BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6941_g2_i1 len=841 path=[2825:0-840]

Length=841
                                                                      Score     E

ref|XP_009787390.1|  PREDICTED: uncharacterized protein LOC104235351    189   6e-53   
ref|XP_009595195.1|  PREDICTED: uncharacterized protein DDB_G0271670    187   3e-52   
ref|XP_011071438.1|  PREDICTED: uncharacterized protein LOC105156886    186   9e-52   
emb|CDO98849.1|  unnamed protein product                                168   3e-45   
ref|XP_004229252.1|  PREDICTED: uncharacterized protein DDB_G0271670    167   8e-45   
ref|XP_011090992.1|  PREDICTED: uncharacterized protein LOC105171540    164   7e-44   
ref|XP_006342813.1|  PREDICTED: uncharacterized protein DDB_G0271...    160   3e-42   
gb|KDP27815.1|  hypothetical protein JCGZ_18895                         145   2e-36   
ref|XP_008223212.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    141   4e-35   
ref|XP_002270026.1|  PREDICTED: uncharacterized protein DDB_G0271...    139   2e-34   Vitis vinifera
ref|XP_006419538.1|  hypothetical protein CICLE_v10004985mg             139   2e-34   
ref|XP_007035629.1|  Uncharacterized protein TCM_021236                 138   4e-34   
ref|XP_007226372.1|  hypothetical protein PRUPE_ppa022820mg             137   1e-33   
ref|XP_007154176.1|  hypothetical protein PHAVU_003G096600g             136   3e-33   
ref|XP_009622778.1|  PREDICTED: uncharacterized protein LOC104114114    134   4e-33   
ref|XP_002314378.2|  hypothetical protein POPTR_0010s01580g             133   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008367144.1|  PREDICTED: uncharacterized protein DDB_G0271...    133   4e-32   
ref|XP_008390641.1|  PREDICTED: uncharacterized protein DDB_G0271670    133   4e-32   
ref|XP_002516943.1|  conserved hypothetical protein                     132   5e-32   Ricinus communis
ref|XP_011010196.1|  PREDICTED: sericin 1-like                          132   5e-32   
ref|XP_009352288.1|  PREDICTED: uncharacterized protein LOC103943673    130   2e-31   
ref|XP_009769314.1|  PREDICTED: uncharacterized protein LOC104220188    129   3e-31   
ref|XP_006380149.1|  hypothetical protein POPTR_0008s22370g             129   6e-31   
ref|XP_004296853.1|  PREDICTED: uncharacterized protein LOC101313206    129   6e-31   
ref|XP_011003913.1|  PREDICTED: uncharacterized protein LOC105110537    127   2e-30   
ref|XP_010105149.1|  hypothetical protein L484_007215                   127   3e-30   
gb|EYU45546.1|  hypothetical protein MIMGU_mgv1a022941mg                127   4e-30   
ref|XP_006349822.1|  PREDICTED: uncharacterized serine-rich prote...    125   6e-30   
ref|XP_003550539.1|  PREDICTED: uncharacterized protein DDB_G0271...    127   6e-30   
ref|XP_004134219.1|  PREDICTED: uncharacterized protein LOC101205873    124   4e-29   
gb|KGN57124.1|  hypothetical protein Csa_3G159440                       124   4e-29   
ref|XP_003528634.1|  PREDICTED: uncharacterized protein DDB_G0271...    124   5e-29   
ref|XP_004252911.1|  PREDICTED: uncharacterized protein DDB_G0271...    123   6e-29   
ref|XP_008353253.1|  PREDICTED: uncharacterized protein DDB_G0271...    120   6e-29   
ref|XP_010693606.1|  PREDICTED: uncharacterized serine-rich prote...    120   1e-27   
ref|XP_003547383.1|  PREDICTED: uncharacterized protein DDB_G0271...    118   2e-27   
ref|XP_009129760.1|  PREDICTED: uncharacterized protein DDB_G0271...    118   4e-27   
emb|CDY70669.1|  BnaCnng69290D                                          118   4e-27   
gb|KHN14609.1|  hypothetical protein glysoja_024704                     118   6e-27   
ref|XP_003609688.1|  hypothetical protein MTR_4g120050                  116   3e-26   
ref|XP_010440208.1|  PREDICTED: vitellogenin-2-like                     115   3e-26   
gb|KEH32293.1|  hypothetical protein MTR_4g120050                       116   3e-26   
emb|CDY33930.1|  BnaA02g30570D                                          115   4e-26   
ref|XP_008340808.1|  PREDICTED: probable GPI-anchored adhesin-lik...    115   4e-26   
gb|ACU23354.1|  unknown                                                 114   6e-26   Glycine max [soybeans]
ref|XP_003533304.1|  PREDICTED: uncharacterized protein DDB_G0271...    114   6e-26   
gb|KHN26543.1|  hypothetical protein glysoja_019782                     114   6e-26   
ref|XP_008438897.1|  PREDICTED: uncharacterized protein DDB_G0271...    114   8e-26   
ref|XP_004150501.1|  PREDICTED: uncharacterized protein LOC101221255    112   4e-25   
ref|XP_004167713.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    112   4e-25   
ref|XP_010442367.1|  PREDICTED: vitellogenin-2-like                     112   8e-25   
ref|XP_008458419.1|  PREDICTED: sericin 1                               111   1e-24   
ref|XP_006395095.1|  hypothetical protein EUTSA_v10004314mg             111   1e-24   
ref|XP_010482192.1|  PREDICTED: vitellogenin-2-like                     111   2e-24   
ref|XP_004508203.1|  PREDICTED: uncharacterized protein DDB_G0271...    110   2e-24   
emb|CDX86254.1|  BnaA06g29710D                                          110   3e-24   
ref|XP_006282305.1|  hypothetical protein CARUB_v10028592mg             108   9e-24   
gb|AFK46837.1|  unknown                                                 103   3e-23   
ref|XP_009782617.1|  PREDICTED: uncharacterized protein LOC104231340    105   3e-23   
ref|XP_010445663.1|  PREDICTED: uncharacterized protein DDB_G0271670    107   4e-23   
ref|XP_009594798.1|  PREDICTED: uncharacterized protein LOC104091220    105   4e-23   
gb|AAM61310.1|  unknown                                                 106   5e-23   Arabidopsis thaliana [mouse-ear cress]
emb|CDX85391.1|  BnaC07g27020D                                          105   8e-23   
ref|NP_568706.1|  uncharacterized protein                               105   1e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002865709.1|  hypothetical protein ARALYDRAFT_917876             105   1e-22   
gb|KEH37227.1|  hypothetical protein MTR_2g436340                       104   3e-22   
ref|XP_009151710.1|  PREDICTED: uncharacterized serine-rich prote...    102   2e-21   
ref|XP_007138927.1|  hypothetical protein PHAVU_009G249600g             100   3e-21   
ref|XP_009124613.1|  PREDICTED: uncharacterized protein LOC103849619  99.8    9e-21   
ref|XP_010558810.1|  PREDICTED: uncharacterized protein DDB_G0271...    100   1e-20   
ref|XP_010558808.1|  PREDICTED: uncharacterized protein DDB_G0271...    100   1e-20   
ref|XP_010024715.1|  PREDICTED: uncharacterized protein LOC104415159  99.0    2e-20   
ref|XP_006299713.1|  hypothetical protein CARUB_v10015905mg           99.0    2e-20   
ref|XP_010249406.1|  PREDICTED: uncharacterized protein LOC104591946  98.2    3e-20   
gb|KCW61178.1|  hypothetical protein EUGRSUZ_H039421                  98.6    3e-20   
ref|XP_010525280.1|  PREDICTED: uncharacterized protein DDB_G0271...  99.4    3e-20   
ref|XP_002882498.1|  hypothetical protein ARALYDRAFT_478007           97.8    4e-20   
ref|NP_001118595.1|  uncharacterized protein                          95.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464278.1|  PREDICTED: uncharacterized protein DDB_G0271...  95.5    3e-19   
ref|XP_009147123.1|  PREDICTED: uncharacterized protein LOC103870716  94.7    4e-19   
emb|CDY24661.1|  BnaA05g30600D                                        94.7    5e-19   
ref|XP_010046017.1|  PREDICTED: trinucleotide repeat-containing g...  94.7    1e-18   
emb|CDY05297.1|  BnaC05g45060D                                        93.6    1e-18   
gb|KCW84802.1|  hypothetical protein EUGRSUZ_B01602                   94.0    1e-18   
gb|KHN03351.1|  hypothetical protein glysoja_004377                   94.0    3e-18   
gb|KFK38150.1|  hypothetical protein AALP_AA3G075700                  90.9    1e-17   
ref|XP_006407894.1|  hypothetical protein EUTSA_v10021990mg           88.6    8e-17   
ref|XP_009390817.1|  PREDICTED: uncharacterized protein LOC103977119  88.2    2e-16   
ref|XP_009134934.1|  PREDICTED: uncharacterized protein LOC103859187  85.5    4e-16   
ref|XP_009381710.1|  PREDICTED: uncharacterized protein LOC103969788  84.7    3e-15   
ref|XP_010547019.1|  PREDICTED: uncharacterized protein DDB_G0271...  80.1    3e-14   
ref|XP_009383397.1|  PREDICTED: uncharacterized protein DDB_G0271...  81.6    4e-14   
emb|CDY08027.1|  BnaC03g34960D                                        77.4    3e-13   
ref|XP_009390380.1|  PREDICTED: uncharacterized transmembrane pro...  75.9    4e-12   
ref|XP_009404206.1|  PREDICTED: uncharacterized protein DDB_G0271...  75.5    5e-12   
ref|XP_010937132.1|  PREDICTED: uncharacterized protein DDB_G0271...  68.9    6e-10   
ref|XP_010937122.1|  PREDICTED: uncharacterized protein DDB_G0271...  68.9    6e-10   
ref|NP_001052710.1|  Os04g0405500                                     63.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
emb|CAE04879.1|  OSJNBa0042I15.1                                      64.3    2e-08   Oryza sativa [red rice]
emb|CAE05374.1|  OJ000315_02.19                                       63.5    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006596719.1|  PREDICTED: uncharacterized protein LOC100788701  61.2    1e-07   
dbj|BAJ99583.1|  predicted protein                                    59.7    6e-07   
ref|XP_003581177.1|  PREDICTED: forkhead box protein C1-like          59.7    7e-07   
ref|XP_006844776.1|  hypothetical protein AMTR_s00016p00259280        59.3    7e-07   
gb|EPS66912.1|  hypothetical protein M569_07867                       59.7    7e-07   
ref|NP_001145361.1|  uncharacterized protein LOC100278697             57.4    4e-06   Zea mays [maize]
emb|CBI22994.3|  unnamed protein product                              54.3    4e-05   
ref|XP_002453920.1|  hypothetical protein SORBIDRAFT_04g021450        53.9    6e-05   Sorghum bicolor [broomcorn]
ref|XP_004952618.1|  PREDICTED: putative protein TPRXL-like           53.5    9e-05   
emb|CDY34922.1|  BnaA01g32530D                                        49.7    9e-05   
gb|EPS63060.1|  hypothetical protein M569_11727                       52.0    1e-04   
gb|EAY86101.1|  hypothetical protein OsI_07471                        52.8    1e-04   Oryza sativa Indica Group [Indian rice]
gb|AGT16018.1|  hypothetical protein SHCRBa_144_K17_F_320             52.4    2e-04   
ref|XP_004975525.1|  PREDICTED: serine/arginine repetitive matrix...  52.0    2e-04   
ref|NP_001146008.1|  hypothetical protein                             52.0    2e-04   Zea mays [maize]
ref|NP_001047000.1|  Os02g0526700                                     52.0    3e-04   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ23278.1|  hypothetical protein OsJ_06973                        51.2    4e-04   Oryza sativa Japonica Group [Japonica rice]



>ref|XP_009787390.1| PREDICTED: uncharacterized protein LOC104235351 [Nicotiana sylvestris]
Length=409

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 126/150 (84%), Gaps = 10/150 (7%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVH-HRTSGAS--GQDCIKERVRCGGIFSGFMIT  670
            ERISTGFGDCTLRRVESQREGK KV SVH HR++G+S  GQDCIKERVRCGG+FSGFMIT
Sbjct  264  ERISTGFGDCTLRRVESQREGKSKVSSVHNHRSNGSSTSGQDCIKERVRCGGLFSGFMIT  323

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF---T  499
            SSSSSSSSSS+ VSSEENVNG    + ASVG   HQL HGR++SWGWAFASPMRAF   T
Sbjct  324  SSSSSSSSSSHWVSSEENVNGKSSIAPASVG---HQLVHGRNKSWGWAFASPMRAFSSKT  380

Query  498  KTSTGKREASSNKNTTPNLAVIPSLLTARG  409
             +S GK +A SNKN TPNLA IPSLLTARG
Sbjct  381  SSSNGKTDA-SNKNATPNLAAIPSLLTARG  409



>ref|XP_009595195.1| PREDICTED: uncharacterized protein DDB_G0271670 [Nicotiana tomentosiformis]
Length=417

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 127/151 (84%), Gaps = 11/151 (7%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVH-HRTSGAS--GQDCIKERVRCGGIFSGFMIT  670
            ERISTGFGDCTLRRVESQREGK KV SVH HR++G+S  GQDCIKERVRCGG+FSGFMIT
Sbjct  271  ERISTGFGDCTLRRVESQREGKSKVSSVHNHRSNGSSTSGQDCIKERVRCGGLFSGFMIT  330

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF----  502
            SSSSSSSSSS+ VSSEENVNG    + ASVG   HQL HGR++SWGWAFASPMRAF    
Sbjct  331  SSSSSSSSSSHWVSSEENVNGKSSIAPASVG---HQLVHGRNKSWGWAFASPMRAFSSKT  387

Query  501  TKTSTGKREASSNKNTTPNLAVIPSLLTARG  409
            + +S GKREA SNKN TPNLA IPSLLTARG
Sbjct  388  SSSSNGKREA-SNKNATPNLAAIPSLLTARG  417



>ref|XP_011071438.1| PREDICTED: uncharacterized protein LOC105156886 [Sesamum indicum]
Length=405

 Score =   186 bits (471),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 117/145 (81%), Gaps = 8/145 (6%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPKV  VH R SG +GQDCIKERVRCGGIFSGFMI SSS
Sbjct  264  ERISTGFGDCTLRRVESQREGKPKVQQVH-RNSGINGQDCIKERVRCGGIFSGFMIASSS  322

Query  660  sssss--ssylvsSEENVNGNGRPSM-ASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSSSS       S+E+N N NG+P+  +SVG     L+HGRSRSWGWAFASPMRAF K S
Sbjct  323  SSSSSSSYLVASSAEDNNNANGKPTNHSSVG----SLSHGRSRSWGWAFASPMRAFGKNS  378

Query  489  TGKREASSNKNTTPNLAVIPSLLTA  415
            TGKR+ S+NKNTTPNLA IPSLL  
Sbjct  379  TGKRDVSTNKNTTPNLAAIPSLLAV  403



>emb|CDO98849.1| unnamed protein product [Coffea canephora]
Length=403

 Score =   168 bits (425),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 117/145 (81%), Gaps = 5/145 (3%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPKV S+H R SGA GQDCIKERV+CGGIFSGFM+TSSS
Sbjct  263  ERISTGFGDCTLRRVESQREGKPKVPSMH-RNSGA-GQDCIKERVKCGGIFSGFMVTSSS  320

