query  742   VFRDDAKGLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRN  563
              F  DA   + P+V FLA  G PLLAN+YPYF+Y  +   I L YA FT++     GY+N
Sbjct  115   EFSPDAIPYITPIVNFLASNGAPLLANVYPYFAYISDQKDISLEYATFTQQGYTDIGYQN  174

Query  562   LFDALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGT  383
             LFDA+LD++YAA+ K G  ++ IVVSE+GWPSAGG  ATT+NAA YY NLI+HV    GT
Sbjct  175   LFDAMLDALYAAILKTGASDLQIVVSESGWPSAGGEGATTENAAAYYTNLINHVNSGNGT  234

Query  382   PLKPGRSIETYLFAMYDENLKGGDAVEKNFGV  287
             P++PG+ IETYLFAM+DENLK G A  ++ GV
Sbjct  235   PMRPGQPIETYLFAMFDENLKPGAATAQSVGV  266



>ref|XP_010063513.1| PREDICTED: lichenase [Eucalyptus grandis]
Length=369

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 222/321 (69%), Gaps = 8/321 (2%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V+SIGVCYG  GNNLPS ++ + L KS GI  +R+Y        A RGSN+ +I+ V N 
Sbjct  32    VQSIGVCYGMLGNNLPSASEVVALYKSRGITQMRLYDPSQAALQALRGSNIELILGVPNS  91

Query  1015  KLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
             +LQ L ++PA A +WVQ N+  Y+  V F+YIAVGNEV   N  TA++  FV+PA+RN+ 
Sbjct  92    ELQALASNPANANSWVQRNVKNYSPGVRFRYIAVGNEVSPVNGGTAQFARFVLPAMRNIQ  151

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              AL ++GLQ +IK +TA    ++ N+YPP+QG FR D +  ++P++ FL    +PLLANI
Sbjct  152   AALRSSGLQNQIKVSTAIDMTLIGNSYPPSQGAFRGDVRSYLDPIISFLVSNNSPLLANI  211

Query  658   YPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             Y YFSY GNP  I L YALFT  +         YRNLFDA+LD++Y+A+++AGG  + +V
Sbjct  212   YTYFSYVGNPKDISLPYALFTSPSVVVRDGAHEYRNLFDAMLDALYSALERAGGAALRVV  271

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAG FAAT  NA TY  NLI HVKG  GTP +P  +IETY+FA++DEN K  +
Sbjct  272   VSESGWPSAGAFAATVDNARTYNGNLIKHVKG--GTPKRPNGAIETYIFALFDENQKQPE  329

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
              +EK+FG+F P+K  KY L+F
Sbjct  330   -LEKHFGLFFPNKQPKYPLSF  349



>ref|XP_006430506.1| hypothetical protein CICLE_v10012099mg [Citrus clementina]
 gb|ESR43746.1| hypothetical protein CICLE_v10012099mg [Citrus clementina]
 gb|KDO53666.1| hypothetical protein CISIN_1g019014mg [Citrus sinensis]
Length=347

 Score =   320 bits (821),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 218/318 (69%), Gaps = 7/318 (2%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG++G  LPSE + ++L K   I+ +R+YA +     A RGSN+ +++ V N  LQ 
Sbjct  32    GVCYGRDGTGLPSEQEVVSLYKQTNIQRMRLYAPNQATLQALRGSNIELLLGVPNSDLQN  91

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +    A A +WVQ N+  YAN V F+YIAVGNEV   N +T +YV+F++PA++N+ NA+ 
Sbjct  92    VAASQANANSWVQNNVGDYANGVKFRYIAVGNEVSPLNGETTQYVSFLLPAMQNIRNAIL  151

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGL  +IK +TA  + VL +  PP++G FR D +  ++PV++FL     PLL N+YPY 
Sbjct  152   AAGLGNQIKVSTAIDTRVLGDASPPSKGTFRPDVRRFLDPVIRFLVDNQAPLLVNLYPYI  211

Query  646   SYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             SY GN   I L +ALFT           GYRNLFDA+LD++YAA++KAGG ++ IVVSE+
Sbjct  212   SYIGNTRDIRLDFALFTSDVVRVQDGQFGYRNLFDAILDAVYAALEKAGGGSLRIVVSES  271

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWP+AGG AA+  NA TY  NLI HVKG  GTP KPG +IETY+FAM+DEN K G   EK
Sbjct  272   GWPTAGGTAASVDNARTYNSNLIQHVKG--GTPRKPGSAIETYVFAMFDENQKQGSEYEK  329

Query  298   NFGVFRPDKSSKYQLNFN  245
             ++G+F P+K  KY +NFN
Sbjct  330   HWGLFLPNKQPKYSINFN  347



>emb|CDP09619.1| unnamed protein product [Coffea canephora]
Length=338

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/327 (50%), Positives = 224/327 (69%), Gaps = 10/327 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              I+  + IG+ YG NGN+LPS+ D INL    GI  +R+YA  P V NA RG+N+ ++VD
Sbjct  16    RISGAQYIGISYGLNGNSLPSKQDVINLYNRIGIHRMRIYAPVPEVLNALRGTNIELLVD  75

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V+N  +Q + T+P+ A  WVQ N+  Y+ AV F+YI+VG+EV    P ++    +V PA+
Sbjct  76    VANEDIQSIATNPSAAVNWVQNNVKKYSPAVKFRYISVGSEV----PLSSNIAQYVGPAM  131

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
               + NALA+AGLQ +IK +T+  + +L+ +YPP+QG+F ++AK  + P++  L +   PL
Sbjct  132   EKIQNALASAGLQNQIKVSTSISAGLLSVSYPPSQGLFSNEAKPFIKPIIDLLVRNNAPL  191

Query  670   LANIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             L N+YPYFSY G+P  I L YALFT R         GY+N+FDA+LD+ YAA++K GG +
Sbjct  192   LVNVYPYFSYIGDPVDISLDYALFTSRGIVVQDGSFGYQNIFDAILDAHYAALEKEGGSS  251

Query  502   VPIVVSETGWPSAGG-FAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDEN  326
             V IVVSETGWPS G   AA+  NA TYY N+ISHVK   GTP +PGR IETYLFAM+DEN
Sbjct  252   VNIVVSETGWPSDGNPPAASFANAGTYYWNVISHVKSGKGTPRRPGRGIETYLFAMFDEN  311

Query  325   LKGGDAVEKNFGVFRPDKSSKYQLNFN  245
              K G   E++FG+F PD+ +KY + F+
Sbjct  312   QKPGAQTERHFGLFFPDQQTKYGITFD  338



>dbj|BAC66185.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 222/324 (69%), Gaps = 10/324 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NG+NLPS+T+ I+L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  28    QITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++
Sbjct  88    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AQYLLPAIQ  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+ AA LQ +IK +TA  + +L  ++PP+ G F   A   + P++ FL   G PLL
Sbjct  144   NIQNAVKAANLQSQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLL  203

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              NIYPYF+Y G+P+ I L YALFT           GY+N+FDA+LD+ Y+A++KAG PN+
Sbjct  204   VNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGAPNM  263

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPS G  AAT  NA TYY NLI+HVK   GTP +P  +IETYLFAM+DENLK
Sbjct  264   VIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFAMFDENLK  321

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G  VEK+FG+F P+K  KYQL F
Sbjct  322   DGAEVEKHFGIFSPNKQPKYQLTF  345



>dbj|BAC66186.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=346

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 222/324 (69%), Gaps = 10/324 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              IT  +S GVCYG+NG+NLPS+T+ I+L KSNGI  +R+Y  +     A RGSN+ ++V 
Sbjct  28    QITGGQSAGVCYGRNGDNLPSDTEVIDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVT  87

Query  1027  VSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALR  848
             + N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++
Sbjct  88    ILNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AQYLLPAIQ  143

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             N+ NA+ AA LQ +IK +TA  + +L  ++PP+ G F   A   + P++ FL   G PLL
Sbjct  144   NIQNAVKAANLQSQIKVSTAIDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLL  203

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              NIYPYF+Y G+P+ I L YALFT           GY+N+FDA+LD+ Y+A++KAG PN+
Sbjct  204   VNIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGAPNM  263

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPS G  AAT  NA TYY NLI+HVK   GTP +P  +IETYLFAM+DENLK
Sbjct  264   VIVVSESGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFAMFDENLK  321

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              G  VEK+FG+F P+K  KYQL F
Sbjct  322   DGAEVEKHFGIFSPNKQPKYQLTF  345



>ref|XP_010434858.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=347

 Score =   320 bits (819),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 163/320 (51%), Positives = 221/320 (69%), Gaps = 10/320 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             E +GVCYG  GNNLPS+ DTI L K   IR +R+Y  +    NA + + + VIV V NP 
Sbjct  25    EPVGVCYGMMGNNLPSKPDTITLFKEKNIRRVRLYDPNQAALNALKNTGIEVIVGVPNPD  84

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ LT+P+ AK+WVQ N++ +  AV+FKYIAVGNEV  GN       + V+PA+RNV++A
Sbjct  85    LRSLTNPSSAKSWVQNNVLNFYPAVSFKYIAVGNEVSPGNGG-----DLVLPAMRNVYDA  139

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L  A LQ +IK +TA    ++ N++PP+ G FR D +   +P++ FL  T + LLANIYP
Sbjct  140   LRGANLQDRIKVSTAVDMTLIGNSFPPSLGEFRGDVRWYTDPIIGFLTSTNSALLANIYP  199

Query  652   YFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             YFSY  NP  I LSYALFT  +        GY+NLFDAL+D +Y+AV+++GG ++P+VVS
Sbjct  200   YFSYVDNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALIDVVYSAVERSGGGSLPVVVS  259

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  + +
Sbjct  260   ESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLFAMFDENQKSPE-I  318

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             EKNFG+F P+K SK+ + F+
Sbjct  319   EKNFGLFSPNKQSKFPITFS  338



>ref|XP_008811754.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=340

 Score =   319 bits (818),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 221/323 (68%), Gaps = 12/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLP  ++ + L KS  I  +R+Y  +  V  A +GSN+ +I+DV 
Sbjct  24    TGVQSIGVCYGMVGNNLPQPSEVVELYKSKRIGQMRIYGPNADVLKALKGSNIELILDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
                LQ L +D + A+ W+Q N+  Y   V+F+YIAVGNEV  GN     +  +V+PA+ N
Sbjct  84    KEDLQRLASDTSAARNWIQNNVKSYLPDVSFRYIAVGNEVIPGN-----FAQYVLPAMNN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +H AL+A+GLQ +IK +T+    VL  +YPP+ G F  DA   + P+V+FLA  G+PLL 
Sbjct  139   IHAALSASGLQNQIKVSTSVSQGVLGKSYPPSSGTFSSDASRYLGPIVKFLASNGSPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY G+   I + YALFT R    +  P GY+NLFDAL+D++Y+A++K  G N+P
Sbjct  199   NVYPYFSYIGDMKDIKIEYALFTSRGTVVSDPPYGYQNLFDALVDAIYSALEKMEGSNIP  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV+   GTP +PG++IE Y+FAM++EN K 
Sbjct  259   VVVSESGWPSAGGTAATMDNAKTYNQNLINHVR--QGTPKRPGKAIEAYIFAMFNENQKK  316

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E NFG+F P+K+  Y +NF
Sbjct  317   PPGIENNFGLFNPNKAPVYPINF  339



>gb|KHN03123.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=324

 Score =   318 bits (816),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 157/315 (50%), Positives = 212/315 (67%), Gaps = 6/315 (2%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             I  +E  G+CYG NGNNLPS+ + +++ KS GI  +R+Y+ D  +  A RGS + +++DV
Sbjct  16    IGVLEFTGICYGINGNNLPSKQEVVDMFKSRGIPRMRIYSPDEEIIQALRGSRIELVMDV  75

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             +   +Q LTDP  A  WV   I  Y+  VNFKYI VGNEV   N D A Y+   +PA+ N
Sbjct  76    AGDTIQSLTDPNVAADWVHRYITSYSQDVNFKYIVVGNEVHP-NYDLAPYI---LPAMTN  131

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + NA+++A L  K+  +TA  + ++TN+YPPN  VF  DA   + P++ FL +   PLLA
Sbjct  132   IQNAISSANLVTKV--STAIDTTLVTNSYPPNNSVFTADASPYIGPIINFLVKNEAPLLA  189

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             N+YPYF+Y  N   I L YALFT++  N  GY+NLFDA+LDS+YAA++K G PN+ +VVS
Sbjct  190   NLYPYFAYVNNQKDIDLHYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGAPNLEVVVS  249

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPSAGG  A   NA  YY  LI H    +GTP +PGR I+T+LFAM+DEN K G  V
Sbjct  250   ESGWPSAGGDGALVDNAHVYYFRLIKHAYSGSGTPKRPGRPIQTFLFAMFDENQKPGAEV  309

Query  304   EKNFGVFRPDKSSKY  260
             E++FG+F PDKS KY
Sbjct  310   ERHFGIFNPDKSPKY  324



>ref|XP_006482037.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Citrus sinensis]
Length=347

 Score =   319 bits (818),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 161/318 (51%), Positives = 217/318 (68%), Gaps = 7/318 (2%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG++G  LPSE + ++L K   I+ +R+YA +     A RGSN+ +++ V N  LQ 
Sbjct  32    GVCYGRDGTGLPSEQEVVSLYKQTNIQRMRLYAPNQATLQALRGSNIELLLGVPNSDLQN  91

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +    A A +WVQ N+  YAN V F+YIAVGNEV   N +T +YV F++PA++N+ NA+ 
Sbjct  92    VAASQANANSWVQNNVRDYANGVKFRYIAVGNEVSPLNGETTQYVPFLLPAMQNIRNAIL  151

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGL  +IK +TA  + VL +  PP++G FR D +  ++PV++FL     PLL N+YPY 
Sbjct  152   AAGLGNQIKVSTAIDTRVLGDASPPSKGTFRPDVRRFLDPVIRFLVDNQAPLLVNLYPYI  211

Query  646   SYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             SY GN   I L +ALFT           GYRNLFDA+LD++YAA++KAGG ++ IVVSE+
Sbjct  212   SYIGNTRDIRLDFALFTSDVVRVQDGQFGYRNLFDAILDAVYAALEKAGGGSLRIVVSES  271

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWP+AGG AA+  NA TY  NLI HVKG  GTP KPG +IETY+FAM+DEN K G   EK
Sbjct  272   GWPTAGGTAASVDNARTYNSNLIQHVKG--GTPRKPGSAIETYVFAMFDENQKQGSEYEK  329

Query  298   NFGVFRPDKSSKYQLNFN  245
             ++G+F P+K  KY +NFN
Sbjct  330   HWGLFLPNKQPKYSINFN  347



>ref|NP_193361.4| putative beta-1,3-endoglucanase [Arabidopsis thaliana]
 gb|AAL36038.1| AT4g16260/dl4170c [Arabidopsis thaliana]
 gb|AAN28806.1| At4g16260/dl4170c [Arabidopsis thaliana]
 gb|AEE83722.1| putative beta-1,3-endoglucanase [Arabidopsis thaliana]
Length=344

 Score =   319 bits (817),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 223/323 (69%), Gaps = 10/323 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  ES+GVCYG  GNNLPS++DTI L + N IR +R+Y  +    NA R + + VI+ V 
Sbjct  19    TSGESVGVCYGMMGNNLPSQSDTIALFRQNNIRRVRLYDPNQAALNALRNTGIEVIIGVP  78

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N  L+ LT+P+ A++W+Q N++ Y  AV+FKYIAVGNEV   N       + V+PA+RNV
Sbjct  79    NTDLRSLTNPSSARSWLQNNVLNYYPAVSFKYIAVGNEVSPSNGG-----DVVLPAMRNV  133

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL  A LQ +IK +TA    ++ N++PP+ G FR D +  ++PV+ FL  T + LLAN
Sbjct  134   YDALRGANLQDRIKVSTAIDMTLIGNSFPPSSGEFRGDVRWYIDPVIGFLTSTNSALLAN  193

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPI  494
             IYPYFSY  NP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++GG ++P+
Sbjct  194   IYPYFSYVDNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALLDVVYSAVERSGGGSLPV  253

Query  493   VVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGG  314
             VVSE+GWPS GG AA+  NA  +Y NL S V+ N GTP +PGR +ETYLFAM+DEN K  
Sbjct  254   VVSESGWPSNGGNAASFDNARAFYTNLASRVRENRGTPKRPGRGVETYLFAMFDENQKSP  313

Query  313   DAVEKNFGVFRPDKSSKYQLNFN  245
             + +EKNFG+F P+K  K+ + F+
Sbjct  314   E-IEKNFGLFFPNKQPKFPITFS  335



>ref|XP_006599943.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Glycine max]
Length=334

 Score =   318 bits (816),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 155/309 (50%), Positives = 210/309 (68%), Gaps = 6/309 (2%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +G+CYG NGNNLPS+ + +++ KS GI  +R+Y+ D  +  A RGS + +++DV+   +Q
Sbjct  32    VGICYGINGNNLPSKQEVVDMFKSRGIPRMRIYSPDEEIIQALRGSRIELVMDVAGDTIQ  91

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              LTDP  A  WV   I  Y+  VNFKYI VGNEV   N D A Y+   +PA+ N+ NA++
Sbjct  92    SLTDPNVAADWVHRYITSYSQDVNFKYIVVGNEVHP-NYDLAPYI---LPAMTNIQNAIS  147

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +A L  K+  +TA  + ++TN+YPPN  VF  DA   + P++ FL +   PLLAN+YPYF
Sbjct  148   SANLVTKV--STAIDTTLVTNSYPPNNSVFTADASPYIGPIINFLVKNEAPLLANLYPYF  205

Query  646   SYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWPS  467
             +Y  N   I L YALFT++  N  GY+NLFDA+LDS+YAA++K G PN+ +VVSE+GWPS
Sbjct  206   AYVNNQKDIDLHYALFTQQGTNDIGYQNLFDAMLDSIYAALEKIGAPNLEVVVSESGWPS  265

Query  466   AGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFGV  287
             AGG  A   NA  YY  LI H    +GTP +PGR I+T+LFAM+DEN K G  VE++FG+
Sbjct  266   AGGDGALVDNAHVYYFRLIKHAYSGSGTPKRPGRPIQTFLFAMFDENQKPGAEVERHFGI  325

