BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c69375_g1_i1 len=125 path=[1:0-124]

Length=125
                                                                      Score     E

ref|XP_010685296.1|  PREDICTED: subtilisin-like protease              56.2    1e-07   
emb|CDP13953.1|  unnamed protein product                              54.7    2e-07   
emb|CDP12292.1|  unnamed protein product                              55.1    2e-07   
ref|XP_006342910.1|  PREDICTED: subtilisin-like protease-like         55.8    2e-07   
emb|CDO97802.1|  unnamed protein product                              55.5    2e-07   
ref|XP_010273831.1|  PREDICTED: subtilisin-like protease              55.5    2e-07   
emb|CDP15554.1|  unnamed protein product                              55.5    3e-07   
ref|XP_002534008.1|  Xylem serine proteinase 1 precursor, putative    54.7    4e-07   Ricinus communis
ref|XP_003632775.1|  PREDICTED: subtilisin-like protease              54.7    4e-07   
ref|XP_004235537.1|  PREDICTED: subtilisin-like protease              54.7    5e-07   
ref|XP_009357945.1|  PREDICTED: subtilisin-like protease              54.3    6e-07   
ref|XP_009357900.1|  PREDICTED: subtilisin-like protease isoform X2   54.3    6e-07   
ref|XP_009357899.1|  PREDICTED: subtilisin-like protease isoform X1   54.3    6e-07   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease              54.3    7e-07   
gb|EYU21279.1|  hypothetical protein MIMGU_mgv1a023973mg              53.9    7e-07   
ref|XP_003553808.1|  PREDICTED: subtilisin-like protease-like         53.9    9e-07   
ref|XP_010552189.1|  PREDICTED: subtilisin-like protease              53.9    1e-06   
ref|XP_009628999.1|  PREDICTED: subtilisin-like protease              53.5    1e-06   
gb|KFK38761.1|  hypothetical protein AALP_AA3G157200                  53.1    2e-06   
ref|XP_002272769.1|  PREDICTED: subtilisin-like protease              53.1    2e-06   Vitis vinifera
ref|XP_010686124.1|  PREDICTED: subtilisin-like protease              53.1    2e-06   
ref|XP_009146389.1|  PREDICTED: subtilisin-like protease              52.8    2e-06   
ref|XP_010487224.1|  PREDICTED: subtilisin-like protease              52.8    2e-06   
ref|XP_010465317.1|  PREDICTED: subtilisin-like protease isoform X1   52.8    2e-06   
emb|CDX98438.1|  BnaC05g39370D                                        52.8    2e-06   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease              52.8    2e-06   
gb|KFK38784.1|  hypothetical protein AALP_AA3G160100                  52.8    2e-06   
gb|AAM60964.1|  subtilisin-like serine protease                       52.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566483.1|  Subtilase family protein                            52.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease         52.4    3e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841           52.4    3e-06   
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g           52.4    3e-06   
ref|XP_006298945.1|  hypothetical protein CARUB_v10015070mg           52.4    3e-06   
emb|CDX97560.1|  BnaA05g25190D                                        52.4    3e-06   
ref|XP_006407103.1|  hypothetical protein EUTSA_v10020111mg           52.4    3e-06   
gb|KDP40686.1|  hypothetical protein JCGZ_24685                       52.4    3e-06   
ref|XP_004141706.1|  PREDICTED: subtilisin-like protease-like         52.4    3e-06   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease              52.4    3e-06   
ref|XP_003520892.1|  PREDICTED: subtilisin-like protease-like         52.0    4e-06   
ref|XP_011036534.1|  PREDICTED: subtilisin-like protease              52.0    4e-06   
emb|CDX75758.1|  BnaC03g38410D                                        51.2    4e-06   
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease              52.0    4e-06   
ref|XP_010089708.1|  Subtilisin-like protease                         51.6    5e-06   
ref|XP_009146419.1|  PREDICTED: subtilisin-like protease              51.6    5e-06   
emb|CDY52259.1|  BnaC05g52030D                                        51.6    6e-06   
ref|XP_009135372.1|  PREDICTED: subtilisin-like protease              51.6    6e-06   
emb|CDX82491.1|  BnaA03g33300D                                        51.6    6e-06   
ref|XP_007139067.1|  hypothetical protein PHAVU_009G262100g           51.6    6e-06   
ref|XP_007024751.1|  Subtilase family protein isoform 2               51.2    6e-06   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease              51.2    6e-06   
emb|CDP15538.1|  unnamed protein product                              51.2    6e-06   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg              51.2    7e-06   
ref|XP_002304129.2|  hypothetical protein POPTR_0003s06530g           51.2    7e-06   Populus trichocarpa [western balsam poplar]
gb|EPS64737.1|  hypothetical protein M569_10042                       51.2    7e-06   
ref|XP_007024651.1|  Subtilase family protein                         51.2    7e-06   
ref|XP_006407132.1|  hypothetical protein EUTSA_v10022348mg           51.6    7e-06   
ref|XP_004510560.1|  PREDICTED: subtilisin-like protease-like         51.2    7e-06   
ref|XP_007024750.1|  Subtilase family protein isoform 1               51.2    7e-06   
gb|KCW56428.1|  hypothetical protein EUGRSUZ_I02156                   51.2    8e-06   
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180        50.8    9e-06   
gb|KDP40640.1|  hypothetical protein JCGZ_24639                       50.8    1e-05   
emb|CDY33251.1|  BnaC01g37240D                                        50.4    1e-05   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease              50.4    1e-05   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease              50.4    1e-05   
ref|XP_006369092.1|  subtilase family protein                         50.4    1e-05   
ref|XP_008462294.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  50.1    2e-05   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like         50.1    2e-05   
gb|KCW53526.1|  hypothetical protein EUGRSUZ_J02805                   50.1    2e-05   
ref|XP_002885009.1|  subtilase family protein                         50.1    2e-05   
ref|XP_010033727.1|  PREDICTED: subtilisin-like protease              49.7    2e-05   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like         49.7    3e-05   
ref|XP_004155899.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  49.7    3e-05   
ref|XP_010685295.1|  PREDICTED: subtilisin-like protease              49.7    3e-05   
ref|XP_009117189.1|  PREDICTED: subtilisin-like protease              49.3    3e-05   
emb|CDY39093.1|  BnaA01g29630D                                        49.3    3e-05   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870        49.3    3e-05   
gb|AFW61874.1|  putative subtilase family protein                     49.3    3e-05   
gb|EPS74243.1|  subtilase family protein                              49.3    3e-05   
ref|XP_002444456.1|  hypothetical protein SORBIDRAFT_07g022170        49.3    4e-05   Sorghum bicolor [broomcorn]
emb|CDX97540.1|  BnaA05g25390D                                        48.1    4e-05   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease              49.3    4e-05   
ref|XP_009788688.1|  PREDICTED: subtilisin-like protease              48.9    4e-05   
ref|XP_010654422.1|  PREDICTED: subtilisin-like protease              48.9    4e-05   
emb|CAN75239.1|  hypothetical protein VITISV_014205                   48.9    5e-05   Vitis vinifera
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease              48.9    5e-05   
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like         48.9    5e-05   
ref|XP_007217030.1|  hypothetical protein PRUPE_ppa001661mg           48.9    5e-05   
ref|XP_010111996.1|  Subtilisin-like protease                         48.9    5e-05   
ref|XP_008228336.1|  PREDICTED: subtilisin-like protease              48.5    6e-05   
emb|CDP20511.1|  unnamed protein product                              48.5    6e-05   