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST-G  484
            SSSSSSSY VSS    N NG  S ++ G   H +AHGRS+SWGWA ASPMRAF K S  G
Sbjct  321  SSSSSSSYWVSSSTEDNVNGGRSASTPGSARH-VAHGRSKSWGWALASPMRAFGKPSNHG  379

Query  483  KREASSNKNTTPNLAVIPSLLTARG  409
            KREA SNKN  PNLA IPSLL ARG
Sbjct  380  KREA-SNKNAAPNLAAIPSLLAARG  403



>ref|XP_004229252.1| PREDICTED: uncharacterized protein DDB_G0271670 [Solanum lycopersicum]
Length=383

 Score =   167 bits (422),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 123/152 (81%), Gaps = 11/152 (7%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASG----QDCIKERVRCGGIFSGFMI  673
            ERISTGFGDCTLRRVESQREG  K   +HHR SGA+G    QDCIKERVRCGG+FSGFMI
Sbjct  235  ERISTGFGDCTLRRVESQREGNNK-SKIHHRNSGAAGAGAGQDCIKERVRCGGLFSGFMI  293

Query  672  TssssssssssylvsSEENVNGNGRPSMASVGH-HHHQLAHGRSR-SWGWAFASPMRAFT  499
            TSSSSSSSSSS+ VSSEEN+  NG+ ++A VGH    Q+ HGR+R SWGWAFASPMRAF+
Sbjct  294  TSSSSSSSSSSHWVSSEENM--NGKSNIAPVGHQQQQQIVHGRNRSSWGWAFASPMRAFS  351

Query  498  KTST--GKREASSNKNTTPNLAVIPSLLTARG  409
            KTS+  GKR AS+    TPNLA IPSLLTARG
Sbjct  352  KTSSSNGKRGASNKNANTPNLAAIPSLLTARG  383



>ref|XP_011090992.1| PREDICTED: uncharacterized protein LOC105171540 [Sesamum indicum]
Length=408

 Score =   164 bits (416),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 104/147 (71%), Positives = 117/147 (80%), Gaps = 8/147 (5%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASG--QDCIKERVRCGGIFSGFMITs  667
            ERISTGFGDCTLRRVESQREGKP++ SV      +    QDCIKERV+CGGIFSGFMITS
Sbjct  267  ERISTGFGDCTLRRVESQREGKPRLHSVQRNGGNSGNNGQDCIKERVKCGGIFSGFMITS  326

Query  666  sssssssssylvsSE-ENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSSSSSSSSY VSS  E+ N NG+ S++SV H    ++HGRSRSWGWA ASPMRAF+K S
Sbjct  327  SSSSSSSSSYWVSSSAEDSNVNGK-SISSVRH----VSHGRSRSWGWALASPMRAFSKPS  381

Query  489  TGKREASSNKNTTPNLAVIPSLLTARG  409
             GKR+A+SNKN TPNLA IPSLL   G
Sbjct  382  AGKRDAASNKNVTPNLAAIPSLLAVSG  408



>ref|XP_006342813.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Solanum 
tuberosum]
Length=400

 Score =   160 bits (405),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 121/153 (79%), Gaps = 12/153 (8%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASG-----QDCIKERVRCGGIFSGFM  676
            ERISTGFGDCTLRRVESQREG  K   +HHR SGA+      QDCIKERVRCGG+FSGFM
Sbjct  251  ERISTGFGDCTLRRVESQREGNNK-SKIHHRNSGAAAAAGAGQDCIKERVRCGGLFSGFM  309

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVG-HHHHQLAHGRSR-SWGWAFASPMRAF  502
            ITSSSSSSSSSS+ VSSEEN+  NG+  +A VG     QL HGR+R SWGWAFASPMRAF
Sbjct  310  ITSSSSSSSSSSHWVSSEENM--NGKSGIAPVGQQQQQQLVHGRNRSSWGWAFASPMRAF  367

Query  501  TKTST--GKREASSNKNTTPNLAVIPSLLTARG  409
            +KTS+  GKR AS+   TTPNLA IPSLLTARG
Sbjct  368  SKTSSSNGKRGASNKNATTPNLAAIPSLLTARG  400



>gb|KDP27815.1| hypothetical protein JCGZ_18895 [Jatropha curcas]
Length=417

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 111/151 (74%), Gaps = 20/151 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK+         A+    +KERV+CGGIF GFMITSSS
Sbjct  280  ERISTGFGDCTLRRVESQREGKPKI---------AAATSNMKERVKCGGIFGGFMITSSS  330

Query  660  sssssssylvsSE-ENVNGNGR-PSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST  487
            SSSSSSSY VSS  E++NG    P   + G     LAHGRSRSWGWAFASPMRAF+K S+
Sbjct  331  SSSSSSSYWVSSSTEDMNGKSSGPGSVAAG----PLAHGRSRSWGWAFASPMRAFSKPSS  386

Query  486  --GKREA---SSNKNTTPNLAVIPSLLTARG  409
              GKR+    +SNKNTTPNL+ IPSLL  RG
Sbjct  387  KDGKRDIIREASNKNTTPNLSAIPSLLAVRG  417



>ref|XP_008223212.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein DDB_G0271670 
[Prunus mume]
Length=427

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 105/149 (70%), Gaps = 23/149 (15%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK     HR    +   C+KERV+CGGIFSGFM+TSSS
Sbjct  297  ERISTGFGDCTLRRVESQREGKPKASV--HRHGEHNNSHCMKERVKCGGIFSGFMMTSSS  354

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSSSSY VSS                    QL HGRSRSWGWAFASPMRAFTK S+  
Sbjct  355  SSSSSSSYWVSSSAE----------------GQLVHGRSRSWGWAFASPMRAFTKPSSKD  398

Query  486  GKRE---ASSNKNTTPNLAVIPSLLTARG  409
            GKR+    +S+KNTTPNL  IPSLL+ RG
Sbjct  399  GKRDIVRQASDKNTTPNLNAIPSLLSVRG  427



>ref|XP_002270026.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Vitis vinifera]
Length=420

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 104/156 (67%), Gaps = 21/156 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQD--CIKERVRCGGIFSGFMIT-  670
            ERISTGFGDCTLRRVESQREGKPK  S  HR     G D  CIKERV+CGGIF GF++T 
Sbjct  274  ERISTGFGDCTLRRVESQREGKPK-SSGAHRGGAPGGPDHQCIKERVKCGGIFGGFIMTS  332

Query  669  -ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT  493
             SSSSSSSS     + E+NVNG    + A        L+HGRS+SWGWAFASPMRA +K 
Sbjct  333  SSSSSSSSSYWMSSTVEDNVNGKSTAAAAP-----GPLSHGRSKSWGWAFASPMRALSKP  387

Query  492  ST--------GKREASSNKNTTPNLAVIPSLLTARG  409
            S+        GKR+ + NK   PNLA IPSLL  RG
Sbjct  388  SSSKVEYKDAGKRDITPNK---PNLAAIPSLLAVRG  420



>ref|XP_006419538.1| hypothetical protein CICLE_v10004985mg [Citrus clementina]
 ref|XP_006489053.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Citrus 
sinensis]
 gb|ESR32778.1| hypothetical protein CICLE_v10004985mg [Citrus clementina]
 gb|KDO71715.1| hypothetical protein CISIN_1g013639mg [Citrus sinensis]
Length=439

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 110/158 (70%), Gaps = 27/158 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK   VH+  S +     +KERV+CGGIF GF++TSSS
Sbjct  295  ERISTGFGDCTLRRVESQREGKPK---VHNAASSSHHHHHMKERVKCGGIFGGFIMTSSS  351

Query  660  sssssssylvsS-----EENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF--  502
            SSSSSSSY VSS     ++NVNG    S          LAHGRSRSWGWAFASPMRAF  
Sbjct  352  SSSSSSSYWVSSSSTDHQDNVNGKSSSS----------LAHGRSRSWGWAFASPMRAFGS  401

Query  501  ---TKTSTGKRE----ASSNKNTTPNLAVIPSLLTARG  409
               +K  + KR+     S+NKNTTPNLA IPSLL  RG
Sbjct  402  KPSSKDGSKKRDHVIRESANKNTTPNLAAIPSLLAVRG  439



>ref|XP_007035629.1| Uncharacterized protein TCM_021236 [Theobroma cacao]
 gb|EOY06555.1| Uncharacterized protein TCM_021236 [Theobroma cacao]
Length=428

 Score =   138 bits (348),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 110/151 (73%), Gaps = 25/151 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPKV         A+    +KERV+CGGIF GF++TSSS
Sbjct  296  ERISTGFGDCTLRRVESQREGKPKV---------AASSSAMKERVKCGGIFGGFIMTSSS  346

Query  660  sssssssylvsSE-ENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST-  487
            SSSSSSSY VSS  E+VNG      ++ G     L HGRS+SWGWAFASPMRAF+K S+ 
Sbjct  347  SSSSSSSYWVSSSAEDVNGK-----STAG----TLVHGRSKSWGWAFASPMRAFSKPSSK  397

Query  486  -GKREA----SSNKNTTPNLAVIPSLLTARG  409
             GKR+     S++KNTTPNLA IPSLL  RG
Sbjct  398  DGKRDTIIRESNSKNTTPNLAAIPSLLAVRG  428



>ref|XP_007226372.1| hypothetical protein PRUPE_ppa022820mg [Prunus persica]
 gb|EMJ27571.1| hypothetical protein PRUPE_ppa022820mg [Prunus persica]
Length=417

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 100/152 (66%), Gaps = 26/152 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK     HR    +   C+KERV+CGGIFSGFM+TSSS
Sbjct  284  ERISTGFGDCTLRRVESQREGKPKASV--HRHGENNNSHCMKERVKCGGIFSGFMMTSSS  341

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSSS                S         QL HGRSRSWGWAFASPMRAFTK S+  
Sbjct  342  SSSSSS----------------SYWVSSSAEGQLVHGRSRSWGWAFASPMRAFTKPSSSS  385

Query  486  ---GKRE---ASSNKNTTPNLAVIPSLLTARG  409
               GKR+    +S+KNTTP L  IPSLL+ RG
Sbjct  386  SKDGKRDIVRQASDKNTTPTLNGIPSLLSVRG  417



>ref|XP_007154176.1| hypothetical protein PHAVU_003G096600g [Phaseolus vulgaris]
 gb|ESW26170.1| hypothetical protein PHAVU_003G096600g [Phaseolus vulgaris]
Length=427

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 103/156 (66%), Gaps = 20/156 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKV-----GSVHHRTSGASGQDCIKERVRCGGIFSGFM  676
            ERISTGFGDCTLRRVESQREGKPKV      SV           C+KERVRCGG+FSGFM
Sbjct  278  ERISTGFGDCTLRRVESQREGKPKVAGGGAASVSRGGDHHHHHHCMKERVRCGGLFSGFM  337

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK  496
            +TSSSSSSSSSSY +SS  +   NG+ +  +       L+H R RSWGWAFASPMRAF+ 
Sbjct  338  MTSSSSSSSSSSYWISSSADDAANGKSATVA-------LSHNRGRSWGWAFASPMRAFSG  390

Query  495  TSTGK--------REASSNKNTTPNLAVIPSLLTAR  412
              + K        R+A+ NKN  PNL+ IPSLL  R
Sbjct  391  KPSSKESNRRDIIRDANDNKNAAPNLSAIPSLLAVR  426



>ref|XP_009622778.1| PREDICTED: uncharacterized protein LOC104114114 [Nicotiana tomentosiformis]
Length=337

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 93/143 (65%), Gaps = 38/143 (27%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            E+ISTGFGDCTL+R+ESQREGKP+  SV+H           KERV CGGI S ++++   
Sbjct  230  EKISTGFGDCTLKRIESQREGKPRFSSVNH-----------KERVNCGGILS-YLVS---  274

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT-STG  484
                       SEEN++G             H +A+GRS++WGWA ASPMRAF+KT S+G
Sbjct  275  -----------SEENLHGKS-----------HNIANGRSKNWGWALASPMRAFSKTSSSG  312

Query  483  KREASSNKNTTPNLAVIPSLLTA  415
            KRE S+NKN TPNLA IPSLLT 
Sbjct  313  KREDSNNKNATPNLAAIPSLLTV  335



>ref|XP_002314378.2| hypothetical protein POPTR_0010s01580g [Populus trichocarpa]
 gb|EEF00549.2| hypothetical protein POPTR_0010s01580g [Populus trichocarpa]
Length=407

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 103/144 (72%), Gaps = 16/144 (11%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPKV      TSGAS    +KERVRCGGIF GF ITSSS
Sbjct  280  ERISTGFGDCTLRRVESQREGKPKV------TSGASH---MKERVRCGGIFGGFNITSSS  330

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
            SSSSSSSY VSS    + NG+ S A        LAHGRSRSWGWAFASPMRAF    + K
Sbjct  331  SSSSSSSYWVSSSAE-DMNGKSSGAG------PLAHGRSRSWGWAFASPMRAFGSKPSSK  383

Query  480  REASSNKNTTPNLAVIPSLLTARG  409
                + K+TTPNL+ IPSLL  RG
Sbjct  384  DGKRNIKHTTPNLSAIPSLLAVRG  407



>ref|XP_008367144.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=426

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 97/147 (66%), Gaps = 26/147 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK     HR  G     C+KERV+CGGIFSGFM+TSSS
Sbjct  299  ERISTGFGDCTLRRVESQREGKPKAA---HR--GGEHNHCMKERVKCGGIFSGFMMTSSS  353

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSSS                S          L HGR+RSWGWAFASPMRAFTK S+  
Sbjct  354  SSSSSS----------------SYWVSSSAEGPLVHGRNRSWGWAFASPMRAFTKPSSKD  397

Query  486  GKRE---ASSNKNTTPNLAVIPSLLTA  415
            GKR+    +S+KNT PNL  IPSLL+ 
Sbjct  398  GKRDIVRQASDKNTAPNLNAIPSLLSV  424



>ref|XP_008390641.1| PREDICTED: uncharacterized protein DDB_G0271670 [Malus domestica]
Length=427

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 97/147 (66%), Gaps = 26/147 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK     HR  G     C+KERV+CGGIFSGFM+TSSS
Sbjct  300  ERISTGFGDCTLRRVESQREGKPKAA---HR--GGEHNHCMKERVKCGGIFSGFMMTSSS  354

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSSS                S          L HGR+RSWGWAFASPMRAFTK S+  
Sbjct  355  SSSSSS----------------SYWVSSSAEGPLVHGRNRSWGWAFASPMRAFTKPSSKD  398

Query  486  GKRE---ASSNKNTTPNLAVIPSLLTA  415
            GKR+    +S+KNT PNL  IPSLL+ 
Sbjct  399  GKRDIVRQASDKNTAPNLNAIPSLLSV  425



>ref|XP_002516943.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45557.1| conserved hypothetical protein [Ricinus communis]
Length=450

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 110/153 (72%), Gaps = 19/153 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK-VGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERISTGFGDCTLRRVESQREGKPK  G+  H          +KERV+CGGIF GFMITSS
Sbjct  308  ERISTGFGDCTLRRVESQREGKPKGPGAASH----------MKERVKCGGIFGGFMITSS  357

Query  663  ssssssssylv---sSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT  493
            SSSSSSSSY V   + E ++NG     +A+       LAHGRSRSWGWAFASPMRAF+K 
Sbjct  358  SSSSSSSSYWVSSSAEEHHMNGKSTHGVAAAAGAGGPLAHGRSRSWGWAFASPMRAFSKP  417