Query  286   FRPDKSSKY  260
             F PDKS KY
Sbjct  326   FNPDKSPKY  334



>gb|AEE81082.1| beta-1,3-glucanase [Musa balbisiana]
Length=339

 Score =   318 bits (815),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/324 (51%), Positives = 227/324 (70%), Gaps = 13/324 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG+ G+NLP  ++ ++L KS  I  +R+Y  +  V  A RGSN+ ++VDV 
Sbjct  24    TRVQSIGVCYGRLGDNLPQPSEVVDLYKSYNIGSMRIYDPNSDVLEALRGSNIQLLVDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N +L+ L +DP+ A  WVQ+N+V    +V+F+YIAVGNEV     D A+YV   +PA++N
Sbjct  84    NEQLESLASDPSAANDWVQSNVVANWPSVSFRYIAVGNEVIL--VDKAQYV---LPAMQN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V NALA+A LQG+IK +T+  + VL  +YPP++G F  +A+  MNP+VQFL   G PLL 
Sbjct  139   VQNALASANLQGQIKVSTSVSTGVLGVSYPPSEGSFSSEAQTYMNPIVQFLVDNGAPLLL  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSYR N +QI LSYALFT      N    GY+NLFDA++D+ YA+++K GG +V 
Sbjct  199   NVYPYFSYRDNQAQISLSYALFTSPDVVVNDGSYGYQNLFDAIVDATYASMEKVGGSSVA  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSAG    T  NA TY +NLI+HV    GTP +PG +IE Y+FAM++E+ K 
Sbjct  259   IVVSESGWPSAGDVETTIDNARTYNQNLINHV--GQGTPRRPGSAIEAYIFAMFNEDQKN  316

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
              + +E+NFG+F P+K   Y +NF+
Sbjct  317   SE-LERNFGLFYPNKQPVYLINFS  339



>ref|XP_006414372.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
 gb|ESQ55825.1| hypothetical protein EUTSA_v10025628mg [Eutrema salsugineum]
Length=345

 Score =   318 bits (816),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 219/319 (69%), Gaps = 10/319 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             E +GVCYG  GNNLPS+++TI L + N IR +R+Y  +    NA + S + VIV V N  
Sbjct  23    EPVGVCYGMLGNNLPSQSETIALFRQNNIRRIRLYDPNQAALNALKNSGIEVIVGVPNSD  82

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ LT+P+ A++W+Q N++ Y  AVNFKYIAVGNEV   N       + V+PA+RNV++A
Sbjct  83    LRSLTNPSSARSWLQNNVLNYYPAVNFKYIAVGNEVVPSNGG-----DLVLPAMRNVYDA  137

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L  A L  +IK +TA    ++ N++PP+ G FR D +   +P++ FL  T + LLANIYP
Sbjct  138   LRGANLHDRIKVSTAVDMTLIGNSFPPSSGEFRGDVRSYTDPIIGFLTSTNSALLANIYP  197

Query  652   YFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             YFSY GNP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++GG ++P+VVS
Sbjct  198   YFSYIGNPRDISLSYALFTSSSVVVWDGSRGYQNLFDALLDVIYSAVERSGGGSLPVVVS  257

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  + +
Sbjct  258   ESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLFAMFDENQKSPE-I  316

Query  304   EKNFGVFRPDKSSKYQLNF  248
             EKNFG+F P+K  K+ + F
Sbjct  317   EKNFGLFFPNKQPKFPITF  335



>gb|ADW08742.1| 1,3-beta-D-glucanase GH17_39 [Populus tremula x Populus tremuloides]
Length=338

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/323 (52%), Positives = 229/323 (71%), Gaps = 11/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             +++ +SIGVCYGKNGNNLPS+ + ++L ++  IR +R+Y  +     A RGSN+ VI+ V
Sbjct  22    LSDAQSIGVCYGKNGNNLPSDQEVVSLSQTMAIRRMRIYDPNRDTLEALRGSNIEVILGV  81

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N KLQ LTD + A  WVQ N+V Y++ V F+YIAVGNEV  G+ +       V+PA++N
Sbjct  82    PNDKLQSLTDASAATTWVQDNVVAYSSNVRFRYIAVGNEVPPGDANAQS----VLPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +HNA+A+A LQ +IK +TA  + +L ++YPP+ G F   A   +NP++ FL   G+PLLA
Sbjct  138   IHNAIASANLQDQIKVSTAIDTTLLGSSYPPSAGSFSAGASSFINPIINFLRTNGSPLLA  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYF YR +P  I LSYALFT           GY+NLFDALLD++YAA++KAG P++ 
Sbjct  198   NVYPYFGYRDDPQNIDLSYALFTSPGVVVQDGQYGYQNLFDALLDALYAALEKAGAPDLN  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPS GG A T +NA T+YRNLI+H K   GTP + G++IETYLFAM+DENLK 
Sbjct  258   IVVSESGWPSEGGTATTVENAGTFYRNLINHAK--QGTPRRSGQAIETYLFAMFDENLKP  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E++FG+F P+K  KYQL F
Sbjct  316   A-GIEQHFGLFLPNKQPKYQLTF  337



>ref|XP_006284042.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
 gb|EOA16940.1| hypothetical protein CARUB_v10005163mg [Capsella rubella]
Length=346

 Score =   318 bits (815),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 221/323 (68%), Gaps = 10/323 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  E +GVCYG  GNNLPS +DTI L +   IR +R+Y  +    NA + S + VIV V 
Sbjct  21    TSGEPVGVCYGMMGNNLPSHSDTIALFREKNIRRVRLYDPNQAALNALKNSGIEVIVGVP  80

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N  L+ LT+P+ A++W+Q N++ Y  AV+FKYI+VGNEV  GN       + V+PA+RNV
Sbjct  81    NSDLRSLTNPSSARSWLQNNVLNYYPAVSFKYISVGNEVSPGNGG-----DLVLPAMRNV  135

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL  A LQ +IK +TA    ++ N++PP+ G FR D +   +P++ FL  T + LLAN
Sbjct  136   YDALRGANLQDRIKVSTAIDMTLIGNSFPPSSGEFRGDVRWYTDPIIGFLTSTNSALLAN  195

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPI  494
             IYPYFSY GNP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++GG ++P+
Sbjct  196   IYPYFSYVGNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALLDVVYSAVERSGGGSIPV  255

Query  493   VVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGG  314
             VVSE+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  
Sbjct  256   VVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLFAMFDENQKSP  315

Query  313   DAVEKNFGVFRPDKSSKYQLNFN  245
             + +EKNFG+F P+K  K+ + F+
Sbjct  316   E-IEKNFGLFFPNKQPKFPITFS  337



>ref|XP_010673693.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
 emb|CAA53545.1| glucan endo-1,3-beta-D-glucosidase [Beta vulgaris subsp. vulgaris]
Length=336

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 174/326 (53%), Positives = 225/326 (69%), Gaps = 19/326 (6%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
              +TE + IGVC G+ GNNLPSE D ++L KS GI  +R+Y  +     A RGSN+ +IVD
Sbjct  24    QLTEAQ-IGVCNGRLGNNLPSEEDVVSLYKSRGITRMRIYDPNQRTLQAVRGSNIGLIVD  82

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V    L+ L +D   A  WVQ N+VPYA+  N +YIAVGNE+   + +       ++PA+
Sbjct  83    VPKRDLRSLGSDAGAASRWVQNNVVPYAS--NIRYIAVGNEIMPNDAEAGS----IVPAM  136

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             +NV NAL +A L G+IK +TA  S ++ N +PP++GVF   +   MNP+V FL    +PL
Sbjct  137   QNVQNALRSANLAGRIKVSTAIKSDLVAN-FPPSKGVFTSSS--YMNPIVNFLKNNNSPL  193

Query  670   LANIYPYFSYRGNPSQIPLSYALFT----ERNPNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             LANIYPYFS+ G PS + L YALFT    + N N   Y+N+FDAL+D++YAA+ KAG PN
Sbjct  194   LANIYPYFSFIGTPS-MRLDYALFTSPNAQVNDNGLQYQNVFDALVDTVYAALAKAGAPN  252

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             VPIVVSE+GWPSAGG AA+  NA TYY+ LI HVK   GTPLK G++IE YLFAM+DEN 
Sbjct  253   VPIVVSESGWPSAGGNAASFSNAGTYYKGLIGHVK--QGTPLKKGQAIEAYLFAMFDENQ  310

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNFN  245
             KGG  +E NFG+F P+K  KYQLNFN
Sbjct  311   KGG-GIENNFGLFTPNKQPKYQLNFN  335



>ref|XP_010440186.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=346

 Score =   318 bits (814),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 220/320 (69%), Gaps = 10/320 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             E +GVCYG  GNNLPS+ DTI L +   IR +R+Y  +    NA + + + VIV V NP 
Sbjct  24    EPVGVCYGMMGNNLPSQPDTIALFREKNIRRVRLYDPNQAALNALKNTGIEVIVGVPNPD  83

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ LT+P+ AK+WVQ N++ +  AV+FKYIAVGNEV  GN       + V+PA+RNV++A
Sbjct  84    LRSLTNPSSAKSWVQNNVLNFYPAVSFKYIAVGNEVSPGNGG-----DLVLPAMRNVYDA  138

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L  A LQ +IK +TA    ++ N++PP+ G FR D +   +P++ FL  T + LLANIYP
Sbjct  139   LRGANLQDRIKVSTAVDMTLIGNSFPPSLGEFRGDVRWYTDPIIGFLTSTNSALLANIYP  198

Query  652   YFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             YFSY  NP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++GG ++P+VVS
Sbjct  199   YFSYVDNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALLDVVYSAVERSGGGSLPVVVS  258

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  + +
Sbjct  259   ESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLFAMFDENQKSPE-I  317

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             EKNFG+F P+K  K+ + F+
Sbjct  318   EKNFGLFSPNKQPKFPITFS  337



>ref|XP_002868146.1| AT4g16260/dl4170c [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44405.1| AT4g16260/dl4170c [Arabidopsis lyrata subsp. lyrata]
Length=343

 Score =   317 bits (813),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 222/323 (69%), Gaps = 10/323 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  E +GVCYG  GNNLPS++DTI L + N IR +R+Y  +    NA + + + VI+ V 
Sbjct  18    TSGEPVGVCYGMMGNNLPSQSDTIALFRQNNIRRVRLYDPNQAALNALKNTGIEVIIGVP  77

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N  L+ LT+P+ A++W+Q N++ Y  AV+FKYIAVGNEV   N       + V+PA+RNV
Sbjct  78    NSDLRSLTNPSSARSWLQNNVLNYYPAVSFKYIAVGNEVSPSNGG-----DVVLPAIRNV  132

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL  A LQ +IK +TA    ++ N++PP+ G FR D K  ++P++ FL  T + LLAN
Sbjct  133   YDALRGANLQDRIKVSTAIDMTLIGNSFPPSSGEFRGDVKWYIDPIIGFLTSTNSALLAN  192

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPI  494
             IYPYFSY  NP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++GG ++P+
Sbjct  193   IYPYFSYVDNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALLDVIYSAVERSGGGSLPV  252

Query  493   VVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGG  314
             VVSE+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  
Sbjct  253   VVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLFAMFDENQKSP  312

Query  313   DAVEKNFGVFRPDKSSKYQLNFN  245
             D +EKNFG+F P+K  K+ + F+
Sbjct  313   D-IEKNFGLFFPNKQPKFPITFS  334



>gb|AAX81589.1| beta-1,3-glucanase [Fragaria x ananassa]
Length=320

 Score =   316 bits (809),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 220/323 (68%), Gaps = 10/323 (3%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             I+  +S GVCYG+NG+NLPS+T+ ++L KSNGI  +R+Y  +     A RGSN+ ++V +
Sbjct  3     ISGAQSAGVCYGRNGDNLPSDTEVVDLYKSNGIGRMRIYEPNQATLEALRGSNIELMVTI  62

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
              N  LQ LTD A A  WVQ N+ PY+  V FKYIAVGNEV   +PD A    +++PA++N
Sbjct  63    LNNNLQALTDAAAATDWVQKNVQPYSADVKFKYIAVGNEV---HPDAAE-AQYLLPAIQN  118

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + NA+ AA LQG+IK +TA  + +L  ++PP+ G F   A   + P++ FL   G PLL 
Sbjct  119   IQNAVTAANLQGQIKVSTAVDTTLLDPSFPPSDGAFSSAANSFITPIITFLGNNGAPLLV  178

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             NIYPYF+Y G+P+ I L YALFT           GY+N+FDA+LD+ Y+A++KAG  N+ 
Sbjct  179   NIYPYFAYIGDPANIKLEYALFTSPGVVVQDGSNGYQNIFDAILDTHYSALEKAGASNMA  238

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE GWPS G  AAT  NA TYY NLI+HVK   GTP +P  +IETYLFAM+DENLK 
Sbjct  239   IVVSEGGWPSEGSDAATNGNAGTYYSNLINHVK--TGTPKRPNGAIETYLFAMFDENLKD  296

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G  +E +FG+F P+K  KYQL F
Sbjct  297   GAEIENHFGIFSPNKQPKYQLTF  319



>emb|CDY34445.1| BnaC01g21880D [Brassica napus]
Length=346

 Score =   317 bits (811),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 164/322 (51%), Positives = 220/322 (68%), Gaps = 10/322 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  E +GVCYG  GNNLPS+ DTI L + N IR +R+Y  +    NA + + + V+V V 
Sbjct  21    TSGEPVGVCYGMMGNNLPSKPDTIALFRQNNIRRVRLYDPNQEALNALKNTGIEVLVGVP  80

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N  L+ LT+P+ A+AW+Q N++ +  AVNFKYIAVGNEV   N         V+PA+RNV
Sbjct  81    NSDLRSLTNPSSARAWLQNNVLNHHPAVNFKYIAVGNEVVPSNGGGD-----VLPAMRNV  135

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL  A LQ +IK +TA    ++ N++PP+ G FR D +  ++P++ FL  T + LLAN
Sbjct  136   YDALRGANLQDRIKVSTAVDMTLIGNSFPPSAGEFRGDVRWYIDPIIGFLTSTNSVLLAN  195

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPI  494
             IYPYFSY GNP  I LSYALFT  N        GY+NLFDALLD +Y+AV+++GG ++P+
Sbjct  196   IYPYFSYIGNPRDISLSYALFTSPNVIVWDGSRGYQNLFDALLDVVYSAVERSGGGSLPV  255

Query  493   VVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGG  314
             VVSE+GWPS GG AAT  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  
Sbjct  256   VVSESGWPSNGGNAATFDNARAYYTNLAARVRENKGTPKRPGRGVETYLFAMFDENQKNP  315

Query  313   DAVEKNFGVFRPDKSSKYQLNF  248
             + +EKNFG+F P+K  K+ + F
Sbjct  316   E-IEKNFGLFFPNKQPKFPIAF  336



>ref|XP_010921891.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   316 bits (809),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 223/323 (69%), Gaps = 13/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NGNNLP  +  +NL KS  I  +R+Y  +     A +GSN+ +I+DV 
Sbjct  24    TGVKSIGVCYGMNGNNLPQPSAVVNLYKSKNINAMRLYDPNQAALQALKGSNIQLILDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N +LQ L + P+ A  WVQ N+  Y++ V+FKYIAVGNEV  G    A+YV   +PA+RN
Sbjct  84    NTRLQSLASSPSAANNWVQQNVKAYSSGVSFKYIAVGNEVIPG--AEAQYV---LPAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +++AL++AGLQ +IK +TA  ++VL  ++PP+QG F   A   ++P+VQFLA  G PLL 
Sbjct  139   IYSALSSAGLQNQIKVSTAVATSVLGKSFPPSQGAFSSAAMTYLSPIVQFLASNGAPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY  NP+QI + YALFT            Y+NLFDA++D++YAA++K GG NV 
Sbjct  199   NVYPYFSYVNNPNQINIEYALFTSPGTVVTDGQYKYQNLFDAIVDAIYAALEKVGGSNVA  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP + G++IE Y+F M++ENLK 
Sbjct  259   IVVSESGWPSAGGTAATINNAKTYNQNLINHV--GQGTPRRSGKAIEAYIFEMFNENLK-  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E+NFG+F P+    Y +NF
Sbjct  316   SSGIEQNFGLFYPNMQPVYPINF  338



>ref|XP_009391471.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=340

 Score =   315 bits (808),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 164/321 (51%), Positives = 220/321 (69%), Gaps = 13/321 (4%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V +IGVCYG+ GNNLP   + +NL K+N I  +R+Y  +  V  A RGSN+ ++V V N 
Sbjct  27    VSAIGVCYGRLGNNLPQPGEVVNLYKANKIGSMRIYDPNQEVLQALRGSNIQLVVGVPNE  86

Query  1015  KLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              LQ L +DP+ A  WVQ N+V +  +V+F+YIAVGNEV  G         +V+PA++NV 
Sbjct  87    NLQSLASDPSAASNWVQKNVVAFRPSVSFRYIAVGNEVIPGG-----LAQYVLPAMQNVQ  141

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              AL++AGLQ +IK +T+  + VL  +YPP+ G F   A+  MNP+VQFLA+ G PLL N+
Sbjct  142   KALSSAGLQNQIKVSTSVATIVLGTSYPPSAGAFSSAAQTHMNPIVQFLARNGAPLLVNV  201

Query  658   YPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSY+ N +QI  SYALFT           GYRNLFDA++D++YAA++K GG NV IV
Sbjct  202   YPYFSYKDNRNQISASYALFTSTEVVVKDGQFGYRNLFDAMVDAVYAAMEKVGGSNVAIV  261

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAG FAAT +NA TY +NLI HV    GTP + G  IETY+FAM++EN K  +
Sbjct  262   VSESGWPSAGDFAATIENAKTYNQNLIRHV--GRGTPRRSGAPIETYIFAMFNENQKNPE  319

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
              +EK+FG+F P+K   Y ++F
Sbjct  320   -LEKHFGLFNPNKQPVYPISF  339



>ref|XP_010921866.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=340

 Score =   315 bits (807),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 216/323 (67%), Gaps = 12/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLP  ++ + L KS  I  +R+Y  +  V  A +GSN+ +I+DV 
Sbjct  24    TGVQSIGVCYGMVGNNLPQPSEVVELYKSKTIGRMRIYGPNADVLQALKGSNIGLILDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
                LQ L +D + A  WVQ +I  Y   V+F+YIAVGNEV  GN     Y  +V+PA+ N
Sbjct  84    KEDLQRLASDRSAASNWVQNHIKSYLPDVSFRYIAVGNEVIPGN-----YAQYVLPAMNN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +H+AL+A+GLQ +IK +T+    VL  +YPP+ G F  DA   + P+V FLA  G+PLL 
Sbjct  139   IHSALSASGLQNQIKVSTSVSQGVLGTSYPPSSGTFSSDASKYLGPIVNFLASNGSPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GN   I + YALFT      N  P GY+NLFDAL+D++Y+A++K  G N+P
Sbjct  199   NVYPYFSYIGNMKDIKIEYALFTSPGTVVNDPPYGYQNLFDALVDAIYSALEKMKGSNIP  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSA G AAT  NA TY +NLI+HV  + GTP +PG+ IE Y+FAM++EN K 
Sbjct  259   IVVSESGWPSANGTAATMDNAKTYNQNLINHV--SRGTPKRPGKVIEAYVFAMFNENEKK  316

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                 E NFG+F P+K+  Y +NF
Sbjct  317   PSGTENNFGLFYPNKTPVYPINF  339



>emb|CAA09765.1| beta-1,3-glucanase [Cichorium intybus x Cichorium endivia]
Length=347

