BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6935_g1_i1 len=1667 path=[1:0-1666]

Length=1667
                                                                      Score     E

ref|XP_007013015.1|  Iq-domain 31                                       318   1e-98   
ref|XP_010267115.1|  PREDICTED: protein IQ-DOMAIN 14-like               310   1e-95   
gb|KDP33804.1|  hypothetical protein JCGZ_07375                         307   1e-94   
ref|XP_002514224.1|  conserved hypothetical protein                     303   5e-93   Ricinus communis
ref|XP_010656256.1|  PREDICTED: protein IQ-DOMAIN 14                    302   1e-92   
ref|XP_004288896.1|  PREDICTED: uncharacterized protein LOC101305601    291   4e-88   
ref|XP_011093642.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    290   5e-88   
ref|XP_010249482.1|  PREDICTED: protein IQ-DOMAIN 31-like               289   1e-87   
gb|KHG17476.1|  Protein IQ-DOMAIN 14 -like protein                      283   2e-85   
ref|XP_008450788.1|  PREDICTED: protein IQ-DOMAIN 14-like               282   4e-85   
ref|XP_004158419.1|  PREDICTED: uncharacterized protein LOC101226199    277   4e-83   
ref|XP_007204806.1|  hypothetical protein PRUPE_ppa025288mg             276   1e-82   
ref|XP_006451315.1|  hypothetical protein CICLE_v10008287mg             277   1e-82   
ref|XP_008242480.1|  PREDICTED: protein IQ-DOMAIN 14-like               276   1e-82   
ref|XP_009781989.1|  PREDICTED: uncharacterized protein LOC104230803    276   1e-82   
ref|XP_006475587.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    275   6e-82   
gb|KHG26933.1|  Protein IQ-DOMAIN 31 -like protein                      272   2e-81   
ref|XP_009604096.1|  PREDICTED: protein IQ-DOMAIN 14-like               270   2e-80   
ref|XP_004135807.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    265   1e-79   
gb|KHN14257.1|  Protein IQ-DOMAIN 31                                    267   3e-79   
ref|XP_006583555.1|  PREDICTED: protein IQ-DOMAIN 14-like               267   3e-79   
gb|KGN66184.1|  hypothetical protein Csa_1G575000                       265   3e-79   
emb|CDP03247.1|  unnamed protein product                                264   6e-78   
ref|XP_007160280.1|  hypothetical protein PHAVU_002G308100g             263   1e-77   
gb|KHN26986.1|  Protein IQ-DOMAIN 31                                    260   1e-76   
ref|XP_011080380.1|  PREDICTED: protein IQ-DOMAIN 14-like               259   2e-76   
ref|XP_006353577.1|  PREDICTED: protein IQ-DOMAIN 14-like               259   2e-76   
ref|XP_007152967.1|  hypothetical protein PHAVU_004G175300g             259   5e-76   
ref|XP_010688345.1|  PREDICTED: protein IQ-DOMAIN 14                    259   8e-76   
ref|XP_003517637.1|  PREDICTED: protein IQ-DOMAIN 14-like               256   4e-75   
ref|XP_004503494.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3    256   4e-75   
ref|XP_004503492.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    256   7e-75   
ref|XP_004503493.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    256   7e-75   
ref|XP_004251641.1|  PREDICTED: protein IQ-DOMAIN 14                    254   1e-74   
ref|XP_008342322.1|  PREDICTED: protein IQ-DOMAIN 14-like               253   5e-74   
emb|CDO97967.1|  unnamed protein product                                251   2e-73   
ref|XP_009352560.1|  PREDICTED: protein IQ-DOMAIN 14-like               251   3e-73   
ref|XP_010110878.1|  Protein IQ-DOMAIN 31                               249   2e-72   
ref|XP_003630704.1|  hypothetical protein MTR_8g102400                  249   2e-72   
ref|XP_011072442.1|  PREDICTED: protein IQ-DOMAIN 31-like               244   3e-71   
ref|XP_006584809.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    245   1e-70   
ref|XP_006356137.1|  PREDICTED: protein IQ-DOMAIN 14-like               243   2e-70   
ref|XP_007024326.1|  Iq-domain 14 isoform 1                             243   3e-70   
emb|CAN69979.1|  hypothetical protein VITISV_011284                     241   5e-70   Vitis vinifera
ref|XP_002515955.1|  conserved hypothetical protein                     241   9e-70   Ricinus communis
ref|XP_002277925.2|  PREDICTED: protein IQ-DOMAIN 14-like               241   1e-69   Vitis vinifera
ref|XP_009404542.1|  PREDICTED: uncharacterized protein LOC103987843    242   1e-69   
gb|KDP40852.1|  hypothetical protein JCGZ_24851                         241   2e-69   
ref|XP_010062543.1|  PREDICTED: uncharacterized protein LOC104449924    239   5e-69   
ref|XP_004241751.1|  PREDICTED: protein IQ-DOMAIN 14-like               239   5e-69   
gb|EYU27263.1|  hypothetical protein MIMGU_mgv1a007196mg                237   5e-68   
ref|XP_008794100.1|  PREDICTED: protein IQ-DOMAIN 14-like               236   1e-67   
ref|XP_010925518.1|  PREDICTED: protein IQ-DOMAIN 14-like               235   5e-67   
ref|XP_009777311.1|  PREDICTED: protein IQ-DOMAIN 31-like               234   7e-67   
ref|XP_009622656.1|  PREDICTED: protein IQ-DOMAIN 31-like               233   7e-67   
ref|XP_008798581.1|  PREDICTED: protein IQ-DOMAIN 14-like               232   3e-65   
gb|KHN16648.1|  Protein IQ-DOMAIN 31                                    227   7e-65   
ref|XP_010098153.1|  Protein IQ-DOMAIN 31                               223   5e-64   
ref|XP_011013968.1|  PREDICTED: protein IQ-DOMAIN 14-like               226   8e-64   
ref|XP_006465703.1|  PREDICTED: protein IQ-DOMAIN 14-like               225   1e-63   
ref|XP_007216908.1|  hypothetical protein PRUPE_ppa019001mg             224   4e-63   
ref|XP_006426860.1|  hypothetical protein CICLE_v10025716mg             223   6e-63   
gb|EYU21448.1|  hypothetical protein MIMGU_mgv1a007787mg                223   6e-63   
gb|KDO51826.1|  hypothetical protein CISIN_1g014980mg                   223   1e-62   
ref|XP_002299740.2|  hypothetical protein POPTR_0001s19140g             222   2e-62   Populus trichocarpa [western balsam poplar]
ref|XP_011000945.1|  PREDICTED: protein IQ-DOMAIN 14-like               221   3e-62   
ref|XP_002304223.2|  hypothetical protein POPTR_0003s04620g             221   4e-62   Populus trichocarpa [western balsam poplar]
ref|XP_006583044.1|  PREDICTED: protein IQ-DOMAIN 14-like               220   7e-62   
ref|XP_010665888.1|  PREDICTED: protein IQ-DOMAIN 14-like               220   7e-62   
ref|XP_009421295.1|  PREDICTED: uncharacterized protein LOC104000876    221   8e-62   
emb|CBI36045.3|  unnamed protein product                                229   2e-61   
ref|XP_008380848.1|  PREDICTED: uncharacterized protein LOC103443739    218   9e-61   
ref|XP_006585563.1|  PREDICTED: protein IQ-DOMAIN 14-like               217   1e-60   
ref|XP_009392681.1|  PREDICTED: protein IQ-DOMAIN 14-like               218   2e-60   
ref|XP_009364672.1|  PREDICTED: protein IQ-DOMAIN 14-like               216   3e-60   
ref|XP_007135626.1|  hypothetical protein PHAVU_010G144700g             215   4e-60   
ref|XP_009347221.1|  PREDICTED: protein IQ-DOMAIN 14-like               215   5e-60   
ref|XP_008228411.1|  PREDICTED: protein IQ-DOMAIN 14                    215   5e-60   
ref|XP_008360734.1|  PREDICTED: uncharacterized protein LOC103424428    215   6e-60   
ref|XP_009338738.1|  PREDICTED: uncharacterized protein LOC103931052    213   4e-59   
ref|XP_003524408.1|  PREDICTED: protein IQ-DOMAIN 14-like               209   3e-58   
ref|XP_010915110.1|  PREDICTED: protein IQ-DOMAIN 14-like               211   5e-58   
ref|XP_009344480.1|  PREDICTED: uncharacterized protein LOC103936369    207   3e-57   
ref|XP_004305257.1|  PREDICTED: protein IQ-DOMAIN 14-like               208   3e-57   
gb|KHG10609.1|  Protein IQ-DOMAIN 14 -like protein                      207   3e-57   
ref|XP_003627052.1|  IQ domain-containing protein                       207   6e-57   
ref|XP_004510319.1|  PREDICTED: protein IQ-DOMAIN 14-like               207   1e-56   
gb|EYU45838.1|  hypothetical protein MIMGU_mgv1a021295mg                205   3e-56   
ref|XP_008775821.1|  PREDICTED: uncharacterized protein LOC103696080    201   2e-54   
gb|KHG03794.1|  Protein IQ-DOMAIN 31 -like protein                      199   2e-54   
ref|XP_008462411.1|  PREDICTED: protein IQ-DOMAIN 14-like               197   4e-53   
ref|XP_006853731.1|  hypothetical protein AMTR_s00056p00168250          197   1e-52   
ref|XP_010924446.1|  PREDICTED: protein IQ-DOMAIN 14-like               195   3e-52   
ref|XP_009135486.1|  PREDICTED: protein IQ-DOMAIN 14-like               192   1e-51   
emb|CDX82400.1|  BnaA03g34210D                                          191   4e-51   
ref|XP_004141786.1|  PREDICTED: uncharacterized protein LOC101204536    191   8e-51   
ref|XP_010051558.1|  PREDICTED: protein IQ-DOMAIN 14-like               192   1e-50   
ref|XP_009114713.1|  PREDICTED: protein IQ-DOMAIN 14-like               190   1e-50   
emb|CDY68636.1|  BnaAnng27880D                                          190   1e-50   
gb|KGN45577.1|  hypothetical protein Csa_7G452320                       191   9e-50   
ref|XP_010051559.1|  PREDICTED: protein IQ-DOMAIN 14-like               190   1e-49   
ref|NP_188270.1|  protein IQ-domain 26                                  187   1e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297850.1|  hypothetical protein CARUB_v10013891mg             186   3e-49   
ref|XP_010504374.1|  PREDICTED: protein IQ-DOMAIN 14-like               182   4e-48   
ref|XP_008795506.1|  PREDICTED: protein IQ-DOMAIN 1-like                183   9e-48   
ref|XP_002885142.1|  IQ-domain 26                                       181   1e-47   
gb|KFK38994.1|  hypothetical protein AALP_AA3G186300                    181   1e-47   
ref|XP_010487511.1|  PREDICTED: protein IQ-DOMAIN 14-like               180   3e-47   
emb|CDY67178.1|  BnaCnng53860D                                          180   4e-47   
ref|XP_010465672.1|  PREDICTED: protein IQ-DOMAIN 14-like               179   8e-47   
emb|CDX75883.1|  BnaC03g39660D                                          177   3e-46   
emb|CDX92076.1|  BnaA05g23310D                                          177   4e-46   
ref|XP_009146082.1|  PREDICTED: protein IQ-DOMAIN 14                    176   7e-46   
gb|KCW82319.1|  hypothetical protein EUGRSUZ_C03723                     177   2e-45   
ref|XP_006406831.1|  hypothetical protein EUTSA_v10020849mg             174   5e-45   
ref|XP_009385779.1|  PREDICTED: protein IQ-DOMAIN 14-like               174   6e-45   
ref|NP_001054836.1|  Os05g0187500                                       175   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006597052.1|  PREDICTED: uncharacterized protein LOC100806...    172   2e-44   
gb|KHM98712.1|  Protein IQ-DOMAIN 31                                    172   3e-44   
ref|XP_008656305.1|  PREDICTED: uncharacterized protein LOC103635...    173   4e-44   
ref|XP_004960892.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    173   5e-44   
ref|NP_001242174.1|  uncharacterized protein LOC100806729               171   8e-44   
gb|EEC70092.1|  hypothetical protein OsI_00721                          171   4e-43   Oryza sativa Indica Group [Indian rice]
ref|NP_001042265.1|  Os01g0190500                                       171   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008649419.1|  PREDICTED: protein IQ-DOMAIN 14-like               169   2e-42   
ref|XP_004486789.1|  PREDICTED: protein IQ-DOMAIN 14-like               166   2e-42   
emb|CDY43103.1|  BnaC05g36740D                                          166   4e-42   
ref|XP_010535189.1|  PREDICTED: protein IQ-DOMAIN 14                    165   7e-42   
gb|EYU30698.1|  hypothetical protein MIMGU_mgv1a007190mg                166   8e-42   
ref|XP_009399809.1|  PREDICTED: protein IQ-DOMAIN 31-like               166   1e-41   
ref|XP_006645590.1|  PREDICTED: protein IQ-DOMAIN 14-like               163   4e-41   
ref|XP_008656304.1|  PREDICTED: uncharacterized protein LOC103635...    164   9e-41   
ref|XP_002869449.1|  hypothetical protein ARALYDRAFT_491843             161   2e-40   
ref|XP_007150597.1|  hypothetical protein PHAVU_005G165500g             160   2e-40   
ref|XP_002457200.1|  hypothetical protein SORBIDRAFT_03g003180          162   5e-40   Sorghum bicolor [broomcorn]
ref|XP_007150595.1|  hypothetical protein PHAVU_005G165500g             159   6e-40   
ref|XP_006285646.1|  hypothetical protein CARUB_v10007101mg             156   9e-39   
ref|XP_009409690.1|  PREDICTED: protein IQ-DOMAIN 14-like               156   1e-38   
ref|XP_003543618.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    155   2e-38   
dbj|BAK07171.1|  predicted protein                                      157   2e-38   
ref|NP_194644.2|  protein IQ-domain 25                                  155   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597665.1|  IQ domain-containing protein                       154   4e-38   
emb|CDM81723.1|  unnamed protein product                                156   4e-38   
ref|XP_004968459.1|  PREDICTED: uncharacterized protein LOC101775005    154   2e-37   
ref|XP_009413858.1|  PREDICTED: protein IQ-DOMAIN 31-like               153   3e-37   
gb|KFK29473.1|  hypothetical protein AALP_AA7G138200                    152   3e-37   
ref|XP_008447560.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    152   3e-37   
ref|XP_010033830.1|  PREDICTED: protein IQ-DOMAIN 31-like               150   4e-37   
ref|XP_004149189.1|  PREDICTED: protein IQ-DOMAIN 14-like               151   6e-37   
emb|CAB43929.1|  hypothetical protein                                   149   2e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KCW79610.1|  hypothetical protein EUGRSUZ_C00964                     150   2e-36   
ref|XP_010047665.1|  PREDICTED: protein IQ-DOMAIN 14-like               150   4e-36   
ref|XP_006412875.1|  hypothetical protein EUTSA_v10025424mg             147   2e-35   
emb|CDO99100.1|  unnamed protein product                                148   2e-35   
ref|XP_009629604.1|  PREDICTED: protein IQ-DOMAIN 1                     148   2e-35   
ref|XP_010529030.1|  PREDICTED: protein IQ-DOMAIN 14-like               143   4e-35   
ref|XP_009757400.1|  PREDICTED: protein IQ-DOMAIN 14                    146   8e-35   
ref|XP_006838975.1|  hypothetical protein AMTR_s00002p00271290          145   1e-34   
ref|XP_010033552.1|  PREDICTED: protein IQ-DOMAIN 14-like               144   3e-34   
ref|XP_010034632.1|  PREDICTED: protein IQ-DOMAIN 14-like               144   3e-34   
ref|XP_009137830.1|  PREDICTED: uncharacterized protein LOC103861873    142   4e-34   
emb|CDY30233.1|  BnaA03g49370D                                          142   5e-34   
ref|XP_002439404.1|  hypothetical protein SORBIDRAFT_09g005870          144   5e-34   Sorghum bicolor [broomcorn]
ref|XP_002517079.1|  calmodulin binding protein, putative               143   7e-34   Ricinus communis