Query  492  ST--GKRE---ASSNKNTTPNLAVIPSLLTARG  409
            S+  GKR+    +SNKNTTPNL+ IPSLL  RG
Sbjct  418  SSKDGKRDIIREASNKNTTPNLSAIPSLLAVRG  450



>ref|XP_011010196.1| PREDICTED: sericin 1-like [Populus euphratica]
Length=407

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 100/145 (69%), Gaps = 18/145 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGF-MITss  664
            ERISTGFGDCTLRRVESQREGKPKV      TSGAS    +KERVRCGGIF GF M +SS
Sbjct  280  ERISTGFGDCTLRRVESQREGKPKV------TSGASH---MKERVRCGGIFGGFNMTSSS  330

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG  484
            SSSSSSS ++ SS E++NG               LAHGRSRSWGWAFASPMRAF    + 
Sbjct  331  SSSSSSSYWVSSSAEDMNGKS--------SGAGPLAHGRSRSWGWAFASPMRAFGSKPSS  382

Query  483  KREASSNKNTTPNLAVIPSLLTARG  409
            K    + K TTPNL+ IPSLL  RG
Sbjct  383  KDGKRNVKQTTPNLSAIPSLLAVRG  407



>ref|XP_009352288.1| PREDICTED: uncharacterized protein LOC103943673 [Pyrus x bretschneideri]
Length=405

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 97/147 (66%), Gaps = 26/147 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK     HR  G     C+KERV+CGGIFSGFM+TSSS
Sbjct  278  ERISTGFGDCTLRRVESQREGKPKTA---HR--GGEHNHCMKERVKCGGIFSGFMMTSSS  332

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSSS                S          L +GR+RSWGWAFASPMRAFTK S+  
Sbjct  333  SSSSSS----------------SYWVSSSAEGPLVNGRNRSWGWAFASPMRAFTKPSSKD  376

Query  486  GKRE---ASSNKNTTPNLAVIPSLLTA  415
            GKR+    +S+KNT PNL  IPSLL+ 
Sbjct  377  GKRDIVRQASDKNTAPNLNAIPSLLSV  403



>ref|XP_009769314.1| PREDICTED: uncharacterized protein LOC104220188 [Nicotiana sylvestris]
Length=336

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 88/142 (62%), Gaps = 37/142 (26%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            E+ISTGFGDCTLRR+ESQREGKP+  SV+H           KERV CGGI S ++++S  
Sbjct  230  EKISTGFGDCTLRRIESQREGKPRFSSVNH-----------KERVNCGGILS-YLVSS--  275

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
                        EEN++G             H + +GRS++WGWA ASPMRAF+KTS+  
Sbjct  276  ------------EENLHGKS-----------HNITNGRSKNWGWALASPMRAFSKTSSSG  312

Query  480  REASSNKNTTPNLAVIPSLLTA  415
            +   SNKN TPNLA IPSLLT 
Sbjct  313  KREDSNKNATPNLAAIPSLLTV  334



>ref|XP_006380149.1| hypothetical protein POPTR_0008s22370g [Populus trichocarpa]
 gb|ERP57946.1| hypothetical protein POPTR_0008s22370g [Populus trichocarpa]
Length=403

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 101/146 (69%), Gaps = 21/146 (14%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP-KVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERISTGFGDCTLRRVESQREGKP  VG+ H           +K RVRCGGIF GF+ITSS
Sbjct  277  ERISTGFGDCTLRRVESQREGKPVTVGTSH-----------MKGRVRCGGIFGGFIITSS  325

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF-TKTST  487
            SSSSSSS ++ SS E++NG   P           LAHGRSRSWGWAFASPMRA  +K S+
Sbjct  326  SSSSSSSYWVSSSAEDMNGKS-PGAG-------PLAHGRSRSWGWAFASPMRALGSKPSS  377

Query  486  GKREASSNKNTTPNLAVIPSLLTARG  409
               +   N+NTTPNL+ IPSLL  RG
Sbjct  378  KDGKRDINRNTTPNLSGIPSLLAVRG  403



>ref|XP_004296853.1| PREDICTED: uncharacterized protein LOC101313206 [Fragaria vesca 
subsp. vesca]
Length=428

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 110/152 (72%), Gaps = 22/152 (14%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK     H ++  +G     ERV+CGG+FSGFM+TSSS
Sbjct  291  ERISTGFGDCTLRRVESQREGKPK-----HSSAVRNGA----ERVKCGGLFSGFMMTSSS  341

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSR-SWGWAFASPMRAFTKTST-  487
            SSSSSSSY VSS E++NG      A  G     +  GRSR SWGWAFASPMRAF+K S+ 
Sbjct  342  SSSSSSSYWVSSAEDMNGK-----AISGGPGALVQGGRSRSSWGWAFASPMRAFSKPSSK  396

Query  486  -GKREA-----SSNKNTTPNLAVIPSLLTARG  409
             GKR+      +S+KNTTPNL+ IPSLL+ RG
Sbjct  397  DGKRDIIRQANTSDKNTTPNLSAIPSLLSVRG  428



>ref|XP_011003913.1| PREDICTED: uncharacterized protein LOC105110537 [Populus euphratica]
Length=404

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 99/146 (68%), Gaps = 21/146 (14%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP-KVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERISTGFGDCTLRRVESQREGKP  VG+ H           +K RVRCGGIF GF+ITSS
Sbjct  278  ERISTGFGDCTLRRVESQREGKPVTVGTSH-----------MKGRVRCGGIFGGFIITSS  326

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF-TKTST  487
             SSSSSS ++ SS E++NG               LAHGRSRSWGWAFASPMRAF +K S+
Sbjct  327  FSSSSSSYWVSSSAEDMNGK--------SSGAGPLAHGRSRSWGWAFASPMRAFGSKPSS  378

Query  486  GKREASSNKNTTPNLAVIPSLLTARG  409
               +   N+NTT NL+ IPSLL  RG
Sbjct  379  KDGKRDINRNTTSNLSGIPSLLAVRG  404



>ref|XP_010105149.1| hypothetical protein L484_007215 [Morus notabilis]
 gb|EXC03957.1| hypothetical protein L484_007215 [Morus notabilis]
Length=440

 Score =   127 bits (320),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 110/163 (67%), Gaps = 27/163 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG----KPK--VGSVHHRTSGASGQDCIKERVRCGGIFSGF  679
            ERISTGFGDCTLRRVESQREG    KPK    S HH   G     C+KERV+CGGIF GF
Sbjct  286  ERISTGFGDCTLRRVESQREGNGAGKPKSSATSSHH---GGGEHHCMKERVKCGGIFGGF  342

Query  678  MITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT  499
            ++TSSSSSSSSSSY VSS ++VNG   P   + G     LAHGR RSWGWAFASPMRAF 
Sbjct  343  ILTSSSSSSSSSSYWVSSADDVNG---PKHVAGGPG--PLAHGRIRSWGWAFASPMRAFG  397

Query  498  KT--STGKRE---ASSNKN--------TTPNLAVIPSLLTARG  409
            K   S GKR+    +S+KN        TTPNLA IPSLL  RG
Sbjct  398  KPSGSNGKRDIIRQASDKNSSASATTTTTPNLAAIPSLLAVRG  440



>gb|EYU45546.1| hypothetical protein MIMGU_mgv1a022941mg [Erythranthe guttata]
Length=377

 Score =   127 bits (318),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 102/152 (67%), Gaps = 15/152 (10%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQRE-GKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERISTGFGDCTLRRVESQRE      G       G +GQD IKERV+CGG+FSGFMI  S
Sbjct  233  ERISTGFGDCTLRRVESQREGKPKNGGKNGGGGGGMNGQDYIKERVKCGGLFSGFMIAGS  292

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK----  496
            SSSSSSSS    +  +V  N +  M         L+HGRS++WGWAFASPMRAF+K    
Sbjct  293  SSSSSSSSSYWVAGNSVEENSKSQMV-------NLSHGRSKNWGWAFASPMRAFSKNINI  345

Query  495  -TSTGKREA--SSNKNTTPNLAVIPSLLTARG  409
              ++GKR+A  +SNKN +PNL+ IPSLL   G
Sbjct  346  NNNSGKRDADLNSNKNRSPNLSAIPSLLAVSG  377



>ref|XP_006349822.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Solanum 
tuberosum]
Length=340

 Score =   125 bits (315),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 89/144 (62%), Gaps = 38/144 (26%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            E+ISTGFGDCTLRR+ESQRE KP+  SVHH           KERV CGGI S ++++S  
Sbjct  231  EKISTGFGDCTLRRIESQRESKPRFSSVHH-----------KERVNCGGILS-YLVSSEV  278

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG-  484
                          N+NG             H +A+GRS++WGWA ASPMRAF+KTS+  
Sbjct  279  -------------NNLNGKS-----------HHIANGRSKNWGWALASPMRAFSKTSSSV  314

Query  483  KREASS-NKNTTPNLAVIPSLLTA  415
            KRE S+ NKN TPNLA IPSLLT 
Sbjct  315  KREDSNDNKNATPNLAAIPSLLTV  338



>ref|XP_003550539.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=444

 Score =   127 bits (318),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 100/165 (61%), Gaps = 35/165 (21%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK------------VGSVHHRTSGASGQDCIKERVRCG  697
            ERISTGFGDCTLRRVESQREGKPK             G  HH         CIKERVRCG
Sbjct  294  ERISTGFGDCTLRRVESQREGKPKGTGGGASAAVSRAGEQHH-------HHCIKERVRCG  346

Query  696  GIFSGFMIT--ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAF  523
            G+FSGFM+T  SSSSSSSS     S+++    NG+ +  +       L+H R RSWGWAF
Sbjct  347  GLFSGFMMTSSSSSSSSSSYWVSSSADDAAAVNGKSATVA-------LSHNRGRSWGWAF  399

Query  522  ASPMRAFTKTSTGKRE-------ASSNKNTTPNLAVIPSLLTARG  409
            ASPMRAF+   + K          +++KN TPNL+ IPSLL  RG
Sbjct  400  ASPMRAFSGKPSSKESNRRDIIRDANDKNATPNLSAIPSLLAVRG  444



>ref|XP_004134219.1| PREDICTED: uncharacterized protein LOC101205873 [Cucumis sativus]
 ref|XP_004164706.1| PREDICTED: uncharacterized protein LOC101231327 [Cucumis sativus]
Length=385

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 96/147 (65%), Gaps = 14/147 (10%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI TGFGDCTLRRVES REGKPK+      T    G DC+KERV+CGGIF GFMI  +S
Sbjct  248  ERI-TGFGDCTLRRVESHREGKPKINPTAVATV-PDGNDCLKERVKCGGIFGGFMI-QTS  304

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSS+S       +    GR   A+ G        GRS++ GWAFASPMRAFTK S+  
Sbjct  305  SSSSSASSSYWVSSSSGEEGRFQQATYGQ------AGRSKNKGWAFASPMRAFTKPSSSS  358

Query  486  --GKREASSNKNTTPNLAVIPSLLTAR  412
              GKRE SS KN+TPNL  IPSLL  R
Sbjct  359  SEGKRE-SSEKNSTPNLDAIPSLLAVR  384



>gb|KGN57124.1| hypothetical protein Csa_3G159440 [Cucumis sativus]
Length=385

 Score =   124 bits (311),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 96/147 (65%), Gaps = 14/147 (10%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI TGFGDCTLRRVES REGKPK+      T    G DC+KERV+CGGIF GFMI  +S
Sbjct  248  ERI-TGFGDCTLRRVESHREGKPKINPTAVATV-PDGNDCLKERVKCGGIFGGFMI-QTS  304

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSS+S       +    GR   A+ G        GRS++ GWAFASPMRAFTK S+  
Sbjct  305  SSSSSASSSYWVSSSSGEEGRFQQATYGQ------AGRSKNKGWAFASPMRAFTKPSSSS  358

Query  486  --GKREASSNKNTTPNLAVIPSLLTAR  412
              GKRE SS KN+TPNL  IPSLL  R
Sbjct  359  SEGKRE-SSEKNSTPNLDAIPSLLAVR  384



>ref|XP_003528634.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
 gb|KHN02957.1| hypothetical protein glysoja_009823 [Glycine soja]
Length=420

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 99/163 (61%), Gaps = 28/163 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK-VG----SVHHRTSGASGQDCIKERVRCGGIFSGFM  676
            ERISTGFGDCTLRRVESQREGKPK +G    +V           C+KERVRCGG+FSGFM
Sbjct  267  ERISTGFGDCTLRRVESQREGKPKGIGGGSSAVSRGGEHHHHHHCMKERVRCGGLFSGFM  326

Query  675  IT-------ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFAS  517
            +T       SSS   SSS+   ++   VNG      A+V      L+H R RSWGWAFAS
Sbjct  327  MTSSSSSSSSSSYWVSSSADDAAAAAAVNGKS----ATVA-----LSHNRGRSWGWAFAS  377

Query  516  PMRAFTKTSTGKRE-------ASSNKNTTPNLAVIPSLLTARG  409
            PMRAF+   + K          +S+KN TPNL+ IPSLL  RG
Sbjct  378  PMRAFSGKPSSKESNRRDIIRGASDKNATPNLSAIPSLLAVRG  420



>ref|XP_004252911.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Solanum 
lycopersicum]
Length=341

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 73/146 (50%), Positives = 88/146 (60%), Gaps = 40/146 (27%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            E+ISTGFGDCTLRR+ESQRE KP+  SVHH           KERV CGGI S ++++S  
Sbjct  230  EKISTGFGDCTLRRIESQRESKPRFSSVHH-----------KERVNCGGILS-YLVSSEV  277

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG-  484
                          N+NG             H +A+GRS++WGWA ASPMRAF+KTS+  
Sbjct  278  -------------NNLNGKS-----------HHIANGRSKNWGWALASPMRAFSKTSSSV  313

Query  483  KREASS---NKNTTPNLAVIPSLLTA  415
            KRE S+   NKN TPNL  IPSLLT 
Sbjct  314  KREDSNSNDNKNATPNLDAIPSLLTV  339



>ref|XP_008353253.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Malus domestica]
Length=220

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 92/142 (65%), Gaps = 25/142 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK  +VH    G     C+KE+V+CGGIFSGFM+TSSS
Sbjct  86   ERISTGFGDCTLRRVESQREGKPK--AVHR--GGEHNNHCMKEKVKCGGIFSGFMMTSSS  141

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSSSS                S          L H RSRSWGWAFASPMRAF+K S+  
Sbjct  142  SSSSSS----------------SYWVSSSXEGPLVHVRSRSWGWAFASPMRAFSKPSSKD  185

Query  486  GKR---EASSNKNTTPNLAVIP  430
            GKR     +S+KNT PNL  IP
Sbjct  186  GKRXIIRQASDKNTAPNLNAIP  207



>ref|XP_010693606.1| PREDICTED: uncharacterized serine-rich protein C215.13 [Beta 
vulgaris subsp. vulgaris]
Length=418

 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 101/161 (63%), Gaps = 28/161 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVES REG        H TS ASG D I+++VRCGG+F GF+ITSSS
Sbjct  269  ERISTGFGDCTLRRVESHREGSKH----RHSTSRASG-DTIRDKVRCGGLFGGFIITSSS  323