 Score =   315 bits (807),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/327 (49%), Positives = 217/327 (66%), Gaps = 9/327 (3%)
 Frame = -3

Query  1207  HI-TEVESIGVCYGKNG--NNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAV  1037
             HI  + +++GVCYG+     +LPSE  T+NL + NGI  +R+Y  +     A +G ++ +
Sbjct  23    HIFIDAQAVGVCYGRVAVPGSLPSEEATVNLYQQNGITAMRIYDPNQATLQALQGIDIEL  82

Query  1036  IVDVSNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMP  857
             ++DV N +L+ L +P  A  WV+ NI  Y   VNF+YIAVGNEV   N  T+ YV  V+P
Sbjct  83    MLDVPNSELESLNNPVAATTWVRNNIQNYP-GVNFRYIAVGNEVDPNNNATSDYVKLVLP  141

Query  856   ALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGN  677
             A+RNVH A+  A L  +IK +TATY+ +L N+YPP+ GVF ++ K  + P++ FL Q   
Sbjct  142   AMRNVHQAIVDASLANQIKVSTATYTGLLENSYPPSDGVFHENVKAFIEPIIAFLVQNNL  201

Query  676   PLLANIYPYFSYRGNPSQIPLSYALFTERNP----NPAGYRNLFDALLDSMYAAVQKAGG  509
             P+LANIYPYF+ +G+  Q+ LSYAL     P    N   Y NLFDA+LD+ YAA    GG
Sbjct  202   PMLANIYPYFAAQGS-MQVNLSYALLQPDAPVVNDNGIMYSNLFDAMLDAHYAAQAPFGG  260

Query  508   PNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDE  329
              N+ IVVSE+GWPS     AT +NA TYYRNLI HV    GT  KPG+SIETY FAM+DE
Sbjct  261   ENLEIVVSESGWPSCCDSIATVENAGTYYRNLIGHVTQVGGTSAKPGKSIETYQFAMFDE  320

Query  328   NLKGGDAVEKNFGVFRPDKSSKYQLNF  248
             N+K GD  EK+FG+F P+++ KYQ+NF
Sbjct  321   NIKDGDESEKHFGIFSPNQTPKYQVNF  347



>ref|XP_008227224.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=386

 Score =   316 bits (810),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 219/321 (68%), Gaps = 11/321 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             ESIGVCYG+  +NLP + + I+L ++NGIR +R++  +PP   A RGSN+ +IV V N  
Sbjct  34    ESIGVCYGRVADNLPPDPEVISLYQANGIRRMRIFDPNPPTLQALRGSNIELIVGVRNQD  93

Query  1012  LQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             +Q L  D A A AWVQ N++ Y   V F+YIAVGNE+    P  A  + +V+ A++N+  
Sbjct  94    IQSLGNDVAAATAWVQNNVLNYFPDVKFRYIAVGNEI---KPQDAEAI-YVLAAMKNIKT  149

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             A+A+A LQ +IK +TA   ++L ++YPP+ G F D A   +NP++ FLA  G+P LAN+Y
Sbjct  150   AIASANLQDQIKVSTAIDMSLLGSSYPPSTGSFSDAASSYINPIIAFLASNGSPFLANVY  209

Query  655   PYFSYRGNPSQIPLSYALF----TERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             PYFSY G+   I L YALF            GY NLF A +D++Y+A++KAGG +V IVV
Sbjct  210   PYFSYIGDTKDISLGYALFAAPGVTVQDGAFGYTNLFAAAVDALYSALEKAGGSSVEIVV  269

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SETGWPS GG  AT +NA+TYY+NLI  VKG  GTP + G+ +ETYLFAM+DEN KG   
Sbjct  270   SETGWPSQGGEGATVENASTYYKNLIDSVKG--GTPKRRGKPVETYLFAMFDENQKGPAE  327

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +E++FG+F PDK  KYQ+ FN
Sbjct  328   IERHFGLFSPDKQPKYQIRFN  348



>ref|XP_010279591.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=348

 Score =   314 bits (805),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 168/322 (52%), Positives = 213/322 (66%), Gaps = 14/322 (4%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYG  GNNLP   + ++L K+N I+ +R+Y  +     A +GSN+ V++ V N  
Sbjct  35    QSIGVCYGMLGNNLPPSNEVVDLFKANNIQMVRLYDPNRDALQALKGSNIEVMLGVPNSD  94

Query  1012  LQELT--DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
             LQ     D   A  +V  N+V   + + FKYI VGNEV      +     +V+PA+RNV 
Sbjct  95    LQRFAGGDLTPAFNFVYGNVVDNRDTIKFKYIVVGNEV------SLEDFKYVLPAMRNVQ  148

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              A+  AGLQ  +K TTATYS VL NT+PP+  VFR +    M P++ FLA+ G+PL ANI
Sbjct  149   RAVEQAGLQNLVKVTTATYSGVLDNTFPPSNSVFRAEYLQYMQPIIGFLAEKGSPLCANI  208

Query  658   YPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSY GNP+ I L YALFT ++         YRNLFDALLDSMYAAV+KAGG +V IV
Sbjct  209   YPYFSYSGNPASIRLDYALFTAQSDVAEDGQLRYRNLFDALLDSMYAAVEKAGGGSVKIV  268

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWP+AG  AATT NA TY   LI HVKG  GTP +P   IETY+FAM+DEN K G 
Sbjct  269   VSESGWPNAGESAATTPNAQTYLNGLIQHVKG--GTPRRPNGPIETYIFAMFDENTKPGA  326

Query  310   AVEKNFGVFRPDKSSKYQLNFN  245
               E++FG+F P+K  KYQ+NFN
Sbjct  327   ETERHFGLFSPNKQPKYQINFN  348



>ref|XP_010449818.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Camelina sativa]
Length=346

 Score =   314 bits (805),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 162/320 (51%), Positives = 219/320 (68%), Gaps = 10/320 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             E +GVCYG  GNNLPS+ DTI L +   IR +R+Y  +    NA + + + VIV V N  
Sbjct  24    EPVGVCYGMMGNNLPSKPDTIALFREKNIRRVRLYDPNQAALNALKNTGIEVIVGVPNSD  83

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             L+ LT+P+ AK+WVQ N++ +  AV+FKYIAVGNEV  GN       + V+PA+RNV++A
Sbjct  84    LRSLTNPSSAKSWVQNNVLNFYPAVSFKYIAVGNEVSPGNGG-----DLVLPAMRNVYDA  138

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L  A LQ +IK +TA    ++ N++PP+ G FR D +   +PV+ FL  T + LLANIYP
Sbjct  139   LRGANLQDRIKVSTAVDMTLIGNSFPPSSGEFRGDVRWYTDPVIGFLTSTNSALLANIYP  198

Query  652   YFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             YFSY  NP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++GG ++P+VVS
Sbjct  199   YFSYVDNPRDISLSYALFTSPSVVVWDGSRGYQNLFDALLDVVYSAVERSGGGSLPVVVS  258

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +ETYLFAM+DEN K  + +
Sbjct  259   ESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVETYLFAMFDENQKSPE-I  317

Query  304   EKNFGVFRPDKSSKYQLNFN  245
             EKNFG+F P+K  K+ + F+
Sbjct  318   EKNFGLFFPNKQPKFPITFS  337



>ref|XP_009146295.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Brassica rapa]
Length=357

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 219/322 (68%), Gaps = 10/322 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  E +GVCYG  GNNLPS+ DTI L + N IR +R+Y  +    NA + + + V+V V 
Sbjct  21    TSGEPVGVCYGMMGNNLPSKPDTIALFRQNNIRRVRLYDPNQEALNALKNTGIEVLVGVP  80

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N  L+ LT+P+ A+AW+Q N++ +  AVNFKYIAVGNEV   N         V+PA+RNV
Sbjct  81    NSDLRSLTNPSSARAWLQNNVLNHYPAVNFKYIAVGNEVIPSNGGGD-----VLPAMRNV  135

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL  A LQ +IK +TA    ++ N++PP+ G FR D +  ++P++ FL  T + LLAN
Sbjct  136   YDALRGANLQDRIKVSTAVDMTLIGNSFPPSAGEFRGDVRWYIDPIIGFLTSTNSVLLAN  195

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPI  494
             IYPYFSY GNP  I LSYALFT  N        GY+NLFDALLD +Y+AV+++GG ++P+
Sbjct  196   IYPYFSYIGNPRDISLSYALFTSPNVIVWDGSRGYQNLFDALLDVVYSAVERSGGGSLPV  255

Query  493   VVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGG  314
             VVSE+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +E YLFAM+DEN K  
Sbjct  256   VVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVEMYLFAMFDENQKNP  315

Query  313   DAVEKNFGVFRPDKSSKYQLNF  248
             + +EKNFG+F P+K  K+ + F
Sbjct  316   E-IEKNFGLFFPNKQPKFPIAF  336



>gb|ADG56569.1| beta-1,3-glucanase [Phyllostachys edulis]
Length=335

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 163/324 (50%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLPS +D + L +S GI G+R+Y  D    +A R S +++I+DV 
Sbjct  25    TAVQSIGVCYGVQGNNLPSRSDVVQLYRSKGINGMRIYFPDKQALDALRNSGISLILDVG  84

Query  1021  NPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N KL EL   P+ A +WVQ+N+ PY  AVN KYIAVGNEV  G+  +      ++ A+RN
Sbjct  85    NDKLGELAASPSNAASWVQSNVRPYYPAVNIKYIAVGNEVGGGSTQS------ILQAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ AL+AAGL G +K +T+    V+ N++PP++GVF   A+  M  + +FLA TG PLLA
Sbjct  139   LNGALSAAGL-GSVKVSTSVRFDVIANSFPPSKGVF---AQSYMTDIAKFLASTGAPLLA  194

Query  664   NIYPYFSYRGNPSQIPLSYALF-----TERNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
             N+YPYF+YR NP  I L+YA F        + N   Y NLFDA++D++ AAV+KAG P V
Sbjct  195   NVYPYFAYRDNPRDIKLNYATFQPGTTVRDDGNGLTYTNLFDAMVDAIVAAVEKAGAPRV  254

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPSAGGF AT  NA TY + LI HV  + GTP +PG ++E ++FAM++EN K
Sbjct  255   GIVVSESGWPSAGGFGATVDNARTYNQGLIDHV--SRGTPKRPG-ALEAFIFAMFNENQK  311

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
              GD +E++FG+F PDKS  Y + F
Sbjct  312   TGDEIERHFGLFNPDKSPAYAIRF  335



>ref|XP_004505796.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=368

 Score =   313 bits (803),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 213/314 (68%), Gaps = 7/314 (2%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +S+GVCYG   NNLP   + I+L K+NGI  +R+Y  +     A RGSN+ + + VSN  
Sbjct  57    QSLGVCYGIVANNLPPVVEVIDLFKTNGIARMRIYNPNQATLEALRGSNIELAIGVSNED  116

Query  1012  LQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             +Q +  D + A +WVQ NI+ YAN V F+YI VGNE+   +P +     FV+ A++N++ 
Sbjct  117   IQSIANDISSATSWVQINIINYANDVIFRYIIVGNEISHNDPTS----QFVLRAMQNIYG  172

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             AL    LQ +IK +T    ++L ++YPP+QG F  DA   + P+V FLA  G PLLAN+Y
Sbjct  173   ALG--NLQNQIKISTTIQLSLLGSSYPPSQGEFSPDAIPYITPIVNFLASNGAPLLANVY  230

Query  655   PYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             PYF+Y  +   I L YA FT++     GY+NLFDA+LD++YAA+ K G  ++ IVVSE+G
Sbjct  231   PYFAYISDQKDISLEYATFTQQGYTDIGYQNLFDAMLDALYAAILKTGASDLQIVVSESG  290

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG  ATT+NAA YY NLI+HV    GTP++PG+ IETYLFAM+DENLK G A E+ 
Sbjct  291   WPSAGGEGATTENAAAYYTNLINHVNSGNGTPMRPGQPIETYLFAMFDENLKPGAASEQY  350

Query  295   FGVFRPDKSSKYQL  254
             FG+F PDKS KY +
Sbjct  351   FGLFTPDKSQKYNI  364



>ref|XP_010907250.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=340

 Score =   312 bits (800),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 157/323 (49%), Positives = 216/323 (67%), Gaps = 12/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLP  ++ + L KS  I  +R+Y  +  V  A +GSN+ +I+DV 
Sbjct  24    TGVQSIGVCYGMVGNNLPQPSEVVELYKSKMIGQMRIYGPNADVLQALKGSNVGLILDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
                LQ L +DP+ A  WVQ NI  Y   V+F+YIA+GNEV  GN     Y  +V+PA+ N
Sbjct  84    KEDLQRLASDPSAASNWVQDNIKSYLPDVSFRYIAIGNEVIPGN-----YAQYVLPAMNN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +H+AL+A+GLQ +IK +T+    VL  +YPP+ G F  DA   +  +V FLA  G+PLL 
Sbjct  139   IHDALSASGLQNQIKVSTSVSQGVLGQSYPPSSGTFSSDASKYLGHIVNFLASNGSPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY  +   I + YALFT      N  P GY+NLFDA++D++Y+A++K  G N+P
Sbjct  199   NVYPYFSYIDDMKDIKIEYALFTSPGTVVNDPPYGYQNLFDAIVDAIYSALEKMEGSNIP  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSA G AAT  NA  Y +NLI+HV  + GTP +PG++IE Y+FAM++EN K 
Sbjct  259   VVVSESGWPSATGIAATMDNAKIYNQNLINHV--SRGTPKRPGKAIEAYIFAMFNENEKK  316

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +E NFG+F P+K+  Y +NF
Sbjct  317   PSGIENNFGLFYPNKTPVYPINF  339



>emb|CDY32230.1| BnaA01g17540D [Brassica napus]
Length=346

 Score =   312 bits (800),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 162/322 (50%), Positives = 219/322 (68%), Gaps = 10/322 (3%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  E +GVCYG  GNNLPS+ DTI L + N IR +R+Y  +    NA + + + V+V V 
Sbjct  21    TSGEPVGVCYGMMGNNLPSKPDTIALFRQNNIRRVRLYDPNQEALNALKNTGIEVLVGVP  80

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N  L+ LT+P+ A+AW+Q N++ +  AVNFKYIAVGNEV   N         V+PA+RNV
Sbjct  81    NSDLRSLTNPSSARAWLQNNVLNHYPAVNFKYIAVGNEVVPSNGGGD-----VLPAMRNV  135

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL  A LQ +IK +TA    ++ N++PP+ G FR D +  ++P++ FL  T + LLAN
Sbjct  136   YDALRGANLQDRIKVSTAVDMTLIGNSFPPSAGEFRGDIRWYIDPIIGFLTSTNSVLLAN  195

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPI  494
             IYPYFSY GNP  I LSYALFT  N        GY+NLFDALLD +Y+AV+++GG ++P+
Sbjct  196   IYPYFSYIGNPRDISLSYALFTSPNVIVWDGSRGYQNLFDALLDVVYSAVERSGGGSLPV  255

Query  493   VVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGG  314
             VVSE+GWPS GG AA+  NA  YY NL + V+ N GTP +PGR +E YLFAM+DEN K  
Sbjct  256   VVSESGWPSNGGNAASFDNARAYYTNLAARVRENRGTPKRPGRGVEMYLFAMFDENQKNP  315

Query  313   DAVEKNFGVFRPDKSSKYQLNF  248
             + +EKNFG+F P+K  K+ + F
Sbjct  316   E-IEKNFGLFFPNKQPKFPIAF  336



>ref|XP_010921890.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   312 bits (799),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 220/323 (68%), Gaps = 13/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NGNNLP  +  +NL KS  I  +R+Y  +     A +GSN+ +I+DV 
Sbjct  24    TGVKSIGVCYGMNGNNLPQPSAVVNLYKSKSINAMRLYGPNQDALQALKGSNIQLILDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
                LQ L ++P+ A  WVQ N+  Y+  V+FKYIAVGNEV  G+     Y  +V+PA+RN
Sbjct  84    KNDLQSLASNPSAANDWVQQNVKAYSPDVSFKYIAVGNEVITGD-----YAQYVLPAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +++AL++AGLQ +IK +TA  ++VL  + PP+ GVF  DA   ++P+VQFLA  G PLL 
Sbjct  139   IYSALSSAGLQNQIKVSTAVATSVLEKSSPPSDGVFSSDALTYLSPIVQFLASNGAPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY  N  QI +++ALFT      +     Y+NLFDA++D++YAA++K GG  VP
Sbjct  199   NVYPYFSYVDNQGQIDINFALFTSSEIVVHDGQYNYQNLFDAIVDAVYAALEKVGGSTVP  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSA G AAT  NA TY +NLI+HV    GTP +PG++IETY+F M++EN K 
Sbjct  259   IVVSESGWPSADGTAATINNAQTYNQNLINHV--GQGTPRRPGKAIETYIFEMFNENQK-  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                VE+NFG+F P     Y +NF
Sbjct  316   QPPVEQNFGLFYPSMQPVYPINF  338



>ref|XP_011083774.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Sesamum indicum]
Length=343

 Score =   311 bits (798),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 165/321 (51%), Positives = 213/321 (66%), Gaps = 8/321 (2%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V   GVCYG+ GNNLPS +D + L   N IR +R+Y    P   A RGSN+ +++ V N 
Sbjct  27    VAQTGVCYGRLGNNLPSSSDVVALYNQNNIRRMRIYDPHQPTLQALRGSNIELMLGVPNT  86

Query  1015  KLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              LQ +    A A  WVQ N+  Y N V F+YIAVGNEV     DT++YV FV+PAL+N+ 
Sbjct  87    DLQNVAASQANANTWVQNNVRNYPN-VRFRYIAVGNEVSPLRGDTSQYVQFVLPALQNIQ  145

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             NA++AAGL  +IK +TA  + VL N YPP  GVFR      +N +++FL     PLL NI
Sbjct  146   NAISAAGLGNQIKVSTAVETGVLGNAYPPADGVFRPKVAQYLNGIIRFLVNNRAPLLVNI  205

Query  658   YPYFSYRGNPSQIPLSYALFTERN---PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             YPYFSY  N +QI L YALFT      P    Y+NLF A+LD+MYAA++K+GG ++ IVV
Sbjct  206   YPYFSYISNKAQISLQYALFTSDGVVVPGGIRYQNLFYAILDAMYAALEKSGGSSLEIVV  265

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSAGG + +  NA TY  NLI  VK   GTP +PGR+IETY+FAM+DEN K  + 
Sbjct  266   SESGWPSAGGDSTSIDNARTYNTNLIQRVKN--GTPKRPGRAIETYIFAMFDENQKNPE-  322

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK+FG+F PD+ +KY +NFN
Sbjct  323   YEKHFGIFSPDRRAKYPINFN  343



>gb|AAQ90286.1| beta-1,3-glucanase, basic [Coffea arabica x Coffea canephora]
Length=343