emb|CDY47784.1|  BnaC07g41760D                                          142   8e-34   
ref|XP_009407024.1|  PREDICTED: protein IQ-DOMAIN 14-like               142   9e-34   
ref|XP_004170997.1|  PREDICTED: uncharacterized protein LOC101230453    141   9e-34   
ref|XP_008344115.1|  PREDICTED: protein IQ-DOMAIN 1-like                139   1e-33   
ref|XP_002314666.2|  calmodulin-binding family protein                  140   4e-33   Populus trichocarpa [western balsam poplar]
ref|XP_010526431.1|  PREDICTED: protein IQ-DOMAIN 14                    138   8e-33   
ref|NP_175608.1|  IQ-domain 27 protein                                  137   1e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010694040.1|  PREDICTED: protein IQ-DOMAIN 32                    139   2e-32   
ref|XP_010433130.1|  PREDICTED: uncharacterized protein LOC104717283    137   2e-32   
ref|XP_003564676.1|  PREDICTED: uncharacterized protein LOC100844448    138   6e-32   
ref|XP_011030639.1|  PREDICTED: protein IQ-DOMAIN 14-like               136   1e-31   
ref|XP_010500790.1|  PREDICTED: protein IQ-DOMAIN 14-like               135   1e-31   
ref|XP_002891673.1|  IQ-domain 27                                       135   1e-31   
ref|XP_010447885.1|  PREDICTED: uncharacterized protein LOC104730422    135   1e-31   
ref|XP_006489449.1|  PREDICTED: protein IQ-DOMAIN 14-like               136   1e-31   
ref|XP_010256160.1|  PREDICTED: protein IQ-DOMAIN 14-like               136   2e-31   
ref|XP_006420022.1|  hypothetical protein CICLE_v10004919mg             135   3e-31   
ref|XP_006392975.1|  hypothetical protein EUTSA_v10012305mg             134   3e-31   
ref|XP_010548880.1|  PREDICTED: uncharacterized protein LOC104820211    134   4e-31   
ref|XP_010092431.1|  Protein IQ-DOMAIN 31                               134   6e-31   
gb|KDO74471.1|  hypothetical protein CISIN_1g012293mg                   134   8e-31   
ref|XP_004496689.1|  PREDICTED: protein IQ-DOMAIN 1-like                134   8e-31   
gb|KDP40224.1|  hypothetical protein JCGZ_02222                         134   9e-31   
ref|XP_010259131.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    133   2e-30   
ref|XP_006574456.1|  PREDICTED: uncharacterized protein LOC100810...    132   2e-30   
ref|XP_009416470.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    132   2e-30   
gb|KHN00271.1|  Protein IQ-DOMAIN 31                                    132   3e-30   
ref|XP_007224458.1|  hypothetical protein PRUPE_ppa022210mg             132   3e-30   
gb|EMS48192.1|  Protein IQ-DOMAIN 31                                    130   3e-30   
ref|XP_009107802.1|  PREDICTED: uncharacterized protein LOC103833471    131   4e-30   
ref|NP_001242711.1|  uncharacterized protein LOC100810189               131   4e-30   
ref|XP_011091033.1|  PREDICTED: protein IQ-DOMAIN 14-like               131   5e-30   
emb|CDY36861.1|  BnaC08g09860D                                          130   5e-30   
ref|XP_009416469.1|  PREDICTED: uncharacterized protein LOC103997...    132   5e-30   
ref|XP_006283879.1|  hypothetical protein CARUB_v10004996mg             130   5e-30   
ref|XP_008655709.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    132   6e-30   
emb|CDY50677.1|  BnaA08g29370D                                          130   7e-30   
ref|XP_010253848.1|  PREDICTED: protein IQ-DOMAIN 31-like               127   7e-30   
ref|XP_008655708.1|  PREDICTED: uncharacterized protein LOC103634...    132   7e-30   
ref|XP_007034846.1|  Iq-domain 31 isoform 2                             131   9e-30   
ref|XP_002265460.1|  PREDICTED: protein IQ-DOMAIN 14                    131   1e-29   Vitis vinifera
ref|XP_010435074.1|  PREDICTED: uncharacterized protein LOC104718945    130   1e-29   
ref|XP_010449997.1|  PREDICTED: protein IQ-DOMAIN 14-like               130   1e-29   
ref|XP_010259130.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    130   2e-29   
gb|EPS70679.1|  hypothetical protein M569_04083                         128   2e-29   
ref|XP_010525232.1|  PREDICTED: protein IQ-DOMAIN 14-like               127   2e-29   
ref|XP_007034845.1|  Iq-domain 31 isoform 1                             131   2e-29   
ref|XP_011073614.1|  PREDICTED: protein IQ-DOMAIN 32-like               128   2e-29   
ref|XP_009371968.1|  PREDICTED: protein IQ-DOMAIN 14-like               129   3e-29   
ref|XP_006363480.1|  PREDICTED: protein IQ-DOMAIN 14-like               129   3e-29   
emb|CAN66770.1|  hypothetical protein VITISV_013810                     130   4e-29   Vitis vinifera
ref|XP_010112558.1|  Protein IQ-DOMAIN 31                               129   4e-29   
ref|XP_010462035.1|  PREDICTED: protein IQ-DOMAIN 14-like               127   5e-29   
ref|XP_008777374.1|  PREDICTED: protein IQ-DOMAIN 14                    129   5e-29   
ref|XP_010440400.1|  PREDICTED: uncharacterized protein LOC104723702    127   6e-29   
ref|XP_010559033.1|  PREDICTED: protein IQ-DOMAIN 14-like               127   7e-29   
ref|XP_008673593.1|  PREDICTED: protein IQ-DOMAIN 14-like               129   8e-29   
emb|CBI26300.3|  unnamed protein product                                128   8e-29   
ref|XP_008238822.1|  PREDICTED: protein IQ-DOMAIN 14                    127   1e-28   
ref|XP_007143302.1|  hypothetical protein PHAVU_007G060900g             128   1e-28   
ref|XP_008224258.1|  PREDICTED: protein IQ-DOMAIN 14                    128   1e-28   
ref|XP_010932805.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X2         127   2e-28   
ref|XP_008391004.1|  PREDICTED: protein IQ-DOMAIN 14                    127   2e-28   
ref|XP_010932804.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1         127   2e-28   
emb|CDY45643.1|  BnaA05g15100D                                          125   2e-28   
ref|XP_002312547.2|  calmodulin-binding family protein                  127   2e-28   Populus trichocarpa [western balsam poplar]
gb|KHN15734.1|  Protein IQ-DOMAIN 14                                    125   2e-28   
ref|XP_006306443.1|  hypothetical protein CARUB_v10012385mg             125   2e-28   
ref|XP_004247593.1|  PREDICTED: protein IQ-DOMAIN 14                    127   3e-28   
gb|EMT31921.1|  hypothetical protein F775_15466                         124   4e-28   
ref|XP_006606074.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3    125   4e-28   
gb|KFK43744.1|  hypothetical protein AALP_AA1G167200                    125   6e-28   
ref|XP_004166570.1|  PREDICTED: uncharacterized LOC101212161            125   6e-28   
ref|XP_009335283.1|  PREDICTED: protein IQ-DOMAIN 14-like               126   7e-28   
ref|XP_008438624.1|  PREDICTED: protein IQ-DOMAIN 14                    125   7e-28   
ref|XP_003556065.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    125   7e-28   
gb|KEH43814.1|  IQ calmodulin-binding motif protein                     125   8e-28   
gb|EPS60953.1|  hypothetical protein M569_13848                         121   8e-28   
gb|KGN61670.1|  hypothetical protein Csa_2G222130                       125   8e-28   
ref|XP_004145422.1|  PREDICTED: uncharacterized protein LOC101212161    125   8e-28   
ref|XP_010552067.1|  PREDICTED: protein IQ-DOMAIN 14-like               123   8e-28   
ref|XP_007145905.1|  hypothetical protein PHAVU_007G277500g             124   1e-27   
ref|XP_007210506.1|  hypothetical protein PRUPE_ppa005786mg             124   2e-27   
ref|XP_008449323.1|  PREDICTED: uncharacterized protein LOC103491236    124   2e-27   
ref|NP_193211.2|  protein IQ-domain 19                                  123   2e-27   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK07793.1|  predicted protein                                      123   2e-27   
gb|AAL86322.1|  unknown protein                                         123   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006606073.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    124   2e-27   
ref|XP_002870287.1|  IQ-domain 19                                       123   3e-27   
ref|XP_003569776.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X3    123   3e-27   
ref|XP_010479698.1|  PREDICTED: protein IQ-DOMAIN 14-like               122   3e-27   
ref|XP_004134123.1|  PREDICTED: uncharacterized protein LOC101202972    123   4e-27   
ref|XP_010232302.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    122   7e-27   
ref|XP_009144869.1|  PREDICTED: protein IQ-DOMAIN 14                    120   8e-27   
ref|XP_006589585.1|  PREDICTED: protein IQ-DOMAIN 14-like               122   1e-26   
ref|XP_003638200.1|  Vacuolar protein sorting-associated protein-...    123   1e-26   
ref|XP_010232301.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    122   1e-26   
ref|XP_011026988.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    121   2e-26   
ref|XP_011026994.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    121   2e-26   
dbj|BAK06948.1|  predicted protein                                      120   5e-26   
ref|XP_008798489.1|  PREDICTED: protein IQ-DOMAIN 14-like               119   7e-26   
gb|EPS67207.1|  hypothetical protein M569_07568                         120   9e-26   
ref|XP_008664949.1|  PREDICTED: uncharacterized protein LOC103643558    118   2e-25   
ref|XP_002448359.1|  hypothetical protein SORBIDRAFT_06g025790          118   3e-25   Sorghum bicolor [broomcorn]
ref|NP_001044215.1|  Os01g0743100                                       117   3e-25   Oryza sativa Japonica Group [Japonica rice]
gb|EAY75778.1|  hypothetical protein OsI_03694                          117   3e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010933871.1|  PREDICTED: protein IQ-DOMAIN 1-like                117   8e-25   
gb|EYU41446.1|  hypothetical protein MIMGU_mgv1a006082mg                116   1e-24   
ref|XP_009415192.1|  PREDICTED: protein IQ-DOMAIN 14-like               115   1e-24   
gb|KHG27723.1|  Protein IQ-DOMAIN 31 -like protein                      115   2e-24   
emb|CDM84039.1|  unnamed protein product                                114   2e-24   
emb|CDY64325.1|  BnaC01g42170D                                          114   2e-24   
gb|EAY98736.1|  hypothetical protein OsI_20667                          114   2e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001056080.2|  Os05g0521900                                       114   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004298748.1|  PREDICTED: uncharacterized protein LOC101291430    115   3e-24   
ref|XP_010917795.1|  PREDICTED: protein IQ-DOMAIN 14-like               114   4e-24   
ref|XP_004961449.1|  PREDICTED: uncharacterized protein LOC101766...    113   4e-24   
ref|XP_004976532.1|  PREDICTED: protein IQ-DOMAIN 1-like                113   1e-23   
ref|XP_009392357.1|  PREDICTED: protein IQ-DOMAIN 14                    113   1e-23   
ref|XP_003580351.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2          113   1e-23   
ref|XP_009380463.1|  PREDICTED: uncharacterized protein LOC103968854    111   2e-23   
ref|XP_010938447.1|  PREDICTED: protein IQ-DOMAIN 14-like               111   3e-23   
gb|KHN10073.1|  Protein IQ-DOMAIN 31                                    111   4e-23   
ref|XP_009393924.1|  PREDICTED: protein IQ-DOMAIN 1-like                111   4e-23   
ref|XP_003536833.1|  PREDICTED: protein IQ-DOMAIN 14-like               110   7e-23   
ref|XP_004245642.1|  PREDICTED: protein IQ-DOMAIN 14                    110   1e-22   
ref|XP_006358875.1|  PREDICTED: protein IQ-DOMAIN 14-like               110   1e-22   
ref|NP_001147670.1|  LOC100281279                                       109   3e-22   
ref|XP_003571792.2|  PREDICTED: protein IQ-DOMAIN 14-like               108   4e-22   
gb|KEH31712.1|  calmodulin-binding protein                              108   4e-22   
ref|XP_009148233.1|  PREDICTED: uncharacterized protein LOC103871707    107   5e-22   
ref|XP_004297967.1|  PREDICTED: uncharacterized protein LOC101300531    108   5e-22   
ref|XP_011029205.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    108   1e-21   
ref|XP_008345351.1|  PREDICTED: protein IQ-DOMAIN 14-like               107   1e-21   
gb|EMS67735.1|  hypothetical protein TRIUR3_26848                       100   2e-21   
gb|EYU38984.1|  hypothetical protein MIMGU_mgv1a008113mg                105   3e-21   
ref|XP_010278570.1|  PREDICTED: protein IQ-DOMAIN 14-like               106   3e-21   
ref|XP_009615886.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2    105   3e-21   
dbj|BAJ91377.1|  predicted protein                                      106   3e-21   
gb|KEH41068.1|  IQ calmodulin-binding motif protein                     105   4e-21   
ref|XP_010270194.1|  PREDICTED: uncharacterized protein LOC104606600    102   4e-21   
ref|XP_004497985.1|  PREDICTED: protein IQ-DOMAIN 14-like               105   8e-21   
ref|XP_003562123.1|  PREDICTED: protein IQ-DOMAIN 14-like               105   9e-21   
emb|CBI23074.3|  unnamed protein product                                104   1e-20   
ref|XP_010662925.1|  PREDICTED: protein IQ-DOMAIN 14                    104   1e-20   
ref|XP_011076213.1|  PREDICTED: protein IQ-DOMAIN 31                    104   1e-20   
ref|XP_006589561.1|  PREDICTED: protein IQ-DOMAIN 14-like               104   2e-20   
gb|EYU19528.1|  hypothetical protein MIMGU_mgv1a006074mg                104   2e-20   
ref|XP_003592300.1|  hypothetical protein MTR_1g101330                  103   2e-20   
ref|XP_008369498.1|  PREDICTED: protein IQ-DOMAIN 14                    103   2e-20   
gb|EYU25070.1|  hypothetical protein MIMGU_mgv1a007392mg                103   2e-20   
ref|XP_002441405.1|  hypothetical protein SORBIDRAFT_09g026070          103   2e-20   
dbj|BAK00878.1|  predicted protein                                      102   3e-20   
ref|XP_004985609.1|  PREDICTED: uncharacterized protein LOC101759...    102   5e-20   
ref|XP_004985611.1|  PREDICTED: uncharacterized protein LOC101759...    102   5e-20   
gb|KDP23646.1|  hypothetical protein JCGZ_23479                         102   5e-20   
ref|XP_011029204.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    102   6e-20   
ref|XP_008218500.1|  PREDICTED: protein IQ-DOMAIN 1-like                101   7e-20   
ref|XP_009615885.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1    101   9e-20   
ref|XP_002299555.2|  hypothetical protein POPTR_0001s08910g             102   1e-19   
emb|CDX70019.1|  BnaA10g23680D                                          100   1e-19   
ref|XP_009628884.1|  PREDICTED: protein IQ-DOMAIN 14-like               100   2e-19   
ref|XP_009122359.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...    100   2e-19   
ref|XP_006414646.1|  hypothetical protein EUTSA_v10025526mg             100   2e-19   
dbj|BAK07420.1|  predicted protein                                      101   2e-19   
ref|NP_001147510.1|  IQ calmodulin-binding motif family protein         101   2e-19   