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK-----  496
            SS+SSSS    ++      GRP+  +       L HGRSRSWGWAFASPMRAF K     
Sbjct  324  SSTSSSSSYWPAD------GRPNGPTATPGTGPLVHGRSRSWGWAFASPMRAFAKPTITT  377

Query  495  ----TSTGKR--------EASSNKNTTPNLAVIPSLLTARG  409
                T+ GKR        E S N N T NLA IPSLL+ RG
Sbjct  378  TTMVTNDGKRDLGGKSGTELSKNSNGTTNLAAIPSLLSVRG  418



>ref|XP_003547383.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=337

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 99/150 (66%), Gaps = 32/150 (21%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG-KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERIS+G GDCTLRRVESQREG KPK+ +     S  +   C+KERVRCGGIFSGF++ SS
Sbjct  214  ERISSGLGDCTLRRVESQREGGKPKLAA-----SANTMNHCMKERVRCGGIFSGFVMNSS  268

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT-----  499
            SS++SSSS++ SS ++                     GR RSWGWAFASPMRAFT     
Sbjct  269  SSTTSSSSWVSSSVDD---------------------GRGRSWGWAFASPMRAFTTKGSP  307

Query  498  KTSTGKREASSNKNTTPNLAVIPSLLTARG  409
             +S+ KR+AS   N TPNL+ IP+LLT RG
Sbjct  308  PSSSSKRDASDKNNATPNLSAIPTLLTVRG  337



>ref|XP_009129760.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Brassica 
rapa]
Length=354

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 95/147 (65%), Gaps = 17/147 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVES REG         + + ++G   ++E VRCGGIF GFMI + S
Sbjct  220  ERITHGFGDCTLRRVESHREGNNNNNKA--KVNSSNGNVGVREIVRCGGIFGGFMIMTPS  277

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
            SSSSSSS  VSS  +               HHQ   GR+RSWGWAFASPMRAF+ +S+GK
Sbjct  278  SSSSSSSSWVSSSSSAE-----------QQHHQGHGGRNRSWGWAFASPMRAFSYSSSGK  326

Query  480  R----EASSNKNTTPNLAVIPSLLTAR  412
            R      S++KNTTPNL  IPSLLT R
Sbjct  327  RGRTISDSTSKNTTPNLDAIPSLLTVR  353



>emb|CDY70669.1| BnaCnng69290D [Brassica napus]
Length=349

 Score =   118 bits (295),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 93/147 (63%), Gaps = 19/147 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG          +S       ++E VRCGGIF GFMI + S
Sbjct  217  ERITHGFGDCTLRRVESQREGNNNNSKAKVNSSNVG----VREIVRCGGIFGGFMIMTPS  272

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
            SSSSSSS  VSS  +               HHQ   GR+RSWGWAFASPMRAF+ +S+GK
Sbjct  273  SSSSSSSSWVSSSSSAE-----------QQHHQGHGGRNRSWGWAFASPMRAFSYSSSGK  321

Query  480  R----EASSNKNTTPNLAVIPSLLTAR  412
            R      S++KNTTPNL  IPSLLT R
Sbjct  322  RGRTISDSTSKNTTPNLDAIPSLLTVR  348



>gb|KHN14609.1| hypothetical protein glysoja_024704 [Glycine soja]
Length=433

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 99/150 (66%), Gaps = 32/150 (21%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG-KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERIS+G GDCTLRRVESQREG KPK+ +     S  +   C+KERVRCGGIFSGF++ SS
Sbjct  310  ERISSGLGDCTLRRVESQREGGKPKLAA-----SANTMNHCMKERVRCGGIFSGFVMNSS  364

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT-----  499
            SS++SSSS++ SS ++                     GR RSWGWAFASPMRAFT     
Sbjct  365  SSTTSSSSWVSSSVDD---------------------GRGRSWGWAFASPMRAFTTKGSP  403

Query  498  KTSTGKREASSNKNTTPNLAVIPSLLTARG  409
             +S+ KR+AS   N TPNL+ IP+LLT RG
Sbjct  404  PSSSSKRDASDKNNATPNLSAIPTLLTVRG  433



>ref|XP_003609688.1| hypothetical protein MTR_4g120050 [Medicago truncatula]
 gb|AES91885.1| hypothetical protein MTR_4g120050 [Medicago truncatula]
Length=445

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 105/171 (61%), Gaps = 33/171 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--VGSVHHRTSGASGQD-------CIKERV--RCGG  694
            ERISTGFGDCTLRRVESQREGK K  V S +   S    QD       C+KERV  RCGG
Sbjct  281  ERISTGFGDCTLRRVESQREGKSKGVVASSNGIASVNRAQDHHHHHHHCMKERVLRRCGG  340

Query  693  IFSGFMI----TssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWA  526
            IFSGFM+    +S+SS+SS      S+++ VNG G+    +V  +         +SWGWA
Sbjct  341  IFSGFMMTSSSSSNSSTSSYWVSSNSADDAVNGGGKQGSVTVSQNRG------GKSWGWA  394

Query  525  FASPMRAFTKTSTGK-----------REAS-SNKNTTPNLAVIPSLLTARG  409
            FASPMRAF+   + K           R+A+ +NKN TPNL+ +PSLL+ARG
Sbjct  395  FASPMRAFSSKGSSKENHQNNRRDIIRDANDNNKNATPNLSAMPSLLSARG  445



>ref|XP_010440208.1| PREDICTED: vitellogenin-2-like [Camelina sativa]
Length=408

 Score =   115 bits (289),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 100/145 (69%), Gaps = 5/145 (3%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG      V + +S ++  + ++E VRCGGIF GFMI +SS
Sbjct  260  ERITNGFGDCTLRRVESQREGNNNKAKVSNSSSNSNPSNGVREMVRCGGIFGGFMIMTSS  319

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
            SSSSSSS  VSS    + +         +H+     GR+RSWGWAFASPMRAFT +S+GK
Sbjct  320  SSSSSSSSWVSSSSAEHHHQHQHHHHHHNHNMGHGGGRNRSWGWAFASPMRAFTSSSSGK  379

Query  480  R-----EASSNKNTTPNLAVIPSLL  421
            R     +++++KNTTPNL  IPSLL
Sbjct  380  RGRTISDSTTSKNTTPNLGAIPSLL  404



>gb|KEH32293.1| hypothetical protein MTR_4g120050 [Medicago truncatula]
Length=451

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 105/171 (61%), Gaps = 33/171 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--VGSVHHRTSGASGQD-------CIKERV--RCGG  694
            ERISTGFGDCTLRRVESQREGK K  V S +   S    QD       C+KERV  RCGG
Sbjct  287  ERISTGFGDCTLRRVESQREGKSKGVVASSNGIASVNRAQDHHHHHHHCMKERVLRRCGG  346

Query  693  IFSGFMI----TssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWA  526
            IFSGFM+    +S+SS+SS      S+++ VNG G+    +V  +         +SWGWA
Sbjct  347  IFSGFMMTSSSSSNSSTSSYWVSSNSADDAVNGGGKQGSVTVSQNRG------GKSWGWA  400

Query  525  FASPMRAFTKTSTGK-----------REAS-SNKNTTPNLAVIPSLLTARG  409
            FASPMRAF+   + K           R+A+ +NKN TPNL+ +PSLL+ARG
Sbjct  401  FASPMRAFSSKGSSKENHQNNRRDIIRDANDNNKNATPNLSAMPSLLSARG  451



>emb|CDY33930.1| BnaA02g30570D [Brassica napus]
Length=352

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 93/147 (63%), Gaps = 18/147 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVES REG     +     S   G   ++E VRCGGIF GFMI + S
Sbjct  219  ERITHGFGDCTLRRVESHREGNNNNNNKAKVNSSNVG---VREYVRCGGIFGGFMIMTPS  275

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
            SSSSSSS  VSS  +               HH+   GRSRSWGWAFASPMRAF+ +S+GK
Sbjct  276  SSSSSSSSWVSSSSSAE-----------QQHHRGHGGRSRSWGWAFASPMRAFSYSSSGK  324

Query  480  R----EASSNKNTTPNLAVIPSLLTAR  412
            R      S++KNTTPNL  IPSLLT R
Sbjct  325  RGRTISDSTSKNTTPNLDAIPSLLTVR  351



>ref|XP_008340808.1| PREDICTED: probable GPI-anchored adhesin-like protein PGA55 [Malus 
domestica]
Length=424

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 91/145 (63%), Gaps = 28/145 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKV---GSVHHRTSGASGQDCIKERVRCGGIFSGFMIT  670
            ERISTGFGDCTLRRVESQREGKPK    G  H+  +      C+KE+V+CGGIFSGFM+T
Sbjct  287  ERISTGFGDCTLRRVESQREGKPKAVHRGGEHNHHN----NHCMKEKVKCGGIFSGFMMT  342

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSSSSSSSS                S          L H RSRSW WAFASPMRAF+K S
Sbjct  343  SSSSSSSSS----------------SYWVSSSXEGPLVHVRSRSWXWAFASPMRAFSKPS  386

Query  489  T--GKR---EASSNKNTTPNLAVIP  430
            +  GKR     +S+KNT PNL  IP
Sbjct  387  SKDGKRXIIRQASDKNTAPNLNAIP  411



>gb|ACU23354.1| unknown [Glycine max]
Length=324

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 94/147 (64%), Gaps = 28/147 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG-KPKV--GSVHHRTSGASGQDCIKERVRCGGIFSGFMIT  670
            +RIS+G  DCTLRRVESQREG KPKV   +++H         C+KERVRCGGIFSGF++T
Sbjct  203  DRISSGLSDCTLRRVESQREGGKPKVIANTMNH---------CMKERVRCGGIFSGFVMT  253

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSSS++SSS                S +S       +  GR RSWGWAFASPM+AFT   
Sbjct  254  SSSSTTSSS----------------SSSSSSWVSSSVDDGRGRSWGWAFASPMKAFTTKG  297

Query  489  TGKREASSNKNTTPNLAVIPSLLTARG  409
            + KR+AS   N T NL+ IPSLLT RG
Sbjct  298  SSKRDASDKNNDTHNLSAIPSLLTVRG  324



>ref|XP_003533304.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Glycine 
max]
Length=325

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 95/147 (65%), Gaps = 27/147 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG-KPKV--GSVHHRTSGASGQDCIKERVRCGGIFSGFMIT  670
            +RIS+G  DCTLRRVESQREG KPKV   +++H         C+KERVRCGGIFSGF++T
Sbjct  203  DRISSGLSDCTLRRVESQREGGKPKVIANTMNH---------CMKERVRCGGIFSGFVMT  253

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSSS++SSSS               S +S       +  GR RSWGWAFASPM+AFT   
Sbjct  254  SSSSTTSSSS---------------SSSSSSWVSSSVDDGRGRSWGWAFASPMKAFTTKG  298

Query  489  TGKREASSNKNTTPNLAVIPSLLTARG  409
            + KR+AS   N T NL+ IPSLLT RG
Sbjct  299  SSKRDASDKNNDTHNLSAIPSLLTVRG  325



>gb|KHN26543.1| hypothetical protein glysoja_019782 [Glycine soja]
Length=322

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 94/147 (64%), Gaps = 30/147 (20%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG-KPKV--GSVHHRTSGASGQDCIKERVRCGGIFSGFMIT  670
            +RIS+G  DCTLRRVESQREG KPKV   +++H         C+KERVRCGGIFSGF++T
Sbjct  203  DRISSGLSDCTLRRVESQREGGKPKVIANTMNH---------CMKERVRCGGIFSGFVMT  253

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSSS++SSSS       +V+                   GR RSWGWAFASPM+AFT   
Sbjct  254  SSSSTTSSSSSSSWVSSSVDD------------------GRGRSWGWAFASPMKAFTTKG  295

Query  489  TGKREASSNKNTTPNLAVIPSLLTARG  409
            + KR+AS   N T NL+ IPSLLT RG
Sbjct  296  SSKRDASDKNNDTHNLSAIPSLLTVRG  322



>ref|XP_008438897.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Cucumis 
melo]
Length=385

 Score =   114 bits (286),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 94/147 (64%), Gaps = 13/147 (9%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI TGFGDCTLRRVES REGKPK+      T    G D +KERV+CGGIF GF I +SS
Sbjct  247  ERI-TGFGDCTLRRVESHREGKPKINPTAVATV-PDGNDSLKERVKCGGIFGGFTIQTSS  304

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST--  487
            SSSS+SS    S  +         A+ G        GRS++ GWAFASPMRAFTK S+  
Sbjct  305  SSSSASSSYWVSSSSGEEGRFQQAATYGQ------AGRSKNKGWAFASPMRAFTKPSSSS  358

Query  486  --GKREASSNKNTTPNLAVIPSLLTAR  412
              GKRE SS KN+TPNL  IPSLL  R
Sbjct  359  SEGKRE-SSEKNSTPNLDAIPSLLAVR  384



>ref|XP_004150501.1| PREDICTED: uncharacterized protein LOC101221255 [Cucumis sativus]
 gb|KGN47432.1| hypothetical protein Csa_6G319780 [Cucumis sativus]
Length=413

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 14/153 (9%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVH-----HRTSGASGQDCIKERVRCGGIFSGFM  676
            ERISTGFGDCTLRRVESQRE K    S +     HR        CIKERV+CGG+FSGFM
Sbjct  264  ERISTGFGDCTLRRVESQRESKSSKVSTNGNSSSHRNGAGVDHHCIKERVKCGGLFSGFM  323

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK  496
            +TSSSSSSSSSSYLVSS        +P+   VG     ++ GRSR+W WAFASPMRAF  
Sbjct  324  MTSSSSSSSSSSYLVSSSSADELTRKPTPV-VG---PVISGGRSRTWTWAFASPMRAFKP  379

Query  495  TSTGKREAS-----SNKNTTPNLAVIPSLLTAR  412
            +++  R+ S     +  N +P+L  IPSLLT R
Sbjct  380  SNSKDRKRSIIRQATESNPSPDLNAIPSLLTVR  412



>ref|XP_004167713.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101226695 
[Cucumis sativus]
Length=412

 Score =   112 bits (281),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 14/153 (9%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVH-----HRTSGASGQDCIKERVRCGGIFSGFM  676
            ERISTGFGDCTLRRVESQRE K    S +     HR        CIKERV+CGG+FSGFM
Sbjct  263  ERISTGFGDCTLRRVESQRESKSSKVSTNGNSSSHRNGAGVDHHCIKERVKCGGLFSGFM  322

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK  496
            +TSSSSSSSSSSYLVSS        +P+   VG     ++ GRSR+W WAFASPMRAF  
Sbjct  323  MTSSSSSSSSSSYLVSSSSADELTRKPTPV-VG---PVISGGRSRTWTWAFASPMRAFKP  378

Query  495  TSTGKREAS-----SNKNTTPNLAVIPSLLTAR  412
            +++  R+ S     +  N +P+L  IPSLLT R
Sbjct  379  SNSKDRKRSIIRQATESNPSPDLNAIPSLLTVR  411



>ref|XP_010442367.1| PREDICTED: vitellogenin-2-like [Camelina sativa]
Length=411

 Score =   112 bits (279),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 101/146 (69%), Gaps = 6/146 (4%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMI-Tss  664
            ERI+ GFGDC LRRVESQREG      V + +S ++  + ++E VRCGGIF GFMI TSS
Sbjct  262  ERITNGFGDCALRRVESQREGNNNKAKVSNNSSSSNPSNGVREMVRCGGIFGGFMIMTSS  321