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 215/316 (68%), Gaps = 7/316 (2%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG+ G+NLPS  D + L     I+ +R+Y    P   A  GSN+ VI+ V N  LQ 
Sbjct  31    GVCYGRLGSNLPSPADVVALCNQRNIKRMRIYDPHQPTLQALGGSNIEVILGVPNTDLQN  90

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +    A A  WVQ N+  Y N V F+YIAVGNEV +    TA+Y NF++PA+RN+ NA++
Sbjct  91    VAASQANANNWVQINVRKYPN-VKFRYIAVGNEV-SPLTGTAQYTNFLLPAIRNIFNAVS  148

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGL+ +IK +TA  + ++ N YPP+ G F+  A+  + P+VQFLA  G PLL N+YPYF
Sbjct  149   AAGLRNQIKVSTAIETGLVANGYPPSAGTFQPQAQNFIKPIVQFLAGNGAPLLVNVYPYF  208

Query  646   SYRGNPSQIPLSYALFTER---NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             SY GNP  I L YALFT      P+   Y+NLFDAL+D+ Y+A++KAGG +V IVVSETG
Sbjct  209   SYTGNPKSIALEYALFTSSGITTPDGVKYQNLFDALVDATYSALEKAGGSSVQIVVSETG  268

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG A +  NA TY  NLI HV GN+GTP +PGR+IETY+F ++DE+ K  +  EK+
Sbjct  269   WPSAGGQATSIDNARTYNNNLIKHVNGNSGTPKRPGRAIETYIFDLFDEDQKSPE-YEKH  327

Query  295   FGVFRPDKSSKYQLNF  248
             FG+F P++  KY ++F
Sbjct  328   FGLFLPNRQPKYPISF  343



>ref|XP_010692567.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=341

 Score =   311 bits (796),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 171/328 (52%), Positives = 224/328 (68%), Gaps = 18/328 (5%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             H TE + IGVCYG NGNNLP+  D +NL +SNGI  +R+YA D P   A +GS + +I+D
Sbjct  25    HPTEAQ-IGVCYGNNGNNLPNPQDVVNLYRSNGIGAMRIYAPDQPTLQALQGSGIRIILD  83

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V    LQ L +D + A  WVQ N+VP+A+++  KYIAVGNE+ A +   +     V PA+
Sbjct  84    VPRDNLQSLASDQSAANQWVQTNVVPFASSI--KYIAVGNEIHASDQQASS----VAPAM  137

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             +NV NAL +  L G+IK +TA  + ++TN++PP+ G F D   G + P++ FL    +PL
Sbjct  138   QNVLNALNSNNLGGQIKVSTAIDTTLITNSFPPSNGQFSD--GGYITPIINFLTGNDSPL  195

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERNP------NPAGYRNLFDALLDSMYAAVQKAGG  509
             L N+YPYF+Y  NP  I L YALFT          N   Y+NLFDALLD++YAA+ +AG 
Sbjct  196   LVNVYPYFAYTNNPQSIQLEYALFTSGGTVVTDTNNGKNYQNLFDALLDAVYAALGRAGA  255

Query  508   PNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDE  329
             PN  IVVSE+GWPS GG AAT+ NA TYYRNLI HV    GTPLKPG+ IETYLFAM+DE
Sbjct  256   PNTAIVVSESGWPSEGGNAATSDNAGTYYRNLIGHVS--QGTPLKPGQGIETYLFAMFDE  313

Query  328   NLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             N K GDA E++FG+F P + +KYQL+F+
Sbjct  314   NSKTGDATEQHFGLFTPAQQAKYQLSFS  341



>ref|XP_008811757.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Phoenix 
dactylifera]
Length=346

 Score =   311 bits (797),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 164/323 (51%), Positives = 220/323 (68%), Gaps = 13/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             + V+SIGVCYG  GNNLP  +D +NL KS  I+ +R+Y  +    +A +GSN+ +I+D  
Sbjct  24    SSVQSIGVCYGMVGNNLPQPSDVVNLYKSENIKAMRLYGPNQAALDALKGSNIQLILDFP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             NP L+ + ++PA A  WVQ N+  Y   V+FKYIAVGNEV  G  D A+YV   +PA+RN
Sbjct  84    NPDLKSVASNPAAANDWVQKNVRAYYPDVSFKYIAVGNEVIPG--DHAQYV---LPAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + +AL+ AGLQ +IK +TA  + VL  +YPP+ G F  +A   + P+V FLA  G PLL 
Sbjct  139   IFSALSLAGLQNQIKVSTAVSTGVLGASYPPSAGEFSSNALNYLRPIVHFLAGNGAPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNP----NPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+ I + +ALFT            Y+NLFDA +D++Y+A++KAGG NV 
Sbjct  199   NVYPYFSYVGNPNSIKIEFALFTSLGTFVMDGQHRYQNLFDATVDAVYSALEKAGGSNVA  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSAGG AA+  NA  Y +NLI HV    GTP +PGR+IET+LFAM++EN K 
Sbjct  259   IVVSESGWPSAGGTAASINNAQIYNQNLIRHV--GHGTPKRPGRAIETFLFAMFNENQK-  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                +EKNFG+F P+K   Y +NF
Sbjct  316   PQGIEKNFGLFYPNKQPVYPINF  338



>emb|CDP14179.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   310 bits (795),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 161/316 (51%), Positives = 215/316 (68%), Gaps = 7/316 (2%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG+ G+NLPS  D + L     I+ +R+Y    P   A  GSN+ VI+ V N  LQ 
Sbjct  31    GVCYGRLGSNLPSPADVVALCNQRNIKRMRIYDPHQPTLQALGGSNIEVILGVPNTDLQN  90

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +    A A  WVQ N+  Y N V F+YIAVGNEV +    TA+Y NF++PA+RN+ NA++
Sbjct  91    VAASQANANNWVQNNVRKYPN-VKFRYIAVGNEV-SPLTGTAQYTNFLLPAIRNIFNAVS  148

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGL+ +IK +TA  + ++ N YPP+ G F+  A+  + P+VQFLA  G PLL N+YPYF
Sbjct  149   AAGLRNQIKVSTAIETGLVANGYPPSAGTFQPQAQNFIKPIVQFLAGNGAPLLVNVYPYF  208

Query  646   SYRGNPSQIPLSYALFTER---NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             SY GNP  I L YALFT      P+   Y+NLFDAL+D+ Y+A++KAGG +V IVVSETG
Sbjct  209   SYTGNPKSIALEYALFTSSGITTPDGVKYQNLFDALVDATYSALEKAGGSSVQIVVSETG  268

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG A +  NA TY  NLI HV GN+GTP +PGR+IETY+F ++DE+ K  +  EK+
Sbjct  269   WPSAGGQATSIDNARTYNNNLIKHVNGNSGTPKRPGRAIETYIFDLFDEDQKSPE-YEKH  327

Query  295   FGVFRPDKSSKYQLNF  248
             FG+F P++  KY ++F
Sbjct  328   FGLFLPNRQPKYPISF  343



>gb|KFK36125.1| hypothetical protein AALP_AA4G081000 [Arabis alpina]
Length=350

 Score =   311 bits (796),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 224/323 (69%), Gaps = 12/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T  ES+GVCYG  GNNLPS+++TI L K N I+ +R+Y  +    NA + + + V++ V 
Sbjct  23    TSGESVGVCYGMMGNNLPSQSETITLFKQNNIKRVRLYDPNQNALNALKNTGIEVLIGVP  82

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             N +L+ LT+P+ AK+W+Q N++ Y  AV+FKYIAVGNEV   N         V+PA+RNV
Sbjct  83    NSELRSLTNPSSAKSWLQNNVLNYHPAVSFKYIAVGNEVSPNNGGD------VLPAMRNV  136

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++AL +  L  +IK +TA    ++ N++PP+ G FR D +  ++P++ FL  T + LLAN
Sbjct  137   YDALRSVNLHDRIKVSTAIDMTLIGNSFPPSSGEFRGDVRWYIDPIIGFLKSTNSALLAN  196

Query  661   IYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKA-GGPNVP  497
             IYPYFSY  NP  I LSYALFT  +        GY+NLFDALLD +Y+AV+++ GG ++P
Sbjct  197   IYPYFSYVDNPRDISLSYALFTSPSVIVWDGSRGYQNLFDALLDVVYSAVERSNGGDSLP  256

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPS GG AA+  NA  YY NL + V+ N GTP +PG+ +ETYLFAM+DENLK 
Sbjct  257   VVVSESGWPSNGGTAASFDNAKAYYTNLAARVRENRGTPKRPGKGVETYLFAMFDENLKN  316

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
              + +EKNFG+F P+K +K+ ++F
Sbjct  317   PE-IEKNFGLFFPNKQAKFPISF  338



>ref|XP_004505799.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=329

 Score =   310 bits (793),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/314 (49%), Positives = 213/314 (68%), Gaps = 7/314 (2%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +S+GVCYG   NNLP   + I+L K+NGI  +R+Y  +     A RGSN+ + + V N +
Sbjct  21    QSVGVCYGIVANNLPPAVEVIDLFKTNGIARMRIYNPNQATLEALRGSNIELAIGVPNEE  80

Query  1012  LQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             +Q +  D + A  WVQ NI+ YAN V F+YI +GNE+   +P +     F++PA++N++ 
Sbjct  81    IQSIANDISSAANWVQNNIINYANNVIFRYIILGNEISPNDPTS----QFILPAMQNIYG  136

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             AL    LQ +IK +TA   ++L ++YPP+QG F  DA   + P+V FL+  G PLLAN+Y
Sbjct  137   ALG--NLQNQIKISTAIQLSLLGSSYPPSQGEFSPDAIPYITPIVNFLSTNGAPLLANVY  194

Query  655   PYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             PYF+Y  +   I L YA FT++     GY+NLFDA+LD++YAA+ K G  ++ IVVSE+G
Sbjct  195   PYFAYISDQKDISLEYATFTQQGYTDIGYQNLFDAMLDALYAAILKTGASDLQIVVSESG  254

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG  ATT+NAA YY NLI+HV    GTP++P +SIETYLFAM+DEN+K G   E+ 
Sbjct  255   WPSAGGEGATTENAAAYYTNLINHVNSGIGTPMRPNQSIETYLFAMFDENMKPGATSEQY  314

Query  295   FGVFRPDKSSKYQL  254
             FG+F PDKS KY +
Sbjct  315   FGLFTPDKSQKYNI  328



>ref|XP_004505797.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=321

 Score =   309 bits (792),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/314 (49%), Positives = 209/314 (67%), Gaps = 7/314 (2%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +S+GVCYG   NNLP   + I+L K+NGI  +R+Y  +     A RGSN+ + + VSN  
Sbjct  12    QSLGVCYGIVANNLPPVVEVIDLFKTNGIARMRIYNPNQATLEALRGSNIELAIGVSNED  71

Query  1012  LQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             +Q +  D + A +WVQ NI+ YAN V F+YI VGNE+   +P +     FV+ A++N++ 
Sbjct  72    IQSIANDISSATSWVQINIINYANDVIFRYIIVGNEISHNDPTS----QFVLRAMQNIYG  127

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             AL    LQ +IK +TA   ++L ++YPP+QG F  DA   + P+V FLA  G PLLAN+Y
Sbjct  128   ALG--NLQNQIKISTAIQLSLLGSSYPPSQGEFSPDAISYITPIVNFLATNGAPLLANVY  185

Query  655   PYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             PYF+Y  +   I L YA FT++     GY+NLFDA+LD++Y AV K G  N+ IVVSE+G
Sbjct  186   PYFAYISDQKDISLEYATFTQQGYTDIGYQNLFDAMLDALYVAVLKTGASNLQIVVSESG  245

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG  A T+N   YY NLI+HV     TP++P +SIETYLFAM+DEN+K G A E+ 
Sbjct  246   WPSAGGEGAITENDDAYYTNLINHVNSGIETPMRPNQSIETYLFAMFDENMKSGAASEQY  305

Query  295   FGVFRPDKSSKYQL  254
             FG+F PDKS KY +
Sbjct  306   FGLFTPDKSQKYNI  319



>ref|XP_010673702.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=340

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 173/351 (49%), Positives = 236/351 (67%), Gaps = 25/351 (7%)
 Frame = -3

Query  1261  LPCKSSMAAlilllvglLHITEVESIGVCYG--KNGNNLPSETDTINLMKSNGIRGLRVY  1088
             +   +S+ A+ +LL+ + H  E + IGVCYG  +NG+NLPS+ D +N  +S GI+ +R+Y
Sbjct  1     MAATTSLFAIAILLLSIQHTAEAQ-IGVCYGGSQNGDNLPSQQDVVNFYQSKGIQAMRMY  59

Query  1087  AADPPVFNAARGSNLAVIVDVSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGN  911
             A       A + +N+ VI+DV N KLQ L +DP+ A  WVQ N+VP+A+++  KYIAVGN
Sbjct  60    APYQATLQALQSTNIKVILDVPNDKLQSLASDPSTAMEWVQTNVVPFASSI--KYIAVGN  117

Query  910   EVFAGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRD  731
             E+   + + +     V PA++NV NAL +  L  +IK +T+  ++++TN+YPP+ G F D
Sbjct  118   EIHPSDQEASS----VQPAMQNVLNALKSNNLDDQIKVSTSIDTSLITNSYPPSNGQFSD  173

Query  730   DAKGLMNPVVQFLAQTGNPLLANIYPYFSYR-GNPSQIPLSYALF-------TERNPNPA  575
                  + P++ FL   G+PLL NIYPYFSYR GN   I L YALF       T+ N N  
Sbjct  174   --ISYVTPIINFLTSNGSPLLVNIYPYFSYRYGNKQDITLDYALFKAPGNVVTDSNNN-L  230

Query  574   GYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWPSAG-GFAATTQNAATYYRNLISHVK  398
              Y+NLFDA++DS+YAA+ KAG PN  +VVSETGWPS G G AAT  NA TYYRNLI+HV 
Sbjct  231   NYQNLFDAMVDSVYAALGKAGAPNTAVVVSETGWPSDGDGDAATVDNAGTYYRNLINHV-  289

Query  397   GNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKY-QLNF  248
              N GTPLK G++IETYLF M+DEN K  D  E++FG+F PD+  KY Q+NF
Sbjct  290   -NQGTPLKAGQAIETYLFEMFDENKKPNDETERHFGLFFPDQHPKYGQINF  339



>ref|XP_006645316.1| PREDICTED: glucan endo-1,3-beta-glucosidase GII-like [Oryza brachyantha]
Length=334

 Score =   309 bits (791),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 170/323 (53%), Positives = 218/323 (67%), Gaps = 18/323 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLPS  + + L +S GI G+R+Y  D    NA R S + +I+DV 
Sbjct  25    TAVQSIGVCYGVLGNNLPSRNEVVQLYRSKGINGMRIYYPDKEALNALRNSGIGLILDVG  84

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             +         A A+AWV+ N+ PY  AVN KYIAVGNEV  G        N ++PA+RNV
Sbjct  85    DALNYLAGSAANAEAWVRDNVRPYYPAVNIKYIAVGNEVEGGA------TNSILPAMRNV  138

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++ALA++GL G IKA+TA  S V+TN+YPP+ GVFRD+    M  +  +LA TG PLLAN
Sbjct  139   NSALASSGL-GAIKASTAVKSDVITNSYPPSAGVFRDN---YMRDIAGYLASTGAPLLAN  194

Query  661   IYPYFSYRGNPSQIPLSYALF----TERNPNPA-GYRNLFDALLDSMYAAVQKAGGPNVP  497
             IYPYF+YRGNP  I L+YA F    T R+PN    Y NLFDA++DS YAA++KAG  +V 
Sbjct  195   IYPYFAYRGNPRDISLNYATFRPGTTVRDPNSGLTYTNLFDAMMDSTYAALEKAGAGSVR  254

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSA GF A+  NA  Y + LI HV    GTP +PG+ +E Y+FAM++EN K 
Sbjct  255   IVVSESGWPSAEGFGASMDNARAYNQGLIDHV--GRGTPKRPGQ-LEAYIFAMFNENQKT  311

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             GDA E+NFG+F P+KS  Y + F
Sbjct  312   GDATERNFGLFYPNKSPVYPIRF  334



>gb|AIS22073.1| beta-1,3 glucanase 4 [Musa AB Group]
Length=340

 Score =   309 bits (792),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 219/321 (68%), Gaps = 13/321 (4%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V +IGVCYG+ GNNLP   + +NL K+N I  +R+Y  +  V  A RGSN+ ++VDV N 
Sbjct  27    VSAIGVCYGRLGNNLPQPGEVVNLYKANKIGSMRIYDPNQEVLQALRGSNIQLVVDVPNE  86

Query  1015  KLQELTDPARAKA-WVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              LQ L   A A + WVQ N+V +  +V+F+YIAVGNEV  G         +V+PA++NV 
Sbjct  87    DLQSLASDASAASKWVQKNVVAFRPSVSFRYIAVGNEVIPGG-----LAQYVLPAMQNVQ  141

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              A++AAGLQ +IK +T+  + VL  +YPP+ G F   A+  MNP+VQFLA+ G PLL N+
Sbjct  142   KAVSAAGLQNQIKVSTSVATIVLGTSYPPSAGAFSSAAQTYMNPIVQFLAKNGAPLLVNV  201

Query  658   YPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSYR N +QI  SYALFT           GYRNLFDA++D++YAA++K GG NV IV
Sbjct  202   YPYFSYRDNRNQISASYALFTSTEVVVKDGQFGYRNLFDAMVDAVYAAMEKVGGSNVAIV  261

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAG FAAT +NA TY +NLI HV    GTP K G  IETY+FAM++EN K  +
Sbjct  262   VSESGWPSAGDFAATIENAKTYNQNLIRHV--GRGTPRKSGAPIETYIFAMFNENQKNPE  319

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
              +EK+FG+F P+K   Y ++F
Sbjct  320   -LEKHFGLFNPNKQPVYPISF  339



>ref|XP_003607322.1| Endo-1 3-beta-glucanase [Medicago truncatula]
Length=373

 Score =   310 bits (795),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/323 (49%), Positives = 219/323 (68%), Gaps = 5/323 (2%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             H+ + +SIG CYG+  NNLP     IN+ + N I  +R+Y  D     A+RGS L++++ 
Sbjct  53    HLYKAQSIGACYGQVANNLPPVAFVINMFEQNIIHKMRIYNPDQATLEASRGSLLSLVIG  112

Query  1027  VSNPKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V N  +Q +  D + A  WVQ NI+ Y   VNF+YI VGNE+   N  T++   FV+ A+
Sbjct  113   VPNEDIQSIANDISSANNWVQNNILKYTPGVNFRYIVVGNEINPSNDPTSQ---FVLRAM  169

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             +N+++ALA+A LQ +IK +TA    +L ++YPP+ G F   A   +  +V FL  T  PL
Sbjct  170   QNIYSALASANLQNQIKISTAINMGLLGSSYPPSAGAFSASAIPYITSIVGFLVNTEAPL  229