gb|KDO68023.1|  hypothetical protein CISIN_1g004010mg                 48.5    6e-05   
gb|KDO68024.1|  hypothetical protein CISIN_1g004010mg                 48.5    6e-05   
ref|XP_006486757.1|  PREDICTED: subtilisin-like protease-like         48.5    6e-05   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease              48.5    6e-05   
dbj|BAE98521.1|  putative subtilisin-like serine proteinase           48.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566473.2|  Subtilase family protein                            48.5    6e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006422621.1|  hypothetical protein CICLE_v10027859mg           48.5    6e-05   
ref|XP_002534468.1|  Cucumisin precursor, putative                    47.8    8e-05   Ricinus communis
ref|XP_009389184.1|  PREDICTED: subtilisin-like protease              48.1    9e-05   
ref|NP_001061952.1|  Os08g0452100                                     48.1    9e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease              48.1    9e-05   
gb|EYU21314.1|  hypothetical protein MIMGU_mgv1a001662mg              48.1    9e-05   
ref|XP_011036446.1|  PREDICTED: subtilisin-like protease              48.1    1e-04   
gb|EEC83669.1|  hypothetical protein OsI_29445                        47.8    1e-04   Oryza sativa Indica Group [Indian rice]
gb|ACN40199.1|  unknown                                               48.1    1e-04   Picea sitchensis
gb|EPS74284.1|  hypothetical protein M569_00464                       47.8    1e-04   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_011072593.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_006369129.1|  subtilase family protein                         47.8    1e-04   
ref|XP_008228179.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_004973598.1|  PREDICTED: subtilisin-like protease-like         47.8    1e-04   
ref|XP_002533857.1|  Cucumisin precursor, putative                    47.8    1e-04   Ricinus communis
ref|XP_008784364.1|  PREDICTED: subtilisin-like protease              47.8    1e-04   
ref|XP_007217156.1|  hypothetical protein PRUPE_ppa001739mg           47.8    1e-04   
ref|XP_003627424.1|  Subtilisin-like serine protease                  47.4    2e-04   
ref|XP_010932346.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  47.4    2e-04   
ref|XP_006357406.1|  PREDICTED: subtilisin-like protease-like         47.4    2e-04   
ref|XP_006342924.1|  PREDICTED: subtilisin-like protease-like         47.0    2e-04   
ref|XP_010920139.1|  PREDICTED: subtilisin-like protease              47.0    2e-04   
ref|XP_011046353.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  47.0    2e-04   
ref|XP_010917391.1|  PREDICTED: subtilisin-like protease              47.0    2e-04   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g           47.0    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008236002.1|  PREDICTED: subtilisin-like protease              47.0    2e-04   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like         47.0    2e-04   
ref|XP_007199629.1|  hypothetical protein PRUPE_ppa001754mg           47.0    2e-04   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g           47.0    2e-04   Populus trichocarpa [western balsam poplar]
ref|XP_003540860.1|  PREDICTED: subtilisin-like protease-like         46.6    3e-04   
ref|XP_006583162.1|  PREDICTED: subtilisin-like protease-like iso...  46.6    3e-04   
ref|XP_010090327.1|  Subtilisin-like protease                         46.6    3e-04   
ref|XP_010246830.1|  PREDICTED: subtilisin-like protease              46.6    3e-04   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g           46.6    3e-04   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease              46.6    3e-04   
ref|XP_010542387.1|  PREDICTED: subtilisin-like protease              46.6    3e-04   
gb|KDP29636.1|  hypothetical protein JCGZ_18798                       46.6    3e-04   
ref|XP_008797372.1|  PREDICTED: subtilisin-like protease              46.2    4e-04   
ref|XP_004505786.1|  PREDICTED: subtilisin-like protease-like         46.2    4e-04   
gb|KEH30495.1|  subtilisin-like serine protease                       46.2    4e-04   
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like         46.2    4e-04   
gb|ABR18065.1|  unknown                                               46.2    4e-04   Picea sitchensis
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  46.2    4e-04   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like         46.2    4e-04   
ref|XP_008391410.1|  PREDICTED: subtilisin-like protease              45.8    5e-04   
ref|XP_006296785.1|  hypothetical protein CARUB_v10016006mg           45.8    5e-04   
ref|XP_010489238.1|  PREDICTED: subtilisin-like protease              45.8    5e-04   
ref|XP_010432360.1|  PREDICTED: subtilisin-like protease              45.8    5e-04   
ref|XP_010467397.1|  PREDICTED: subtilisin-like protease isoform X2   45.8    5e-04   
ref|XP_010467396.1|  PREDICTED: subtilisin-like protease isoform X1   45.8    5e-04   
emb|CDY40653.1|  BnaA03g53100D                                        45.8    5e-04   
ref|NP_567972.1|  subtilisin-like serine protease 2                   45.8    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010437545.1|  PREDICTED: subtilisin-like protease              45.8    5e-04   
ref|XP_006283144.1|  hypothetical protein CARUB_v10004172mg           45.8    5e-04   
ref|XP_010447014.1|  PREDICTED: subtilisin-like protease              45.8    5e-04   
ref|XP_002867098.1|  hypothetical protein ARALYDRAFT_491159           45.8    6e-04   
ref|XP_009138332.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
emb|CDX72509.1|  BnaC07g45310D                                        45.8    6e-04   
ref|NP_001049524.2|  Os03g0242900                                     45.8    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009410252.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease              45.8    6e-04   
gb|ABR17987.1|  unknown                                               45.4    7e-04   Picea sitchensis
ref|XP_010933329.1|  PREDICTED: subtilisin-like protease              45.4    7e-04   
ref|XP_010487192.1|  PREDICTED: subtilisin-like protease              45.4    7e-04   
ref|XP_010530892.1|  PREDICTED: subtilisin-like protease              45.4    7e-04   
ref|XP_002886065.1|  predicted protein                                45.4    7e-04   
ref|XP_010501588.1|  PREDICTED: subtilisin-like protease              45.4    7e-04   
ref|XP_006841679.1|  hypothetical protein AMTR_s00003p00245290        45.4    7e-04   
dbj|BAJ94518.1|  predicted protein                                    45.4    8e-04   
ref|XP_011088593.1|  PREDICTED: subtilisin-like protease              45.4    8e-04   
dbj|BAJ91233.1|  predicted protein                                    45.4    8e-04   
ref|XP_004231026.1|  PREDICTED: subtilisin-like protease              45.4    8e-04   
ref|XP_006359680.1|  PREDICTED: subtilisin-like protease-like         45.4    8e-04   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                45.1    8e-04   
ref|XP_006465903.1|  PREDICTED: subtilisin-like protease-like         45.1    8e-04   
ref|XP_006649720.1|  PREDICTED: subtilisin-like protease-like         45.1    8e-04   
ref|XP_010526897.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...  45.1    8e-04   
ref|XP_006298979.1|  hypothetical protein CARUB_v10015104mg           45.1    8e-04   
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease              45.1    8e-04   
gb|ABR16566.1|  unknown                                               45.1    9e-04   Picea sitchensis
ref|XP_009593174.1|  PREDICTED: subtilisin-like protease              45.1    9e-04   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease              45.1    9e-04   
ref|XP_006426684.1|  hypothetical protein CICLE_v10024936mg           45.1    0.001   
ref|XP_009789823.1|  PREDICTED: subtilisin-like protease              45.1    0.001   