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG  484
            SSSSSSSS++ SS    +   +       +H+     GR+RSWGWAFASPMRAFT +S+G
Sbjct  322  SSSSSSSSWVSSSSAEHHHQHQHHHHHHHNHNMGHGGGRNRSWGWAFASPMRAFTSSSSG  381

Query  483  KR-----EASSNKNTTPNLAVIPSLL  421
            KR     +++++KNTTPNL  IPSLL
Sbjct  382  KRGRTISDSTTSKNTTPNLGAIPSLL  407



>ref|XP_008458419.1| PREDICTED: sericin 1 [Cucumis melo]
Length=418

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 100/153 (65%), Gaps = 14/153 (9%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVH-----HRTSGASGQDCIKERVRCGGIFSGFM  676
            ERISTGFGDCTLRRVESQRE K    S +     HR        CIKERV+CGG+FSGFM
Sbjct  269  ERISTGFGDCTLRRVESQRESKSSKVSTNGNSSSHRNGAGVDHHCIKERVKCGGLFSGFM  328

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK  496
            +TSSSSSSSSSSYLVSS        +P+   VG     ++ GRSR+W WAFASPMRAF  
Sbjct  329  MTSSSSSSSSSSYLVSSSSADELTRKPTPV-VG---PVISGGRSRTWTWAFASPMRAFKP  384

Query  495  TSTGKREAS-----SNKNTTPNLAVIPSLLTAR  412
            +++  R+ S     +  N +P+L  IPSLLT R
Sbjct  385  SNSKDRKRSIIRQATESNPSPDLNSIPSLLTVR  417



>ref|XP_006395095.1| hypothetical protein EUTSA_v10004314mg [Eutrema salsugineum]
 gb|ESQ32381.1| hypothetical protein EUTSA_v10004314mg [Eutrema salsugineum]
Length=411

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 89/149 (60%), Positives = 101/149 (68%), Gaps = 18/149 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG  K G V + +S   G   ++E VRCGGIF GFMI +SS
Sbjct  274  ERITNGFGDCTLRRVESQREGHNK-GKVSNPSSNGGGG--VREMVRCGGIFGGFMIMTSS  330

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHG-RSRSWGWAFASPMRAFT-KTST  487
            SSSSSSS  VSS          S     HHH  +AHG R+RSWGWAFASPMRAFT  +S+
Sbjct  331  SSSSSSSSWVSSS---------SAEHHHHHHQNMAHGGRNRSWGWAFASPMRAFTSSSSS  381

Query  486  GKR----EASSNKNTTPNLAVIPSLLTAR  412
            GKR      S++KNTTPNL  IPSLL  R
Sbjct  382  GKRGRTISDSTSKNTTPNLDAIPSLLAVR  410



>ref|XP_010482192.1| PREDICTED: vitellogenin-2-like [Camelina sativa]
Length=405

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 97/145 (67%), Gaps = 8/145 (6%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG      V + +S ++  + ++E VRCGGIF GFMI +SS
Sbjct  260  ERITNGFGDCTLRRVESQREGNNNKAKVSNSSSSSNPSNGVREMVRCGGIFGGFMIMTSS  319

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGK  481
            SSSSSSS  VSS                +H+     GR+RSWGWAFASPMRAFT +S+GK
Sbjct  320  SSSSSSSSWVSSSS---AEHHHQHQHHHNHNMGHGGGRNRSWGWAFASPMRAFTSSSSGK  376

Query  480  R-----EASSNKNTTPNLAVIPSLL  421
            R     +++++KN TPNL  IPSLL
Sbjct  377  RGRTISDSTTSKNATPNLGAIPSLL  401



>ref|XP_004508203.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Cicer arietinum]
Length=468

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 106/166 (64%), Gaps = 28/166 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQD----CIKERV--RCGGIFSGF  679
            ERISTGFGDCTLRRVESQREGK K  S    +  AS  +    C+KERV  RCGGIFSGF
Sbjct  309  ERISTGFGDCTLRRVESQREGKSKAVSTSSSSVAASSVNHHNHCMKERVLRRCGGIFSGF  368

Query  678  MITssssssssssylvsSEENVNG---NGRPSMASVGHHHHQLAHGRSRSWGWAFASPMR  508
            M+TSSSSS+SSSS    S  + +    NG+ + ASV      L+  R +SW WAFASPMR
Sbjct  369  MMTSSSSSNSSSSSYWVSSNSADDAAVNGKQA-ASV-----TLSQNRGKSWSWAFASPMR  422

Query  507  AFTKTSTGK-------------REASSNKNTTPNLAVIPSLLTARG  409
            AF+ ++ G              R+A+ NKN TPNL+ +PSLL ARG
Sbjct  423  AFSSSNKGNSSKENHQNRRDIIRDANDNKNVTPNLSAMPSLLAARG  468



>emb|CDX86254.1| BnaA06g29710D [Brassica napus]
Length=376

 Score =   110 bits (274),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 96/148 (65%), Gaps = 19/148 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG    GS   + S +S    ++E VRCGGIF GFMI +SS
Sbjct  242  ERITNGFGDCTLRRVESQREGG---GSNKGKVSSSSNGGGVREMVRCGGIFGGFMIMTSS  298

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAH-GRSRSWGWAFASPMRAFTKTSTG  484
            SSSSSSS  VSS          S A    H + + H GR+R WGWAFASPMRAF  +S+G
Sbjct  299  SSSSSSSSWVSS----------SSAEQQQHQNNMGHGGRNRGWGWAFASPMRAFG-SSSG  347

Query  483  KR----EASSNKNTTPNLAVIPSLLTAR  412
            KR      S++KN+ PNL  IPSLL  +
Sbjct  348  KRGRTITDSTSKNSAPNLDAIPSLLVVK  375



>ref|XP_006282305.1| hypothetical protein CARUB_v10028592mg [Capsella rubella]
 gb|EOA15203.1| hypothetical protein CARUB_v10028592mg [Capsella rubella]
Length=402

 Score =   108 bits (271),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 97/148 (66%), Gaps = 11/148 (7%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG    G V +  S ++  + ++E VRCGGIF GFMI +SS
Sbjct  260  ERITNGFGDCTLRRVESQREGNNNKGKVSNSNSSSNPSNGVREMVRCGGIFGGFMIMTSS  319

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT-KTSTG  484
            SSSSSSS  VSS                HH+     GR+RSWGWAFASPMRAFT  +S+G
Sbjct  320  SSSSSSSSWVSSSS------AEHQHHHHHHNMGHGGGRNRSWGWAFASPMRAFTSSSSSG  373

Query  483  KR----EASSNKNTTPNLAVIPSLLTAR  412
            KR      S++KNTTPNL  IPSLL  R
Sbjct  374  KRGRTISDSTSKNTTPNLGAIPSLLAVR  401



>gb|AFK46837.1| unknown [Medicago truncatula]
Length=166

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 88/145 (61%), Gaps = 26/145 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGK-PKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            E+ISTGFGDCTLRRVESQREGK  KV S        + Q C+KERV+CGGIF GFM+ +S
Sbjct  47   EKISTGFGDCTLRRVESQREGKGSKVISSSVVAGNGNIQHCMKERVKCGGIFGGFMMLNS  106

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG  484
            SSSS            V+G+                 G   SWGWA ASPMRAF+  S+ 
Sbjct  107  SSSSYL----------VSGDD--------------GRGSRGSWGWALASPMRAFSSKSSS  142

Query  483  KREASSNKNTTPNLAVIPSLLTARG  409
            K   ++++  TPNL+ +PSLLTARG
Sbjct  143  KDSKNTSEK-TPNLSAVPSLLTARG  166



>ref|XP_009782617.1| PREDICTED: uncharacterized protein LOC104231340 [Nicotiana sylvestris]
Length=257

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 70/134 (52%), Gaps = 47/134 (35%)
 Frame = -2

Query  819  GDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITssssssssss  640
            GDC LRRVESQREGK       HR S  S ++CIKERVRC GIFSGFMIT          
Sbjct  170  GDCILRRVESQREGK-------HRVS--SRKECIKERVRCRGIFSGFMIT----------  210

Query  639  ylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGKREASSNK  460
                                        +  S  WGW  ASPMRAF+K  + K+  +SNK
Sbjct  211  ----------------------------NSSSSYWGWVLASPMRAFSKPLSSKKREASNK  242

Query  459  NTTPNLAVIPSLLT  418
            N TPNLA IPSLLT
Sbjct  243  NATPNLAAIPSLLT  256



>ref|XP_010445663.1| PREDICTED: uncharacterized protein DDB_G0271670 [Camelina sativa]
Length=368

 Score =   107 bits (266),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 70/147 (48%), Positives = 89/147 (61%), Gaps = 27/147 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE    +G+      G    D + E V+CGGIF GFMI +SS
Sbjct  244  ERISNGFGDCALRRIESQREATKVIGN-----GGGEAADAMSEMVKCGGIFGGFMIMTSS  298

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS---  490
            SSSSS++               S ++V HH+H++ +   RSWGWAFASPMRA   T+   
Sbjct  299  SSSSSTT---------------SSSTVDHHNHKIGN---RSWGWAFASPMRAKATTNHRG  340

Query  489  -TGKREASSNKNTTPNLAVIPSLLTAR  412
             T    ++ NKNT+PNL  IPSLL  +
Sbjct  341  RTITESSADNKNTSPNLDSIPSLLALK  367



>ref|XP_009594798.1| PREDICTED: uncharacterized protein LOC104091220 [Nicotiana tomentosiformis]
Length=256

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 72/134 (54%), Gaps = 47/134 (35%)
 Frame = -2

Query  819  GDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITssssssssss  640
            GDC LRRVESQREGK       HR S  S ++CIKERVRC GIFSGFMITSSS       
Sbjct  169  GDCILRRVESQREGK-------HRVS--SRKECIKERVRCRGIFSGFMITSSS-------  212

Query  639  ylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGKREASSNK  460
                                           S  WGW  ASPMRAFTK  + K+  +SNK
Sbjct  213  -------------------------------SSYWGWVLASPMRAFTKPLSSKKGEASNK  241

Query  459  NTTPNLAVIPSLLT  418
            N TPNLA IPSLLT
Sbjct  242  NATPNLAAIPSLLT  255



>gb|AAM61310.1| unknown [Arabidopsis thaliana]
Length=388

 Score =   106 bits (265),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 96/149 (64%), Gaps = 16/149 (11%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG    G+     S     + ++E VRCGGIF GFMI +SS
Sbjct  249  ERITNGFGDCTLRRVESQREGNNNKGNKVSSNS----SNGVREMVRCGGIFGGFMIMTSS  304

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS-TG  484
            SSSSSSS  VSS                H+      GR+RSWGW+FASPMRAFT +S +G
Sbjct  305  SSSSSSSSWVSSSS------AEHHHHHNHNMGHGGGGRNRSWGWSFASPMRAFTSSSYSG  358

Query  483  KR-----EASSNKNTTPNLAVIPSLLTAR  412
            KR     +++++KNTTPNL  IPSLL+ R
Sbjct  359  KRGRTISDSTTSKNTTPNLGAIPSLLSVR  387



>emb|CDX85391.1| BnaC07g27020D [Brassica napus]
Length=358

 Score =   105 bits (263),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 94/148 (64%), Gaps = 19/148 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG          +S   G   ++E VRCGGIF GFMI +SS
Sbjct  224  ERITNGFGDCTLRRVESQREGGSSSKGKVSSSSNGGG---VREMVRCGGIFGGFMIMTSS  280

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAH-GRSRSWGWAFASPMRAFTKTSTG  484
            SSSSSSS  VSS          S A    H + +AH GR+R WGWAFASPMRAF  +S+G
Sbjct  281  SSSSSSSSWVSS----------SSAEQQQHQNNMAHGGRNRGWGWAFASPMRAF-GSSSG  329

Query  483  KR----EASSNKNTTPNLAVIPSLLTAR  412
            KR      S++KN+ PNL  IPSLL  +
Sbjct  330  KRGRTITDSTSKNSAPNLDAIPSLLVVK  357



>ref|NP_568706.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10092.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL66973.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91776.1| unknown protein [Arabidopsis thaliana]
 gb|AED95770.1| uncharacterized protein AT5G49100 [Arabidopsis thaliana]
Length=396

 Score =   105 bits (263),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 97/149 (65%), Gaps = 16/149 (11%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG    G+       ++  + ++E VRCGGIF GFMI +SS
Sbjct  257  ERITNGFGDCTLRRVESQREGNNNKGN----KVSSNPSNGVREMVRCGGIFGGFMIMTSS  312

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS-TG  484
            SSSSSSS  VSS                H+      GR+RSWGW+FASPMRAFT +S +G
Sbjct  313  SSSSSSSSWVSSSS------AEHHHHHNHNMGHGGGGRNRSWGWSFASPMRAFTSSSYSG  366

Query  483  KR-----EASSNKNTTPNLAVIPSLLTAR  412
            KR     +++++KNTTPNL  IPSLL+ R
Sbjct  367  KRGRTISDSTTSKNTTPNLGAIPSLLSVR  395



>ref|XP_002865709.1| hypothetical protein ARALYDRAFT_917876 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41968.1| hypothetical protein ARALYDRAFT_917876 [Arabidopsis lyrata subsp. 
lyrata]
Length=384

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 97/148 (66%), Gaps = 17/148 (11%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERI+ GFGDCTLRRVESQREG    G+       ++  + ++E VRCGGIF GFMI +SS
Sbjct  248  ERITNGFGDCTLRRVESQREGNNNKGN----KVSSNPSNGVREMVRCGGIFGGFMIMTSS  303

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST-G  484
            SSSSSSS  VSS          +     +H+     GR+RSWGWAFASPMRAF+ +S+ G
Sbjct  304  SSSSSSSSWVSSSS--------AEHHHHNHNMGHGGGRNRSWGWAFASPMRAFSSSSSFG  355

Query  483  KR----EASSNKNTTPNLAVIPSLLTAR  412
            KR      S++KNTTPNL  IPSLL+ R
Sbjct  356  KRGRTISDSTSKNTTPNLGAIPSLLSVR  383



>gb|KEH37227.1| hypothetical protein MTR_2g436340 [Medicago truncatula]
Length=388

 Score =   104 bits (259),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 88/145 (61%), Gaps = 26/145 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGK-PKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            E+ISTGFGDCTLRRVESQREGK  KV S        + Q C+KERV+CGGIF GFM+ +S
Sbjct  269  EKISTGFGDCTLRRVESQREGKGSKVISSSVVAGNGNIQHCMKERVKCGGIFGGFMMLNS  328

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG  484
            SSSS            V+G+                 G   SWGWA ASPMRAF+  S+ 
Sbjct  329  SSSSYL----------VSGDD--------------GRGSRGSWGWALASPMRAFSSKSSS  364

Query  483  KREASSNKNTTPNLAVIPSLLTARG  409
            K   ++++  TPNL+ +PSLLTARG
Sbjct  365  KDSKNTSEK-TPNLSAVPSLLTARG  388



>ref|XP_009151710.1| PREDICTED: uncharacterized serine-rich protein C215.13-like [Brassica 
rapa]
Length=380

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 91/151 (60%), Gaps = 26/151 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITs--  667
            ERI+ GFGDCTLRRVESQREG    G  +     +S    ++E VRCGGIF GFMI +  
Sbjct  247  ERITNGFGDCTLRRVESQREG----GGSNKGKVSSSSNGGVREMVRCGGIFGGFMIMTSS  302