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             LAN++PYF+Y G+P  IPL +ALF ++  N  GY+NLFDA LDS+YAA++K GG +V IV
Sbjct  230   LANVHPYFAYIGDPQNIPLDFALFKQQGNNAVGYQNLFDAQLDSVYAALEKVGGSSVKIV  289

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAGG  AT +NA TYY NLI+H     GTPL+PG++IETYLFAM+DEN K G 
Sbjct  290   VSESGWPSAGGDVATIENARTYYSNLINHANSGNGTPLRPGQAIETYLFAMFDENQKPGA  349

Query  310   AVEKNFGVFRPDKSS-KYQLNFN  245
             A E++FG+F P  +S KY L+FN
Sbjct  350   ATEQHFGLFNPVGTSPKYILSFN  372



>gb|AHW57401.1| beta-1,3 glucanase 4 [Musa AB Group]
Length=340

 Score =   309 bits (791),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 166/321 (52%), Positives = 219/321 (68%), Gaps = 13/321 (4%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V +IGVCYG+ GNNLP   + +NL K+N I  +R+Y  +  V  A RGSN+ ++VDV N 
Sbjct  27    VSAIGVCYGRLGNNLPQPGEVVNLYKANKIGSMRIYDPNQEVLQALRGSNIQLVVDVPNE  86

Query  1015  KLQELTDPARAKA-WVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              LQ L   A A + WVQ N+V +  +V+F+YIAVGNEV  G         +V+PA++NV 
Sbjct  87    DLQSLASDASAASKWVQRNVVAFRPSVSFRYIAVGNEVIPGG-----LAQYVLPAMQNVQ  141

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              A++AAGLQ +IK +T+  + VL  +YPP+ G F   A+  MNP+VQFLA+ G PLL N+
Sbjct  142   KAVSAAGLQNQIKVSTSVATIVLGTSYPPSAGAFSSAAQTYMNPIVQFLAKNGAPLLVNV  201

Query  658   YPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYFSYR N +QI  SYALFT           GYRNLFDA++D++YAA++K GG NV IV
Sbjct  202   YPYFSYRDNRNQISASYALFTSTEVVVKDGQFGYRNLFDAMVDAVYAAMEKVGGSNVAIV  261

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGD  311
             VSE+GWPSAG FAAT +NA TY +NLI HV    GTP K G  IETY+FAM++EN K  +
Sbjct  262   VSESGWPSAGDFAATIENAKTYNQNLIRHV--GRGTPRKSGAPIETYIFAMFNENQKNPE  319

Query  310   AVEKNFGVFRPDKSSKYQLNF  248
              +EK+FG+F P+K   Y ++F
Sbjct  320   -LEKHFGLFNPNKQPVYPISF  339



>ref|XP_010907249.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 158/323 (49%), Positives = 217/323 (67%), Gaps = 13/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NGNNLP  +  +NL KS  I+ +R+Y  D     A + SN+ +I+DV 
Sbjct  24    TGVKSIGVCYGMNGNNLPQPSTVVNLYKSKNIKAMRLYDPDQAALQALKSSNIQLILDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  LQ L ++ + A  WVQ N+  Y+++V+FKYIAVGNEV  G         +V+PA+RN
Sbjct  84    NTALQSLASNTSAANDWVQQNVKAYSSSVSFKYIAVGNEVIPG-----AQAQYVLPAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +++AL++AGLQ +IK +T+  ++VL  + PP+ GVF   A   + P+VQFLA  G PLL 
Sbjct  139   IYSALSSAGLQNQIKVSTSVATSVLAESSPPSHGVFSSAALTYLRPIVQFLASNGAPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY  +   I ++YALFT            Y+NLFDA++D++YAA++K GG NV 
Sbjct  199   NVYPYFSYVDSQGTININYALFTSSGTVVTDGQYKYQNLFDAIVDAVYAALEKVGGSNVT  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSAGG+AAT  NA TY +NLI+HV    GTP +PG++IE Y+F M++EN K 
Sbjct  259   IVVSESGWPSAGGYAATINNAKTYNQNLINHV--GQGTPRRPGKTIEAYIFEMFNENQKS  316

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
                VE+NFG+F P     Y +NF
Sbjct  317   A-GVEQNFGLFYPSTQPVYTINF  338



>ref|XP_010921893.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=339

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 161/323 (50%), Positives = 216/323 (67%), Gaps = 13/323 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLP  +D +NL KS  I  +R+Y        A + SN+ +I+D  
Sbjct  24    TRVQSIGVCYGMVGNNLPKPSDVVNLYKSENIDAMRLYGPSQAALQALKDSNIQLILDAP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             NP L+   ++P+ A  WVQ N+  Y   V+FKYI+VGNEV  G  D A+YV   +PA+RN
Sbjct  84    NPDLRSFASNPSAANDWVQKNVKAYYPGVSFKYISVGNEVIPG--DHAQYV---LPAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             + +AL  AGLQ +IK +TA  + VL  +YPP+ G F  +A   + P++ FLA +G PLL 
Sbjct  139   IFSALCLAGLQDQIKVSTAVATGVLGTSYPPSAGAFSSNALNYLRPILGFLASSGAPLLV  198

Query  664   NIYPYFSYRGNPSQIPLSYALFTERNP----NPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+ I + +ALFT            Y+NLFDA++D++Y+A++K GG NVP
Sbjct  199   NVYPYFSYVGNPNNINIEFALFTSLGTFVMDGQHRYQNLFDAIVDAVYSAMEKEGGSNVP  258

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSETGWPSAGG AA+  NA  Y +NLI HV    GTP +PGR++ET+LFAM++EN K 
Sbjct  259   IVVSETGWPSAGGVAASINNAKIYNQNLIWHV--GQGTPKRPGRAVETFLFAMFNENQK-  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
              + +EKNFG+F P K   Y +NF
Sbjct  316   PEGIEKNFGLFYPSKQPVYPINF  338



>gb|EYU35916.1| hypothetical protein MIMGU_mgv1a009371mg [Erythranthe guttata]
Length=344

 Score =   308 bits (790),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 165/322 (51%), Positives = 217/322 (67%), Gaps = 14/322 (4%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             +IGVC G+ G NLP E D +   K+NGI+ +R+Y  +     A + S + +++ V N  L
Sbjct  29    TIGVCNGRVGGNLPPEKDVVEFYKTNGIKRMRIYDPNQATLTALQNSGIELMLGVPNVDL  88

Query  1009  QEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             Q L TD   A  WV AN+  +  +   +YIAVGNEV   NP+T  Y   V+PA+++++ A
Sbjct  89    QSLQTD---ATTWVNANVRAHFPSTKIRYIAVGNEVDPENPETQIYAPLVLPAMQSIYRA  145

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             L    LQ +IK +TAT+SAVLT+TYPP++  F+ ++   M P+V+FLAQT +PLLANIYP
Sbjct  146   LTLFNLQDQIKVSTATFSAVLTDTYPPSKATFKSNS--FMEPIVKFLAQTRSPLLANIYP  203

Query  652   YFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             YF Y G+   I L YALFT           GYRNLFDA++D+MY+A +KAGG +V IVVS
Sbjct  204   YFGYIGDAENIQLPYALFTAAGVVVQDGGYGYRNLFDAMVDAMYSATEKAGGGSVEIVVS  263

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPS GG AAT +NA  YYRNLI HV  N GTP KPG++IETYLFAM+DEN K G   
Sbjct  264   ESGWPSDGGVAATVENAGVYYRNLIGHV--NKGTPKKPGKAIETYLFAMFDENQKPGAES  321

Query  304   EKNFGVFRPDKSS-KYQ-LNFN  245
             E++FG+F PD    KYQ L+FN
Sbjct  322   EQHFGLFNPDNMQLKYQPLSFN  343



>gb|AES89519.2| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=391

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 159/320 (50%), Positives = 217/320 (68%), Gaps = 5/320 (2%)
 Frame = -3

Query  1198  EVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSN  1019
             E +SIG CYG+  NNLP     IN+ + N I  +R+Y  D     A+RGS L++++ V N
Sbjct  74    EAQSIGACYGQVANNLPPVAFVINMFEQNIIHKMRIYNPDQATLEASRGSLLSLVIGVPN  133

Query  1018  PKLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
               +Q +  D + A  WVQ NI+ Y   VNF+YI VGNE+   N  T++   FV+ A++N+
Sbjct  134   EDIQSIANDISSANNWVQNNILKYTPGVNFRYIVVGNEINPSNDPTSQ---FVLRAMQNI  190

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++ALA+A LQ +IK +TA    +L ++YPP+ G F   A   +  +V FL  T  PLLAN
Sbjct  191   YSALASANLQNQIKISTAINMGLLGSSYPPSAGAFSASAIPYITSIVGFLVNTEAPLLAN  250

Query  661   IYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSE  482
             ++PYF+Y G+P  IPL +ALF ++  N  GY+NLFDA LDS+YAA++K GG +V IVVSE
Sbjct  251   VHPYFAYIGDPQNIPLDFALFKQQGNNAVGYQNLFDAQLDSVYAALEKVGGSSVKIVVSE  310

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPSAGG  AT +NA TYY NLI+H     GTPL+PG++IETYLFAM+DEN K G A E
Sbjct  311   SGWPSAGGDVATIENARTYYSNLINHANSGNGTPLRPGQAIETYLFAMFDENQKPGAATE  370

Query  301   KNFGVFRPDKSS-KYQLNFN  245
             ++FG+F P  +S KY L+FN
Sbjct  371   QHFGLFNPVGTSPKYILSFN  390



>gb|ABD85024.1| beta-1,3-glucanase [Lilium hybrid division VII]
Length=337

 Score =   306 bits (785),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 228/350 (65%), Gaps = 20/350 (6%)
 Frame = -3

Query  1279  MALQHPLPCKSSMAAlilllvglLHITE-VESIGVCYGKNGNNLPSETDTINLMKSNGIR  1103
             MA QH +    SMAA+  LLV L  I   VESIGVC G +G+NLP   D +NL KSN I 
Sbjct  1     MAAQHII----SMAAMASLLVVLSAIPRGVESIGVCNGMDGDNLPQPADVVNLYKSNNIA  56

Query  1102  GLRVYAADPPVFNAARGSNLAVIVDVSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKY  926
             G+R+Y  D     A +GSN+ +I+DV N  LQ + +D + A  WVQ N+  Y N V F+Y
Sbjct  57    GMRLYRPDQATLQALQGSNIYLILDVPNSDLQNIASDQSAATNWVQTNVQAYPN-VAFRY  115

Query  925   IAVGNEVFAGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQ  746
             IAVGNEV  G         +V+PA+ N+ +AL++AGLQ  IK +T+    V+  +YPP+ 
Sbjct  116   IAVGNEVIPGGQ-----AQYVLPAMNNIQSALSSAGLQ-NIKVSTSVSFGVVGTSYPPSA  169

Query  745   GVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTER----NPNP  578
             G F  DA   + P++QFLA  G+PLLANIYPY SY GN   I LSYALFT          
Sbjct  170   GSFSSDASSTLGPIIQFLASNGSPLLANIYPYLSYAGNSGSIDLSYALFTASGTVVQDGS  229

Query  577   AGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVK  398
               Y NLFDA++D++Y+A++ AGGPNVP+VVSE+GWPSAGG AAT  NA TY  NLI+HV 
Sbjct  230   YAYNNLFDAMVDALYSALESAGGPNVPVVVSESGWPSAGGTAATVSNAQTYNSNLINHV-  288

Query  397   GNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNF  248
                GTP +PG +IETY+FAM++E+ K    +E NFG+F P++   Y ++F
Sbjct  289   -GQGTPKRPG-AIETYIFAMFNEDQKQPQGIENNFGLFYPNEQPVYSISF  336



>emb|CDP14184.1| unnamed protein product [Coffea canephora]
Length=343

 Score =   306 bits (785),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 154/316 (49%), Positives = 215/316 (68%), Gaps = 7/316 (2%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG+ G+ LPS  D + L K N IR +R+Y    P   A  GSN+ +I+ V N  LQ 
Sbjct  31    GVCYGRLGSRLPSPADVVALCKQNNIRRMRIYDPHRPTLQALGGSNIELILGVPNTDLQN  90

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +    A A  WV  N+  Y N V F YIAVGNEV +   DTA+Y  F++PA++N++NA++
Sbjct  91    IAASQASANNWVHNNVRNYPN-VRFSYIAVGNEV-SPLRDTAQYTRFLLPAMQNIYNAIS  148

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGL  ++K +TA  + ++  +YPP+ G+FR + +  +NP+VQFLA+   PLL N+YP+F
Sbjct  149   AAGLGNQVKVSTAVETGLVGQSYPPSAGIFRQEVRSFINPIVQFLARNRAPLLVNVYPFF  208

Query  646   SYRGNPSQIPLSYALFTER---NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             +Y GNP  I L YALFT      P+   Y+NLFDAL+D+ Y+A++KAGG ++ IVVSE+G
Sbjct  209   AYTGNPRDISLQYALFTSSGIVTPDGVRYQNLFDALVDATYSALEKAGGSSIEIVVSESG  268

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPSAGG A +  NA TY  NLI HV G +GTP +P R+IETY+FA++DE+ K  +  EK+
Sbjct  269   WPSAGGQATSIDNARTYNSNLIGHVTGGSGTPKRPRRNIETYIFALFDEDQKSPE-YEKH  327

Query  295   FGVFRPDKSSKYQLNF  248
             FG+F P++  KYQ+ F
Sbjct  328   FGLFLPNRQPKYQITF  343



>ref|XP_002459074.1| hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor]
 gb|EES04194.1| hypothetical protein SORBIDRAFT_03g045460 [Sorghum bicolor]
Length=332

 Score =   306 bits (784),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 178/343 (52%), Positives = 232/343 (68%), Gaps = 21/343 (6%)
 Frame = -3

Query  1255  CKSSMAAlilllvglLHI-TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAAD  1079
             C +SM AL LLL     I T V++IGVCYG NG+NLPS +D + L +SNGI  +R+Y AD
Sbjct  5     CIASMLALALLLGAFAAIPTGVQAIGVCYGVNGDNLPSASDVVKLYQSNGINLMRIYFAD  64

Query  1078  PPVFNAARGSNLAVIVDVSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVF  902
                 NA  GSN+ VI+DV N  L  L +DP+ A  WV++N+  +   VNFKYIAVGNEV 
Sbjct  65    TNALNALSGSNIGVIMDVPNTDLSSLASDPSAAATWVKSNVQAFP-GVNFKYIAVGNEVS  123

Query  901   AGNPDTARYVNFVMPALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAK  722
              G+       N ++PA++NV++AL+ AGL GKIK +TA  S V T  YPP+QG F   ++
Sbjct  124   GGD------TNNILPAMKNVNSALSNAGL-GKIKVSTAVQSGV-TQGYPPSQGSF---SQ  172

Query  721   GLMNPVVQFLAQTGNPLLANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFD  554
               M P+ Q+L  TG PLL N+YPYFSY GN +QI LSYALFT            Y+NLFD
Sbjct  173   SYMAPIAQYLQSTGAPLLCNVYPYFSYTGNEAQIALSYALFTSPGTVVQDGSNAYQNLFD  232

Query  553   ALLDSMYAAVQKAGGPNVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLK  374
             AL+D+  +A++ AG  NV +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +
Sbjct  233   ALVDTFVSALENAGAGNVGVVVSESGWPSAGGDAATPGNAQTYNQNLINHV--GKGTPKR  290

Query  373   PGRSIETYLFAMYDENLKGGDAVEKNFGVFRPDKSSKYQLNFN  245
             PG +IETY+FAM++E+ K G   E++FG+F PDKS  Y +NF+
Sbjct  291   PG-AIETYIFAMFNEDKKTGAETERHFGLFNPDKSPAYSINFS  332



>gb|ABB04444.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   305 bits (781),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSVG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62688.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62689.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62692.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABA33843.1| pathogenesis-related protein 6 [Zea diploperennis]
 gb|ACJ62683.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   305 bits (780),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62680.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABA33840.1| pathogenesis-related protein 6 [Zea diploperennis]
 gb|ABA33841.1| pathogenesis-related protein 6 [Zea diploperennis]
 gb|ABA33842.1| pathogenesis-related protein 6 [Zea diploperennis]
 gb|ABA33844.1| pathogenesis-related protein 6 [Zea diploperennis]
Length=334

 Score =   305 bits (780),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAGAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>ref|NP_001045372.1| Os01g0944700 [Oryza sativa Japonica Group]
 dbj|BAB63853.1| putative beta 1,3-glucanase [Oryza sativa Japonica Group]
 dbj|BAB86248.1| putative endo-1,3-beta-glucanase [Oryza sativa Japonica Group]
 dbj|BAF07286.1| Os01g0944700 [Oryza sativa Japonica Group]
 dbj|BAG91747.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86867.1| beta 1,3-glucanase [Oryza sativa Japonica Group]
Length=334

 Score =   304 bits (779),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 219/323 (68%), Gaps = 18/323 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLPS ++ + L KS GI G+R+Y  D    NA R S +A+I+DV 
Sbjct  25    TTVQSIGVCYGVLGNNLPSRSEVVQLYKSKGINGMRIYYPDKEALNALRNSGIALILDVG  84

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             +         + A AWV+ N+ PY  AVN KYIAVGNEV  G   +      ++PA+RNV
Sbjct  85    DQLSNLAASSSNAAAWVRDNVRPYYPAVNIKYIAVGNEVEGGATSS------ILPAIRNV  138

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++ALA++GL G IKA+TA    V++N+YPP+ GVFRD     M  + ++LA TG PLLAN
Sbjct  139   NSALASSGL-GAIKASTAVKFDVISNSYPPSAGVFRD---AYMKDIARYLASTGAPLLAN  194

Query  661   IYPYFSYRGNPSQIPLSYALF----TERNPNPA-GYRNLFDALLDSMYAAVQKAGGPNVP  497
             +YPYF+YRGNP  I L+YA F    T R+PN    Y NLFDA++D++YAA++KAG  NV 
Sbjct  195   VYPYFAYRGNPRDISLNYATFRPGTTVRDPNNGLTYTNLFDAMMDAVYAALEKAGAGNVR  254

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGGF A+  NA  Y + LI HV    GTP +PG ++E Y+FAM++EN K 
Sbjct  255   VVVSESGWPSAGGFGASVDNARAYNQGLIDHV--GRGTPKRPG-ALEAYIFAMFNENQKN  311

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             GD  E+NFG+F P+KS  Y + F
Sbjct  312   GDPTERNFGLFYPNKSPVYPIRF  334



>gb|ABA33838.1| pathogenesis-related protein 6 [Zea diploperennis]
 gb|ABA33839.1| pathogenesis-related protein 6 [Zea diploperennis]
Length=334

 Score =   304 bits (778),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 168/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGN----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|AGQ89281.1| beta-1,3-glucanase A [Saccharum hybrid cultivar]
 gb|AGR42648.1| beta-1,3-glucanase A [Saccharum hybrid cultivar]
Length=332

