BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c70027_g1_i1 len=111 path=[89:0-110]

Length=111
                                                                      Score     E

emb|CDP11347.1|  unnamed protein product                              48.1    2e-05   
ref|XP_006428571.1|  hypothetical protein CICLE_v100108902mg          47.0    8e-05   
ref|XP_004304804.1|  PREDICTED: U5 small nuclear ribonucleoprotei...  45.8    5e-04   
gb|KDO47597.1|  hypothetical protein CISIN_1g0001142mg                45.8    5e-04   
ref|XP_006480405.1|  PREDICTED: U5 small nuclear ribonucleoprotei...  45.8    5e-04   
gb|KDO47596.1|  hypothetical protein CISIN_1g0001142mg                45.8    6e-04   
ref|XP_009758634.1|  PREDICTED: U5 small nuclear ribonucleoprotei...  45.4    6e-04   



>emb|CDP11347.1| unnamed protein product [Coffea canephora]
Length=220

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  2    VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAGK  109
            VGDPK+D+LLAI+ V + QRKSTV L F APAEAG+
Sbjct  149  VGDPKTDQLLAIKTV-TFQRKSTVRLDFDAPAEAGR  183



>ref|XP_006428571.1| hypothetical protein CICLE_v100108902mg, partial [Citrus clementina]
 gb|ESR41811.1| hypothetical protein CICLE_v100108902mg, partial [Citrus clementina]
Length=249

 Score = 47.0 bits (110),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  2    VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAGK  109
            VGD K+++LLAI+ V S+QRKS V L FAAPAEAGK
Sbjct  184  VGDTKTNQLLAIKRV-SLQRKSRVKLDFAAPAEAGK  218



>ref|XP_004304804.1| PREDICTED: U5 small nuclear ribonucleoprotein 200 kDa helicase-like 
[Fragaria vesca subsp. vesca]
Length=2174

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  2     VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAGK  109
             VGD K++ LLAI+ V+ + +K+ + LRF+APAEAGK
Sbjct  2100  VGDTKTNSLLAIKKVLPLLKKAKIQLRFSAPAEAGK  2135



>gb|KDO47597.1| hypothetical protein CISIN_1g0001142mg, partial [Citrus sinensis]
Length=2066

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  2     VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAGK  109
             VGD K+++LLAI+ V S+QRKS V L FAAPAEAGK
Sbjct  2001  VGDTKTNQLLAIKRV-SLQRKSRVKLDFAAPAEAGK  2035



>ref|XP_006480405.1| PREDICTED: U5 small nuclear ribonucleoprotein 200 kDa helicase-like 
isoform X1 [Citrus sinensis]
 ref|XP_006480406.1| PREDICTED: U5 small nuclear ribonucleoprotein 200 kDa helicase-like 
isoform X2 [Citrus sinensis]
Length=2179

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  2     VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAGK  109
             VGD K+++LLAI+ V S+QRKS V L FAAPAEAGK
Sbjct  2114  VGDTKTNQLLAIKRV-SLQRKSRVKLDFAAPAEAGK  2148



>gb|KDO47596.1| hypothetical protein CISIN_1g0001142mg, partial [Citrus sinensis]
Length=2022

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 25/36 (69%), Positives = 30/36 (83%), Gaps = 1/36 (3%)
 Frame = +2

Query  2     VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAGK  109
             VGD K+++LLAI+ V S+QRKS V L FAAPAEAGK
Sbjct  1957  VGDTKTNQLLAIKRV-SLQRKSRVKLDFAAPAEAGK  1991



>ref|XP_009758634.1| PREDICTED: U5 small nuclear ribonucleoprotein 200 kDa helicase-like 
[Nicotiana sylvestris]
Length=1206

 Score = 45.4 bits (106),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +2

Query  2     VGDPKSDKLLAIEMVMSIQRKSTVMLRFAAPAEAG  106
             VGD KS++LLAI+ V S+QRKS + L FAAPAEAG
Sbjct  1138  VGDTKSNQLLAIKRV-SLQRKSKIKLDFAAPAEAG  1171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 522694794284