Query  666  --sssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT  493
              SSSSSS  S   + ++ +  N       VGH       GR+R WGWAFASP+RAF  +
Sbjct  303  SSSSSSSSWVSSSSAEQQQLQNN-------VGH------GGRNRGWGWAFASPIRAFG-S  348

Query  492  STGKR----EASSNKNTTPNLAVIPSLLTAR  412
            S+GKR      S++KN+ PNL  IPSLL  +
Sbjct  349  SSGKRGRTITDSTSKNSAPNLDAIPSLLVVK  379



>ref|XP_007138927.1| hypothetical protein PHAVU_009G249600g [Phaseolus vulgaris]
 gb|ESW10921.1| hypothetical protein PHAVU_009G249600g [Phaseolus vulgaris]
Length=328

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 74/150 (49%), Positives = 86/150 (57%), Gaps = 30/150 (20%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKV----GSVHHRTSGASGQDCIKERVRCGGIFSGFMI  673
            ERIS+G  DCTLRRVESQREGKPKV     S         G  C+KERVRCGGIF G   
Sbjct  203  ERISSGLSDCTLRRVESQREGKPKVVASASSSSSFAGAGVGNHCMKERVRCGGIFGGTSS  262

Query  672  TssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF--T  499
            +SS+SSSS  S                          +  GR RSWGWAFASP+RAF   
Sbjct  263  SSSASSSSWVSST------------------------VDDGRGRSWGWAFASPIRAFTTK  298

Query  498  KTSTGKREASSNKNTTPNLAVIPSLLTARG  409
             +S+  +  +S+KN TPNL+ IPSLLT RG
Sbjct  299  ASSSSSKRDASDKNATPNLSSIPSLLTVRG  328



>ref|XP_009124613.1| PREDICTED: uncharacterized protein LOC103849619 [Brassica rapa]
Length=347

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 78/146 (53%), Gaps = 32/146 (22%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE    + +       A   D + E V+CGGIF GFMI +  
Sbjct  230  ERISNGFGDCALRRIESQRESTKVISNGGGGGEAA--DDAMSEMVKCGGIFGGFMIMT--  285

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT---KTS  490
                                  S AS    HH++A+   RSWGWAFASPMRA T   +  
Sbjct  286  ----------------------SSASSTVVHHKMAN---RSWGWAFASPMRAKTNSHRDR  320

Query  489  TGKREASSNKNTTPNLAVIPSLLTAR  412
            T    ++++KNT+PNL  +PSL+  +
Sbjct  321  TITESSTTDKNTSPNLDSVPSLVAMK  346



>ref|XP_010558810.1| PREDICTED: uncharacterized protein DDB_G0271670 isoform X3 [Tarenaya 
hassleriana]
Length=449

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 100/160 (63%), Gaps = 20/160 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG--KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITs  667
            ERIS GFGDCTLRRVESQREG  K KV S      G  G   +++ VRCGGIF GFMI +
Sbjct  292  ERISNGFGDCTLRRVESQREGVNKAKVNSSSSSNGGGGGGAGMRDMVRCGGIFGGFMIMT  351

Query  666  sssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST  487
            SSSSSSSSS  VSS      +      +  HHHH L HGR+RSWGWAFASPMRAFT TST
Sbjct  352  SSSSSSSSSSWVSSSS---ADHNLHPHNHNHHHHNLVHGRNRSWGWAFASPMRAFTSTST  408

Query  486  GKREA---------------SSNKNTTPNLAVIPSLLTAR  412
             K  +               S++KNTTPNL  IPSLL  R
Sbjct  409  TKASSSSSGKDGKSGRTITDSTSKNTTPNLDAIPSLLAVR  448



>ref|XP_010558808.1| PREDICTED: uncharacterized protein DDB_G0271670 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558809.1| PREDICTED: uncharacterized protein DDB_G0271670 isoform X2 [Tarenaya 
hassleriana]
Length=458

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 100/160 (63%), Gaps = 20/160 (13%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG--KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITs  667
            ERIS GFGDCTLRRVESQREG  K KV S      G  G   +++ VRCGGIF GFMI +
Sbjct  301  ERISNGFGDCTLRRVESQREGVNKAKVNSSSSSNGGGGGGAGMRDMVRCGGIFGGFMIMT  360

Query  666  sssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTST  487
            SSSSSSSSS  VSS      +      +  HHHH L HGR+RSWGWAFASPMRAFT TST
Sbjct  361  SSSSSSSSSSWVSSSS---ADHNLHPHNHNHHHHNLVHGRNRSWGWAFASPMRAFTSTST  417

Query  486  GKREA---------------SSNKNTTPNLAVIPSLLTAR  412
             K  +               S++KNTTPNL  IPSLL  R
Sbjct  418  TKASSSSSGKDGKSGRTITDSTSKNTTPNLDAIPSLLAVR  457



>ref|XP_010024715.1| PREDICTED: uncharacterized protein LOC104415159 [Eucalyptus grandis]
Length=365

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 88/146 (60%), Gaps = 27/146 (18%)
 Frame = -2

Query  840  ERISTGF-GDCT-LRRVESQREGKPKVGSVHHRTSGASGQ-------DCIKERVRCGGIF  688
            ERISTGF GDCT LRRVES REGKP   S    TS A           C+KERVRCGGIF
Sbjct  204  ERISTGFIGDCTALRRVESHREGKPPRASTSTATSEAHHHHHPHYPHQCMKERVRCGGIF  263

Query  687  SGFMITssssssssssyl-------------vsSEENVNGNGRPSMASVGHHHHQLAHGR  547
             GF I ++++SSSS S                S+E+NVN  G  S  +V  HHH    GR
Sbjct  264  GGFAIANAANSSSSISSSSASSSSYWVPSSSNSAEDNVNHIGASSKPAVYPHHH----GR  319

Query  546  SRSWGWAFASPMRAFTK-TSTGKREA  472
            SRSWGWA ASPMRAF + +S+GKR A
Sbjct  320  SRSWGWALASPMRAFGRPSSSGKRNA  345



>ref|XP_006299713.1| hypothetical protein CARUB_v10015905mg [Capsella rubella]
 gb|EOA32611.1| hypothetical protein CARUB_v10015905mg [Capsella rubella]
Length=368

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 82/147 (56%), Gaps = 26/147 (18%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE    + +      G    D + E V+CGGIF GFMI +SS
Sbjct  243  ERISNGFGDCALRRIESQREATKVISN-----GGGEAADAMSEMVKCGGIFGGFMIMTSS  297

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS---  490
            S+ SS++   + +                 HHQ     +RSWGWAFASPMRA   T+   
Sbjct  298  STPSSTTSSSTVD-----------------HHQNHKMGNRSWGWAFASPMRAKATTNHRG  340

Query  489  -TGKREASSNKNTTPNLAVIPSLLTAR  412
             T    ++ NKNT+PNL  IPSL+  +
Sbjct  341  RTITESSADNKNTSPNLDSIPSLVALK  367



>ref|XP_010249406.1| PREDICTED: uncharacterized protein LOC104591946 [Nelumbo nucifera]
Length=355

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 72/117 (62%), Gaps = 13/117 (11%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVES RE KPK+  V H    A     IKERVRCGGIF GF ++SS 
Sbjct  249  ERISTGFGDCTLRRVESHRETKPKI--VMHGDVAAEEHQRIKERVRCGGIFRGFSMSSSY  306

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
            SSS     +         NGR S A+         H RSRSWGWAFASPMRA T+ S
Sbjct  307  SSSYWLPEV---------NGRTSAAAA--EARGTPHSRSRSWGWAFASPMRALTRPS  352



>gb|KCW61178.1| hypothetical protein EUGRSUZ_H039421, partial [Eucalyptus grandis]
Length=391

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 88/146 (60%), Gaps = 27/146 (18%)
 Frame = -2

Query  840  ERISTGF-GDCT-LRRVESQREGKPKVGSVHHRTSGASGQ-------DCIKERVRCGGIF  688
            ERISTGF GDCT LRRVES REGKP   S    TS A           C+KERVRCGGIF
Sbjct  234  ERISTGFIGDCTALRRVESHREGKPPRASTSTATSEAHHHHHPHYPHQCMKERVRCGGIF  293

Query  687  SGFMITssssssssssyl-------------vsSEENVNGNGRPSMASVGHHHHQLAHGR  547
             GF I ++++SSSS S                S+E+NVN  G  S  +V  HHH    GR
Sbjct  294  GGFAIANAANSSSSISSSSASSSSYWVPSSSNSAEDNVNHIGASSKPAVYPHHH----GR  349

Query  546  SRSWGWAFASPMRAFTK-TSTGKREA  472
            SRSWGWA ASPMRAF + +S+GKR A
Sbjct  350  SRSWGWALASPMRAFGRPSSSGKRNA  375



>ref|XP_010525280.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Tarenaya 
hassleriana]
Length=480

 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 96/163 (59%), Gaps = 31/163 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS+GFGDCTLRRVESQREG  K   V++   G +    +++ VRCGGIF GFM+ +SS
Sbjct  328  ERISSGFGDCTLRRVESQREGANKA-KVNNGGGGGAAAAGMRDMVRCGGIFGGFMMMTSS  386

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHG-RSRSWGWAFASPMRAFTKTST-  487
            SSSSSSS                     HHH  L HG R+RSWGWAFASPMRAFT TST 
Sbjct  387  SSSSSSSSSADHHH----------HHHHHHHQNLVHGGRNRSWGWAFASPMRAFTSTSTT  436

Query  486  -------------GKR-----EASSNKNTTPNLAVIPSLLTAR  412
                         GKR     E+++ KNT P+L  IPSLL  R
Sbjct  437  KASSSSSSSYGKDGKRGRTITESTTGKNTAPSLDSIPSLLVVR  479



>ref|XP_002882498.1| hypothetical protein ARALYDRAFT_478007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58757.1| hypothetical protein ARALYDRAFT_478007 [Arabidopsis lyrata subsp. 
lyrata]
Length=372

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 86/149 (58%), Gaps = 29/149 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE    + +      G    + + E V+CGGIF GFMI + S
Sbjct  246  ERISNGFGDCALRRIESQREATKVISN----GGGGEAANAMNEMVKCGGIFGGFMIMTPS  301

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHH-HQLAHGRSRSWGWAFASPMRAFTKTSTG  484
            S+SSS+                + ++V HHH H++ +   R+WGWAFASPMRA   T+T 
Sbjct  302  STSSST----------------TSSTVDHHHNHKMGN---RNWGWAFASPMRAKATTTTH  342

Query  483  K-----REASSNKNTTPNLAVIPSLLTAR  412
            +       ++ NKN +PNL  IPSLL  +
Sbjct  343  RGRTITESSADNKNISPNLDSIPSLLALK  371



>ref|NP_001118595.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAF01810.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74469.1| uncharacterized protein AT3G06868 [Arabidopsis thaliana]
Length=369

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 86/148 (58%), Gaps = 28/148 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE    + +      G    D + E V+CGGIF GFMI +SS
Sbjct  244  ERISNGFGDCALRRIESQREATKVISN----GGGGEAADAMSEMVKCGGIFGGFMIMTSS  299

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHH-HQLAHGRSRSWGWAFASPMRA-FTKTST  487
            S++SS+                + ++V HHH H++ +   R+WGWAFASPMRA  T T  
Sbjct  300  STTSST----------------TSSTVDHHHNHKMGN---RNWGWAFASPMRAKATATHR  340

Query  486  GK---REASSNKNTTPNLAVIPSLLTAR  412
            G+      + NKNT+ NL  IPSLL  +
Sbjct  341  GRTITESTADNKNTSSNLDSIPSLLALK  368



>ref|XP_010464278.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Camelina 
sativa]
Length=376

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/147 (45%), Positives = 83/147 (56%), Gaps = 23/147 (16%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE    + +      G    D + E V+CGGIF GFMI +SS
Sbjct  248  ERISNGFGDCALRRIESQREATKVISN-----GGGEAADAMSEMVKCGGIFGGFMIMTSS  302

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS---  490
            SSSSS++        V+ +       +G+          RSWGWAFASPMRA   T+   
Sbjct  303  SSSSSTTS----SSTVDHHHHHHNHKMGN----------RSWGWAFASPMRAKATTNHRG  348

Query  489  -TGKREASSNKNTTPNLAVIPSLLTAR  412
             T    ++ NKNT+PNL  IPSLL  +
Sbjct  349  RTITESSADNKNTSPNLDSIPSLLALK  375



>ref|XP_009147123.1| PREDICTED: uncharacterized protein LOC103870716 [Brassica rapa]
Length=357

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 84/144 (58%), Gaps = 24/144 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC L+R+ESQRE    + +      G    D + E V+CGGIF GFMI +SS
Sbjct  236  ERISNGFGDCALKRIESQREHSKVISN----GGGGEAADAMNEMVKCGGIFGGFMIMTSS  291

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG-  484
            SSS+S                 + ++V HHHH++  G   +WG AFASPMRA T    G 
Sbjct  292  SSSTS-----------------ASSTVDHHHHKM--GNKSAWGRAFASPMRAKTVHKGGT  332

Query  483  KREASSNKNTTPNLAVIPSLLTAR  412
              E+S++KNTT NL  + SL+T R
Sbjct  333  TTESSTDKNTTQNLDSVSSLVTMR  356



>emb|CDY24661.1| BnaA05g30600D [Brassica napus]
Length=347

 Score = 94.7 bits (234),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 85/144 (59%), Gaps = 23/144 (16%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC L+R+ESQRE    + +      G    D + E V+CGGIF GFMI +SS
Sbjct  225  ERISNGFGDCALKRIESQREHSKVISN----GGGGEAADAMNEMVKCGGIFGGFMIMTSS  280

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG-  484
            SSSS+S                + ++V HHHH++  G   +WG AFASPMRA T    G 
Sbjct  281  SSSSTS----------------ASSTVDHHHHKM--GNKSAWGRAFASPMRAKTVHKGGT  322

Query  483  KREASSNKNTTPNLAVIPSLLTAR  412
              E+S++KNTT NL  + SL+T R
Sbjct  323  TTESSTDKNTTQNLDSVSSLVTMR  346



>ref|XP_010046017.1| PREDICTED: trinucleotide repeat-containing gene 18 protein-like 
[Eucalyptus grandis]
Length=440

 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 94/166 (57%), Gaps = 34/166 (20%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG------KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGF  679
            ERISTGFGDCTLRRVESQRE       KP++ + H             ERVRCGGIF GF
Sbjct  287  ERISTGFGDCTLRRVESQREAGGRSHQKPRISAAHG-----------GERVRCGGIFGGF  335

Query  678  MITssssssss------ssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFAS  517
               +SSSSSSS      S+   + +E  + +   S A+    H   A G  RSWGWAF S
Sbjct  336  AAMASSSSSSSSSSHWVSTGCSADQEMAHSSSSRSSATAAVVHGGGARGH-RSWGWAFTS  394

Query  516  PMRAFTK---TSTGKRE----ASSNKN---TTPNLAVIPSLLTARG  409
            PMRAF +   T   KRE    AS N+N   T+PNLA IPSLL  RG
Sbjct  395  PMRAFGRPAYTKDAKRERSVVASRNRNNATTSPNLAAIPSLLAVRG  440