 Score =   303 bits (777),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 170/324 (52%), Positives = 219/324 (68%), Gaps = 20/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V SIGVCYG NG+NLPS +D + L +SNGI  +R+Y  D    NA  GSN+ VI+DV 
Sbjct  24    TGVHSIGVCYGVNGDNLPSASDVVQLYQSNGINLMRIYFPDTNALNALSGSNIGVIMDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A  WVQ+N+  +   VNFKYIAVGNEV  G+       N ++PA++N
Sbjct  84    NSDLSSLASDPSAAATWVQSNVQAFP-GVNFKYIAVGNEVSGGD------TNNILPAMKN  136

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             V++ALA A L G IK +TA  S V T  YPP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  137   VNSALANANL-GSIKVSTAVQSGV-TQGYPPSQGSF---SQGYMGPIAQYLQSTGAPLLC  191

Query  664   NIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GN +QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NV 
Sbjct  192   NVYPYFSYTGNEAQIDLSYALFTSSGTVVQDGGNAYQNLFDALVDTFVSALENAGAGNVG  251

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG +IETY+FAM++E+ K 
Sbjct  252   VVVSESGWPSAGGDAATPGNAQTYNQNLINHV--GQGTPKRPG-AIETYIFAMFNEDQKP  308

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  309   GAETERHFGLFNPDKSPAYPINFS  332



>ref|XP_011090470.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=404

 Score =   306 bits (784),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 159/319 (50%), Positives = 220/319 (69%), Gaps = 12/319 (4%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             SIGVC G+ G++LP E + + L K++GI+ +R+Y  +     A +GS + +++DV N  L
Sbjct  8     SIGVCNGRLGSDLPPEQEVVELYKTSGIKRMRIYDPNQATLTALQGSGIELVLDVPNADL  67

Query  1009  QELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
             + L   + A  WVQ N+V Y  A   +YIAVGNEV     +T+ +V  V+PA++N++ AL
Sbjct  68    ESLQ--SDATHWVQTNVVQYFPATRIRYIAVGNEV-DPEKETSGFVPLVLPAMQNIYKAL  124

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             +  GLQ +IK +TATYSA+L NT PP+  +F+D A   M P++ FLAQT  PLLANIYPY
Sbjct  125   SQFGLQDQIKVSTATYSALLMNTSPPSNAIFKDMA--FMEPIISFLAQTRAPLLANIYPY  182

Query  649   FSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSE  482
             F+Y  +   + L YALFT         P GY+NLFDA++D +Y+A++KAGG +V +VVSE
Sbjct  183   FAYIYS-QGVELPYALFTAPGVVVQDGPYGYQNLFDAMVDGVYSALEKAGGGDVEVVVSE  241

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPS GG AAT +NA TYYRNLI HVK   G+P +PG++IETYLFAM+DEN K G+  E
Sbjct  242   SGWPSDGGVAATRENAETYYRNLIDHVK--RGSPKRPGKAIETYLFAMFDENNKPGEKSE  299

Query  301   KNFGVFRPDKSSKYQLNFN  245
             ++FG+F P+K  KYQ   N
Sbjct  300   QHFGLFYPNKQPKYQFILN  318



>emb|CAH17549.1| beta-1,3-glucanase [Olea europaea]
Length=343

 Score =   304 bits (778),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 161/321 (50%), Positives = 212/321 (66%), Gaps = 8/321 (2%)
 Frame = -3

Query  1195  VESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNP  1016
             V   GVCYG+ GN LP   + + L K NGIR +R+Y    P   A  GSN+ +++ V N 
Sbjct  27    VAQTGVCYGRLGNALPPPPEVVALYKQNGIRRMRIYDPYQPTLQALGGSNIELMLGVPNS  86

Query  1015  KLQELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
              LQ L  +   A  WVQ N+  Y N V FKYIAVGNEV      T+++V +V+PA+RN+ 
Sbjct  87    DLQRLAANQNNANTWVQNNVRKYPN-VRFKYIAVGNEVSPLKSVTSQFVQYVLPAMRNIQ  145

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
              A++AAGL  +IK +T+  + VL N+YPP+ GVFR + +  +  ++QFL     PLL NI
Sbjct  146   TAISAAGLGNQIKVSTSIETGVLGNSYPPSAGVFRSEVQQYLGGIIQFLVNNRAPLLVNI  205

Query  658   YPYFSYRGNPSQIPLSYALFTER---NPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             YPYFS  GNP QI L YALFT      P+   Y+NLFDALLD++YAA++KAGG +V IVV
Sbjct  206   YPYFSRVGNPQQISLQYALFTSSGIVTPDGTRYQNLFDALLDAVYAALEKAGGSSVEIVV  265

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSAGG   +  NA TY  NL+  +K   GTP +PGR+IETY+FAM+DEN K  + 
Sbjct  266   SESGWPSAGGQDTSIDNARTYNTNLVKSIK--TGTPKRPGRAIETYIFAMFDENQKSPE-  322

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
              EK FG+FRP+K  KY ++FN
Sbjct  323   YEKFFGLFRPNKQPKYPISFN  343



>ref|XP_010273332.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010273334.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Nelumbo 
nucifera]
Length=355

 Score =   304 bits (779),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 219/334 (66%), Gaps = 21/334 (6%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             +IT  + IGVCYG  GNNLPS+++ + L ++N I+ +RVYA +   F A +GSN+ V++ 
Sbjct  30    NITGAQRIGVCYGMLGNNLPSKSEVVALYEANNIQRMRVYAPNQEAFQALKGSNIEVMLG  89

Query  1027  VSNPKLQEL--TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPA  854
             V N  LQ +  +D   A  +V  N+V   + +NF YI VGNEV        +Y  +V+PA
Sbjct  90    VPNQDLQRIAGSDLTPAYDFVYGNVVANKDTINFNYILVGNEV------DLKYFQYVLPA  143

Query  853   LRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNP  674
             ++N+ +A+  AGLQ ++K TTAT+S VL  TYPP+  VFR +    M P++ FLA+ G+P
Sbjct  144   MKNIQSAVETAGLQDRVKVTTATHSGVLDKTYPPSNSVFRSEYLQFMRPIIGFLAEKGSP  203

Query  673   LLANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGP  506
             L ANIYPYF+Y GNPS I L YALFT      + +   Y NLFDALLDS YAAV+K GG 
Sbjct  204   LCANIYPYFAYIGNPSSIRLDYALFTAPEAVVSDDQLNYHNLFDALLDSFYAAVEKEGGG  263

Query  505   NVPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDEN  326
             +V IVVSETGWP+AG  AATT NA TY   LI HVKG  GTP +P   IE Y+FAM+DEN
Sbjct  264   SVKIVVSETGWPNAGESAATTANAQTYLNGLIQHVKG--GTPRRPNGPIEAYIFAMFDEN  321

Query  325   LK-------GGDAVEKNFGVFRPDKSSKYQLNFN  245
              K            E+++G+F P+++ KYQ++F+
Sbjct  322   EKPPLKTETEAMTTERHYGLFNPNQNPKYQISFS  355



>gb|ABB04452.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ACJ62651.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (777),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|EYU45079.1| hypothetical protein MIMGU_mgv1a009451mg [Erythranthe guttata]
Length=341

 Score =   304 bits (778),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 156/317 (49%), Positives = 218/317 (69%), Gaps = 11/317 (3%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG+ GN+LP E+D + L K N I+ +R+Y  DP    A  GSN+ + V V+N  L  
Sbjct  31    GVCYGRLGNDLPPESDVVGLFKQNNIQRMRIYNPDPAALQALGGSNIELTVGVANEDLPS  90

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +    + A  WVQ NI  Y   V FKYIAVGNE+     ++++YV +V+PA++N+HN+++
Sbjct  91    IAASQSNADTWVQTNIKSYP-GVKFKYIAVGNEISPLRGESSQYVQYVLPAMQNIHNSIS  149

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             +AGL   I+ +TA    +L  +YPP+ G FR D    +NPVV FLA+TG PLLAN+YPYF
Sbjct  150   SAGL--GIRVSTAVDMGLLGTSYPPDAGAFRSDVASYINPVVGFLAKTGAPLLANVYPYF  207

Query  646   SYRGNPSQIPLSYALFTERN--PNPAG--YRNLFDALLDSMYAAVQKAGGPNVPIVVSET  479
             +Y GN +QI +SYALFT  +  P P G  Y+NLF A++D+MYAA++K+GG +V +VVSET
Sbjct  208   AYVGNKAQIDISYALFTSSSGVPMPGGVTYQNLFYAMVDAMYAALEKSGGSSVEVVVSET  267

Query  478   GWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEK  299
             GWPSAGG + +  NA  Y  NL+  V+  +GTP +PG++IETY+FAM+DEN K  +  EK
Sbjct  268   GWPSAGGDSTSVDNARVYNTNLLQRVQ--SGTPKRPGKAIETYIFAMFDENQKSPE-YEK  324

Query  298   NFGVFRPDKSSKYQLNF  248
             N+G+F P+K  KY + F
Sbjct  325   NWGIFHPNKELKYPIKF  341



>gb|ACJ62694.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSVG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62646.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62699.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04443.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F    +G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSGV-TQGFPPSQGTFL---QGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62629.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62684.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62696.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>tpg|DAA55874.1| TPA: putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=334

 Score =   303 bits (776),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62631.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYDQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62691.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDKKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62628.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62634.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62640.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62641.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62669.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62644.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62675.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04450.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ACJ62649.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62656.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62658.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62659.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62660.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62665.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62671.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62681.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62695.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62697.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62686.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>ref|XP_008811756.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=340

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 165/324 (51%), Positives = 223/324 (69%), Gaps = 14/324 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V SIGVCYG  GNNLP  +  +NL KSN I+ +R+Y  +     A +GSN+ +I+DV 
Sbjct  24    TRVTSIGVCYGMQGNNLPQPSTVVNLYKSNNIKAMRLYDPNQAALQALKGSNIQLILDVP  83

Query  1021  NPKLQELTDPARAKA-WVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  LQ L   A A + WVQ N+  Y++ V+FKYIAVGNEV  GN        +V+PA+RN
Sbjct  84    NSSLQSLASSASAASNWVQTNVKAYSSGVSFKYIAVGNEVIPGN-----LAQYVLPAMRN  138

Query  844   VHNALAAAGLQGKIKATTATYSAVLT-NTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             +++AL++AGLQ +IK +T+  ++VL  N+ PP+ G F  DA   ++P+V+FLA  G PLL
Sbjct  139   IYSALSSAGLQNQIKVSTSVATSVLGGNSSPPSSGFFASDALTYLSPIVKFLASNGAPLL  198

Query  667   ANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
              N+YPYFSY GNP+QI L YALFT            Y+NLFDA++D++YAA++KAGG NV
Sbjct  199   VNVYPYFSYVGNPTQIKLDYALFTSPGTVVTDGQYKYQNLFDAIVDAVYAALEKAGGSNV  258

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IVVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP + G+++ETY+F M++EN K
Sbjct  259   VIVVSESGWPSAGGTAATISNAKTYNQNLINHV--GQGTPRRSGKALETYIFEMFNENEK  316

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
                 VE+NFG+F P+ +  Y +NF
Sbjct  317   SA-GVEQNFGLFYPNTNPVYSINF  339



>ref|XP_007212652.1| hypothetical protein PRUPE_ppa018225mg, partial [Prunus persica]
 gb|EMJ13851.1| hypothetical protein PRUPE_ppa018225mg, partial [Prunus persica]
Length=337

 Score =   303 bits (776),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 156/319 (49%), Positives = 214/319 (67%), Gaps = 11/319 (3%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             ESIGVCYG+  NNLP + + I+L ++NGI  +R++  +PP   A +GSN+ +IV V N  
Sbjct  2     ESIGVCYGRVANNLPPDPEVISLYQANGITRMRIFDPNPPTLQALKGSNIELIVGVRNQD  61

Query  1012  LQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             +Q L  D A A AWVQ N++ Y   V F+YIAVGNE+    P  A    +V+ A++N+  
Sbjct  62    IQSLGNDVAAATAWVQNNVLNYFPDVKFRYIAVGNEI---KPQDAE-AKYVLAAMKNIKT  117

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             A+A+A LQ +IK +TA   ++L ++YPP+ G F   A   +NP++ FLA  G+P LAN+Y
Sbjct  118   AIASANLQDQIKVSTAIDMSLLGSSYPPSTGSFSAAASSYINPIIAFLASNGSPFLANVY  177

Query  655   PYFSYRGNPSQIPLSYALF----TERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             PYFSY  +   I L YALF            GY NLF A +D++Y+A++KAGG +V IVV
Sbjct  178   PYFSYISDTKDISLGYALFAAPGVTVQDGAFGYTNLFAAAVDALYSALEKAGGSSVEIVV  237

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SETGWPS GG  AT +NA+TYY+NLI  VKG  GTP + G+ +ETYLFAM+DEN KG   
Sbjct  238   SETGWPSEGGEGATVENASTYYKNLIDSVKG--GTPKRRGKPVETYLFAMFDENQKGPAE  295

Query  307   VEKNFGVFRPDKSSKYQLN  251
             +E++FG+F PDK  KYQ++
Sbjct  296   IERHFGLFSPDKQPKYQIS  314



>gb|ABB04451.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ABB04454.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHVA--QGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04446.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ACJ62678.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62682.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHVA--QGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62668.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDKKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62657.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62687.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62639.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 221/323 (68%), Gaps = 19/323 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G   E++FG+F PDKS  Y +NF
Sbjct  311   GAESERHFGLFNPDKSPAYPINF  333



>gb|ABB04445.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  ++ + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62624.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62635.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 167/324 (52%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDKKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>ref|XP_004154643.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
isoform 2 [Cucumis sativus]
Length=386

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 219/325 (67%), Gaps = 19/325 (6%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             ESIGVCY   GNNLP   + + L K+N I+ +R+Y  D  + NA RGSN+ VIV + N  
Sbjct  72    ESIGVCYSSAGNNLPDAREVVQLYKNNSIKKMRIYNPDTTILNALRGSNIEVIVGIPNTY  131

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             ++ + + + A  WVQ NI  Y   VNF+YIAVGNEV    PD      +V+PA+ ++++A
Sbjct  132   IEHIVNLSSAANWVQKNIQAYVPYVNFRYIAVGNEV--KPPDAI--AQYVLPAMSSIYSA  187

Query  832   LAAAGLQGKIKATTATYSAVLTN-TYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             ++AA LQ +IK +T    + L+N ++PP+ G F  +A G M P+++FLA+ G+PLLAN+Y
Sbjct  188   ISAANLQDQIKVSTVISMSFLSNSSFPPSNGSFSSEAGGFMEPIIKFLAKNGSPLLANVY  247

Query  655   PYFSYRGNPSQIPLSYALFTERNPNPA--------GYRNLFDALLDSMYAAVQKAGGPNV  500
             PYF Y      I L YALF +   +PA         Y +LF++++D++Y A++K GG  V
Sbjct  248   PYFVYTEINQTISLDYALFMQ---SPALVISDGNFKYNSLFESMVDALYVALEKLGGAKV  304

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IV+SE+GWPS GG  AT +NA TYYRNLIS V+   GTP +P R+IETYLFAM+DENLK
Sbjct  305   SIVISESGWPSGGGNGATIENAGTYYRNLISFVRN--GTPRRPRRAIETYLFAMFDENLK  362

Query  319   GGDAVEKNFGVFRPDKSSKYQLNFN  245
               + +EK+FG+F PDK SKYQL+F+
Sbjct  363   SLE-MEKHFGLFTPDKKSKYQLSFS  386



>gb|ABK96486.1| unknown [Populus trichocarpa x Populus deltoides]
Length=372

 Score =   304 bits (778),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 213/318 (67%), Gaps = 8/318 (3%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +G+CYG  GNNLP  T+ I L K + I+ +R+Y  +    NA RGS + V++ V N  LQ
Sbjct  36    VGICYGMMGNNLPPATEVIALYKQHNIKRMRLYDPNQAALNALRGSGIEVMLGVPNSDLQ  95

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              L++P+ A +WV+ N++ +  +V F+YIAVGNE+   N  T+    FV+PAL NV NA+ 
Sbjct  96    RLSNPSDANSWVKNNVLNFWPSVRFRYIAVGNEISPVNGGTSWMAPFVLPALVNVFNAVR  155

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGLQ +IK + A    ++  +YPP+ G FR D    + P+V  L+    PL ANIY YF
Sbjct  156   AAGLQDQIKVSIAVDMTLIGTSYPPSAGAFRGDVISYLAPIVGHLSYAKTPLFANIYTYF  215

Query  646   SYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPN-VPIVVSE  482
             SY GNP  I L YALFT  +     +  GY+NLFDA+LDS+Y+A+++ GG N + +VVSE
Sbjct  216   SYSGNPRDISLPYALFTSPSVLVWDSGRGYQNLFDAMLDSLYSALERLGGGNTLDVVVSE  275

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPSAGGF  T+ NA TY  NLI HVKG  GTP +PG++IETY+FAM+DEN K  + +E
Sbjct  276   SGWPSAGGFGTTSDNAGTYLSNLIRHVKG--GTPKRPGKAIETYIFAMFDENQKQPE-LE  332

Query  301   KNFGVFRPDKSSKYQLNF  248
             K+FG F P+K  KY LNF
Sbjct  333   KHFGAFSPNKQPKYNLNF  350



>ref|XP_010269788.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform GI9-like 
[Nelumbo nucifera]
Length=334

 Score =   302 bits (774),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 150/323 (46%), Positives = 206/323 (64%), Gaps = 10/323 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             +I + + IGVCYG  GNNLPS+ + + L K N I+ +R+Y  +     A  GSN+ ++V 
Sbjct  18    NIADAQQIGVCYGMLGNNLPSKNEVVELYKINNIQRMRLYDPNREALQALNGSNIELMVG  77

Query  1027  VSNPKLQEL--TDPARAKAWVQANIVPYANAVNFKYIAVGNEV-FAGNPDTARYVNFVMP  857
             + N +LQ +  +DP  A +WV  ++    + V FKYI VGNEV FA          +++P
Sbjct  78    IPNEQLQLMASSDPTAAYSWVFEHVFLNRDDVKFKYIVVGNEVSFAE-------FKYILP  130

Query  856   ALRNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGN  677
             A+RN+++AL  A LQ +IK +TA +S  ++ TYPP   VF    +  M  +V FL +   
Sbjct  131   AMRNIYSALELADLQNQIKVSTAVFSGHISETYPPRNSVFNSQIRPFMREIVAFLLEKQA  190

Query  676   PLLANIYPYFSYRGNPSQIPLSYALFTERNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             PLLAN+YP+F+Y  N  QIP  Y  FT    N  GY+NLFDA+LD  Y  ++K GG ++ 
Sbjct  191   PLLANVYPFFAYLSNQXQIPSEYVFFTSPTVNEIGYQNLFDAMLDGFYYXLEKEGGSSLE  250