ref|XP_004234367.1|  PREDICTED: uncharacterized protein LOC101268068    101   2e-19   
ref|XP_010240279.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1          100   4e-19   
emb|CDX98994.1|  BnaC09g48410D                                        98.6    5e-19   
ref|XP_004986616.1|  PREDICTED: protein IQ-DOMAIN 14-like               100   5e-19   
ref|XP_006573764.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  98.6    6e-19   
ref|XP_002276651.1|  PREDICTED: uncharacterized protein LOC100254717  99.8    7e-19   
ref|XP_006587475.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   98.2    8e-19   
ref|NP_001148196.1|  calmodulin binding protein                       98.6    9e-19   
ref|XP_006587474.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   99.0    9e-19   
ref|NP_001050723.1|  Os03g0636700                                     98.6    1e-18   
gb|EAY91129.1|  hypothetical protein OsI_12737                        98.6    1e-18   
ref|XP_008647973.1|  PREDICTED: IQ calmodulin-binding motif famil...  97.8    1e-18   
ref|XP_010526054.1|  PREDICTED: protein IQ-DOMAIN 1-like              98.6    2e-18   
ref|XP_009136658.1|  PREDICTED: protein IQ-DOMAIN 14-like             98.6    2e-18   
ref|NP_001167752.1|  hypothetical protein                             97.4    2e-18   
ref|XP_009415291.1|  PREDICTED: protein IQ-DOMAIN 14-like             97.8    2e-18   
gb|EYU29831.1|  hypothetical protein MIMGU_mgv1a006306mg              97.4    3e-18   
ref|XP_010555545.1|  PREDICTED: protein IQ-DOMAIN 14                  96.3    3e-18   
gb|EMS62239.1|  Protein IQ-DOMAIN 31                                  95.1    3e-18   
ref|XP_004155992.1|  PREDICTED: uncharacterized LOC101204536          93.6    3e-18   
ref|NP_001152257.1|  IQ calmodulin-binding motif family protein       96.3    4e-18   
emb|CDY53133.1|  BnaC01g41430D                                        97.4    4e-18   
ref|XP_003568073.1|  PREDICTED: uncharacterized protein LOC100823375  95.9    4e-18   
ref|XP_009762655.1|  PREDICTED: protein IQ-DOMAIN 14-like             96.3    4e-18   
ref|XP_010097046.1|  Protein IQ-DOMAIN 1                              96.7    5e-18   
ref|XP_009771152.1|  PREDICTED: protein IQ-DOMAIN 14-like             96.3    5e-18   
ref|XP_002968277.1|  hypothetical protein SELMODRAFT_68032            92.4    6e-18   
gb|KDP47069.1|  hypothetical protein JCGZ_05096                       97.1    6e-18   
ref|XP_002976100.1|  hypothetical protein SELMODRAFT_104616           92.8    7e-18   
emb|CDY53440.1|  BnaC03g78010D                                        94.4    7e-18   
ref|XP_003605876.1|  IQ domain-containing protein                     96.3    7e-18   
gb|KDP25216.1|  hypothetical protein JCGZ_20372                       96.3    1e-17   
ref|XP_006857873.1|  hypothetical protein AMTR_s00069p00100460        95.9    1e-17   
ref|XP_009107161.1|  PREDICTED: uncharacterized protein LOC103832821  93.6    1e-17   
emb|CAB40030.1|  putative protein                                     95.1    1e-17   
ref|XP_010273325.1|  PREDICTED: protein IQ-DOMAIN 14-like             95.5    1e-17   
ref|XP_007135309.1|  hypothetical protein PHAVU_010G118500g           95.9    1e-17   
ref|XP_010448780.1|  PREDICTED: protein IQ-DOMAIN 14-like             95.9    1e-17   
emb|CDX98786.1|  BnaA03g45710D                                        95.5    2e-17   
ref|XP_008776838.1|  PREDICTED: protein IQ-DOMAIN 1-like              95.9    2e-17   
ref|XP_011039163.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        95.9    2e-17   
ref|NP_001147912.1|  calmodulin binding protein                       94.4    2e-17   
ref|XP_008437216.1|  PREDICTED: protein IQ-DOMAIN 14 isoform X1       94.0    2e-17   
ref|XP_011039172.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2        95.9    2e-17   
ref|XP_010685364.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.7    2e-17   
ref|XP_008673057.1|  PREDICTED: hypothetical protein isoform X2       94.4    2e-17   
ref|XP_011039178.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X3        95.9    2e-17   
ref|XP_010232214.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.7    2e-17   
ref|XP_011039187.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X4        95.5    2e-17   
tpg|DAA57703.1|  TPA: calmodulin binding protein                      94.4    2e-17   
ref|XP_004514932.1|  PREDICTED: protein IQ-DOMAIN 1-like              95.5    2e-17   
ref|XP_002525813.1|  conserved hypothetical protein                   95.5    2e-17   
gb|EMT06896.1|  hypothetical protein F775_20753                       93.2    2e-17   
ref|XP_002320895.2|  hypothetical protein POPTR_0014s10040g           95.5    2e-17   
gb|KHN06356.1|  Protein IQ-DOMAIN 14                                  95.1    3e-17   
ref|XP_004982367.1|  PREDICTED: uncharacterized protein LOC101766...  94.7    3e-17   
ref|XP_004159978.1|  PREDICTED: protein IQ-DOMAIN 14-like             93.6    3e-17   
ref|XP_003529877.1|  PREDICTED: protein IQ-DOMAIN 14-like             95.1    3e-17   
ref|XP_007012312.1|  IQ-domain 6                                      94.7    3e-17   
gb|KHN15893.1|  Protein IQ-DOMAIN 14                                  94.7    3e-17   
ref|XP_011019421.1|  PREDICTED: protein IQ-DOMAIN 1                   94.4    4e-17   
ref|XP_003548183.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.7    4e-17   
ref|XP_004143989.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.8    4e-17   
ref|XP_002970253.1|  hypothetical protein SELMODRAFT_67789            89.7    4e-17   
ref|XP_010439237.1|  PREDICTED: uncharacterized protein LOC104722723  94.4    4e-17   
gb|EEE62584.1|  hypothetical protein OsJ_17387                        94.4    4e-17   
ref|XP_007131445.1|  hypothetical protein PHAVU_011G014100g           94.0    4e-17   
ref|XP_006382010.1|  hypothetical protein POPTR_0006s24310g           94.0    4e-17   
ref|XP_009400087.1|  PREDICTED: protein IQ-DOMAIN 14-like             94.4    5e-17   
dbj|BAJ90163.1|  predicted protein                                    94.4    5e-17   
ref|XP_002308551.2|  calmodulin-binding family protein                93.6    5e-17   
ref|XP_010100661.1|  Protein IQ-DOMAIN 14                             94.0    6e-17   
ref|NP_001060851.1|  Os08g0115200                                     94.4    6e-17   
ref|NP_001117204.1|  protein IQ-domain 18                             94.0    6e-17   
gb|KFK42501.1|  hypothetical protein AALP_AA1G001700                  94.0    6e-17   
ref|XP_004982368.1|  PREDICTED: uncharacterized protein LOC101766...  93.6    6e-17   
ref|XP_009119671.1|  PREDICTED: protein IQ-DOMAIN 1                   94.0    6e-17   
emb|CDX90011.1|  BnaA10g00710D                                        94.0    6e-17   
ref|XP_010474698.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.0    6e-17   
ref|XP_010457172.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.0    7e-17   
gb|KDP28424.1|  hypothetical protein JCGZ_14195                       94.0    7e-17   
ref|XP_008366950.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.8    7e-17   
ref|XP_006307205.1|  hypothetical protein CARUB_v10008796mg           94.0    7e-17   
ref|XP_010480654.1|  PREDICTED: protein IQ-DOMAIN 1-like              94.0    7e-17   
emb|CDY15200.1|  BnaC05g00790D                                        93.6    7e-17   
ref|XP_008658572.1|  PREDICTED: calmodulin binding protein isofor...  92.4    7e-17   
ref|XP_004134281.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.4    8e-17   
ref|XP_007040139.1|  IQ-domain 22, putative                           93.6    8e-17   
ref|XP_002529980.1|  calmodulin binding protein, putative             93.6    8e-17   
ref|XP_009387679.1|  PREDICTED: protein IQ-DOMAIN 1-like              93.6    8e-17   
ref|XP_010452681.1|  PREDICTED: protein IQ-DOMAIN 14                  92.4    8e-17   
ref|XP_003539928.1|  PREDICTED: protein IQ-DOMAIN 14-like             93.2    8e-17   
gb|KCW50934.1|  hypothetical protein EUGRSUZ_J00581                   92.8    8e-17   
gb|EPS64582.1|  hypothetical protein M569_10199                       88.6    9e-17   
ref|XP_006413583.1|  hypothetical protein EUTSA_v10025012mg           93.2    9e-17   
ref|XP_003534374.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X1  92.8    1e-16   
ref|XP_009784182.1|  PREDICTED: protein IQ-DOMAIN 1                   92.4    1e-16   
gb|KHG09573.1|  Protein IQ-DOMAIN 14                                  91.7    1e-16   
ref|XP_007218997.1|  hypothetical protein PRUPE_ppa004080mg           93.2    1e-16   
ref|XP_010055603.1|  PREDICTED: protein IQ-DOMAIN 14                  93.2    1e-16   
gb|KHN11724.1|  Protein IQ-DOMAIN 14                                  92.8    1e-16   
ref|XP_006587682.1|  PREDICTED: protein IQ-DOMAIN 14-like isoform X2  92.8    1e-16   
ref|XP_006444739.1|  hypothetical protein CICLE_v10019596mg           93.2    1e-16   
ref|XP_006491358.1|  PREDICTED: protein IQ-DOMAIN 1-like              93.2    1e-16   
ref|XP_002302670.2|  hypothetical protein POPTR_0002s17930g           93.2    1e-16   
ref|XP_004155200.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.8    1e-16   
ref|XP_008233056.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        93.2    1e-16   
ref|XP_008233057.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2        93.2    1e-16   
gb|KHG09572.1|  Protein IQ-DOMAIN 14                                  91.7    1e-16   
ref|XP_009366611.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X2        93.2    1e-16   
ref|XP_009366610.1|  PREDICTED: protein IQ-DOMAIN 1 isoform X1        93.2    1e-16   
gb|KEH18583.1|  IQ calmodulin-binding motif protein                   92.8    1e-16   
ref|XP_002892087.1|  T25K16.10                                        92.8    1e-16   
ref|XP_010246630.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.4    1e-16   
ref|XP_010423237.1|  PREDICTED: protein IQ-DOMAIN 14-like             91.7    1e-16   
ref|XP_010491328.1|  PREDICTED: protein IQ-DOMAIN 14-like             91.7    1e-16   
ref|XP_002875013.1|  IQ-domain 17                                     92.8    2e-16   
ref|XP_003571316.1|  PREDICTED: protein IQ-DOMAIN 14                  92.8    2e-16   
ref|XP_008795399.1|  PREDICTED: protein IQ-DOMAIN 1-like              92.4    2e-16   
gb|EMT11466.1|  hypothetical protein F775_42834                       89.4    2e-16   
ref|XP_007051443.1|  IQ-domain 17 isoform 2                           92.8    2e-16   
ref|XP_007051442.1|  IQ-domain 17 isoform 1                           92.8    2e-16   
gb|KFK30665.1|  hypothetical protein AALP_AA6G011900                  92.4    2e-16   
ref|NP_001276234.1|  uncharacterized protein LOC100819346             91.7    2e-16   
ref|XP_009767106.1|  PREDICTED: protein IQ-DOMAIN 1                   92.4    2e-16   
emb|CDY69140.1|  BnaAnng29450D                                        92.4    2e-16   
ref|XP_008437775.1|  PREDICTED: protein IQ-DOMAIN 1                   92.0    2e-16   
ref|XP_010918300.1|  PREDICTED: protein IQ-DOMAIN 1-like              92.4    2e-16   
ref|NP_001042285.1|  Os01g0194200                                     91.7    2e-16   
ref|XP_002466772.1|  hypothetical protein SORBIDRAFT_01g013960        92.0    2e-16   
ref|XP_009368414.1|  PREDICTED: protein IQ-DOMAIN 1-like              91.7    2e-16   
ref|XP_010433947.1|  PREDICTED: uncharacterized protein LOC104717998  92.0    2e-16   
ref|XP_002265121.1|  PREDICTED: protein IQ-DOMAIN 1                   92.4    2e-16   
dbj|BAF00832.1|  hypothetical protein                                 92.0    2e-16   
gb|EAY72874.1|  hypothetical protein OsI_00748                        91.7    2e-16   
ref|XP_008657968.1|  PREDICTED: protein IQ-DOMAIN 14-like             90.1    2e-16   
ref|XP_006418384.1|  hypothetical protein EUTSA_v10007299mg           92.0    2e-16   
ref|NP_567191.2|  protein IQ-domain 17                                92.0    2e-16   
ref|XP_008234658.1|  PREDICTED: protein IQ-DOMAIN 14-like             92.4    2e-16   
ref|XP_006846576.1|  hypothetical protein AMTR_s00018p00247260        91.7    2e-16   
ref|XP_009134490.1|  PREDICTED: protein IQ-DOMAIN 1                   92.0    3e-16   
ref|XP_011005472.1|  PREDICTED: protein IQ-DOMAIN 1-like              91.3    3e-16   
gb|EAZ10880.1|  hypothetical protein OsJ_00724                        91.7    3e-16   
ref|XP_010456163.1|  PREDICTED: protein IQ-DOMAIN 1-like              92.0    3e-16   
ref|XP_010267407.1|  PREDICTED: protein IQ-DOMAIN 1                   92.0    3e-16   
ref|XP_006287463.1|  hypothetical protein CARUB_v10000672mg           92.0    3e-16   
gb|EMT17970.1|  Protein IQ-DOMAIN 31                                  90.1    3e-16   
ref|XP_010045168.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   90.9    3e-16   
ref|XP_010045169.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   90.9    3e-16   
ref|XP_004306620.1|  PREDICTED: protein IQ-DOMAIN 14-like             91.7    3e-16   
ref|XP_010925464.1|  PREDICTED: protein IQ-DOMAIN 1-like              91.3    3e-16   
ref|XP_010428170.1|  PREDICTED: protein IQ-DOMAIN 1-like              92.0    3e-16   
ref|XP_009606338.1|  PREDICTED: protein IQ-DOMAIN 1                   91.7    3e-16   
ref|XP_010925189.1|  PREDICTED: LOW QUALITY PROTEIN: protein IQ-D...  92.0    3e-16   
ref|XP_006645595.1|  PREDICTED: protein IQ-DOMAIN 1-like              91.3    3e-16   
ref|XP_001758831.1|  predicted protein                                91.3    4e-16   
ref|XP_008793214.1|  PREDICTED: protein IQ-DOMAIN 1-like              91.3    4e-16   
ref|XP_007039184.1|  IQ-domain 17, putative                           91.7    4e-16   
ref|XP_004139377.1|  PREDICTED: uncharacterized protein LOC101218293  89.0    4e-16   
ref|XP_009602959.1|  PREDICTED: protein IQ-DOMAIN 1-like              90.5    4e-16   
ref|XP_004968513.1|  PREDICTED: protein IQ-DOMAIN 1-like              90.9    4e-16   
ref|XP_008350469.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X1   91.3    4e-16   
ref|XP_002444923.1|  hypothetical protein SORBIDRAFT_07g001510        91.7    4e-16   
ref|XP_011025382.1|  PREDICTED: protein IQ-DOMAIN 1                   91.3    4e-16   
ref|XP_008385579.1|  PREDICTED: protein IQ-DOMAIN 1                   90.5    4e-16   
ref|XP_008350526.1|  PREDICTED: protein IQ-DOMAIN 1-like isoform X2   91.3    5e-16   
ref|XP_002518922.1|  conserved hypothetical protein                   91.3    5e-16   
ref|XP_004515805.1|  PREDICTED: protein IQ-DOMAIN 14-like             90.5    5e-16   
ref|XP_006300492.1|  hypothetical protein CARUB_v10020371mg           90.5    5e-16   
emb|CBI34598.3|  unnamed protein product                              90.9    5e-16   