>emb|CDY05297.1| BnaC05g45060D [Brassica napus]
Length=344

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 83/144 (58%), Gaps = 24/144 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC L+R+ESQRE    + +      G    D + E V+CGGIF GFMI +SS
Sbjct  223  ERISNGFGDCALKRIESQREHSKVISN----GGGGEAADAMNEMVKCGGIFGGFMIMTSS  278

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG-  484
            SSS+S                 + ++V HH H++  G   +WG AFASPMRA T    G 
Sbjct  279  SSSTS-----------------ASSTVDHHQHKM--GNKSAWGRAFASPMRAKTVHKGGT  319

Query  483  KREASSNKNTTPNLAVIPSLLTAR  412
              E+S+NKNTT NL  + SL+T R
Sbjct  320  TTESSTNKNTTQNLDSVSSLVTMR  343



>gb|KCW84802.1| hypothetical protein EUGRSUZ_B01602 [Eucalyptus grandis]
Length=415

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 80/166 (48%), Positives = 93/166 (56%), Gaps = 34/166 (20%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREG------KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGF  679
            ERISTGFGDCTLRRVESQRE       KP++ + H             ERVRCGGIF GF
Sbjct  262  ERISTGFGDCTLRRVESQREAGGRSHQKPRISAAHG-----------GERVRCGGIFGGF  310

Query  678  MITsssssss------sssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFAS  517
               +SSSSSS       S+   + +E  + +   S A+    H   A G  RSWGWAF S
Sbjct  311  AAMASSSSSSSSSSHWVSTGCSADQEMAHSSSSRSSATAAVVHGGGARGH-RSWGWAFTS  369

Query  516  PMRAFTK---TSTGKRE----ASSNKN---TTPNLAVIPSLLTARG  409
            PMRAF +   T   KRE    AS N+N   T+PNLA IPSLL  RG
Sbjct  370  PMRAFGRPAYTKDAKRERSVVASRNRNNATTSPNLAAIPSLLAVRG  415



>gb|KHN03351.1| hypothetical protein glysoja_004377 [Glycine soja]
Length=520

 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 93/156 (60%), Gaps = 40/156 (26%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERISTGFGDCTLRRVESQREGKPK       T G +                GFM+TSSS
Sbjct  393  ERISTGFGDCTLRRVESQREGKPK------GTGGVAPPP------------PGFMMTSSS  434

Query  660  sssssssylvsSEEN----VNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT  493
            SSSSSSSY VSS  +    VNG      A+V      L+H R RSWGWAFASPMRAF+  
Sbjct  435  SSSSSSSYWVSSSADDAAAVNGKS----ATVA-----LSHNRGRSWGWAFASPMRAFSGK  485

Query  492  STGK--------REASSNKNTTPNLAVIPSLLTARG  409
             + K        R+A ++KN TPNL+ IPSLL  RG
Sbjct  486  PSSKESNRRDIIRDA-NDKNATPNLSAIPSLLAVRG  520



>gb|KFK38150.1| hypothetical protein AALP_AA3G075700 [Arabis alpina]
Length=382

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 89/152 (59%), Gaps = 25/152 (16%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQRE-----GKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFM  676
            ERIS GFGDC LRR+ESQRE        KV S +    G+     + E V+CGGIF GFM
Sbjct  246  ERISNGFGDCALRRIESQRETNHNHNNNKVSSSN---GGSEATYAMSEMVKCGGIFGGFM  302

Query  675  -ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT  499
             +TS++SSSS++S   + + + + N    M +             RSWGWAFASPMRA T
Sbjct  303  KMTSTTSSSSTTSSSSTVDHHHHHNHHHKMGN-------------RSWGWAFASPMRAKT  349

Query  498  KT---STGKREASSNKNTTPNLAVIPSLLTAR  412
             T    T   E++++KNTTPNL  IPSLL  R
Sbjct  350  TTHRSRTTITESTTDKNTTPNLDSIPSLLAMR  381



>ref|XP_006407894.1| hypothetical protein EUTSA_v10021990mg [Eutrema salsugineum]
 gb|ESQ49347.1| hypothetical protein EUTSA_v10021990mg [Eutrema salsugineum]
Length=369

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 82/145 (57%), Gaps = 22/145 (15%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsss  661
            ERIS GFGDC LRR+ESQRE      S    ++G      + E V+CGGIF GFMI +SS
Sbjct  244  ERISNGFGDCALRRIESQRE------STKVISNGGGEAAAMSEMVKCGGIFGGFMIMTSS  297

Query  660  sssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT--KTST  487
            SSSS++S        V+ +       +G+          RSWGWAFASPMRA T  +  T
Sbjct  298  SSSSTTSS----SSTVDHHHHHQHHKMGN----------RSWGWAFASPMRAKTTHRGRT  343

Query  486  GKREASSNKNTTPNLAVIPSLLTAR  412
                 ++ KNT+PNL  IPSL+  R
Sbjct  344  ITESTTTEKNTSPNLDSIPSLVALR  368



>ref|XP_009390817.1| PREDICTED: uncharacterized protein LOC103977119 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 64/116 (55%), Gaps = 17/116 (15%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVG---SVHHRTSGASGQDCIKERVRCGGIFSGFMIT  670
            ERISTGFGDCTLRR ES RE K K+      HH       +   KERV+CGG+F G  +T
Sbjct  275  ERISTGFGDCTLRRAESHREAKSKIVLHLDQHHNNGEQQQRSATKERVKCGGLFGGLALT  334

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF  502
                         +++++ N N R S A+     H     R+RSW WAFASPMRAF
Sbjct  335  -----------SAAADDDFNSNRRISAAAAAAAVHG---SRTRSWVWAFASPMRAF  376



>ref|XP_009134934.1| PREDICTED: uncharacterized protein LOC103859187 [Brassica rapa]
Length=290

 Score = 85.5 bits (210),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 70/141 (50%), Gaps = 37/141 (26%)
 Frame = -2

Query  834  ISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsssss  655
             S+G GDC LRR+ESQRE   KV S      G    + + E V+CGGIF GFMI +    
Sbjct  186  FSSGLGDCALRRIESQRE-HTKVTS----NGGDKADEAMSEMVKCGGIFGGFMIMT----  236

Query  654  sssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGKRE  475
                               PS ++V HHH      RS +WGWA  SPMRA T    G   
Sbjct  237  -------------------PSSSTVNHHHQHKMANRS-AWGWA--SPMRAKTTHKAG---  271

Query  474  ASSNKNTTPNLAVIPSLLTAR  412
               +KNT PNL  IPSL+T +
Sbjct  272  ---HKNTAPNLDSIPSLVTMK  289



>ref|XP_009381710.1| PREDICTED: uncharacterized protein LOC103969788 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 71/121 (59%), Gaps = 4/121 (3%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGS-VHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            ERISTGFGDCTLRRVESQRE KP +G  ++H   G   Q  +K R +CGG+F GF    +
Sbjct  304  ERISTGFGDCTLRRVESQREAKPNIGLHLNHDNDGEQRQPRMKVRFKCGGLFGGF---GT  360

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG  484
              +   S+     + + + + R S A+        A GR+RSW  AFASPMRAF   S+ 
Sbjct  361  MYAYWLSAAAAEDDLDDSSSSRTSAATPAPSATAAARGRTRSWSLAFASPMRAFRPYSSS  420

Query  483  K  481
            K
Sbjct  421  K  421



>ref|XP_010547019.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Tarenaya 
hassleriana]
Length=311

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 74/153 (48%), Positives = 89/153 (58%), Gaps = 27/153 (18%)
 Frame = -2

Query  837  RISTGFGDCTLRRVESQREG--KPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITss  664
            RIS GFGDCTLRRVESQREG  + KV S     S       +++ VRCGGIFSG M+ +S
Sbjct  174  RISNGFGDCTLRRVESQREGANRAKVNS-----SSNGNGGGMRDVVRCGGIFSGLMMMAS  228

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTG  484
            SSSSSSSS               S     HHH +L HGR+RSWGWAFASPMRAFT  ++ 
Sbjct  229  SSSSSSSSSSSL-----------SAGHHHHHHEKLVHGRNRSWGWAFASPMRAFTTKASS  277

Query  483  K-----REASSNKN----TTPNLAVIPSLLTAR  412
                  ++  S +     T+ N+ VIP LL  R
Sbjct  278  SSSSSGKDGRSGRTIAVPTSKNMDVIPPLLAVR  310



>ref|XP_009383397.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Musa acuminata 
subsp. malaccensis]
Length=481

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 69/120 (58%), Gaps = 7/120 (6%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSV----HHRTSGASGQDCIKERVRCGGIFSGFMI  673
            +RISTGFGDC LRRVES RE KPK   V    H    G   +  IKERV+CGG+F G  +
Sbjct  314  DRISTGFGDCALRRVESHREAKPKSKIVLHLDHDNGDGQRRRPRIKERVKCGGLFRGLGM  373

Query  672  TssssssssssylvsSEENVNGNGRPSMASVGHHH---HQLAHGRSRSWGWAFASPMRAF  502
             SS+   SS++      ++ +     + A+ G          HGR+RSWGWA ASP+RAF
Sbjct  374  MSSAYWLSSAAAADDDYDSSSRTSATTPAASGSTAVRGRSSPHGRTRSWGWALASPVRAF  433



>emb|CDY08027.1| BnaC03g34960D [Brassica napus]
Length=291

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 74/141 (52%), Gaps = 33/141 (23%)
 Frame = -2

Query  834  ISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFSGFMITsssss  655
             S+G GDC LRR ESQRE    + +      G    D + E V+CGGIF GFMI + SS+
Sbjct  183  FSSGLGDCALRRTESQREHTKVISN-----GGCEAADGMSEMVKCGGIFGGFMIMTPSSA  237

Query  654  sssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTSTGKRE  475
            +S                  + ++V HHH      RS +WGW  ASPMRA T T  G   
Sbjct  238  TS------------------TSSTVNHHHKHKMANRS-AWGW--ASPMRAKT-THRG---  272

Query  474  ASSNKNTTPNLAVIPSLLTAR  412
               +KNTTPNL  IPSL+T +
Sbjct  273  ---HKNTTPNLDSIPSLVTMK  290



>ref|XP_009390380.1| PREDICTED: uncharacterized transmembrane protein DDB_G0289901-like 
[Musa acuminata subsp. malaccensis]
Length=463

 Score = 75.9 bits (185),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/119 (42%), Positives = 62/119 (52%), Gaps = 6/119 (5%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--VGSVHHRTSGASGQDCIKERVRCGGIFSGFMITs  667
            ERISTGFGDCTLRRVES RE KPK  +   HH   G   +  ++ERV C     G     
Sbjct  295  ERISTGFGDCTLRRVESHREAKPKAVLNLEHHDNEGEQLRPTVRERVSC----GGLFGGF  350

Query  666  sssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKTS  490
               SS       ++++  + + R   A+          GR+RSWGWA ASPMRAF   S
Sbjct  351  GMMSSFYWLSAATADDGFDDSSRIPAATRPTAAAAQGGGRTRSWGWALASPMRAFKPYS  409



>ref|XP_009404206.1| PREDICTED: uncharacterized protein DDB_G0271670-like [Musa acuminata 
subsp. malaccensis]
Length=465

 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 81/143 (57%), Gaps = 17/143 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKV----GSVHHRTSGASGQDCIKERVRCGGIFSGFMI  673
            ERISTGFGDC+LRRVESQRE KPK+    G  +H   G   +  +KERV+C G+F G M 
Sbjct  303  ERISTGFGDCSLRRVESQREAKPKIVLHLGHDYH--DGEQKRPRMKERVKCRGLF-GLM-  358

Query  672  TssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT  493
                  S++     +++++ + + R S A+        A GR+RSWG +FASPMRAF   
Sbjct  359  ------SANWLSAAAADDDFDSSSRISAATPAASATTAARGRTRSWGLSFASPMRAFRPH  412

Query  492  STGKREASSNKN---TTPNLAVI  433
            ST  +   +  N     P+  +I
Sbjct  413  STSSKSLYAIDNAASAAPSTNII  435



>ref|XP_010937132.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010937140.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X3 [Elaeis guineensis]
Length=476

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 4/151 (3%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGA--SGQDCIKERVRC-GGIFSGFMIT  670
            ERISTGFGDCTLRRVES RE KP++        G     Q   KERV+C G      MI+
Sbjct  315  ERISTGFGDCTLRRVESHREAKPRMSLHVDDVDGEVDEQQRRFKERVKCGGFFGGFGMIS  374

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLA-HGRSRSWGWAFASPMRAFTKT  493
            SSSSS    +        ++     +  +          H RS +W WAFASPMRA    
Sbjct  375  SSSSSYWLPADDFDDSRRISSAAAAAHGAAARGGGGGTPHSRSWAWAWAFASPMRALRPA  434

Query  492  STGKREASSNKNTTPNLAVIPSLLTARG*VN  400
            ++  R + + KN      VI ++  + G +N
Sbjct  435  ASSSRPSYAMKNGATATNVITAINASNGIIN  465



>ref|XP_010937122.1| PREDICTED: uncharacterized protein DDB_G0271670-like isoform 
X1 [Elaeis guineensis]
Length=486

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 56/151 (37%), Positives = 74/151 (49%), Gaps = 4/151 (3%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGA--SGQDCIKERVRC-GGIFSGFMIT  670
            ERISTGFGDCTLRRVES RE KP++        G     Q   KERV+C G      MI+
Sbjct  325  ERISTGFGDCTLRRVESHREAKPRMSLHVDDVDGEVDEQQRRFKERVKCGGFFGGFGMIS  384

Query  669  ssssssssssylvsSEENVNGNGRPSMASVGHHHHQLA-HGRSRSWGWAFASPMRAFTKT  493
            SSSSS    +        ++     +  +          H RS +W WAFASPMRA    
Sbjct  385  SSSSSYWLPADDFDDSRRISSAAAAAHGAAARGGGGGTPHSRSWAWAWAFASPMRALRPA  444

Query  492  STGKREASSNKNTTPNLAVIPSLLTARG*VN  400
            ++  R + + KN      VI ++  + G +N
Sbjct  445  ASSSRPSYAMKNGATATNVITAINASNGIIN  475



>ref|NP_001052710.1| Os04g0405500 [Oryza sativa Japonica Group]
 dbj|BAF14624.1| Os04g0405500, partial [Oryza sativa Japonica Group]
Length=299

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 62/127 (49%), Gaps = 22/127 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--VGSVHH----RTSGASGQDCIKE-----RVRCGG  694
            ER+STGFGDC LRRVES RE KPK   G++ H     ++  +G D   E     R++C G
Sbjct  152  ERLSTGFGDCALRRVESHREPKPKSSAGALAHLGGNHSAAGNGDDDEYESTQQHRIKCAG  211

Query  693  IFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASP  514
             F G      ++   +SS    S  +      PS  + G   H       RSW WA ASP
Sbjct  212  FFGGL----GAAPPPTSSSYWLSAADGATAAAPSARTHGARSH-------RSWAWALASP  260

Query  513  MRAFTKT  493
            MRA   T
Sbjct  261  MRALRPT  267



>emb|CAE04879.1| OSJNBa0042I15.1 [Oryza sativa Japonica Group]
 emb|CAH66531.1| H0502B11.11 [Oryza sativa Indica Group]
 gb|EAY93997.1| hypothetical protein OsI_15774 [Oryza sativa Indica Group]
 gb|EAZ30640.1| hypothetical protein OsJ_14692 [Oryza sativa Japonica Group]
Length=395