>ref|XP_010685296.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=767

 Score = 56.2 bits (134),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+S++PDQ+HQ+QTTRT QFLGLS+   SGLW  SD G+DI
Sbjct  97   VLSIIPDQVHQVQTTRTTQFLGLSEG--SGLWPQSDQGSDI  135



>emb|CDP13953.1| unnamed protein product [Coffea canephora]
Length=273

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++V+P+Q+ QL TTR+PQFLGL  SD +GL + SD+G+D+
Sbjct  113  ILAVIPEQVRQLHTTRSPQFLGLKTSDSAGLLKESDFGSDL  153



>emb|CDP12292.1| unnamed protein product [Coffea canephora]
Length=312

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++V+P+Q+ QL TTR+PQFLGL  SD +GL + SD+G+D+
Sbjct  114  ILAVIPEQVRQLHTTRSPQFLGLKTSDSAGLLKESDFGSDL  154



>ref|XP_006342910.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=785

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+P+Q+  +QTTR+P+FLGLS +D +GL + SDYG+D+
Sbjct  104  VLAVIPEQVRHVQTTRSPEFLGLSSADSAGLLKESDYGSDL  144



>emb|CDO97802.1| unnamed protein product [Coffea canephora]
Length=792

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++V+P+Q+ QL TTR+PQFLGL  SD +GL + SD+G+D+
Sbjct  110  ILAVIPEQVRQLHTTRSPQFLGLKTSDSAGLLKESDFGSDL  150



>ref|XP_010273831.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=786

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+P+Q+ QL TTR+PQFLGL   D SGL + SD+G+D+
Sbjct  105  VLAVIPEQVRQLHTTRSPQFLGLKTKDSSGLLKESDFGSDL  145



>emb|CDP15554.1| unnamed protein product [Coffea canephora]
Length=797

 Score = 55.5 bits (132),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 36/42 (86%), Gaps = 1/42 (2%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSD-PSGLWRISDYGADI  2
            V++VLPD++ QLQTTR+PQFLG+S SD P+GL + SD G++I
Sbjct  111  VLAVLPDKLRQLQTTRSPQFLGISSSDNPAGLLKDSDSGSNI  152



>ref|XP_002534008.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF28379.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=706

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+V+P+++ QLQTTR+P+FLGL  +D +GL + SD+G+D+
Sbjct  93   VIAVIPERVRQLQTTRSPEFLGLKTTDSAGLLKESDFGSDL  133



>ref|XP_003632775.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=787

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++ V+P+Q+ +LQTTR+PQFLGL  +D +GL + SD+G+D+
Sbjct  106  IVGVIPEQVRELQTTRSPQFLGLKTTDSAGLLKESDFGSDL  146



>ref|XP_004235537.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=782

 Score = 54.7 bits (130),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+ V+P+Q+  +QTTR+P+FLGL+ +D +GL + SDYG+D+
Sbjct  101  VLGVIPEQVRHIQTTRSPEFLGLTSADSAGLLKESDYGSDL  141



>ref|XP_009357945.1| PREDICTED: subtilisin-like protease [Pyrus x bretschneideri]
Length=691

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++P+Q+  + TTR+P+FLGL  +DP+GL + SD+G+D+
Sbjct  107  VISLIPEQVRHIHTTRSPEFLGLRTTDPAGLLKESDFGSDL  147



>ref|XP_009357900.1| PREDICTED: subtilisin-like protease isoform X2 [Pyrus x bretschneideri]
Length=797

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++P+Q+  + TTR+P+FLGL  +DP+GL + SD+G+D+
Sbjct  108  VISLIPEQVRHIHTTRSPEFLGLRTTDPAGLLKESDFGSDL  148



>ref|XP_009357899.1| PREDICTED: subtilisin-like protease isoform X1 [Pyrus x bretschneideri]
Length=797

 Score = 54.3 bits (129),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++P+Q+  + TTR+P+FLGL  +DP+GL + SD+G+D+
Sbjct  108  VISLIPEQVRHIHTTRSPEFLGLRTTDPAGLLKESDFGSDL  148



>ref|XP_008392153.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=815

 Score = 54.3 bits (129),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++P+Q+  + TTR+P+FLGL  +DP+GL + SD+G+D+
Sbjct  134  VISLIPEQVRHIHTTRSPEFLGLRTTDPAGLLKESDFGSDL  174



>gb|EYU21279.1| hypothetical protein MIMGU_mgv1a023973mg, partial [Erythranthe 
guttata]
Length=520

 Score = 53.9 bits (128),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +I+V+P+Q+ QL TTR+P+FLGL   D +GL + SD+G+D+
Sbjct  96   IIAVIPEQVRQLHTTRSPEFLGLKTGDSAGLLKESDFGSDL  136



>ref|XP_003553808.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=768

 Score = 53.9 bits (128),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++P+Q+ QL TTR+PQFLGL+ +D +GL + +D+G+D+
Sbjct  90   VISLIPEQLRQLHTTRSPQFLGLNTADRAGLLKETDFGSDL  130



>ref|XP_010552189.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=790

 Score = 53.9 bits (128),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++P+Q+ +L TTR+P+FLGL+ +D +GL + SD+G+D+
Sbjct  106  VISIIPEQVRRLHTTRSPEFLGLTTTDKAGLLKESDFGSDL  146



>ref|XP_009628999.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=788

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+P+Q+  +QTTR+P+FLGL+ +D +GL + SD+G+D+
Sbjct  107  VLAVIPEQVRHVQTTRSPEFLGLTSTDSAGLLKESDFGSDL  147



>gb|KFK38761.1| hypothetical protein AALP_AA3G157200 [Arabis alpina]
Length=775

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG SD+  SGLW  SDYG D+
Sbjct  95   VISVIPDQAREIHTTHTPAFLGFSDN--SGLWSNSDYGEDV  133



>ref|XP_002272769.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=771

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SVLPD+ HQ+ TTRTP FLGL+D+   GLW  SDY  D+
Sbjct  94   VLSVLPDRAHQIHTTRTPHFLGLADN--YGLWPNSDYADDV  132



>ref|XP_010686124.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=771

 Score = 53.1 bits (126),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+S++PDQ+HQ+QTTRT QFL LS+   SGLW  SD G++I
Sbjct  97   VLSIIPDQVHQVQTTRTTQFLDLSEG--SGLWPQSDQGSEI  135



>ref|XP_009146389.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=770

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  86   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  126



>ref|XP_010487224.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=777

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  93   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  133



>ref|XP_010465317.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
 ref|XP_010465318.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=777

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  93   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  133



>emb|CDX98438.1| BnaC05g39370D [Brassica napus]
Length=770

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  86   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  126



>ref|XP_010501809.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=775

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  91   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  131



>gb|KFK38784.1| hypothetical protein AALP_AA3G160100 [Arabis alpina]
Length=773

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  89   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  129



>gb|AAM60964.1| subtilisin-like serine protease [Arabidopsis thaliana]
Length=775

 Score = 52.8 bits (125),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  91   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  131



>ref|NP_566483.1| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB01030.1| subtilisin proteinase-like protein [Arabidopsis thaliana]
 gb|AEE75493.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  91   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  131



>gb|AAK25839.1|AF360129_1 putative subtilisin serine protease [Arabidopsis thaliana]
Length=775

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  91   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  131



>ref|XP_002885025.1| hypothetical protein ARALYDRAFT_478841 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61284.1| hypothetical protein ARALYDRAFT_478841 [Arabidopsis lyrata subsp. 
lyrata]
Length=776

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  92   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  132



>ref|XP_007135377.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
 gb|ESW07371.1| hypothetical protein PHAVU_010G124400g [Phaseolus vulgaris]
Length=781

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+++P+Q+ QL TTR+PQFLGL+ +D +GL   +D+G+D+
Sbjct  94   VITLVPEQVRQLHTTRSPQFLGLTTADRTGLLHETDFGSDL  134



>ref|XP_006298945.1| hypothetical protein CARUB_v10015070mg [Capsella rubella]
 gb|EOA31843.1| hypothetical protein CARUB_v10015070mg [Capsella rubella]
Length=776

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  92   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  132



>emb|CDX97560.1| BnaA05g25190D [Brassica napus]
Length=770

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  86   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  126



>ref|XP_006407103.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
 gb|ESQ48556.1| hypothetical protein EUTSA_v10020111mg [Eutrema salsugineum]
Length=779

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  L TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  94   VISVIPEQVRHLHTTRSPEFLGLRSTDKAGLLEESDFGSDL  134



>gb|KDP40686.1| hypothetical protein JCGZ_24685 [Jatropha curcas]
Length=773

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PDQI QL TTRTP FLGL++   SGLW    YG D+
Sbjct  97   VLSVIPDQIRQLHTTRTPHFLGLTNG--SGLWLNGAYGEDV  135



>ref|XP_004141706.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004155913.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45480.1| Subtilase family protein [Cucumis sativus]
Length=771

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +ISV+PDQI QL TTRTP FLGL+D+   GLW  ++Y  D+
Sbjct  99   IISVIPDQIRQLHTTRTPHFLGLADN--LGLWADTNYADDV  137