>ref|XP_007013015.1| Iq-domain 31 [Theobroma cacao]
 gb|EOY30634.1| Iq-domain 31 [Theobroma cacao]
Length=445

 Score =   318 bits (815),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 225/439 (51%), Positives = 286/439 (65%), Gaps = 48/439 (11%)
 Frame = +1

Query  121   IKSLKNESKMGKVIKWLKGLFttrqsnggrsgsggat------------aatgLCHnptt  264
             + +L+N   MG+  +WLKGLF  + S    + S                A+  LCHNPTT
Sbjct  11    VSALRN---MGRATRWLKGLFGLKNSKDYSNSSDRRDQKKCSSGHSGRDASAALCHNPTT  67

Query  265   ippnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIAS  444
             IPPNI+PAEAAWL S+Y  +  E++ +       AA  AAA  A  AA  AA AVVR+ S
Sbjct  68    IPPNISPAEAAWLRSYYNETEKEQNKH---AIAVAAATAAAADAAVAAAQAAVAVVRLTS  124

Query  445   RERGR---GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASA  615
               RG    GG    RERWAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRKQA+A
Sbjct  125   HGRGTMFGGG----RERWAAVKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKQATA  180

Query  616   TLHSMQALMRAQATVLAQKSRPSIINHP--------QKSIDKNKEARSENITSVHSGRYF  771
             TLHSMQAL+RAQAT+ +QK+R  +INH         +KS+++  + RSE+  S HS R  
Sbjct  181   TLHSMQALIRAQATIRSQKAR-GLINHDANRFDIRARKSMERFDDTRSEHTVSFHSRRLS  239