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSETGWP+AG   +TT+NA  YY NLI HV    GTP +PG+ IETYLFAM+DEN K 
Sbjct  251   IVVSETGWPNAGDSISTTENAQKYYSNLIRHVNSGKGTPKRPGKPIETYLFAMFDENQKL  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             GD  EK+FG+F P+K  KYQ++F
Sbjct  311   GDEREKHFGLFSPNKKPKYQISF  333



>ref|XP_011010204.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform 
[Populus euphratica]
Length=372

 Score =   303 bits (777),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/318 (49%), Positives = 213/318 (67%), Gaps = 8/318 (3%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +G+CYG  GNNLP  T+ I L K + I+ +R+Y  +    NA RGS + V++ V N  LQ
Sbjct  36    VGICYGMMGNNLPPATEVIALYKQHNIKRMRLYDPNQAALNALRGSGIEVMLGVPNSDLQ  95

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
              L++P+ A +WV+ N++ +  +V F+YIAVGNE+   N  T+    FV+PAL NV NA+ 
Sbjct  96    RLSNPSNANSWVKNNVLNFWPSVKFRYIAVGNEISPVNGGTSWMAPFVLPALVNVFNAVR  155

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAGLQ +IK + A    ++  +YPP+ G FR D    + P+V  L+    PL ANIY YF
Sbjct  156   AAGLQDQIKVSIAVDMTLIGTSYPPSAGAFRGDVISYLAPIVGHLSYAKTPLFANIYTYF  215

Query  646   SYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPN-VPIVVSE  482
             SY GNP  I L YALFT  +     +  GY+NLFDA+LDS+Y+A+++ GG N + +VVSE
Sbjct  216   SYSGNPRDISLPYALFTSPSVLVWDSGRGYQNLFDAMLDSLYSALERLGGGNTLDVVVSE  275

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPSAGGF  T+ NA TY  NLI HVKG  GTP +PG++IETY+FAM+DEN K  + +E
Sbjct  276   SGWPSAGGFGTTSDNAGTYLSNLIRHVKG--GTPKRPGKAIETYIFAMFDENQKQPE-LE  332

Query  301   KNFGVFRPDKSSKYQLNF  248
             K+FG F P+K  KY LNF
Sbjct  333   KHFGAFSPNKQPKYNLNF  350



>ref|XP_010097796.1| Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform [Morus 
notabilis]
 gb|EXB71075.1| Glucan endo-1,3-beta-glucosidase, basic vacuolar isoform [Morus 
notabilis]
Length=356

 Score =   303 bits (775),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 158/318 (50%), Positives = 217/318 (68%), Gaps = 11/318 (3%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             +GVC G  GNNLP  ++ + L KSN I+ +R+Y A+  V NA +GSN+ +I+ V N +LQ
Sbjct  22    VGVCCGLLGNNLPPISEVVALYKSNNIKRMRMYDANHAVLNALKGSNIELILGVPNSELQ  81

Query  1006  ELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNP-DTARYVNFVMPALRNVHNAL  830
              LTD + A +WVQ+N+VP+  +V  +YIAVGNEV   +P   A     + PAL NV NA+
Sbjct  82    RLTDASSAASWVQSNVVPFWPSVRIRYIAVGNEV---SPIHQASLAQSLRPALVNVFNAV  138

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
              +AGL  +IK +TA  + ++  +YPP++G FRDD +  ++P++  L     P+LANIY Y
Sbjct  139   RSAGLNEQIKVSTAIDTTLIGKSYPPSEGAFRDDVRWFVDPIIGHLVWAKTPILANIYTY  198

Query  649   FSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSE  482
             FSY GNP  I L YALFT  +        GY+NLFDA+LD++Y++++ A G ++ +VVSE
Sbjct  199   FSYVGNPGDISLPYALFTSPSISVWDKGRGYQNLFDAMLDALYSSLEGAWGGDLDVVVSE  258

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWPSAGG  AT  NA TYY NLI HVKG  GTP +P + IETYLFA+++EN K  + +E
Sbjct  259   SGWPSAGGTGATLDNARTYYTNLIKHVKG--GTPKRPNKPIETYLFALFNENQKSPE-LE  315

Query  301   KNFGVFRPDKSSKYQLNF  248
             KNFGVF P+K  KY LNF
Sbjct  316   KNFGVFYPNKQPKYNLNF  333



>ref|XP_008351633.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform-like 
[Malus domestica]
Length=346

 Score =   302 bits (774),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 161/319 (50%), Positives = 216/319 (68%), Gaps = 14/319 (4%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             IGVCYG NG+ LP + + I L K N IR +R+Y  +P    A RGS++ +++ + N +LQ
Sbjct  37    IGVCYGMNGD-LPPQAEVIALYKQNNIRRMRLYDPNPAALAALRGSDIELMLGIPNDQLQ  95

Query  1006  EL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
              + +  A A  WVQ N+  YAN V FKYIAVGNE+   +        F++PA+RN+ NA+
Sbjct  96    NIASSQANANTWVQNNVRNYAN-VRFKYIAVGNEIKPSDSSA----QFLVPAMRNIQNAI  150

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             ++AGL  +IK +TA  + VL  ++PP+ G FR D   ++NPVV+FL    +PLL N+YPY
Sbjct  151   SSAGLGNQIKVSTAIDTGVLGKSFPPSNGEFRGDYSPILNPVVRFLVDNKSPLLVNLYPY  210

Query  649   FSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVSE  482
             FSY GN   I L YALFT R+        GYRNLFDA+LD++YAA+ K GG ++ IVVSE
Sbjct  211   FSYIGNTRDIRLDYALFTARSVVVQDGQRGYRNLFDAILDAVYAALDKVGGGSLDIVVSE  270

Query  481   TGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVE  302
             +GWP+AGG A T  NA TY  NL+ HVKG  GTP KPGR IETY+FAM+DEN K  + +E
Sbjct  271   SGWPTAGGTATTVDNARTYNSNLVQHVKG--GTPRKPGRPIETYIFAMFDENRKTPE-LE  327

Query  301   KNFGVFRPDKSSKYQLNFN  245
             K++G+F P+K  KY +NFN
Sbjct  328   KHWGLFSPNKQPKYPINFN  346



>gb|ABB04441.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ABB04453.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
Length=334

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62630.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62679.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62698.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  ++ + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62652.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 222/324 (69%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  ++ + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNEV  G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEVSGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62647.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62648.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62654.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62664.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62667.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62672.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62693.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|EAY77183.1| hypothetical protein OsI_05153 [Oryza sativa Indica Group]
Length=334

 Score =   302 bits (773),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 167/323 (52%), Positives = 218/323 (67%), Gaps = 18/323 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLPS ++ + L KS GI G+R+Y  D    NA R S +A+I+DV 
Sbjct  25    TTVQSIGVCYGVLGNNLPSRSEVVQLYKSKGINGMRIYYPDKEALNALRNSGIALILDVG  84

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             +         + A AWV+ N+ PY  AVN KYIAVGNEV  G        N ++PA+RNV
Sbjct  85    DQLSYLAASSSNAAAWVRDNVKPYYPAVNIKYIAVGNEVEGGA------TNSILPAIRNV  138

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++ALA++GL G IKA+TA    V++N+YPP+ GVFRD     M  + ++LA TG PLLAN
Sbjct  139   NSALASSGL-GAIKASTAVKFDVISNSYPPSAGVFRD---AYMKDIARYLATTGAPLLAN  194

Query  661   IYPYFSYRGNPSQIPLSYALF----TERNPNPA-GYRNLFDALLDSMYAAVQKAGGPNVP  497
             +YPYF+YRGNP  I L+YA F    T R+PN    Y NLFDA++D++YAA++KAG  NV 
Sbjct  195   VYPYFAYRGNPRDISLNYATFRPGTTVRDPNNGLTYTNLFDAMVDAVYAALEKAGAGNVK  254

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGGF A+  NA  Y + LI HV    GTP +PG  +E Y+FAM++EN K 
Sbjct  255   VVVSESGWPSAGGFGASVDNARAYNQGLIDHV--GRGTPKRPG-PLEAYIFAMFNENQKN  311

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             GD  E+NFG+F P+KS  Y + F
Sbjct  312   GDPTERNFGLFYPNKSPVYPIRF  334



>ref|NP_001234805.1| glucan endo-1,3-beta-glucosidase B precursor [Solanum lycopersicum]
 ref|XP_004229005.1| PREDICTED: glucan endo-1,3-beta-glucosidase B [Solanum lycopersicum]
 sp|Q01413.1|E13B_SOLLC RecName: Full=Glucan endo-1,3-beta-glucosidase B; AltName: Full=(1->3)-beta-glucan 
endohydrolase B; Short=(1->3)-beta-glucanase 
B; AltName: Full=Basic beta-1,3-glucanase; AltName: Full=Beta-1,3-endoglucanase 
B; Flags: Precursor [Solanum lycopersicum]
 gb|AAA03618.1| beta-1,3-glucanase [Solanum lycopersicum]
Length=360

 Score =   303 bits (775),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 166/325 (51%), Positives = 213/325 (66%), Gaps = 11/325 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             HITE + IGVCYG  GNNLPS ++ I L KS  IR LR+Y  +    NA RGSN+ VI+ 
Sbjct  21    HITEAQ-IGVCYGMMGNNLPSHSEVIQLYKSRNIRRLRLYDPNHGALNALRGSNIEVILG  79

Query  1027  VSNPKLQELTDP-ARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             + N  ++ ++     A+ WVQ N+  +   V  KYIAVGNE+ +    T+    F +PAL
Sbjct  80    LPNVDVKHISSGMEHARWWVQKNVRDFWPHVKIKYIAVGNEI-SPVTGTSNLAPFQVPAL  138

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
              N++ A+  AGL   IK +T+    ++ N+YPP+QG FR+D +   +P+V FL  T  PL
Sbjct  139   VNIYKAIGEAGLGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTDPIVGFLRDTRAPL  198

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             L NIYPYFSY GNP QI L YALFT  N         YRNLFDA+LDS+YAA+ + GG +
Sbjct  199   LVNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLDSVYAAMDRTGGGS  258

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             V IVVSE+GWPSAG F AT +NA TY RNLI H K   G+P KPG  IETY+FAM+DEN 
Sbjct  259   VGIVVSESGWPSAGAFGATHENAQTYLRNLIQHAK--EGSPRKPG-PIETYIFAMFDENN  315

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNF  248
             K  + +EK+FG+F P+K  KY LNF
Sbjct  316   KNPE-LEKHFGMFSPNKQPKYNLNF  339



>ref|XP_004139045.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
[Cucumis sativus]
 ref|XP_004154642.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic vacuolar isoform-like 
isoform 1 [Cucumis sativus]
Length=392

 Score =   304 bits (778),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 157/325 (48%), Positives = 219/325 (67%), Gaps = 19/325 (6%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             ESIGVCY   GNNLP   + + L K+N I+ +R+Y  D  + NA RGSN+ VIV + N  
Sbjct  78    ESIGVCYSSAGNNLPDAREVVQLYKNNSIKKMRIYNPDTTILNALRGSNIEVIVGIPNTY  137

Query  1012  LQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             ++ + + + A  WVQ NI  Y   VNF+YIAVGNEV    PD      +V+PA+ ++++A
Sbjct  138   IEHIVNLSSAANWVQKNIQAYVPYVNFRYIAVGNEV--KPPDAI--AQYVLPAMSSIYSA  193

Query  832   LAAAGLQGKIKATTATYSAVLTN-TYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             ++AA LQ +IK +T    + L+N ++PP+ G F  +A G M P+++FLA+ G+PLLAN+Y
Sbjct  194   ISAANLQDQIKVSTVISMSFLSNSSFPPSNGSFSSEAGGFMEPIIKFLAKNGSPLLANVY  253

Query  655   PYFSYRGNPSQIPLSYALFTERNPNPA--------GYRNLFDALLDSMYAAVQKAGGPNV  500
             PYF Y      I L YALF +   +PA         Y +LF++++D++Y A++K GG  V
Sbjct  254   PYFVYTEINQTISLDYALFMQ---SPALVISDGNFKYNSLFESMVDALYVALEKLGGAKV  310

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              IV+SE+GWPS GG  AT +NA TYYRNLIS V+   GTP +P R+IETYLFAM+DENLK
Sbjct  311   SIVISESGWPSGGGNGATIENAGTYYRNLISFVRN--GTPRRPRRAIETYLFAMFDENLK  368

Query  319   GGDAVEKNFGVFRPDKSSKYQLNFN  245
               + +EK+FG+F PDK SKYQL+F+
Sbjct  369   SLE-MEKHFGLFTPDKKSKYQLSFS  392



>gb|ACJ62633.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62663.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62666.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62670.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04447.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ACJ62637.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62643.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62650.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62653.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62676.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62677.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62625.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  ++ + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASEVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ABB04442.1| pathogenesis-related protein 6 [Zea mays subsp. parviglumis]
 gb|ACJ62626.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62627.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
 gb|ACJ62700.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62674.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (772),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHVA--QGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>dbj|BAO09557.1| beta-1,3-glucanase, partial [Morus alba]
Length=342

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 159/324 (49%), Positives = 219/324 (68%), Gaps = 12/324 (4%)
 Frame = -3

Query  1204  ITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDV  1025
             IT+ + +GVC G  GNNLP  ++ + L KSN I+ +R+Y A   V NA +GSN+ +I+ V
Sbjct  22    ITDAQ-VGVCCGLLGNNLPPISEVVALYKSNNIKRMRIYDASHAVLNALKGSNIELILGV  80

Query  1024  SNPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNP-DTARYVNFVMPALR  848
              N +LQ LTD + A +WVQ+N+VP+  +V  +YIAVGNEV   +P   A     + PAL 
Sbjct  81    PNSELQRLTDASSAASWVQSNVVPFWPSVRIRYIAVGNEV---SPIHQASLAQSLRPALV  137

Query  847   NVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLL  668
             NV NA+ +AGL  +IK +TA  + ++  +YPP++G FRDD +  ++P++  L     P+L
Sbjct  138   NVFNAVRSAGLHEQIKVSTAIDTTLIGKSYPPSEGAFRDDVRWFVDPIIGHLVWAKTPIL  197

Query  667   ANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNV  500
             ANIY YFSY  NP  I L YALFT  +        GY+NLFDA+LD++Y++++ A G ++
Sbjct  198   ANIYTYFSYVSNPRDISLPYALFTSPSISVWDQGRGYQNLFDAMLDALYSSLEGAWGGDL  257

Query  499   PIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK  320
              +VVSE+GWPSAGG  AT  NA TYY NLI HVKG  GTP +P + IETYLFA+++EN K
Sbjct  258   DVVVSESGWPSAGGTGATLDNARTYYTNLIKHVKG--GTPKRPNKPIETYLFALFNENQK  315

Query  319   GGDAVEKNFGVFRPDKSSKYQLNF  248
               + +EKNFGVF P+K  KY LNF
Sbjct  316   SPE-LEKNFGVFYPNKQPKYNLNF  338



>gb|ACJ62661.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62638.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVRSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|AGT78193.1| beta-1,3 glucanase 2 [Musa AB Group]
Length=348

 Score =   301 bits (772),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 157/321 (49%), Positives = 219/321 (68%), Gaps = 14/321 (4%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             +SIGVCYG  G+NLP  ++ ++L +SN I  +R+Y+ +     A R SN+ V++DV    
Sbjct  37    QSIGVCYGMLGDNLPPPSEVVSLYRSNNIGRMRLYSPNQAALQALRNSNIEVLMDVPKED  96

Query  1012  LQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             LQ L +DP+ A  WVQ+N+V    +V F+YIAVGNEV  G  D ARYV   +PA+RN+ +
Sbjct  97    LQSLASDPSTASDWVQSNVVANWPSVTFRYIAVGNEVIPG--DLARYV---LPAMRNIQS  151

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             AL++AGLQ +IK +TA  + VL ++YPP+ G F   AK  ++P++QFLA    PL  N+Y
Sbjct  152   ALSSAGLQDQIKVSTAVSTGVLGSSYPPSAGAFSSAAKTYLSPILQFLASNAAPLFLNVY  211

Query  655   PYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             PYF+Y  NPSQ+ LSYALFT           GYRNLFDA++D+++AA++  G  +V IVV
Sbjct  212   PYFTYADNPSQVSLSYALFTAPGAVVQDGQFGYRNLFDAIVDAVHAAIEVEGS-DVAIVV  270

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSAGG AA+  NA TY +NLI HV G  GTP + GR+IETY++ M+DEN K    
Sbjct  271   SESGWPSAGGTAASVSNAKTYNQNLIMHVGG--GTPRRSGRAIETYIYEMFDENQK-ASG  327

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +E+ FG+F P+K   Y ++F+
Sbjct  328   IEQKFGMFHPNKQPVYPISFS  348



>gb|ACJ62685.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (771),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDKKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>gb|ACJ62645.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 221/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA RG+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALRGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+  PDKS  Y +NF+
Sbjct  311   GAESERHFGLSNPDKSPAYPINFS  334



>gb|ACJ62632.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (770),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 220/323 (68%), Gaps = 19/323 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NLFDAL+D+  +A++ AG  NVP
Sbjct  194   NVYPYFSYIGNPAQIDLSYALFTSPGTVVQDGSNAYQNLFDALVDTFVSALENAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             G   E++FG+F PDKS  Y +NF
Sbjct  311   GAESERHFGLFNPDKSPAYPINF  333



>ref|XP_011083775.1| PREDICTED: glucan endo-1,3-beta-glucosidase, acidic isoform PR-Q'-like 
[Sesamum indicum]
Length=343

 Score =   301 bits (771),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 157/317 (50%), Positives = 212/317 (67%), Gaps = 8/317 (3%)
 Frame = -3

Query  1183  GVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQE  1004
             GVCYG+ G NLPSE+D + L   N IR +R+Y  D     A RGS++ VI+ V N  LQ 
Sbjct  31    GVCYGRLGTNLPSESDVVALYNQNNIRRMRIYDPDQLTLQALRGSSIEVILGVPNTDLQN  90

Query  1003  LT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNALA  827
             +      A +WVQ N+  Y + V F++IAVGNEV     DT++Y  F++PA++NV NA++
Sbjct  91    VAASQGNADSWVQNNVRNYPD-VRFRFIAVGNEVSPLRGDTSQYAQFILPAMQNVQNAIS  149

Query  826   AAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPYF  647
             AAG+  +IK +TA  +AVL   +PP  G FR +    +N ++ FL   G PLL NIYPYF
Sbjct  150   AAGIGNQIKVSTAIDTAVLGVDFPPADGAFRPEVGDYLNGIIDFLVNNGAPLLVNIYPYF  209

Query  646   SYRGNPSQIPLSYALFTERNPNPAG---YRNLFDALLDSMYAAVQKAGGPNVPIVVSETG  476
             SY  N +QI L YALFT  +   AG   Y+NLF A+LD+MYAA++K+GG ++ IVVSE+G
Sbjct  210   SYINNKAQISLEYALFTSADGVDAGGVRYQNLFYAILDAMYAALEKSGGSSLEIVVSESG  269