>ref|XP_011072681.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=792

 Score = 52.4 bits (124),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +I+V+P+Q+ Q+ TTR+P+FLGL   D +GL + SD+G+D+
Sbjct  111  IIAVIPEQVRQVHTTRSPEFLGLKTGDNAGLLKESDFGSDL  151



>ref|XP_003520892.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+++P+Q+ QL TTR+PQFLGL+ +D  GL + +D+G+D+
Sbjct  91   VITLIPEQVRQLHTTRSPQFLGLNTADRDGLLKETDFGSDL  131



>ref|XP_011036534.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++V+P+++  L TTR+PQFLGL  SD +GL + SD+G+D+
Sbjct  90   IVAVIPERVRHLHTTRSPQFLGLRTSDSAGLLKESDFGSDL  130



>emb|CDX75758.1| BnaC03g38410D [Brassica napus]
Length=305

 Score = 51.2 bits (121),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  + TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  88   VISVIPEQVRHVHTTRSPEFLGLRSTDKAGLLEESDFGSDL  128



>ref|XP_010261833.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=783

 Score = 52.0 bits (123),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+S+LPD+ HQL TTRTP FLGL+D+   GLW  SDY  D+
Sbjct  99   VLSILPDRPHQLHTTRTPHFLGLADT--FGLWPNSDYADDV  137



>ref|XP_010089708.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38258.1| Subtilisin-like protease [Morus notabilis]
Length=787

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+P+Q+ +L TTR+P+FLGL  +D +GL + SD+G+D+
Sbjct  106  VLAVIPEQVRRLHTTRSPEFLGLKKTDSAGLLKESDFGSDL  146



>ref|XP_009146419.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=776

 Score = 51.6 bits (122),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  97   VISVIPDQAREIHTTHTPSFLGFSDN--SGLWSNSNYGEDV  135



>emb|CDY52259.1| BnaC05g52030D [Brassica napus]
Length=736

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  97   VISVIPDQAREIHTTHTPAFLGFSDN--SGLWSNSNYGEDV  135



>ref|XP_009135372.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=767

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  + TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  89   VISVIPEQVRHVHTTRSPEFLGLRSTDKAGLLEESDFGSDL  129



>emb|CDX82491.1| BnaA03g33300D [Brassica napus]
Length=767

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+P+Q+  + TTR+P+FLGL  +D +GL   SD+G+D+
Sbjct  89   VISVIPEQVRHVHTTRSPEFLGLRSTDKAGLLEESDFGSDL  129



>ref|XP_007139067.1| hypothetical protein PHAVU_009G262100g [Phaseolus vulgaris]
 gb|ESW11061.1| hypothetical protein PHAVU_009G262100g [Phaseolus vulgaris]
Length=771

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+++P+Q+ QL TTR+P FLGL+ +D +GL + +D+G+D+
Sbjct  91   VIALIPEQVRQLHTTRSPHFLGLNTADRAGLLKETDFGSDL  131



>ref|XP_007024751.1| Subtilase family protein isoform 2, partial [Theobroma cacao]
 gb|EOY27373.1| Subtilase family protein isoform 2, partial [Theobroma cacao]
Length=543

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +I+V+P+Q+  +QTTR+P FLGL  +D +GL + SD+G+D+
Sbjct  82   IIAVIPEQVRHVQTTRSPLFLGLKTTDSAGLLKESDFGSDL  122



>ref|XP_010029506.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=780

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++++P+Q+ +L TTR+PQFLGL   D +GL + SD+G+D+
Sbjct  99   VLALIPEQVRRLHTTRSPQFLGLKTGDSAGLLKESDFGSDL  139



>emb|CDP15538.1| unnamed protein product [Coffea canephora]
Length=764

 Score = 51.2 bits (121),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 33/41 (80%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++SV+PD I QLQTTR+ QFLGL+DS  SG+W  ++YG DI
Sbjct  100  ILSVIPDSISQLQTTRSLQFLGLADS--SGIWPNTNYGEDI  138



>gb|EYU46755.1| hypothetical protein MIMGU_mgv1a001548mg [Erythranthe guttata]
Length=798

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISVLPD++ QL  TR+P FLGLS  +P+GL   SD G+++
Sbjct  113  VISVLPDRLRQLHITRSPYFLGLSSDNPTGLMSESDSGSNV  153



>ref|XP_002304129.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
 gb|EEE79108.2| hypothetical protein POPTR_0003s06530g [Populus trichocarpa]
Length=774

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYG  11
            ++SV+PDQI QL TT TP FLGLS+S  SGLW  S YG
Sbjct  98   ILSVIPDQIRQLHTTHTPAFLGLSES--SGLWENSGYG  133



>gb|EPS64737.1| hypothetical protein M569_10042, partial [Genlisea aurea]
Length=572

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+P+Q+ +L TTR+P+FLGL   D +GL + SD+G+D+
Sbjct  92   VLAVIPEQVRRLHTTRSPEFLGLKTGDNAGLLKESDFGSDL  132



>ref|XP_007024651.1| Subtilase family protein [Theobroma cacao]
 gb|EOY27273.1| Subtilase family protein [Theobroma cacao]
Length=767

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 2/38 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYG  11
            ++SV+PDQ+ Q+ TTRTPQFLGLSD    GLW+ S YG
Sbjct  92   ILSVIPDQVRQIHTTRTPQFLGLSDG--VGLWQNSYYG  127



>ref|XP_006407132.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
 gb|ESQ48585.1| hypothetical protein EUTSA_v10022348mg, partial [Eutrema salsugineum]
Length=1359

 Score = 51.6 bits (122),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  701  VISVIPDQAREIHTTHTPTFLGFSDN--SGLWSNSNYGEDV  739



>ref|XP_004510560.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=789

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+V+P+QI  L TTR+PQFLGL  +D +GL   +D+G+D+
Sbjct  101  VITVIPEQIRTLHTTRSPQFLGLKTADRAGLLHETDFGSDL  141



>ref|XP_007024750.1| Subtilase family protein isoform 1 [Theobroma cacao]
 gb|EOY27372.1| Subtilase family protein isoform 1 [Theobroma cacao]
Length=772

 Score = 51.2 bits (121),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +I+V+P+Q+  +QTTR+P FLGL  +D +GL + SD+G+D+
Sbjct  91   IIAVIPEQVRHVQTTRSPLFLGLKTTDSAGLLKESDFGSDL  131



>gb|KCW56428.1| hypothetical protein EUGRSUZ_I02156 [Eucalyptus grandis]
Length=897

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++++P+Q+ +L TTR+PQFLGL   D +GL + SD+G+D+
Sbjct  216  VLALIPEQVRRLHTTRSPQFLGLKTGDSAGLLKESDFGSDL  256



>ref|XP_006828664.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
 gb|ERM96080.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
Length=799

 Score = 50.8 bits (120),  Expect = 9e-06, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++SV+PD+  QLQTTR+PQFLGL   D  GL   SD+G+++
Sbjct  119  ILSVIPDKARQLQTTRSPQFLGLKRKDTMGLLAESDFGSNL  159



>gb|KDP40640.1| hypothetical protein JCGZ_24639 [Jatropha curcas]
Length=578

 Score = 50.8 bits (120),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+P+++  +QTTR+P+FLGL  +D +GL + SD+G+D+
Sbjct  101  VLAVIPERVRHVQTTRSPEFLGLKTTDSAGLLKESDFGSDL  141



>emb|CDY33251.1| BnaC01g37240D [Brassica napus]
Length=775

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  98   VISVIPDQAREIHTTHTPAFLGFSDN--SGLWSNSNYGEDV  136



>ref|XP_009613479.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISVLPD++  L TT TP FLGL+DS   GLW  SDY  D+
Sbjct  96   VISVLPDEVRHLHTTHTPTFLGLADS--FGLWPNSDYADDV  134



>ref|XP_009758461.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISVLPD++  L TT TP FLGL+DS   GLW  SDY  D+
Sbjct  96   VISVLPDEVRHLHTTHTPTFLGLADS--FGLWPNSDYADDV  134