Query  772   ASLGSENDVIT--KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST-  942
             ASL +  ++    K+VE+DT   PK+  +SRR+ T V +F  +P     SSPLP ++   
Sbjct  240   ASLDTAINIDESPKIVEVDTG-RPKS--RSRRTNTSVSDFSDDPPYQTLSSPLPSRVPAR  296

Query  943   -----SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY  1107
                  S+  Q+ D     DE RFSTAQ+TPRF N  GSN P+T +KS+  E  FR+Y  +
Sbjct  297   LSLPDSRHCQETDWGLTGDECRFSTAQSTPRFINSCGSNAPVTPAKSVCAENLFRHYGNF  356

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             P YMASTQSF +KLRS SAPKQRPE GP   +KR+SLNEMMESR+S SGVRMQ+SCS  Q
Sbjct  357   PNYMASTQSFKAKLRSHSAPKQRPEPGP---KKRLSLNEMMESRSSLSGVRMQRSCSQVQ  413

Query  1288  EVMNFKSAVIGRLGRCTDY  1344
             E +NFK+AV+G+L R +++
Sbjct  414   EAINFKNAVLGKLDRSSEF  432



>ref|XP_010267115.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
 ref|XP_010267116.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
Length=430

 Score =   310 bits (794),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 200/369 (54%), Positives = 251/369 (68%), Gaps = 29/369 (8%)
 Frame = +1

Query  286   AEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR--  459
             A+AAWL S+Y  +   E   +      AA  AAA  A  AA  AA AVVR+ S+ RG   
Sbjct  61    ADAAWLRSYYTET---EKDQNKHAIAVAAATAAAADAAVAAAQAAVAVVRLTSQGRGTMF  117

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             GG    RE+WAAIKIQ  FRGYLA+KALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL
Sbjct  118   GG---GREKWAAIKIQTVFRGYLAKKALRALKGLVKLQALVRGYLVRKQATATLHSMQAL  174

Query  640   MRAQATVLAQKSRPSIINH-----PQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT  804
             +RAQATV AQKSR +++N      P+KSI++  E RSE+  S+HS R  AS+ +  +   
Sbjct  175   IRAQATVRAQKSR-AVVNKEHRYPPRKSIERFDETRSEHTASIHSRRLSASIETAINTFE  233

Query  805   ---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST------SQDFQ  957
                K+VE+DT   PK+  +SRR+ T + E   +P     SSPLP +I         ++FQ
Sbjct  234   ESPKIVEIDTG-RPKS--RSRRTNTSMSECGEDPPYLTISSPLPCQIPARLSIPDCRNFQ  290

Query  958   DLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSF  1137
             DLD     DE RFSTAQ+TPRF N  GSN P+T +KS+  + +FR Y  +P YMA+TQSF
Sbjct  291   DLDWGFTGDECRFSTAQSTPRFVNSGGSNAPVTPAKSVCADSFFRRYSNFPNYMANTQSF  350

Query  1138  MSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVI  1317
              +K+RS SAPKQRPE  P   RKR+SLNEM+ESRAS SGVRMQ+SCS AQE +NFK+AV+
Sbjct  351   KAKVRSHSAPKQRPEPSP---RKRLSLNEMVESRASLSGVRMQRSCSQAQEAINFKNAVV  407

Query  1318  GRLGRCTDY  1344
             GRL R  ++
Sbjct  408   GRLDRSAEF  416



>gb|KDP33804.1| hypothetical protein JCGZ_07375 [Jatropha curcas]
Length=432

 Score =   307 bits (787),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 210/427 (49%), Positives = 271/427 (63%), Gaps = 35/427 (8%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg-------LCHnpttippnitpAEAAWLS  306
             MGK  +WLKGLF  + +N   +                 LC+NP TIPPNI+PAEAAW+ 
Sbjct  1     MGKATRWLKGLFGIKNNNNKDNYHRKNKNRYSSGRDSPGLCYNPATIPPNISPAEAAWIR  60

Query  307   SFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC--R  480
             S+Y  +  +E S HA    AA  AAA  A  AA  A A    R+ S+ RG    +F   +
Sbjct  61    SYYNETE-KEQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSQGRG-SNTMFGGGQ  116

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ  FRGYLARKALR LKGLVK+QA  RGYLVRKQA+ATLHSMQAL+RAQATV
Sbjct  117   ERWAAVKIQTVFRGYLARKALRALKGLVKLQAYFRGYLVRKQATATLHSMQALIRAQATV  176

Query  661   LAQKSR------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT------  804
              +Q++R             +KS+++  E RSE+  S+HS R  +SL  +  +I       
Sbjct  177   RSQRTRNLNGADNRFEARARKSMERFDETRSEHTASIHSRRLSSSLDFQATLINSIDGSP  236

Query  805   KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIS------TSQDFQDLD  966
             K+VE+DT    +   +SRR+ T V +F  +PF     SPLP +I        +++FQD D
Sbjct  237   KIVEVDTGNNCRPKSRSRRTNTSVSDFSDDPFYQTLPSPLPSRIPPRLSMLDTRNFQDSD  296

Query  967   TSQISDEYRFSTAQTTPRFANV-RGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMS  1143
                  DE RFSTAQ+TPRF N  R SN P+T SKS+  +  FR +  +P YMA+TQSF +
Sbjct  297   WGLTGDECRFSTAQSTPRFINSERLSNPPLTPSKSVCADNLFRQFGNFPNYMANTQSFKA  356

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGR  1323
             K+RS SAPKQRPE GP   +KR+SLNE+MESR S SGVRMQ+SCS  QE +NFK+AV+G+
Sbjct  357   KVRSHSAPKQRPEPGP---KKRLSLNELMESRNSISGVRMQRSCSQVQEAINFKNAVLGK  413

Query  1324  LGRCTDY  1344
             L RC+++
Sbjct  414   LDRCSEF  420



>ref|XP_002514224.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48178.1| conserved hypothetical protein [Ricinus communis]
Length=429

 Score =   303 bits (776),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 217/429 (51%), Positives = 272/429 (63%), Gaps = 46/429 (11%)
 Frame = +1

Query  148   MGKVIKWLKGLF----------ttrqsnggrsgsggataatgLCHnpttippnitpAEAA  297
             MG+  +WLKGLF                  ++       ++GLCHNP TIPPNI+PAEAA
Sbjct  1     MGRATRWLKGLFGIRNNSSSSNKDNFDRKDKNRCSSGRDSSGLCHNPATIPPNISPAEAA  60

Query  298   WLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---GGP  468
             WL SFY  +  +E S HA    AA  AAA  A  AA  A A    R+ S  RG    GG 
Sbjct  61    WLRSFYNETE-KEQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSNGRGTMFGGG-  116

Query  469   LFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRA  648
                +ERWAAIKIQ  FRGYLARKALR LKGLVK+QA  RGYLVRKQA+ATLHSMQAL+RA
Sbjct  117   ---QERWAAIKIQTVFRGYLARKALRALKGLVKLQAHFRGYLVRKQATATLHSMQALIRA  173

Query  649   QATVLAQKSRPSIINH------PQKSIDKNKEARSENITSVHSGRYFASLGSEN----DV  798
             QATV +Q++R  I          +KS+++  E RSE+  SVHS R  +SL +      D 
Sbjct  174   QATVRSQRARNLIKTENRFEIRARKSMERFDETRSEHTASVHSRRLSSSLDATFVNPIDE  233

Query  799   ITKVVEMDT-SVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIS------TSQDFQ  957
               K+VE+DT    PK+  +SRR+ T V +F  +PF    SSPLP +         +++FQ
Sbjct  234   SPKIVEVDTGGCRPKS--RSRRTNTSVSDFSDDPFYQTLSSPLPSRFPPRLSMLDTRNFQ  291

Query  958   DLDTSQISDEYRFSTAQTTPRFANVRGSNN-PITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
             D D     DE RFSTAQ+TPRF    GSNN P+T +KS+  + +FR Y   P YMA+T+S
Sbjct  292   DSDWGLTGDECRFSTAQSTPRFG---GSNNPPLTPAKSVCEDNFFRQYGNCPNYMANTKS  348

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAV  1314
             F +K+RS SAPKQRP+ GP   +KR+SLNE+MESR S SGVRMQ+SCS  Q+ +NFK+AV
Sbjct  349   FKAKVRSYSAPKQRPDPGP---KKRLSLNELMESRNSISGVRMQRSCSQVQDAINFKNAV  405

Query  1315  IGRLGRCTD  1341
             +G+L RCTD
Sbjct  406   LGKLDRCTD  414



>ref|XP_010656256.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656257.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656258.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656259.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656260.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 ref|XP_010656261.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
 emb|CBI27990.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   302 bits (774),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 216/431 (50%), Positives = 274/431 (64%), Gaps = 49/431 (11%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsg--------------gataatgLCHnpttippnitp  285
             MG+  +W KGLF  ++    +  S                   + GLCHNPTTIPPNI+ 
Sbjct  1     MGRATRWFKGLFGLKRDKEHKDNSNPGDRKDKSRWSSGHSGRDSVGLCHNPTTIPPNISA  60

Query  286   AEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR--  459
             AEAAWL S+Y  +  E++ +       AA  AAA  A  AA  AA AVVR+ S  RG   
Sbjct  61    AEAAWLRSYYTDTENEQNKH---AIAVAAATAAAADAAVAAAQAAVAVVRLTSHGRGTMF  117

Query  460   -GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
              GG    RERW A+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLH MQA
Sbjct  118   GGG----RERWGAVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHGMQA  173

Query  637   LMRAQATVLAQKSRPSIIN------HPQKSIDKNKEARSENITSVHSGRYFASLGSENDV  798
             L+RAQATV AQK+R  I N        +KS+++  E+RSE+  S+HS R  ASL +  + 
Sbjct  174   LIRAQATVRAQKARELISNEKRFEIQTRKSMERFDESRSEHTASIHSRRLSASLDTTFNA  233

Query  799   IT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL--------PYKIST-  942
             I    K+VE+DT   PK+  +SRR+ T V +   +      SSPL        P ++ST 
Sbjct  234   IDGSPKIVEVDTG-RPKS--RSRRTNTSVSDSGDDQHYQTLSSPLPCRTPIPVPVRLSTP  290

Query  943   -SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYM  1119
               +++QD D     DE RFSTAQ+TPRF N   SN PIT +K++  + +FR Y  +P YM
Sbjct  291   DHRNYQDSDWGLTGDECRFSTAQSTPRFMNSERSNVPITPAKTVCADSFFRQYTNFPNYM  350

Query  1120  ASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             A+TQSF +KLRS SAPKQRPE GP   +KR+SLNEMMESR+S SGV+MQ+SCS  QE +N
Sbjct  351   ANTQSFKAKLRSHSAPKQRPEPGP---KKRLSLNEMMESRSSLSGVKMQRSCSRVQEAIN  407

Query  1300  FKSAVIGRLGR  1332
             FK+AV+G+L R
Sbjct  408   FKNAVMGKLER  418



>ref|XP_004288896.1| PREDICTED: uncharacterized protein LOC101305601 [Fragaria vesca 
subsp. vesca]
Length=439

 Score =   291 bits (744),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 210/445 (47%), Positives = 268/445 (60%), Gaps = 59/445 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggata---------------------atgLCHnptt  264
             MGK  +WLKGLF  ++           +A                      T LCHNP T
Sbjct  1     MGKATRWLKGLFGIKRDRDQHYKPSSDSALVSCFEYKKASSFGREASPPPETMLCHNPAT  60

Query  265   ippnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIAS  444
             IPPNI+P+EAAWL SFY  +  E+ S HA    AA  AAA  A  AA  A A    R+ S
Sbjct  61    IPPNISPSEAAWLRSFYNETENEQ-SKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTS  117

Query  445   RERGR---GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASA  615
               RG    GG    RERWAA+K+Q  +RGYLARKALR LKGLVK+QAL+RGYLVRKQA+A
Sbjct  118   NGRGTMFGGG----RERWAAVKVQTCYRGYLARKALRALKGLVKLQALVRGYLVRKQATA  173

Query  616   TLHSMQALMRAQATVLAQKSRPSIIN-----------HPQKSIDKNKEARSENITSVHSG  762
             TL  MQAL+RAQATV + KSR   +N             +KS ++  E+RSE+    HS 
Sbjct  174   TLQGMQALIRAQATVRSHKSRGLNLNINITEANRFEIRARKSTERFDESRSEHTAPSHSR  233