Query  475   WPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAVEKN  296
             WPS GG + +  NA TY  NLI  V+   GTP +PGR+IETY+FAM+DEN K  + +EK+
Sbjct  270   WPSEGGDSTSIDNARTYNTNLIQRVRD--GTPKRPGRAIETYIFAMFDENQKDPE-IEKH  326

Query  295   FGVFRPDKSSKYQLNFN  245
             FG+F PD+  KY +NFN
Sbjct  327   FGIFLPDRQPKYPINFN  343



>gb|AFU52655.1| beta-1,3-glucanase 22 [Solanum tuberosum]
Length=363

 Score =   302 bits (773),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 165/325 (51%), Positives = 214/325 (66%), Gaps = 11/325 (3%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             HITE + +GVCYG  GNNLPS ++ I L KS  I  LR+Y  +    NA RGSN+ VI+ 
Sbjct  21    HITEAQ-LGVCYGMMGNNLPSHSEVIQLYKSRNIGRLRLYDPNHGALNALRGSNIEVILG  79

Query  1027  VSNPKLQELTDP-ARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             + N  ++ ++     A+ WVQ N+  +   V  KYIAVGNE+ +    T+   +F +PAL
Sbjct  80    LPNVDVKHISSGMEHARWWVQKNVKDFWPDVKIKYIAVGNEI-SPVTGTSSLTSFQVPAL  138

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
              N++ A+  AGL   IK +T+    ++ N+YPP+QG FR+D +   +P+V FL  T  PL
Sbjct  139   VNIYKAIGEAGLGNDIKVSTSVDMTLIGNSYPPSQGSFRNDVRWFTDPIVGFLRDTRAPL  198

Query  670   LANIYPYFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             L NIYPYFSY GNP QI L YALFT  N         YRNLFDA+LDS+YAA+++ GG +
Sbjct  199   LVNIYPYFSYSGNPGQISLPYALFTAPNVVVQDGSRQYRNLFDAMLDSVYAAMERTGGGS  258

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             V IVVSE+GWPSAG F AT  NAATY RNLI H K   G+P KPG  IETY+FAM+DEN 
Sbjct  259   VGIVVSESGWPSAGAFGATQDNAATYLRNLIQHAK--EGSPRKPG-PIETYIFAMFDENN  315

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNF  248
             K  + +EK+FG+F P+K  KY LNF
Sbjct  316   KNPE-LEKHFGLFSPNKQPKYNLNF  339



>gb|ACJ62655.1| beta 1,3 glucanase [Zea mays subsp. parviglumis]
Length=334

 Score =   301 bits (770),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 166/324 (51%), Positives = 220/324 (68%), Gaps = 19/324 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG NG+NLP  +D + L +SNGI  +R+Y  D    NA  G+++ +I+DV 
Sbjct  25    TGVQSIGVCYGVNGDNLPPASDVVQLYQSNGINLMRIYFPDANALNALSGTSIGLIMDVP  84

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  L  L +DP+ A AWVQ+N+  +  +V+F+YIAVGNE   G  DT      ++PA++N
Sbjct  85    NTDLASLASDPSAAAAWVQSNVQAFP-SVSFRYIAVGNEASGG--DTGS----ILPAMQN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             ++ ALA AGL G IK +TA  S V T  +PP+QG F   ++G M P+ Q+L  TG PLL 
Sbjct  138   LNAALANAGLGGSIKVSTAVQSDV-TQGFPPSQGTF---SQGYMAPIAQYLQSTGAPLLC  193

Query  664   NIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY GNP+QI LSYALFT            Y+NL DAL+D+  +A+Q AG  NVP
Sbjct  194   NVYPYFSYVGNPAQIDLSYALFTSPGTVVQDGSNAYQNLLDALVDTFVSALQNAGAGNVP  253

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGG AAT  NA TY +NLI+HV    GTP +PG  IETY+FAM++E+ K 
Sbjct  254   VVVSESGWPSAGGDAATAANAQTYNQNLINHV--GQGTPKRPG-PIETYIFAMFNEDQKT  310

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
             G   E++FG+F PDKS  Y +NF+
Sbjct  311   GAESERHFGLFNPDKSPAYPINFS  334



>ref|XP_010273331.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273333.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Nelumbo 
nucifera]
Length=356

 Score =   301 bits (772),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 216/329 (66%), Gaps = 21/329 (6%)
 Frame = -3

Query  1192  ESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPK  1013
             + IGVCYG  GNNLPS+++ + L ++N I+ +RVYA +   F A +GSN+ V++ V N  
Sbjct  36    QRIGVCYGMLGNNLPSKSEVVALYEANNIQRMRVYAPNQEAFQALKGSNIEVMLGVPNQD  95

Query  1012  LQEL--TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVH  839
             LQ +  +D   A  +V  N+V   + +NF YI VGNEV        +Y  +V+PA++N+ 
Sbjct  96    LQRIAGSDLTPAYDFVYGNVVANKDTINFNYILVGNEV------DLKYFQYVLPAMKNIQ  149

Query  838   NALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANI  659
             +A+  AGLQ ++K TTAT+S VL  TYPP+  VFR +    M P++ FLA+ G+PL ANI
Sbjct  150   SAVETAGLQDRVKVTTATHSGVLDKTYPPSNSVFRSEYLQFMRPIIGFLAEKGSPLCANI  209

Query  658   YPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIV  491
             YPYF+Y GNPS I L YALFT      + +   Y NLFDALLDS YAAV+K GG +V IV
Sbjct  210   YPYFAYIGNPSSIRLDYALFTAPEAVVSDDQLNYHNLFDALLDSFYAAVEKEGGGSVKIV  269

Query  490   VSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLK---  320
             VSETGWP+AG  AATT NA TY   LI HVKG  GTP +P   IE Y+FAM+DEN K   
Sbjct  270   VSETGWPNAGESAATTANAQTYLNGLIQHVKG--GTPRRPNGPIEAYIFAMFDENEKPPL  327

Query  319   ----GGDAVEKNFGVFRPDKSSKYQLNFN  245
                      E+++G+F P+++ KYQ++F+
Sbjct  328   KTETEAMTTERHYGLFNPNQNPKYQISFS  356



>gb|AEQ01058.1| putative endo-beta-1,3-glucanase [Fragaria x ananassa]
Length=371

 Score =   302 bits (773),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 155/322 (48%), Positives = 218/322 (68%), Gaps = 9/322 (3%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             S+GVCYG  GNNLPS ++ I+L+KSN I  +R+Y  +     A RGSN+ +I+ V N  L
Sbjct  34    SVGVCYGMMGNNLPSHSEVISLLKSNNIDRMRLYEPNHGALEALRGSNIELILGVPNSLL  93

Query  1009  QELT-DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNA  833
             Q+   +P+ A+ WVQ N++ +  ++  KYIAVGNEV   N DT+    F++PA+++V+ A
Sbjct  94    QDFAANPSNAQKWVQTNVLNFYPSIRIKYIAVGNEVSPVNGDTS-LAQFLLPAMQHVYQA  152

Query  832   LAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYP  653
             + AA L   IK +TA  + ++  +YPP+ G FR D +G ++P++ +L     PLLANIY 
Sbjct  153   VRAANLHDLIKVSTAIDTTLIGVSYPPSHGAFRGDVRGYLDPIIGYLVYAQAPLLANIYT  212

Query  652   YFSYRGNPSQIPLSYALFTERN----PNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVVS  485
             YFSY GNP  I L YALFT  +        GY+NLFDA+LD +Y+A++ A G ++ +VVS
Sbjct  213   YFSYAGNPRDISLPYALFTSPSVVVWDGDKGYQNLFDAMLDGLYSALEGAWGGSLKVVVS  272

Query  484   ETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDAV  305
             E+GWPSAGGF  + +NA TYY  +I HVKG  GTP +P ++IETYLFA++DEN K  + +
Sbjct  273   ESGWPSAGGFGTSPENAQTYYSKMIQHVKG--GTPKRPNKAIETYLFALFDENQKNPE-L  329

Query  304   EKNFGVFRPDKSSKYQLNFN*G  239
             EK+FGVF P+K  KYQL F  G
Sbjct  330   EKHFGVFYPNKQPKYQLGFGGG  351



>ref|XP_010090235.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
 gb|EXB39104.1| Glucan endo-1,3-beta-glucosidase, basic isoform [Morus notabilis]
Length=347

 Score =   301 bits (771),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 157/321 (49%), Positives = 216/321 (67%), Gaps = 17/321 (5%)
 Frame = -3

Query  1186  IGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKLQ  1007
             IGVCYG  GNNLPS+ + I L   N IR +R+Y  +     A RG+N+ +++ V N  LQ
Sbjct  37    IGVCYGMLGNNLPSQKEVIALYNQNNIRRMRLYDPNQAALQALRGTNIELMLGVPNTDLQ  96

Query  1006  EL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHNAL  830
              L ++ A A  WVQ N+  Y N V FKYIAVGNEV      +  +  F++PA++N+  A+
Sbjct  97    RLASNQAEANTWVQNNVRNYNN-VKFKYIAVGNEV----KTSDSFAQFLVPAMQNIQRAI  151

Query  829   AAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIYPY  650
             +  GL  +IK +T+  + VL  +YPP++G F+ D + ++NPV+ FL   G+PLL N+YPY
Sbjct  152   STFGLANQIKVSTSIDTGVLDVSYPPSKGSFKSDYRAIINPVISFLVSNGSPLLVNLYPY  211

Query  649   FSYRGNPSQIPLSYALFTERNPNPA------GYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             FSY GN   I L YALF  R+P+        GYRNLFDA+LD++Y+A++KAGG ++ IVV
Sbjct  212   FSYSGNTRDISLDYALF--RSPSVVVQDGQYGYRNLFDAILDAVYSALEKAGGGSLEIVV  269

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWPSAGG   T  NA TY  NL+ HVK   GTP KPGR I+TY+FAM++EN K  + 
Sbjct  270   SESGWPSAGGTGTTVDNARTYNNNLVQHVK--KGTPKKPGRPIQTYIFAMFNENQKTPE-  326

Query  307   VEKNFGVFRPDKSSKYQLNFN  245
             +EK++G+F P+K  KYQ+NFN
Sbjct  327   LEKHWGLFLPNKQPKYQMNFN  347



>ref|XP_010273330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=316

 Score =   300 bits (767),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/316 (53%), Positives = 207/316 (66%), Gaps = 14/316 (4%)
 Frame = -3

Query  1189  SIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVSNPKL  1010
             SIGVC G  G+ LPS  + + L K+N I  +R+YA   P F A +GSN+ V++ V N  L
Sbjct  7     SIGVCNGLLGDPLPSPQEVVALYKANDINKMRLYAPHQPTFQALKGSNIEVMLGVPNEDL  66

Query  1009  QELT--DPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNVHN  836
             Q +   D   A  +V  NIV     +NFKYIAVGNEV        +Y  +V+PA+RN+  
Sbjct  67    QRIAGNDLTPAYDFVYGNIVDNRATINFKYIAVGNEV------DLQYFQYVLPAMRNIQR  120

Query  835   ALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLANIY  656
             A+ AAGLQ ++K TTATYSAVL  TYPP+  VFR +    M P++ FLA+ G+PL ANIY
Sbjct  121   AVEAAGLQNQVKVTTATYSAVLDKTYPPSNSVFRAEYLQYMWPIIGFLAEKGSPLCANIY  180

Query  655   PYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPNVPIVV  488
             PYF+Y GNPS I L YALFT            Y+NLFDA+LDS YAAV+KAGGP+V IVV
Sbjct  181   PYFAYIGNPSSIRLDYALFTAPGTVVTDGRFRYQNLFDAMLDSFYAAVEKAGGPSVKIVV  240

Query  487   SETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKGGDA  308
             SE+GWP+AG  AATT NA TY   LI HVKG  GTP +P   IE Y+FAM+DEN K    
Sbjct  241   SESGWPNAGESAATTANAQTYLNGLIRHVKG--GTPRRPNGPIEAYIFAMFDENKKPLPE  298

Query  307   VEKNFGVFRPDKSSKY  260
              E++FG+F P+K  KY
Sbjct  299   TERHFGLFFPNKQPKY  314



>ref|XP_002277193.1| PREDICTED: glucan endo-1,3-beta-glucosidase, basic isoform [Vitis 
vinifera]
Length=334

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 161/326 (49%), Positives = 221/326 (68%), Gaps = 14/326 (4%)
 Frame = -3

Query  1207  HITEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVD  1028
             HIT   + GVCYG  G+NLP   + I+L K N I+ +R+YA  P V  A RGSN+ ++V 
Sbjct  16    HITGANT-GVCYGLLGDNLPPPHEVIDLYKRNNIQKMRIYAPAPEVLQALRGSNIELMVG  74

Query  1027  VSNPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPAL  851
             V+N  L  + TD A+A +WVQ NI  YAN VNF+YIAVGNE+   NP  A   N+++ A+
Sbjct  75    VANEDLHSIATDMAKAYSWVQNNIRSYAN-VNFRYIAVGNEI---NPP-AWEANYLLGAM  129

Query  850   RNVHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPL  671
             +N+H A+  AGL  +IK +T   + VL  +YPP++G FR D    +NP++ FLA T  P 
Sbjct  130   KNIHQAITEAGLGNQIKVSTPFSAMVLGESYPPSKGSFRPDFGSFINPIISFLADTRAPF  189

Query  670   LANIYPYFSYRGNPSQIPLSYALFTE----RNPNPAGYRNLFDALLDSMYAAVQKAGGPN  503
             L N+YPYFSY GN   I L YALFT           GY+N+FDA+LD+ Y+A++KAGG +
Sbjct  190   LFNMYPYFSYSGNTQYISLEYALFTSPGVMEQDGQFGYQNIFDAMLDAGYSALEKAGGAS  249

Query  502   VPIVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENL  323
             + I+VSETGWP+AGG A T +NA TY  NL+ HVKG  GTP +PG+ I+TY+FAM++EN 
Sbjct  250   LEIIVSETGWPTAGGTATTIENARTYITNLLRHVKG--GTPKRPGKPIQTYIFAMFNENN  307

Query  322   KGGDAVEKNFGVFRPDKSSKYQLNFN  245
             K  + +EK++G+F P+K S YQ+ F+
Sbjct  308   KNLE-LEKHWGLFYPNKQSVYQIEFS  332



>ref|XP_008811753.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=338

 Score =   300 bits (769),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 157/324 (48%), Positives = 221/324 (68%), Gaps = 14/324 (4%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG+ GNNLP  +D + L KSN I  +R+Y    P   A +G+N+ +IVDV 
Sbjct  24    TSVQSIGVCYGRLGNNLPQPSDVVALYKSNNIGQMRIYDPFSPTLQALQGTNIQLIVDVP  83

Query  1021  NPKLQEL-TDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRN  845
             N  LQ L +D + A  WVQ NI  Y++ V+F+YIAVGNEV  G  D+A+YV   +PA++N
Sbjct  84    NDGLQNLASDASAANDWVQNNIQAYSD-VSFRYIAVGNEVIPG--DSAQYV---LPAMKN  137

Query  844   VHNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLA  665
             +++AL+AAGLQ +IK +T+  + VL  +YPP+ G F  DA   + P++QFL + G PLL 
Sbjct  138   IYSALSAAGLQNQIKVSTSVATVVLGVSYPPSHGAFSSDALNTLGPIIQFLNENGAPLLV  197

Query  664   NIYPYFSYRGNPSQIPLSYALFTER----NPNPAGYRNLFDALLDSMYAAVQKAGGPNVP  497
             N+YPYFSY  N   I ++YALFT            Y+NLFDA++D++YAA++  GG NV 
Sbjct  198   NVYPYFSYVDNQGSIDINYALFTSSGTVVQDGQYSYQNLFDAMVDAVYAALENVGGSNVA  257

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             IVVSE+GWPSAG   AT  NA TY +NLI+HV    GTP + G+++ETY+F+M++EN K 
Sbjct  258   IVVSESGWPSAGDTVATISNAQTYNQNLINHV--GQGTPRRSGKALETYIFSMFNENGKS  315

Query  316   GDAVEKNFGVFRPDKSSKYQLNFN  245
                +E+N+G+F P++   Y +NF+
Sbjct  316   A-GIEQNWGLFYPNEQPVYPINFS  338



>gb|AAL35900.1|AF443600_1 endo-1,3-beta-glucanase [Oryza sativa]
Length=334

 Score =   300 bits (768),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 166/323 (51%), Positives = 217/323 (67%), Gaps = 18/323 (6%)
 Frame = -3

Query  1201  TEVESIGVCYGKNGNNLPSETDTINLMKSNGIRGLRVYAADPPVFNAARGSNLAVIVDVS  1022
             T V+SIGVCYG  GNNLPS ++ + L KS GI G+R+Y  D    NA R S +A+I+DV 
Sbjct  25    TTVQSIGVCYGVLGNNLPSRSEVVQLYKSKGINGMRIYYPDKEALNALRNSGIALILDVG  84

Query  1021  NPKLQELTDPARAKAWVQANIVPYANAVNFKYIAVGNEVFAGNPDTARYVNFVMPALRNV  842
             +         + A AWV+ N+ PY  AVN KYIAVGNEV  G        N ++PA+RNV
Sbjct  85    DQLSYLAASSSNAAAWVRDNVKPYYPAVNIKYIAVGNEVEGGA------TNSILPAIRNV  138

Query  841   HNALAAAGLQGKIKATTATYSAVLTNTYPPNQGVFRDDAKGLMNPVVQFLAQTGNPLLAN  662
             ++ALA++GL G IKA+TA    V++N+YPP+ GVFRD     M  + ++LA TG PLLAN
Sbjct  139   NSALASSGL-GAIKASTAVKFDVISNSYPPSAGVFRD---AYMKDIARYLATTGAPLLAN  194

Query  661   IYPYFSYRGNPSQIPLSYALF----TERNPNPA-GYRNLFDALLDSMYAAVQKAGGPNVP  497
             +YPYF+YRGNP  I L+YA F    T R+PN    Y NLFD ++D++YAA++KAG  NV 
Sbjct  195   VYPYFAYRGNPRDISLNYATFRPGTTVRDPNNGLTYTNLFDTMVDAVYAALEKAGAGNVK  254

Query  496   IVVSETGWPSAGGFAATTQNAATYYRNLISHVKGNAGTPLKPGRSIETYLFAMYDENLKG  317
             +VVSE+GWPSAGGF A+  NA  Y + LI HV    GTP +PG  +E Y+FAM++EN K 
Sbjct  255   VVVSESGWPSAGGFGASVDNARAYNQGLIDHV--GRGTPKRPG-PLEAYIFAMFNENQKN  311

Query  316   GDAVEKNFGVFRPDKSSKYQLNF  248
             GD  E+NFG+F P+KS  Y + F
Sbjct  312   GDPTERNFGLFYPNKSPVYPIRF  334



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3570442792520