>ref|XP_006369092.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65661.1| subtilase family protein [Populus trichocarpa]
Length=773

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 19/41 (46%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +I+V+P+++  + TTR+PQFLGL  +D +GL + SD+G+D+
Sbjct  90   IIAVIPERVRHVHTTRSPQFLGLKTTDGAGLLKESDFGSDL  130



>ref|XP_008462294.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=770

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +ISV+PD+I QL TTRTP FLGL+D+   GLW  ++Y  D+
Sbjct  99   IISVIPDRIRQLHTTRTPHFLGLADN--LGLWADTNYADDV  137



>ref|XP_004305780.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=770

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++++P+Q+ +L TTR+P+FLGL  +D +GL + SD+G+D+
Sbjct  88   ILALIPEQVRRLHTTRSPEFLGLRSTDTAGLLKESDFGSDL  128



>gb|KCW53526.1| hypothetical protein EUGRSUZ_J02805 [Eucalyptus grandis]
Length=778

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD+I  L TTRTP+FLGL++S   GLW  SDY  DI
Sbjct  106  VLSVVPDRIRHLHTTRTPRFLGLTES--FGLWPNSDYADDI  144



>ref|XP_002885009.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61268.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=777

 Score = 50.1 bits (118),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG S +  SGLW  SDYG D+
Sbjct  98   VISVIPDQAREIHTTHTPDFLGFSQN--SGLWGNSDYGEDV  136



>ref|XP_010033727.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
Length=829

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD+I  L TTRTP+FLGL++S   GLW  SDY  DI
Sbjct  157  VLSVVPDRIRHLHTTRTPRFLGLTES--FGLWPNSDYADDI  195



>ref|XP_004141727.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN45447.1| hypothetical protein Csa_7G448090 [Cucumis sativus]
Length=777

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V S++P+Q+    TTR+P+FLGL  SD +GL + SD+G+D+
Sbjct  95   VASIIPEQVRHPHTTRSPEFLGLKTSDSAGLLKESDFGSDL  135



>ref|XP_004155899.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=776

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V S++P+Q+    TTR+P+FLGL  SD +GL + SD+G+D+
Sbjct  94   VASIIPEQVRHPHTTRSPEFLGLKTSDSAGLLKESDFGSDL  134



>ref|XP_010685295.1| PREDICTED: subtilisin-like protease [Beta vulgaris subsp. vulgaris]
Length=808

 Score = 49.7 bits (117),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD+ HQ+ TT TP FLGL D   SGLW  S Y +D+
Sbjct  123  VLSVIPDRAHQIHTTHTPNFLGLHDG--SGLWPNSHYASDV  161



>ref|XP_009117189.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=775

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++PDQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  98   VISLIPDQAREIHTTHTPAFLGFSDN--SGLWSNSNYGEDV  136



>emb|CDY39093.1| BnaA01g29630D [Brassica napus]
Length=775

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++PDQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  98   VISLIPDQAREIHTTHTPAFLGFSDN--SGLWSNSNYGEDV  136



>ref|XP_006856781.1| hypothetical protein AMTR_s00055p00107870 [Amborella trichopoda]
 gb|ERN18248.1| hypothetical protein AMTR_s00055p00107870 [Amborella trichopoda]
Length=757

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 24/40 (60%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGAD  5
            ++ VL DQ  QL TTR+PQFLGLS+    GLW  SDYG+D
Sbjct  84   ILVVLEDQPRQLHTTRSPQFLGLSNR--RGLWSDSDYGSD  121



>gb|AFW61874.1| putative subtilase family protein [Zea mays]
Length=802

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V +V+P+++ QL TTR+P+FLGL  S PS L   SD+GAD+
Sbjct  110  VAAVVPERVRQLATTRSPRFLGLLSSPPSALLAESDFGADL  150



>gb|EPS74243.1| subtilase family protein, partial [Genlisea aurea]
Length=751

 Score = 49.3 bits (116),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++PD+   L TTRTPQFLGL+DS   GLW  SDY  D+
Sbjct  73   VISLVPDERRVLHTTRTPQFLGLADS--FGLWPNSDYADDV  111



>ref|XP_002444456.1| hypothetical protein SORBIDRAFT_07g022170 [Sorghum bicolor]
 gb|EES13951.1| hypothetical protein SORBIDRAFT_07g022170 [Sorghum bicolor]
Length=805

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V +V+P+++ QL TTR+P+FLGL  S PS L   SD+GAD+
Sbjct  104  VAAVVPERVRQLATTRSPRFLGLLSSPPSALLADSDFGADL  144



>emb|CDX97540.1| BnaA05g25390D [Brassica napus]
Length=261

 Score = 48.1 bits (113),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+ DQ  ++ TT TP FLG SD+  SGLW  S+YG D+
Sbjct  97   VISVITDQAREIHTTHTPAFLGFSDN--SGLWSNSNYGEDV  135



>ref|XP_008462247.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=777

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            + S++P+Q+    TTR+P+FLGL  SD +GL + SD+G+D+
Sbjct  95   IASIIPEQVRHPHTTRSPEFLGLKTSDSAGLLKESDFGSDL  135



>ref|XP_009788688.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=776

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD+  QL TT TP FLGL+DS   GLW  SDY  D+
Sbjct  98   VVSVIPDRARQLHTTHTPTFLGLADS--FGLWPNSDYADDV  136



>ref|XP_010654422.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=788

 Score = 48.9 bits (115),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV P+Q+H++ TT TP FLGL++   SGLW  SDY  D+
Sbjct  115  VLSVWPEQVHEVHTTHTPHFLGLAND--SGLWPNSDYADDV  153



>emb|CAN75239.1| hypothetical protein VITISV_014205 [Vitis vinifera]
Length=768

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV P+Q+H++ TT TP FLGL++   SGLW  SDY  D+
Sbjct  95   VLSVWPEQVHEVHTTHTPHFLGLAND--SGLWPNSDYADDV  133



>ref|XP_011048615.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +I+V+P+++  + TTR+PQFLGL  +D  GL + SD+G+D+
Sbjct  90   IIAVIPERVRHVHTTRSPQFLGLKTTDGVGLLKESDFGSDL  130



>ref|XP_003547873.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=776

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+++P+Q+  L TTR+P+FLGL+ +D +GL   +D+G+D+
Sbjct  93   VITLIPEQLRSLHTTRSPEFLGLTTADRTGLLHETDFGSDL  133



>ref|XP_007217030.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
 gb|EMJ18229.1| hypothetical protein PRUPE_ppa001661mg [Prunus persica]
Length=784

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSG-LWRISDYGADI  2
            V +++P+Q+ QL TTR+P+FLGL  +D +G L R SD+G+D+
Sbjct  105  VTAIIPEQVRQLHTTRSPEFLGLRSTDAAGTLLRESDFGSDL  146



>ref|XP_010111996.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC32307.1| Subtilisin-like protease [Morus notabilis]
Length=826

 Score = 48.9 bits (115),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PDQ  QL TTRT QFLGL+D+   GLW  SDY  D+
Sbjct  149  VVSVVPDQPRQLHTTRTYQFLGLTDN--FGLWPNSDYAEDV  187



>ref|XP_008228336.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=764

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 33/42 (79%), Gaps = 1/42 (2%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSG-LWRISDYGADI  2
            V +++P+Q+ QL TTR+P+FLGL  +D +G L R SD+G+D+
Sbjct  109  VTAIIPEQVRQLHTTRSPEFLGLRSTDAAGTLLRESDFGSDL  150



>emb|CDP20511.1| unnamed protein product [Coffea canephora]
Length=777

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD + QL TTRTP FLGL D    G+W  SDY  DI
Sbjct  99   VLSVVPDSVRQLHTTRTPHFLGLDDF--FGIWPNSDYAEDI  137



>gb|KDO68023.1| hypothetical protein CISIN_1g004010mg [Citrus sinensis]
Length=764

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  97   VLAVIEDQRRQLHTTRSPQFLGLRNQQ--GLWSESDYGSDV  135



>gb|KDO68024.1| hypothetical protein CISIN_1g004010mg [Citrus sinensis]
Length=625