Query  763   RYFASLGSEN-----DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP  927
             R    L + +     D + K+VE+DT   PK+  +SRR+ T + E   + F    SSPLP
Sbjct  234   RLSGCLENNSSFSTIDEVPKIVEVDTG-RPKS--RSRRTNTSISELSDDQFYQAVSSPLP  290

Query  928   ------YKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYF  1089
                     I   ++FQD D     +E RFSTAQ+TPRF N  GSN P T +K++  E ++
Sbjct  291   CCCPGRLIIPDPRNFQDSDWGLTGEECRFSTAQSTPRFVNSFGSNAPATPAKTICAENFY  350

Query  1090  RNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK  1269
             R +  YP YM+STQSF +KLRS SAPKQRPE G    +KR+SLNE++ESR+S SGV+MQ+
Sbjct  351   RGFGNYPNYMSSTQSFKAKLRSHSAPKQRPEPGT---KKRLSLNELLESRSSLSGVKMQR  407

Query  1270  SCSHAQEVMNFKSAVIGRLGRCTDY  1344
             SCS  QEV+NFK+AV+G+L R +D+
Sbjct  408   SCSQVQEVINFKNAVMGKLDRSSDF  432



>ref|XP_011093642.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 14 [Sesamum 
indicum]
Length=427

 Score =   290 bits (742),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 219/435 (50%), Positives = 270/435 (62%), Gaps = 53/435 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsng----------------grsgsggataatgLCHnpttippni  279
             MG+  +WLKGLF  +                        SG   A   LCHNPTTIPPNI
Sbjct  1     MGRATRWLKGLFGIKIKEKERREYSGDGKGKEGRWSAGHSGRDDAVGTLCHNPTTIPPNI  60

Query  280   tpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR  459
             TPAEAAWL SFY  S  E + +          A A  AA AA   AA AVVR+ S+  GR
Sbjct  61    TPAEAAWLRSFYDESDKERNKH----------AIAVAAATAAXAQAAVAVVRLTSQ--GR  108

Query  460   GGPLF--CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQ  633
             G  +F   RE+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RG+LVRKQA+ATLHSMQ
Sbjct  109   GTAVFGGSREKWAAVKIQTVFRGYLARKALRALKGLVKIQALVRGFLVRKQAAATLHSMQ  168

Query  634   ALMRAQATVLAQKSRPSIINH----PQ-----KSIDKNKEARSENITSVHSGRYFASLGS  786
             AL+RAQA+V AQK R  I N     PQ       + K+ +ARSE+ TS+HS R  AS  +
Sbjct  169   ALIRAQASVRAQKIRRLINNEEGFPPQLQARISPLQKHDDARSEHPTSLHSRRLSASSEA  228

Query  787   EN---DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST-----  942
                  D   K+VE+DT        +SRR+ +W+ +     FG   SSP P +I       
Sbjct  229   AMNSFDESPKIVEVDTGSR--TRSRSRRANSWMLDSGEYSFGKATSSPFPCRIPARLPTP  286

Query  943   -SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYM  1119
              S++F D +     +E  FSTAQ+TPRF    G N P+T +KS+  E Y R+   +P YM
Sbjct  287   ESRNFPDQEWGLTGEECHFSTAQSTPRFTTSCGCNTPLTPAKSVCPESYSRSSGDHPNYM  346

Query  1120  ASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             A TQSF +KLRSQSAPKQRPE  PGPRR R+SL+E+MESR S SGVRMQ+SCS AQE +N
Sbjct  347   AKTQSFKAKLRSQSAPKQRPE--PGPRR-RLSLHEVMESRNSLSGVRMQRSCSQAQEAIN  403

Query  1300  FKSAVIGRLGRCTDY  1344
             FK+AV+G++GR +D+
Sbjct  404   FKNAVMGKIGRSSDF  418



>ref|XP_010249482.1| PREDICTED: protein IQ-DOMAIN 31-like [Nelumbo nucifera]
Length=435

 Score =   289 bits (740),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 194/373 (52%), Positives = 243/373 (65%), Gaps = 34/373 (9%)
 Frame = +1

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR--G  462
             +AAWL S+Y  +  E++ +  A+A A A AA A  A A A AA     R+ S+ RG   G
Sbjct  62    DAAWLRSYYSQTEKEQNKHAIAVAAATAAAADAAVAAAQAAAAVV---RLTSQGRGMTFG  118

Query  463   GPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM  642
             G    RE  AA KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+
Sbjct  119   GR---RENLAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALI  175

Query  643   RAQATVLAQKSRPSIINH----------PQKSIDKNKEARSENITSVHSGRYFASLGSEN  792
             RAQATV +QK+R ++ N           P+KSI++  E RSE+  S HS R  AS+    
Sbjct  176   RAQATVRSQKAR-TLHNREHISQPETRPPRKSIERFDETRSEHTASFHSRRLSASIDPAT  234

Query  793   DVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST------S  945
                    K+VE+DT V PK+  + RR+ T + E   +P     SSPLP +I         
Sbjct  235   TTFEESPKIVEIDT-VRPKS--RFRRTNTSMSECGEDPTYQTVSSPLPCQIPARLSIPDC  291

Query  946   QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAS  1125
             ++FQD D S   DE RFSTAQ+TPRF N  GSN P+T +KS+  + +FR +  +P YMA 
Sbjct  292   RNFQDFDWSFTGDECRFSTAQSTPRFVNSGGSNAPVTPAKSVCGDSFFRGHSNFPNYMAD  351

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFK  1305
             TQSF +K+RS SAPKQRPE GP   RKR+SLNEM+ESRAS SGVRMQ+SCS  QE  NFK
Sbjct  352   TQSFKAKVRSYSAPKQRPEPGP---RKRLSLNEMVESRASLSGVRMQRSCSQVQEAFNFK  408

Query  1306  SAVIGRLGRCTDY  1344
             +AV+GRL R  ++
Sbjct  409   NAVMGRLDRSAEF  421



>gb|KHG17476.1| Protein IQ-DOMAIN 14 -like protein [Gossypium arboreum]
Length=408

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 170/320 (53%), Positives = 217/320 (68%), Gaps = 30/320 (9%)
 Frame = +1

Query  433   RIASRERGR--GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQ  606
             R+ S  RG   GG     E+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRKQ
Sbjct  89    RLTSHGRGTMFGG---VHEKWAAVKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKQ  145

Query  607   ASATLHSMQALMRAQATVLAQKSRPSIINHP--------QKSIDKNKEARSENITSVHSG  762
             ASAT HSMQALMRAQAT+ +QK+R +IIN+         +KS+++  + RSE+  S+HS 
Sbjct  146   ASATFHSMQALMRAQATIKSQKAR-AIINNDAIRFDIRARKSMERFDDTRSEHTVSIHSR  204

Query  763   RYFASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK---  933
             R  ASL  + D   K+VE+DT + PKA  +SRR+ T + +F  +       SPLP +   
Sbjct  205   RLSASL--DIDESPKIVEVDTGIKPKA--RSRRTNTSISDFIDDHTYQTLPSPLPCRCPA  260

Query  934   ---ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEG  1104
                I  S+ +QD+D     DE RFSTA +TPRF N   S  P T +KS+    +FR    
Sbjct  261   RLSIPDSRHYQDIDWGFSGDECRFSTAHSTPRFIN---SCAPATPAKSVSGHNFFRPCGD  317

Query  1105  YPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHA  1284
              P YMA+TQSF +KLRS SAPKQRPE GP   +KR+SLNEMMESR+S SGV+MQ+SCS A
Sbjct  318   SPNYMANTQSFKAKLRSHSAPKQRPEPGP---KKRLSLNEMMESRSSLSGVKMQRSCSRA  374

Query  1285  QEVMNFKSAVIGRLGRCTDY  1344
             QE ++FK+AV+G+L R  ++
Sbjct  375   QEAIHFKNAVMGKLDRSLEF  394



>ref|XP_008450788.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis melo]
Length=410

 Score =   282 bits (721),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 207/417 (50%), Positives = 263/417 (63%), Gaps = 32/417 (8%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsg-----gataatgLCHnpttippnitpAEAAWLSSF  312
             MGK  +W K LF  ++                     LC+NP TIPPN++ AEAAWL SF
Sbjct  1     MGKATRWFKSLFGIKRDKEPTKEIPKSKPPTTAVDVQLCNNPATIPPNLSAAEAAWLKSF  60

Query  313   YGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---GGPLFCRE  483
             Y  +  +E S HA    AA  AAA  A  AA  A A    R+ S  RG    GG    RE
Sbjct  61    YSETE-KEQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSHGRGTMFGGG----RE  113

Query  484   RWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVL  663
             RWA++KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQATV 
Sbjct  114   RWASVKIQTCFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQATVR  173

Query  664   AQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTP  837
             +Q++R   IN  +KS ++ ++ +SE+  SVHS R  ASL +    +   K+VE+DT   P
Sbjct  174   SQRTR-RFINDSRKSTERFEDTKSEHTVSVHSRRLSASLDNTTFMEESPKIVEIDTG-RP  231

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTSQDFQDLDTSQISDEYRF-  996
             K+   SRR+ T   E   +PF    SSPLP       +I   + F +       D++R  
Sbjct  232   KSW--SRRTNTSASELSDDPFNQTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWRLI  289

Query  997   STAQTTPRF-ANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQ  1173
             STAQ+TPRF  +  GSN P T +KSM  E +FR Y  +P YMA+TQSF +KLRSQSAPKQ
Sbjct  290   STAQSTPRFMGSGGGSNGPPTPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQSAPKQ  349

Query  1174  RPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             RPE+G    +KRVSLNE+MESR S SGV+MQ+SCS  QE +NFK+AV+ +L R +++
Sbjct  350   RPEIGS---KKRVSLNELMESRNSLSGVKMQRSCSQVQEAINFKNAVMNKLDRPSEF  403



>ref|XP_004158419.1| PREDICTED: uncharacterized protein LOC101226199 [Cucumis sativus]
Length=410

 Score =   277 bits (708),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 205/417 (49%), Positives = 262/417 (63%), Gaps = 32/417 (8%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsg-----gataatgLCHnpttippnitpAEAAWLSSF  312
             MGK  +W K LF  ++                     LC+NP TIPPN++ AEAAWL SF
Sbjct  1     MGKATRWFKNLFGIKRDKEPTKEIPKSKPPTTAVDVQLCNNPATIPPNLSAAEAAWLKSF  60

Query  313   YGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---GGPLFCRE  483
             Y  +  +E S HA    AA  AAA  A  AA  A A    R+ S  RG    GG    RE
Sbjct  61    YSETE-KEQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSHGRGTMFGGG----RE  113

Query  484   RWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVL  663
             RWA++KIQ  FR YLARKALR LKGLVK+QAL+RGYLVRKQA+ATL+SMQAL+RAQATV 
Sbjct  114   RWASVKIQTCFRAYLARKALRALKGLVKLQALVRGYLVRKQATATLYSMQALIRAQATVR  173

Query  664   AQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTP  837
             +Q++R   IN  +KS ++ ++ +SE+  SVHS R  ASL +    +   K+VE+DT   P
Sbjct  174   SQRTR-RFINDARKSTERFEDTKSEHTVSVHSRRLSASLDNTTFMEESPKIVEIDTG-RP  231

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTSQDFQDLDTSQISDEYRF-  996
             K+   SRR+ T   E   +PF    SSPLP       +I   + F +       D++R  
Sbjct  232   KSW--SRRTNTSASELSDDPFNHTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWRLI  289

Query  997   STAQTTPRF-ANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQ  1173
             STAQ+TPRF  +  GSN P T +KSM  E +FR Y  +P YMA+TQSF +KLRSQSAPKQ
Sbjct  290   STAQSTPRFMGSGGGSNGPPTPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQSAPKQ  349

Query  1174  RPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             RPE+G    +KRVSLNE+MESR S SGV+MQ+SCS  QE +NFK+AV+ +L R +++
Sbjct  350   RPEIGS---KKRVSLNELMESRNSLSGVKMQRSCSQVQEAINFKNAVMSKLDRPSEF  403



>ref|XP_007204806.1| hypothetical protein PRUPE_ppa025288mg [Prunus persica]
 gb|EMJ06005.1| hypothetical protein PRUPE_ppa025288mg [Prunus persica]
Length=423