 Score = 64.3 bits (155),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 62/127 (49%), Gaps = 22/127 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--VGSVHH----RTSGASGQDCIKE-----RVRCGG  694
            ER+STGFGDC LRRVES RE KPK   G++ H     ++  +G D   E     R++C G
Sbjct  248  ERLSTGFGDCALRRVESHREPKPKSSAGALAHLGGNHSAAGNGDDDEYESTQQHRIKCAG  307

Query  693  IFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASP  514
             F G      ++   +SS    S  +      PS  + G   H       RSW WA ASP
Sbjct  308  FFGGL----GAAPPPTSSSYWLSAADGATAAAPSARTHGARSH-------RSWAWALASP  356

Query  513  MRAFTKT  493
            MRA   T
Sbjct  357  MRALRPT  363



>emb|CAE05374.1| OJ000315_02.19 [Oryza sativa Japonica Group]
Length=568

 Score = 63.5 bits (153),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 62/127 (49%), Gaps = 22/127 (17%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--VGSVHHR----TSGASGQDCIKE-----RVRCGG  694
            ER+STGFGDC LRRVES RE KPK   G++ H     ++  +G D   E     R++C G
Sbjct  248  ERLSTGFGDCALRRVESHREPKPKSSAGALAHLGGNHSAAGNGDDDEYESTQQHRIKCAG  307

Query  693  IFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASP  514
             F G      ++   +SS    S  +      PS  + G   H       RSW WA ASP
Sbjct  308  FFGGL----GAAPPPTSSSYWLSAADGATAAAPSARTHGARSH-------RSWAWALASP  356

Query  513  MRAFTKT  493
            MRA   T
Sbjct  357  MRALRPT  363



>ref|XP_006596719.1| PREDICTED: uncharacterized protein LOC100788701 [Glycine max]
Length=250

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 41/67 (61%), Gaps = 16/67 (24%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRT----SGASGQD------CIKERVRCGGI  691
            +RIST FGDCTLR VESQ EGKPK      RT    S  S  D      C+KERV  G +
Sbjct  122  KRISTRFGDCTLRSVESQHEGKPK------RTGGGSSAVSNDDEHHHHHCMKERVTYGRL  175

Query  690  FSGFMIT  670
            FSGFM+T
Sbjct  176  FSGFMMT  182



>dbj|BAJ99583.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 58/134 (43%), Gaps = 39/134 (29%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK------VGSVHHRTSGASGQDCIKE-RVRCGGIFSG  682
            ER+STGFGDC LRRVES RE KPK      +G  H    G    +  ++ R++C G F G
Sbjct  243  ERLSTGFGDCALRRVESHREPKPKGSALGHLGGAHDAGDGDEDYEYTQQHRIKCAGFFGG  302

Query  681  FMITssssssssssylvsSEENVNGNGRPSMASV--------GHHHHQLAHGRS-RSWGW  529
                                    G   P+ +S              +++  RS R W W
Sbjct  303  I-----------------------GAAPPASSSYWLSAPSGGSGGSTRVSGTRSHRGWAW  339

Query  528  AFASPMRAFTKTST  487
            A ASPMRA   TS+
Sbjct  340  ALASPMRALRPTSS  353



>ref|XP_003581177.1| PREDICTED: forkhead box protein C1-like [Brachypodium distachyon]
Length=392

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 49/126 (39%), Positives = 61/126 (48%), Gaps = 19/126 (15%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGAS-------GQDCIKERVRCGGIFSG  682
            ER+STGFGDC LRRVES RE KPK    HH     +        +   + R++C G F G
Sbjct  241  ERLSTGFGDCALRRVESHREPKPKGALGHHLGGAGAGDGDEDYDEYARQHRIKCAGFFGG  300

Query  681  FMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAF  502
                +SSS   S++   S   +  G+  P     G   H       RSW WA ASPMRA 
Sbjct  301  AAPPASSSYWLSAANGGSGSGSGGGSRVP-----GARSH-------RSWAWALASPMRAL  348

Query  501  TKTSTG  484
              TS+ 
Sbjct  349  RPTSSA  354



>ref|XP_006844776.1| hypothetical protein AMTR_s00016p00259280 [Amborella trichopoda]
 gb|ERN06451.1| hypothetical protein AMTR_s00016p00259280 [Amborella trichopoda]
Length=263

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 75/140 (54%), Gaps = 29/140 (21%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK--------VGSVHHRTSGASGQDCIKERVRCGGIFS  685
            E++STGF DCTLRRVESQRE K             V H +   S +  IK+RVRCGG   
Sbjct  123  EKLSTGFVDCTLRRVESQREAKQPHNYCNNNNNKIVLHGSREHSEE--IKDRVRCGG---  177

Query  684  GFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRA  505
              +      SSSSSS    S+E++N NG  +  S         H RS+SWGWAFASP+RA
Sbjct  178  --LFGGFGGSSSSSSSYWISDEHLN-NGSSNRIS------GPPHSRSKSWGWAFASPIRA  228

Query  504  FTKTSTGKREASSNKNTTPN  445
            F       R +SS+    PN
Sbjct  229  F-------RPSSSSATKLPN  241



>gb|EPS66912.1| hypothetical protein M569_07867 [Genlisea aurea]
Length=395

 Score = 59.7 bits (143),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 77/151 (51%), Gaps = 22/151 (15%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQD-----CIKERVRCGGIFSGFM  676
            ER+S GFGDC LRRVES REGK      HH  +G    D      IK+R++C  IFSG  
Sbjct  255  ERLSNGFGDCALRRVESHREGK------HHHKNGQQQHDGSSSISIKDRIKCSRIFSGSS  308

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFT-  499
             +SSS   +SS        +     R S++     + + +   S SW W  ASPMRAF+ 
Sbjct  309  SSSSSYWVASSV------HDSASASRKSVSMGSISNGRSSSRSSSSWSWVLASPMRAFSK  362

Query  498  ----KTSTGKREASSNKNTTPNLAVIPSLLT  418
                         SS KN+TP L+ IPSLLT
Sbjct  363  PAATAKKEAAAAPSSTKNSTPTLSAIPSLLT  393



>ref|NP_001145361.1| uncharacterized protein LOC100278697 [Zea mays]
 gb|ACG47012.1| hypothetical protein [Zea mays]
Length=459

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 62/128 (48%), Gaps = 32/128 (25%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK------VGSVHHRTSGASGQDCI---------KERV  706
            ER+S GFGDCTLRRVES RE KP       +GS+H   +  +  D           + R+
Sbjct  297  ERLSNGFGDCTLRRVESHREPKPHRMRGGGLGSLHGAGADDADADDEDDDDDVYQHQHRI  356

Query  705  RCGGIFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWA  526
            +C G F G         +SSS +L ++E   +   R    S G  HH       RSW WA
Sbjct  357  KCAGFFGGL------GPASSSYWLSAAEAGASVTKR----SSGRSHH-------RSWAWA  399

Query  525  FASPMRAF  502
             ASPMRA 
Sbjct  400  LASPMRAL  407



>emb|CBI22994.3| unnamed protein product [Vitis vinifera]
Length=387

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVH  754
            ERISTGFGDCTLRRVESQREGKPK    H
Sbjct  290  ERISTGFGDCTLRRVESQREGKPKSSGAH  318



>ref|XP_002453920.1| hypothetical protein SORBIDRAFT_04g021450 [Sorghum bicolor]
 gb|EES06896.1| hypothetical protein SORBIDRAFT_04g021450 [Sorghum bicolor]
Length=460

 Score = 53.9 bits (128),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 58/131 (44%), Gaps = 34/131 (26%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP-KVGSVHHRTSGASGQDCI----------------KE  712
            ER+S GFGDCTLRRVES RE KP K+        G                       + 
Sbjct  296  ERLSNGFGDCTLRRVESHREPKPHKMRGGGGGGGGLRHLGGAGADDDDDEEEDDVYEHQH  355

Query  711  RVRCGGIFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRS-RSW  535
            R++C G F+G    SSS   S++                  ASVG    + + GRS RSW
Sbjct  356  RIKCAGFFAGLGPASSSYWLSAAEG----------------ASVGSGSTKRSAGRSHRSW  399

Query  534  GWAFASPMRAF  502
             WA ASPMRA 
Sbjct  400  AWALASPMRAL  410



>ref|XP_004952618.1| PREDICTED: putative protein TPRXL-like [Setaria italica]
Length=461

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 58/129 (45%), Gaps = 30/129 (23%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP--------KVGSVHHRTSGASGQDCI--------KER  709
            ER+S GFGDCTLRRVES RE KP          G       GAS  D          + R
Sbjct  292  ERLSNGFGDCTLRRVESHREPKPHKMRGGGGGGGGGLGHRGGASADDDDDEDDEYEHQHR  351

Query  708  VRCGGIFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGW  529
            ++C G F G          +SSSY +S+ E V G         G   H       RSW W
Sbjct  352  IKCAGFFGGL-------GPASSSYWLSAAEGVAGGVSSGTRKSGGRSH-------RSWAW  397

Query  528  AFASPMRAF  502
            A ASPMRAF
Sbjct  398  ALASPMRAF  406



>emb|CDY34922.1| BnaA01g32530D [Brassica napus]
Length=51

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = -2

Query  543  RSWGWAFASPMRAFT---KTSTGKREASSNKNTTPNLAVIPSLLTARG  409
            RSWGWAFASPMRA T   +  T    ++++KNT+PNL  +PSL+  + 
Sbjct  4    RSWGWAFASPMRAKTNSHRDRTITESSTTDKNTSPNLDSVPSLVAMKS  51



>gb|EPS63060.1| hypothetical protein M569_11727, partial [Genlisea aurea]
Length=220

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 32/52 (62%), Gaps = 13/52 (25%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIKERVRCGGIFS  685
            ERISTGFGDCTLRR ESQRE  P       R   A       ERV+CGG+FS
Sbjct  165  ERISTGFGDCTLRRAESQRENAPP------RPKHA-------ERVKCGGLFS  203



>gb|EAY86101.1| hypothetical protein OsI_07471 [Oryza sativa Indica Group]
Length=442

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/122 (39%), Positives = 57/122 (47%), Gaps = 23/122 (19%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP-KVGSVHHRTSGASGQDCI-------KERVRCGGIFS  685
            ERIS GFGDCTLRRVESQRE KP K+ ++ H   G +  D         + R++C G F 
Sbjct  285  ERISNGFGDCTLRRVESQREPKPNKMRALGHLGGGGADDDDDDDDVYQHQHRIKCAGFFG  344

Query  684  GFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGW-AFASPMR  508
            G   T S   S++     +              S G  H        RSW W A ASPMR
Sbjct  345  GMGPTPSYWLSAAEGAATAGGVGGARK------SGGRSH--------RSWAWTALASPMR  390

Query  507  AF  502
            A 
Sbjct  391  AL  392



>gb|AGT16018.1| hypothetical protein SHCRBa_144_K17_F_320 [Saccharum hybrid cultivar 
R570]
Length=383

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 61/124 (49%), Gaps = 15/124 (12%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGS--------VHHRTSGASGQDCIKERVRCGGIFS  685
            ER+STGFGDC LRRVES RE KP   +        +         QD    R++C G F 
Sbjct  252  ERLSTGFGDCALRRVESHREPKPNKAAAGALAGRHLGGGGGEEHEQDHQHHRIKCAGFFG  311

Query  684  GFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRA  505
            G  + +++++ SSS +L + +      G  +  + G   H       RSW WA ASPMRA
Sbjct  312  GGGLGAAAAAPSSSYWLSAPDGGSGAGGGSARGTSGSRSH-------RSWAWALASPMRA  364

Query  504  FTKT  493
               T
Sbjct  365  LRPT  368



>ref|XP_004975525.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Setaria 
italica]
Length=376

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 54/121 (45%), Gaps = 13/121 (11%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPK-VGSVHH----RTSGASGQDCIKERVRCGGIFSGFM  676
            ER+STGFGDC LRRVES RE KPK  G++ H                 R++C G F G +
Sbjct  249  ERLSTGFGDCALRRVESHREPKPKAAGALGHLGGAHGDDGDHDHDQHHRIKCAGFFGGGL  308

Query  675  ITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTK  496
              +   SSS               G  +  +    H        RSWGWA ASPMRA   
Sbjct  309  GAAPPPSSSYWLSAPDGASGGGAGGGSTRGTGTRSH--------RSWGWALASPMRALRP  360

Query  495  T  493
            T
Sbjct  361  T  361



>ref|NP_001146008.1| hypothetical protein [Zea mays]
 gb|ACL53030.1| unknown [Zea mays]
 tpg|DAA37980.1| TPA: hypothetical protein ZEAMMB73_945733 [Zea mays]
Length=366

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 52/117 (44%), Gaps = 11/117 (9%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKPKVGSVHHRTSGASGQDCIK-ERVRCGGIFSGFMITss  664
            ER+STGFGDC LRRVES RE KPK    H        QD  +  R++C G F G +  ++
Sbjct  245  ERLSTGFGDCALRRVESHREPKPKAALGHLGGGEEHEQDQDQHHRIKCAGFFGGGLGAAA  304

Query  663  ssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGWAFASPMRAFTKT  493
              SSS                     S  H          RSW WA ASPMRA   T
Sbjct  305  PPSSSYWLSAPDGASASASGSARGSGSRSH----------RSWAWALASPMRALRPT  351



>ref|NP_001047000.1| Os02g0526700 [Oryza sativa Japonica Group]
 dbj|BAD25406.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF08914.1| Os02g0526700 [Oryza sativa Japonica Group]
Length=445

 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 55/125 (44%), Gaps = 26/125 (21%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP-KVGSVHHRTSGASGQDCI----------KERVRCGG  694
            ERIS GFGDCTLRRVESQRE KP K+ ++ H   G  G              + R++C G
Sbjct  285  ERISNGFGDCTLRRVESQREPKPNKMRALGHLGGGGGGGADDDDDDDDVYQHQHRIKCAG  344

Query  693  IFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGW-AFAS  517
             F G   T S                ++     + A       +L     RSW W A AS
Sbjct  345  FFGGMGPTPSYW--------------LSAAEGAATAGGVGGARKLGGRSHRSWAWTALAS  390

Query  516  PMRAF  502
            PMRA 
Sbjct  391  PMRAL  395



>gb|EAZ23278.1| hypothetical protein OsJ_06973 [Oryza sativa Japonica Group]
Length=404

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 55/125 (44%), Gaps = 26/125 (21%)
 Frame = -2

Query  840  ERISTGFGDCTLRRVESQREGKP-KVGSVHHRTSGASGQDCI----------KERVRCGG  694
            ERIS GFGDCTLRRVESQRE KP K+ ++ H   G  G              + R++C G
Sbjct  244  ERISNGFGDCTLRRVESQREPKPNKMRALGHLGGGGGGGADDDDDDDDVYQHQHRIKCAG  303

Query  693  IFSGFMITssssssssssylvsSEENVNGNGRPSMASVGHHHHQLAHGRSRSWGW-AFAS  517
             F G   T S                ++     + A       +L     RSW W A AS
Sbjct  304  FFGGMGPTPSYW--------------LSAAEGAATAGGVGGARKLGGRSHRSWAWTALAS  349

Query  516  PMRAF  502
            PMRA 
Sbjct  350  PMRAL  354



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1627375116822