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  97   VLAVIEDQRRQLHTTRSPQFLGLRNQQ--GLWSESDYGSDV  135



>ref|XP_006486757.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=779

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  97   VLAVIEDQRRQLHTTRSPQFLGLRNQQ--GLWSESDYGSDV  135



>ref|XP_011001974.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   VLAVIEDQRKQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  131



>dbj|BAE98521.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
Length=777

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG S +  SGLW  S+YG D+
Sbjct  98   VISVIPDQAREIHTTHTPAFLGFSQN--SGLWSNSNYGEDV  136



>ref|NP_566473.2| Subtilase family protein [Arabidopsis thaliana]
 dbj|BAB02339.1| cucumisin-like serine protease; subtilisin-like protease [Arabidopsis 
thaliana]
 gb|AAS49055.1| At3g14067 [Arabidopsis thaliana]
 gb|AAS76762.1| At3g14067 [Arabidopsis thaliana]
 dbj|BAF00939.1| putative subtilisin-like serine proteinase [Arabidopsis thaliana]
 gb|AEE75461.1| Subtilase family protein [Arabidopsis thaliana]
Length=777

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ  ++ TT TP FLG S +  SGLW  S+YG D+
Sbjct  98   VISVIPDQAREIHTTHTPAFLGFSQN--SGLWSNSNYGEDV  136



>ref|XP_006422621.1| hypothetical protein CICLE_v10027859mg [Citrus clementina]
 gb|ESR35861.1| hypothetical protein CICLE_v10027859mg [Citrus clementina]
 gb|KDO68022.1| hypothetical protein CISIN_1g004010mg [Citrus sinensis]
Length=779

 Score = 48.5 bits (114),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  97   VLAVIEDQRRQLHTTRSPQFLGLRNQQ--GLWSESDYGSDV  135



>ref|XP_002534468.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF27917.1| Cucumisin precursor, putative [Ricinus communis]
Length=369

 Score = 47.8 bits (112),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQI  L TTRTP FL LS    SGLW    YG D+
Sbjct  104  VISVIPDQIRHLHTTRTPHFLDLSSV--SGLWPNGAYGEDV  142



>ref|XP_009389184.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=818

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 31/41 (76%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D++ +L TTR+PQFLGL + D  GLW  SDYG+D+
Sbjct  139  VLAVFEDRLRRLDTTRSPQFLGLRNQD--GLWSDSDYGSDV  177



>ref|NP_001061952.1| Os08g0452100 [Oryza sativa Japonica Group]
 dbj|BAD08783.1| putative subtilisin-like proteinase [Oryza sativa Japonica Group]
 dbj|BAF23866.1| Os08g0452100 [Oryza sativa Japonica Group]
 gb|EAZ42947.1| hypothetical protein OsJ_27537 [Oryza sativa Japonica Group]
Length=796

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V +V+P+++ QL TTR+P+FLGL  S PS L   SD+G+D+
Sbjct  106  VAAVVPERVRQLATTRSPRFLGLLSSPPSALLADSDFGSDL  146



>ref|XP_011079622.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=793

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++VLPD++  L  TR+P FLGLS  +P+GL   SD G+++
Sbjct  112  VLAVLPDRLRHLHITRSPHFLGLSSGNPAGLLSESDSGSNV  152



>gb|EYU21314.1| hypothetical protein MIMGU_mgv1a001662mg [Erythranthe guttata]
Length=777

 Score = 48.1 bits (113),  Expect = 9e-05, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD +  L TT TP+FLGL+DS   GLW  SDY  D+
Sbjct  96   VVSVIPDAVRYLHTTHTPKFLGLADS--FGLWPNSDYADDV  134



>ref|XP_011036446.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=774

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 2/38 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYG  11
            ++SV+PDQI Q+ TT TP FLGLS+S   GLW  S YG
Sbjct  98   ILSVIPDQIRQIHTTHTPAFLGLSES--FGLWENSGYG  133



>gb|EEC83669.1| hypothetical protein OsI_29445 [Oryza sativa Indica Group]
Length=705

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V +V+P+++ QL TTR+P+FLGL  S PS L   SD+G+D+
Sbjct  15   VAAVVPERVRQLATTRSPRFLGLLSSPPSALLADSDFGSDL  55



>gb|ACN40199.1| unknown [Picea sitchensis]
Length=766

 Score = 48.1 bits (113),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -2

Query  121  ISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++V PD +++L TTRTP FLGLS S   GLW +S Y  DI
Sbjct  112  LAVFPDSVYRLHTTRTPDFLGLSSS--HGLWPLSHYADDI  149



>gb|EPS74284.1| hypothetical protein M569_00464, partial [Genlisea aurea]
Length=755

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++ LPD+  QL TTR+PQF+GL      GLW  SDYG+D+
Sbjct  81   VLAALPDRRRQLHTTRSPQFIGLRTQ--RGLWSESDYGSDV  119



>ref|XP_011001975.1| PREDICTED: subtilisin-like protease [Populus euphratica]
Length=773

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  DQ  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   VLAVFEDQRQQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  131



>ref|XP_011072593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=774

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PD +    TTRTP+FLGL+DS   GLW  +DY  D+
Sbjct  95   VISVIPDAVRHPHTTRTPKFLGLADS--FGLWPNADYADDV  133



>ref|XP_006369129.1| subtilase family protein [Populus trichocarpa]
 gb|ERP65698.1| subtilase family protein [Populus trichocarpa]
Length=772

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 2/38 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYG  11
            ++SV+PDQI QL TT TP FLGLS+S  S LW+ S YG
Sbjct  96   ILSVIPDQIRQLHTTHTPTFLGLSES--SRLWQNSGYG  131



>ref|XP_008228179.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=810

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV PDQ  QL TT TP FLGL+DS   GLW  SDY  D+
Sbjct  136  VLSVTPDQPRQLHTTHTPNFLGLADS--FGLWPNSDYADDV  174



>ref|XP_004973598.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=811

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V +V+P+++ +L TTR+P+FLGL  S PS L   SD+GAD+
Sbjct  117  VAAVVPERVRRLATTRSPRFLGLLSSPPSALLADSDFGADL  157



>ref|XP_002533857.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF28521.1| Cucumisin precursor, putative [Ricinus communis]
Length=753

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++VL D   QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  72   ILTVLEDHRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  110



>ref|XP_008784364.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=798

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++VLP+Q+ +  TTR+P+FLGL  SD SGL   +D+G+D+
Sbjct  109  VVAVLPEQVRRPLTTRSPRFLGLLSSDRSGLLAETDFGSDL  149



>ref|XP_007217156.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
 gb|EMJ18355.1| hypothetical protein PRUPE_ppa001739mg [Prunus persica]
Length=772

 Score = 47.8 bits (112),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV PDQ  QL TT TP FLGL+DS   GLW  SDY  D+
Sbjct  98   VLSVTPDQPRQLHTTHTPNFLGLADS--FGLWPNSDYADDV  136



>ref|XP_003627424.1| Subtilisin-like serine protease [Medicago truncatula]
 gb|AET01900.1| subtilisin-like serine protease [Medicago truncatula]
Length=782

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+++P+QI  L TTR+P+FLGL  +  +GL   +D+G+D+
Sbjct  94   VITIIPEQIRTLHTTRSPEFLGLKTAAKTGLLHETDFGSDL  134



>ref|XP_010932346.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Elaeis 
guineensis]
Length=804

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++VLP+Q+    TTR+P+FLGL  SD SGL   +D+G+D+
Sbjct  115  VVAVLPEQVRHPLTTRSPRFLGLLSSDRSGLLAETDFGSDL  155



>ref|XP_006357406.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=776

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PDQ+  L TT TP FL L+DS   GLW  SDY  D+
Sbjct  99   VISVIPDQVRYLHTTHTPTFLKLADS--FGLWPDSDYADDV  137