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 209/434 (48%), Positives = 267/434 (62%), Gaps = 55/434 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggat------------aatgLCHnpttippnitpAE  291
             MG+  +W KGLF  +  +     +  +              AT LCHNP TIPPNI+P+E
Sbjct  1     MGRATRWFKGLFGIKTKDKEYKANSSSDFKDTKGSSFGREDATLLCHNPATIPPNISPSE  60

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---G  462
             AAWL S+Y  +  EE + HA    AA  AAA  A  AA  A A    R+ S  RG    G
Sbjct  61    AAWLRSYYNETE-EEQNKHAIAVAAATAAAADAAVAAANAAVAVV--RLTSHGRGTMFGG  117

Query  463   GPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM  642
             G    RERWAA+K+Q  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+
Sbjct  118   G----RERWAAVKVQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALI  173

Query  643   RAQATVLAQKSRPSIINHPQKSIDKN--------------KEARSENITSVHSGRYFAS-  777
             RAQATV + K+R  +IN    +I+ N               +  SE+    HS R  AS 
Sbjct  174   RAQATVRSHKTR-GLINTTTNNIEANSRFEIRARKSMERFDDTGSEHTAPSHSRRLSASN  232

Query  778   LGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNP-FGPPHSSPLPYK------I  936
             L +  D   K+VE+DT   PK+  +SRR+ T V EF  +P +    SSP+P +      I
Sbjct  233   LDANIDESPKIVEVDTG-RPKS--RSRRTNTCVSEFSDDPTYQQALSSPIPCRGPARLSI  289

Query  937   STSQDFQDLDTSQISDEYRF-STAQTTPRFANVRGSNN-PITLSKSMFMEPYFRNYEGYP  1110
               S++F + D     DE RF STAQ+TPRF N  G++N P T SKS+  + +FR Y   P
Sbjct  290   PDSRNFPESDWGLAGDECRFVSTAQSTPRFVNSCGASNLPGTPSKSVCADNFFRGYA--P  347

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
              YMASTQSF +KLRS SAPKQRP+ GP   ++R+SL+EM+ESR S SGVRMQ+SCS AQ+
Sbjct  348   NYMASTQSFKAKLRSHSAPKQRPDTGP---KRRLSLHEMLESRNSLSGVRMQRSCSQAQD  404

Query  1291  VMNFKSAVIGRLGR  1332
              +NFK+A++ +L R
Sbjct  405   AINFKNAIMSKLDR  418



>ref|XP_006451315.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451316.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451317.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451318.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 ref|XP_006451319.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64555.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64556.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64557.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64558.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|ESR64559.1| hypothetical protein CICLE_v10008287mg [Citrus clementina]
 gb|KDO66596.1| hypothetical protein CISIN_1g013213mg [Citrus sinensis]
Length=447

 Score =   277 bits (708),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 191/385 (50%), Positives = 252/385 (65%), Gaps = 27/385 (7%)
 Frame = +1

Query  244   LCHnpttippnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaa  423
             LC+NP TIPPN++PAEAAW+ S+Y     +E + HA    AA  AAA  A  AA  A A 
Sbjct  56    LCYNPATIPPNMSPAEAAWIRSYYATETEKEQNKHAIAVAAATAAAADAAVAAAQAAVAV  115

Query  424   avvRIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRK  603
                R+ S  RG        E+WAA+KIQ+ FRGYLAR+ALR LKGLVK+QA +RGYLVRK
Sbjct  116   V--RLTSHGRGTMFGGATHEKWAAVKIQSVFRGYLARRALRALKGLVKLQAHVRGYLVRK  173

Query  604   QASATLHSMQALMRAQATVLAQKSRPS----------IINHPQKSIDK-NKEARSEN-IT  747
             Q +ATLH MQAL+RAQ T  +Q++R            + +  +KS+++ + E RSE    
Sbjct  174   QTTATLHGMQALIRAQVTARSQRARACGGLTNNNSNRLESRARKSMERYDDETRSEQAAV  233

Query  748   SVHSGRYFASLGSENDVITKVVEMDT-SVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL  924
             S+HS R  AS+ +  D   K+VE+DT S  PK+  +SRR+ T V +F  +P     SSPL
Sbjct  234   SIHSRRLSASIDTTIDESPKIVEVDTGSNRPKS--RSRRTNTSVSDFSDDPHYQTISSPL  291

Query  925   PYK------ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPY  1086
             P +      I   ++FQ+ D     DE +FSTAQ+TPRF +   S  P T +KS+  + +
Sbjct  292   PSRIYQCLSIPDGRNFQESDWGLTGDECKFSTAQSTPRFVSFDRSKAPATPAKSVCADNF  351

Query  1087  FRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQ  1266
             FR Y  +P YMA+T+SF +KLRS SAPKQRPE  PGP+R R+SLNEMMESR+S SG+RMQ
Sbjct  352   FRQYN-FPNYMANTKSFKAKLRSHSAPKQRPE--PGPKR-RLSLNEMMESRSSLSGIRMQ  407

Query  1267  KSCSHAQEVMNFKSAVIGRLGRCTD  1341
             +SCS AQEV++FK+ VIG+L R T+
Sbjct  408   RSCSQAQEVISFKNTVIGKLDRSTE  432



>ref|XP_008242480.1| PREDICTED: protein IQ-DOMAIN 14-like [Prunus mume]
 ref|XP_008242481.1| PREDICTED: protein IQ-DOMAIN 14-like [Prunus mume]
Length=424

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 208/434 (48%), Positives = 268/434 (62%), Gaps = 54/434 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggata-------------atgLCHnpttippnitpA  288
             MG+  +W KGLF  +  +     +  ++              AT LCHNP TIPPNI+P+
Sbjct  1     MGRATRWFKGLFGIKTKDKEHKANSSSSDFKDTKGSSFGREDATLLCHNPATIPPNISPS  60

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---  459
             EAAWL S+Y  +  EE + HA    AA  AAA  A  AA  A      R+ S  RG    
Sbjct  61    EAAWLRSYYNETE-EEQNKHAIAVAAATAAAADAAVAAANAAVEVV--RLTSHGRGTMFG  117

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             GG    RERWAA+K+Q  FRGYLAR+ALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL
Sbjct  118   GG----RERWAAVKVQTVFRGYLARRALRALKGLVKLQALVRGYLVRKQATATLHSMQAL  173

Query  640   MRAQATVLAQKSRPSIINHP-------------QKSIDKNKEARSENITSVHSGRYFAS-  777
             +RAQATV + K+R  I   P             +KS ++  +  SE+    HS R  AS 
Sbjct  174   IRAQATVRSHKTRGLINTTPNNIEANSRFEIRARKSRERFDDTGSEHTAPSHSRRLSASN  233

Query  778   LGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNP-FGPPHSSPLPYK------I  936
             L +  D   K+VE+DT   PK+  +SRR+ T V EF  +P +    SSP+P +      I
Sbjct  234   LDANIDESPKIVEVDTG-RPKS--RSRRTNTCVSEFSDDPTYQQALSSPIPCRGPARLSI  290

Query  937   STSQDFQDLDTSQISDEYRF-STAQTTPRFANVRGSNN-PITLSKSMFMEPYFRNYEGYP  1110
               S++F + D     DE RF STAQ+TPRF N  G++N P T SKS+  + +FR Y   P
Sbjct  291   PDSRNFPESDWGLAGDECRFISTAQSTPRFVNSCGASNLPGTPSKSVCADNFFRGYA--P  348

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
              YMASTQSF +KLRS SAPKQRPE GP   ++R+SL+EM+ESR+S SGVRMQ+SCS AQ+
Sbjct  349   NYMASTQSFKAKLRSHSAPKQRPETGP---KRRLSLHEMLESRSSLSGVRMQRSCSQAQD  405

Query  1291  VMNFKSAVIGRLGR  1332
              +NFK+A++ +L R
Sbjct  406   AINFKNAIMSKLDR  419



>ref|XP_009781989.1| PREDICTED: uncharacterized protein LOC104230803 [Nicotiana sylvestris]
Length=434

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 218/454 (48%), Positives = 264/454 (58%), Gaps = 81/454 (18%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg----------------------------  243
             MGK I+WLKGLF  R+       +      +                             
Sbjct  1     MGKAIRWLKGLFGIRKLENNHKETEEKDRISTTCFGHSGRDTTTATVTATATAVSAAAGG  60

Query  244   LCHnpttippnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaa  423
             LCHNPTTIPPNITPAEAAWLSSFYG    +E S HA    AA  AAA  A  AA  A A 
Sbjct  61    LCHNPTTIPPNITPAEAAWLSSFYGQDSDKEQSKHAIAVAAATAAAADAAVAAAQAAVAV  120

Query  424   avvRIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRK  603
                R+ S+ R     +F RE+WAA KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRK
Sbjct  121   V--RLTSQSRNTA--VFGREKWAATKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRK  176

Query  604   QASATLHSMQALMRAQATVLAQKSRPSII-----NHPQ----KSIDKNKEARSENITSVH  756
             QA+ATLHSMQALMRAQA+V AQKSR         +HPQ    KSI++ +E+RS +    H
Sbjct  177   QATATLHSMQALMRAQASVRAQKSRGGFFINNQNSHPQFQARKSIERFEESRSGHTMQSH  236

Query  757   SGRYFASLGSEN----DVITKVVEMDTSVTPKASRKSRRSKTWV-PEFQGNPFGPPHSSP  921
             S R  AS  + N    +   K+VEMDT   PK+  KSRR+ TWV  +   + F      P
Sbjct  237   SRRLSASFEANNINASEESAKIVEMDTG-RPKS--KSRRTNTWVSSDSCDDSF-----KP  288

Query  922   LPYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP------  1083
             +P       +F DL            TAQ+TPRFAN  GSN PIT +KS+  E       
Sbjct  289   MP-------EFADLAI----------TAQSTPRFANSCGSNTPITPAKSVCGESYYFRNN  331

Query  1084  ----YFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQS  1251
                    N   YP YMA TQSF +KLRSQSAPKQR E   GP+ K+VSLNEMMESRAS S
Sbjct  332   NYYYDNNNNYYYPNYMAKTQSFKAKLRSQSAPKQRLEHVIGPKMKKVSLNEMMESRASLS  391

Query  1252  GVRMQKSCSHAQEVMNFKSAVIGRLGRCTDYPYM  1353
             GV+MQ+SCS AQ+ +NFK+ ++G+LG  T++  +
Sbjct  392   GVKMQRSCSQAQDKINFKNTIMGKLGNSTEFTRL  425



>ref|XP_006475587.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Citrus sinensis]
 ref|XP_006475588.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Citrus sinensis]
Length=455

 Score =   275 bits (703),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 194/391 (50%), Positives = 254/391 (65%), Gaps = 31/391 (8%)
 Frame = +1

Query  244   LCHnpttippnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaa  423
             LC+NP TIPPN++PAEAAW+ S+Y     +E + HA    AA  AAA     AAA AA A
Sbjct  56    LCYNPATIPPNMSPAEAAWIRSYYATETEKEQNKHAIAVAAATAAAADAXXXAAADAAVA  115

Query  424   avv------RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLR  585
             A        R+ S  RG        E+WAA+KIQ+ FRGYLAR+ALR LKGLVK+QA +R
Sbjct  116   AAQAAVAVVRLTSHGRGTMFGGATHEKWAAVKIQSVFRGYLARRALRALKGLVKLQAHVR  175

Query  586   GYLVRKQASATLHSMQALMRAQATVLAQKSRPS----------IINHPQKSIDK-NKEAR  732
             GYLVRKQ +ATLH MQAL+RAQ T  +Q++R            + +  +KS+++ + E R
Sbjct  176   GYLVRKQTTATLHGMQALIRAQVTARSQRARACGGLTNNNSNRLESRARKSMERYDDETR  235

Query  733   SEN-ITSVHSGRYFASLGSENDVITKVVEMDT-SVTPKASRKSRRSKTWVPEFQGNPFGP  906
             SE    S+HS R  AS+ +  D   K+VE+DT S  PK+  +SRR+ T V +F  +P   
Sbjct  236   SEQAAVSIHSRRLSASIDTTIDESPKIVEVDTGSNRPKS--RSRRTNTSVSDFSDDPHYQ  293

Query  907   PHSSPLPYK------ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKS  1068
               SSPLP +      I   ++FQ+ D     DE +FSTAQ+TPRF +   S  P T +KS
Sbjct  294   TISSPLPSRIYQCLSIPDGRNFQESDWGLTGDECKFSTAQSTPRFVSFDRSKAPATPAKS  353