>ref|XP_006342924.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=767

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV+PD++ QL TT TP FLGL DS   G+W  SDY  ++
Sbjct  94   VVSVIPDRVRQLHTTHTPTFLGLEDS--FGIWPNSDYADNV  132



>ref|XP_010920139.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=785

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+V  D++ +L TTR+PQFLGL      GLW  SDYG+D+
Sbjct  105  VIAVFEDRLRRLHTTRSPQFLGLRTQ--VGLWSNSDYGSDV  143



>ref|XP_011046353.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Populus 
euphratica]
Length=777

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  S+YG+D+
Sbjct  97   VLAVIEDQRKQLHTTRSPQFLGLRNQ--RGLWSDSNYGSDV  135



>ref|XP_010917391.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=797

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++VLP+Q+ +  TTR+P FLGL  SD SGL   +D+G+D+
Sbjct  109  VVAVLPEQVRRPLTTRSPSFLGLLSSDRSGLLAETDFGSDL  149



>ref|XP_002313716.1| hypothetical protein POPTR_0009s13590g [Populus trichocarpa]
 gb|EEE87671.1| hypothetical protein POPTR_0009s13590g [Populus trichocarpa]
Length=773

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ  QL TTR+PQFLGL +    GLW  S+YG+D+
Sbjct  93   VLAVIEDQRKQLHTTRSPQFLGLRNQ--RGLWSDSNYGSDV  131



>ref|XP_008236002.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=768

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ   L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVIEDQRRHLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  128



>ref|XP_003538985.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=770

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  128



>ref|XP_007199629.1| hypothetical protein PRUPE_ppa001754mg [Prunus persica]
 gb|EMJ00828.1| hypothetical protein PRUPE_ppa001754mg [Prunus persica]
Length=770

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V+ DQ   L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  92   VLAVIEDQRRHLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  130



>ref|XP_002305511.2| hypothetical protein POPTR_0004s17960g [Populus trichocarpa]
 gb|EEE86022.2| hypothetical protein POPTR_0004s17960g [Populus trichocarpa]
Length=773

 Score = 47.0 bits (110),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   VLAVFEDKRQQLHTTRSPQFLGLRNQ--RGLWSDSDYGSDV  131



>ref|XP_003540860.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=773

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  131



>ref|XP_006583162.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=817

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+++LPDQI    TT TP+FLGL+DS   GLW  SDY  D+
Sbjct  137  VLALLPDQIRHPHTTHTPRFLGLADS--FGLWPNSDYADDV  175



>ref|XP_010090327.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB39297.1| Subtilisin-like protease [Morus notabilis]
Length=778

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  98   VLAVFEDKRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  136



>ref|XP_010246830.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=776

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   VLAVFEDRRRQLHTTRSPQFLGLRNQQ--GLWSESDYGSDV  131



>ref|XP_007131701.1| hypothetical protein PHAVU_011G034700g [Phaseolus vulgaris]
 gb|ESW03695.1| hypothetical protein PHAVU_011G034700g [Phaseolus vulgaris]
Length=775

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  95   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  133



>ref|XP_008457681.1| PREDICTED: subtilisin-like protease [Cucumis melo]
Length=771

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  91   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSDSDYGSDV  129



>ref|XP_010542387.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=781

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV+PD+IHQ+ TT TP+FLG S +    LW  SD G D+
Sbjct  101  VISVIPDRIHQIHTTHTPRFLGFSGN--FSLWSNSDDGEDV  139



>gb|KDP29636.1| hypothetical protein JCGZ_18798 [Jatropha curcas]
Length=774

 Score = 46.6 bits (109),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  91   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  129



>ref|XP_008797372.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=796

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V P+Q+ +  TTR+P+FLGL  SD SGL   +D+G+D+
Sbjct  109  VVAVFPEQVRRPLTTRSPRFLGLLSSDRSGLLAETDFGSDL  149



>ref|XP_004505786.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=776

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 29/40 (73%), Gaps = 2/40 (5%)
 Frame = -2

Query  121  ISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++VL D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  96   LAVLEDRRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  133



>gb|KEH30495.1| subtilisin-like serine protease [Medicago truncatula]
Length=773

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  92   ILAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSESDYGSDV  130



>ref|XP_003528733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=782

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 18/41 (44%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VI+++P+Q+    TTR+P+FLGL+ +D +GL   +D+G+D+
Sbjct  94   VITLIPEQLRSPHTTRSPEFLGLTTADRTGLLHETDFGSDL  134



>gb|ABR18065.1| unknown [Picea sitchensis]
Length=783

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 28/40 (70%), Gaps = 2/40 (5%)
 Frame = -2

Query  121  ISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++V PD ++++ TTRTP FLGLS S   GLW +S Y  DI
Sbjct  112  LAVFPDYVYRVHTTRTPDFLGLSSS--HGLWPLSHYADDI  149



>ref|XP_004158378.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease-like 
[Cucumis sativus]
Length=771

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  91   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSDSDYGSDV  129



>ref|XP_004147036.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN61925.1| hypothetical protein Csa_2G270180 [Cucumis sativus]
Length=771

 Score = 46.2 bits (108),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  91   VLAVFEDRRRQLHTTRSPQFLGLRNQ--RGLWSDSDYGSDV  129



>ref|XP_008391410.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=772

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V+SV PDQ  QL TT TP FLGL++S   GLW  SDY  D+
Sbjct  98   VLSVTPDQPRQLHTTHTPSFLGLAES--FGLWPNSDYADDV  136



>ref|XP_006296785.1| hypothetical protein CARUB_v10016006mg [Capsella rubella]
 gb|EOA29683.1| hypothetical protein CARUB_v10016006mg [Capsella rubella]
Length=765

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVFEDRRRELHTTRSPQFLGLRNQK--GLWSNSDYGSDV  128



>ref|XP_010489238.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=767

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  91   VLAVFEDRRRELHTTRSPQFLGLRNQK--GLWSNSDYGSDV  129



>ref|XP_010432360.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=768

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  91   VLAVFEDKRRELHTTRSPQFLGLQNQ--KGLWSESDYGSDV  129



>ref|XP_010467397.1| PREDICTED: subtilisin-like protease isoform X2 [Camelina sativa]
Length=769

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  89   VLAVFEDRRRELHTTRSPQFLGLRNQK--GLWSNSDYGSDV  127



>ref|XP_010467396.1| PREDICTED: subtilisin-like protease isoform X1 [Camelina sativa]
Length=765

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  89   VLAVFEDRRRELHTTRSPQFLGLRNQK--GLWSNSDYGSDV  127



>emb|CDY40653.1| BnaA03g53100D [Brassica napus]
Length=767

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVFEDRRRELHTTRSPQFLGLENQ--KGLWSDSDYGSDV  128



>ref|NP_567972.1| subtilisin-like serine protease 2 [Arabidopsis thaliana]
 emb|CAA17763.1| subtilisin proteinase-like [Arabidopsis thaliana]
 emb|CAB80215.1| subtilisin proteinase-like [Arabidopsis thaliana]
 gb|AAL67071.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAM19998.1| putative subtilisin serine proteinase [Arabidopsis thaliana]
 gb|AEE86443.1| subtilisin-like serine protease 2 [Arabidopsis thaliana]
Length=764

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  87   VLAVFEDRRRELHTTRSPQFLGLQNQ--KGLWSESDYGSDV  125



>ref|XP_010437545.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=767

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVFEDKRRELHTTRSPQFLGLQNQ--KGLWSESDYGSDV  128



>ref|XP_006283144.1| hypothetical protein CARUB_v10004172mg [Capsella rubella]
 gb|EOA16042.1| hypothetical protein CARUB_v10004172mg [Capsella rubella]
Length=790

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  113  VLAVFEDKRRELHTTRSPQFLGLQNQ--KGLWSESDYGSDV  151



>ref|XP_010447014.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score = 45.8 bits (107),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  109  VLAVFEDKRRELHTTRSPQFLGLQNQ--KGLWSESDYGSDV  147



>ref|XP_002867098.1| hypothetical protein ARALYDRAFT_491159 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43357.1| hypothetical protein ARALYDRAFT_491159 [Arabidopsis lyrata subsp. 
lyrata]
Length=764

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  87   VLAVFEDRRRELHTTRSPQFLGLQNQ--KGLWSESDYGSDV  125



>ref|XP_009138332.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=767

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVFEDRRRELHTTRSPQFLGLENQ--KGLWSDSDYGSDV  128



>emb|CDX72509.1| BnaC07g45310D [Brassica napus]
Length=757

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  90   VLAVFEDRRRELHTTRSPQFLGLENQ--KGLWSDSDYGSDV  128



>ref|NP_001049524.2| Os03g0242900 [Oryza sativa Japonica Group]
 gb|ABF94911.1| subtilisin proteinase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ26232.1| hypothetical protein OsJ_10100 [Oryza sativa Japonica Group]
 dbj|BAH01390.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF11438.2| Os03g0242900 [Oryza sativa Japonica Group]
Length=780

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++   DQ+  L TTR+PQFLGL      GLW ++DYG+D+
Sbjct  101  VLAAFEDQVRTLHTTRSPQFLGLRAR--LGLWSLADYGSDV  139



>ref|XP_009410252.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=790

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++VLP+ I    TTR+P+FLGL  SD +GL   SDYG+++
Sbjct  105  VLAVLPELIRHPDTTRSPEFLGLLSSDRTGLLAESDYGSEL  145



>ref|XP_008780995.1| PREDICTED: subtilisin-like protease [Phoenix dactylifera]
Length=783

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D++ +L TTR+PQFLGL      GLW  SDYG+D+
Sbjct  101  VLAVFEDRLRRLHTTRSPQFLGLRTQ--VGLWSDSDYGSDV  139



>gb|ABR17987.1| unknown [Picea sitchensis]
Length=772

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 2/40 (5%)
 Frame = -2

Query  121  ISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++V PD + +L TTRTP FLGL+  D  GLW  S YG D+
Sbjct  102  LAVFPDSLSRLHTTRTPDFLGLNSID--GLWPQSHYGEDV  139



>ref|XP_010933329.1| PREDICTED: subtilisin-like protease [Elaeis guineensis]
Length=781

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D++ +L TTR+PQFLGL      GLW  SDYG+D+
Sbjct  102  VLAVFEDRLRRLHTTRSPQFLGLRTQ--VGLWSDSDYGSDV  140



>ref|XP_010487192.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=786

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++PDQ  ++ TT TP FLG S +  SGLW  SD G D+
Sbjct  98   VISIIPDQAREIHTTHTPDFLGFSQN--SGLWSNSDDGEDV  136



>ref|XP_010530892.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=771

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  94   VLAVFEDRRRELHTTRSPQFLGLRNQ--KGLWSESDYGSDV  132



>ref|XP_002886065.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62324.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=765

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  89   VLAVFEDRRRELHTTRSPQFLGLRNQ--KGLWSNSDYGSDV  127



>ref|XP_010501588.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=788

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VIS++PDQ  ++ TT TP FLG S +  SGLW  SD G D+
Sbjct  99   VISIIPDQAREIHTTHTPDFLGFSQN--SGLWSNSDDGEDV  137



>ref|XP_006841679.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
 gb|ERN03354.1| hypothetical protein AMTR_s00003p00245290 [Amborella trichopoda]
Length=765

 Score = 45.4 bits (106),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++SV P++ + L TTRTP+FLGLS     GLW  SDY  D+
Sbjct  93   ILSVRPERTYSLHTTRTPEFLGLSKD--QGLWPNSDYAKDV  131



>dbj|BAJ94518.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++   D++ QL TTR+PQF+GL      GLW ++DYG+D+
Sbjct  101  VLASFEDRVRQLHTTRSPQFMGLRAR--LGLWSLADYGSDV  139



>ref|XP_011088593.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=791

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++   D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  111  VLAAFQDRRRQLHTTRSPQFLGLRNQ--QGLWSESDYGSDV  149



>dbj|BAJ91233.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=781

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++   D++ QL TTR+PQF+GL      GLW ++DYG+D+
Sbjct  101  VLASFEDRVRQLHTTRSPQFMGLRAR--LGLWSLADYGSDV  139



>ref|XP_004231026.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=772

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++   D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  92   ILATFEDRRRQLHTTRSPQFLGLRNQ--KGLWSESDYGSDV  130



>ref|XP_006359680.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=772

 Score = 45.4 bits (106),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++   D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  92   ILATFEDRRRQLHTTRSPQFLGLRNQ--KGLWSESDYGSDV  130



>ref|XP_007041871.1| Subtilisin-like serine protease 2 [Theobroma cacao]
 gb|EOX97702.1| Subtilisin-like serine protease 2 [Theobroma cacao]
Length=774

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   VLAVFEDRRRELHTTRSPQFLGLRNQ--HGLWSDSDYGSDV  131



>ref|XP_006465903.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=776

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++SV+PD+   L TTRTP FLGLSDS   G+W  S Y  D+
Sbjct  101  ILSVIPDRPRHLHTTRTPHFLGLSDS--FGIWPNSKYADDV  139



>ref|XP_006649720.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=783

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++   DQ+  L TTR+PQFLGL      GLW ++DYG+D+
Sbjct  104  VLAAFEDQVRTLHTTRSPQFLGLRAR--LGLWSLADYGSDV  142



>ref|XP_010526897.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Tarenaya 
hassleriana]
Length=758

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  95   VLAVFEDRRRELHTTRSPQFLGLRNQ--RGLWSESDYGSDV  133



>ref|XP_006298979.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
 gb|EOA31877.1| hypothetical protein CARUB_v10015104mg [Capsella rubella]
Length=784

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 27/41 (66%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            VISV PDQ  Q+ TT TP FLG S +  +GLW  SD G D+
Sbjct  104  VISVTPDQARQIHTTHTPAFLGFSQN--TGLWSNSDDGEDV  142



>ref|XP_010269647.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=800

 Score = 45.1 bits (105),  Expect = 8e-04, Method: Composition-based stats.
 Identities = 19/41 (46%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++ V PD+I  + TTR+PQFLGL ++   GL   SDYG+ +
Sbjct  108  ILGVYPDRIRHIHTTRSPQFLGLVENGTGGLLADSDYGSSV  148



>gb|ABR16566.1| unknown [Picea sitchensis]
Length=522

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 23/40 (58%), Positives = 26/40 (65%), Gaps = 2/40 (5%)
 Frame = -2

Query  121  ISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +SV  D  + L TTRTP FLGLS S   GLW +S YG DI
Sbjct  104  LSVFQDSTYGLHTTRTPDFLGLSSS--HGLWPLSRYGDDI  141



>ref|XP_009593174.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=774

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++   D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   ILAAFEDRRRQLHTTRSPQFLGLRNQ--KGLWSESDYGSDV  131



>ref|XP_010646965.1| PREDICTED: subtilisin-like protease [Vitis vinifera]
Length=774

 Score = 45.1 bits (105),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            V++V  D+  +L TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  92   VLAVFEDRRRELHTTRSPQFLGLRNQ--RGLWSESDYGSDV  130



>ref|XP_006426684.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
 gb|ESR39924.1| hypothetical protein CICLE_v10024936mg [Citrus clementina]
Length=776

 Score = 45.1 bits (105),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            ++SV+PD+   L TTRTP FLGLSDS   G+W  S Y  D+
Sbjct  101  ILSVIPDRPRHLHTTRTPHFLGLSDS--FGIWPNSKYADDV  139



>ref|XP_009789823.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=774

 Score = 45.1 bits (105),  Expect = 0.001, Method: Composition-based stats.
 Identities = 20/41 (49%), Positives = 28/41 (68%), Gaps = 2/41 (5%)
 Frame = -2

Query  124  VISVLPDQIHQLQTTRTPQFLGLSDSDPSGLWRISDYGADI  2
            +++   D+  QL TTR+PQFLGL +    GLW  SDYG+D+
Sbjct  93   ILATFEDRRRQLHTTRSPQFLGLRNQ--KGLWSESDYGSDV  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516678285084