Query  1069  MFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQ  1248
             +  + +FR Y  +P YMA+T+SF +KLRS SAPKQRPE  PGP+R R+SLNEMMESR+S 
Sbjct  354   VCADNFFRQYN-FPNYMANTKSFKAKLRSHSAPKQRPE--PGPKR-RLSLNEMMESRSSL  409

Query  1249  SGVRMQKSCSHAQEVMNFKSAVIGRLGRCTD  1341
             SGVRMQ+SCS AQEV++FK+ VIG+L R T+
Sbjct  410   SGVRMQRSCSQAQEVISFKNTVIGKLDRSTE  440



>gb|KHG26933.1| Protein IQ-DOMAIN 31 -like protein [Gossypium arboreum]
Length=414

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 204/418 (49%), Positives = 260/418 (62%), Gaps = 36/418 (9%)
 Frame = +1

Query  148   MGKVIKWLKGLF------------ttrqsnggrsgsggataatgLCHnpttippnitpAE  291
             MGK  +WLK LF              +       G  G  ++ GLCHNPTTIPPNI+PAE
Sbjct  1     MGKATRWLKSLFGIKNNKECPSSGDRKDKKRCSIGHSGRESSGGLCHNPTTIPPNISPAE  60

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
               WL SFY  +  E++ +       AA  AAA  A  AA  AA AVVR+ S  RG     
Sbjct  61    VVWLRSFYNETEKEQNKH---AIAVAAATAAAADAAVAAAQAAVAVVRLTSHGRGTMVGG  117

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
                E+WAAIKIQ+ FRGYLA+KALR LKGLVKIQAL+RGYL+RKQASATLH MQAL+RAQ
Sbjct  118   GGHEKWAAIKIQSVFRGYLAKKALRALKGLVKIQALVRGYLLRKQASATLHGMQALIRAQ  177

Query  652   ATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN-DVITKVVEMDTS  828
             AT+ +QK+R        KS+++  + RSE   S HS R  ASL + N +   K+VE+DT 
Sbjct  178   ATIRSQKAR--------KSMEQFDDTRSERTVSFHSRRLSASLDTLNIEESPKIVEIDTG  229

Query  829   VTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQD--LDTSQISDEYRFST  1002
               PK+  +SRR+ T V +F  +P     SS +P ++       D   D     DE RFST
Sbjct  230   -RPKS--RSRRTNTSVSDFGDDPSFQILSSSVPSRVPARLSVPDSHTDWGLTGDECRFST  286

Query  1003  AQTTPRFANVRGSNNPITLSKSMFMEPYFRNYE----GYPKYMASTQSFMSKLRSQSAPK  1170
             AQ+TPRF N   SN P+T +KS+  + +FR+Y      +P YMA+TQSF +KLRS SAPK
Sbjct  287   AQSTPRFINCCVSNAPVTPAKSVCADNFFRHYGIGNLNFPNYMANTQSFKAKLRSHSAPK  346

Query  1171  QRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             QRPE GP   +KR+SL E  ESR+S SG RMQ+SCS AQE ++FK+ V+G+L R  ++
Sbjct  347   QRPEPGP---KKRLSLVETTESRSSLSGARMQRSCSQAQEAISFKNVVMGKLDRSLEF  401



>ref|XP_009604096.1| PREDICTED: protein IQ-DOMAIN 14-like [Nicotiana tomentosiformis]
Length=426

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 216/443 (49%), Positives = 261/443 (59%), Gaps = 74/443 (17%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg----------------------LCHnpt  261
             MGK I+WLK LF  R+       +                              LCHNPT
Sbjct  1     MGKAIRWLKDLFGIRKLENNHKETKENDKIVTTCFGHSGRDTTTATAVSAATGRLCHNPT  60

Query  262   tippnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIA  441
             TIPPNITPAEAAWLSSFYG    +E S HA    AA  AAA  A  AA  A A    R+ 
Sbjct  61    TIPPNITPAEAAWLSSFYGQDSDKEQSKHAIAVAAATAAAADAAVAAAHAAVAVV--RLT  118

Query  442   SRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATL  621
             S+  GR   +F RE+WAA KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRKQA+ATL
Sbjct  119   SQ--GRSTAVFGREKWAATKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKQATATL  176

Query  622   HSMQALMRAQATVLAQKSRPSII-----NHPQ----KSIDKNKEARSENITSVHSGRYFA  774
             HSMQALMRAQA+V AQKSR         +HPQ    KS   ++E+RS +    HS R  A
Sbjct  177   HSMQALMRAQASVRAQKSRGGFFINHQNSHPQFQARKSHGHSEESRSGHTMQSHSRRLSA  236

Query  775   SLGSEN----DVITKVVEMDTSVTPKASRKSRRSKTWV-PEFQGNPFGPPHSSPLPYKIS  939
             S  + N    +   K+VEMDT   PK+     R+ TW+  +   + F      P+P    
Sbjct  237   SFEANNVNASEESAKIVEMDTG-RPKS---RSRTNTWISSDSCDDSF-----KPMP----  283

Query  940   TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPY-FR-------N  1095
                +F DL            TAQ+TPRFAN  GSN PIT +KS+ +E Y FR       N
Sbjct  284   ---EFADLAI----------TAQSTPRFANSCGSNTPITPAKSVCVESYCFRNDNYYDNN  330

Query  1096  YEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSC  1275
                YP YMA TQSF +KLRSQSAPKQRPE   GP+ K++SL EMMESRAS SGV+MQ+SC
Sbjct  331   NNYYPNYMAKTQSFKAKLRSQSAPKQRPEPVIGPKIKKMSLTEMMESRASLSGVKMQRSC  390

Query  1276  SHAQEVMNFKSAVIGRLGRCTDY  1344
             S AQE +NFK+A++ +LG  T++
Sbjct  391   SQAQEKINFKNAIMCKLGNSTEF  413



>ref|XP_004135807.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215651, 
partial [Cucumis sativus]
Length=345

 Score =   265 bits (678),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 208/299 (70%), Gaps = 17/299 (6%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWA++KIQ  FR YLARKALR LKGLVK+QAL+RGYLVRKQA+ATL+SMQAL+RAQAT
Sbjct  47    RERWASVKIQTCFRAYLARKALRALKGLVKLQALVRGYLVRKQATATLYSMQALIRAQAT  106

Query  658   VLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSV  831
             V +Q++R   IN  +KS ++ ++ +SE+  SVHS R  ASL +    +   K+VE+DT  
Sbjct  107   VRSQRTR-RFINDARKSTERFEDTKSEHTVSVHSRRLSASLDNTTFMEESPKIVEIDTG-  164

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTSQDFQDLDTSQISDEYR  993
              PK+   SRR+ T   E   +PF    SSPLP       +I   + F +       D++R
Sbjct  165   RPKS--WSRRTNTSASELSDDPFNHTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWR  222

Query  994   F-STAQTTPRF-ANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAP  1167
               STAQ+TPRF  +  GSN P T +KSM  E +FR Y  +P YMA+TQSF +KLRSQSAP
Sbjct  223   LISTAQSTPRFMGSGGGSNGPPTPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQSAP  282

Query  1168  KQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             KQRPE+G    +KRVSLNE+MESR S SGV+MQ+SCS  QE +NFK+AV+ +L R +++
Sbjct  283   KQRPEIGS---KKRVSLNELMESRNSLSGVKMQRSCSQVQEAINFKNAVMSKLDRPSEF  338



>gb|KHN14257.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=417

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 202/434 (47%), Positives = 262/434 (60%), Gaps = 54/434 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsg-------------sggataatgLCHnpttippnitpA  288
             MG+  +W+K LF  R+    +               S   + +  LCHNP TI PN++ A
Sbjct  1     MGRATRWVKSLFGIRKEKEKKQNFKCGEAKSMEFCCSESTSNSRVLCHNPGTITPNLSQA  60

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGP  468
             EAAWL SFY      +H+   A A A AT AA  AA AA         R+ S+  GRGG 
Sbjct  61    EAAWLQSFYTEKDQNKHAIAVAAAPAGATDAAMAAAQAAVAVV-----RLTSQ--GRGGT  113

Query  469   LFCR--ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM  642
             +F    E WAAIKIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+
Sbjct  114   MFGVGPEMWAAIKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALV  173

Query  643   RAQATVLAQKSRPSIIN---------HPQKSIDKNKEARSENITSVHSGR---YFASLGS  786
             RAQAT+ + KSR  +             ++S+++  + +SE    +HS R   YF +  +
Sbjct  174   RAQATIRSHKSRRLMTTKNEAYRSQIRARRSMERFDDTKSEYAVPIHSRRVSSYFDATIN  233

Query  787   ENDV--ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST--SQDF  954
              N V  I K+VE+DT  TPK+     R++  V +F   P     S+  P ++S    ++F
Sbjct  234   NNSVDGIPKIVEVDT-FTPKS-----RNRRTVSDFGDEPSLQALSNRTPTRLSIPDQRNF  287

Query  955   QDLDTSQISDEYRF-STAQTTPRFANVRGSNN---PITLSKSMFMEPYF--RNYEGYPKY  1116
             QD +     +E RF STAQ+TPRF N     +   P+T  KS+  +  F  R Y  +P Y
Sbjct  288   QDSEWGLTGEECRFSSTAQSTPRFTNSCSCGSVAVPMT-PKSVCTDNLFFLRQYGNFPNY  346

Query  1117  MASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVM  1296
             MASTQSF +KLRS SAPKQRPE GP   RKR+SLNEMMESR+S SGVRMQ+SCS  QEV+
Sbjct  347   MASTQSFKAKLRSHSAPKQRPEPGP---RKRISLNEMMESRSSLSGVRMQRSCSQVQEVI  403

Query  1297  NFKSAVIGRLGRCT  1338
             +FK+AV+G+L + T
Sbjct  404   SFKNAVMGKLQKST  417



>ref|XP_006583555.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=417

 Score =   267 bits (682),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 202/434 (47%), Positives = 262/434 (60%), Gaps = 54/434 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsg-------------sggataatgLCHnpttippnitpA  288
             MG+  +W+K LF  R+    +               S   + +  LCHNP TI PN++ A
Sbjct  1     MGRATRWVKSLFGIRKEKEKKQNFKCGEAKSMEFCCSESTSNSRVLCHNPGTITPNLSQA  60

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGP  468
             EAAWL SFY      +H+   A A AAA  AA  AA AA         R+ S+  GRGG 
Sbjct  61    EAAWLQSFYTEKDQNKHAIAVAAATAAAADAAMAAAQAAVAVV-----RLTSQ--GRGGT  113

Query  469   LFCR--ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM  642
             +F    E WAAIKIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+
Sbjct  114   MFGVGPEMWAAIKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALV  173

Query  643   RAQATVLAQKSRPSIIN---------HPQKSIDKNKEARSENITSVHSGR---YFASLGS  786
             RAQAT+ + KSR  +             ++S+++  + +SE    +HS R   YF +  +
Sbjct  174   RAQATIRSHKSRRLMTTKNEAYRSQIRARRSMERFDDTKSEYAVPIHSRRVSSYFDATIN  233

Query  787   ENDV--ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST--SQDF  954
              N V  I K+VE+DT  TPK+     R++  V +F   P     S+  P ++S    ++F
Sbjct  234   NNSVDGIPKIVEVDT-FTPKS-----RNRRTVSDFGDEPSLQALSNRTPTRLSIPDQRNF  287

Query  955   QDLDTSQISDEYRF-STAQTTPRFANVRGSNN---PITLSKSMFMEPYF--RNYEGYPKY  1116
             QD +     +E RF STAQ+TPRF N     +   P+T  KS+  +  F  R Y  +P Y
Sbjct  288   QDSEWGLTGEECRFSSTAQSTPRFTNSCSCGSVAVPMT-PKSVCTDNLFFLRQYGNFPNY  346

Query  1117  MASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVM  1296
             MASTQSF +KLRS SAPKQRPE GP   RKR+SLNEMMESR+S SGVRMQ+SCS  QEV+
Sbjct  347   MASTQSFKAKLRSHSAPKQRPEPGP---RKRISLNEMMESRSSLSGVRMQRSCSQVQEVI  403

Query  1297  NFKSAVIGRLGRCT  1338
             +FK+AV+G+L + T
Sbjct  404   SFKNAVMGKLQKST  417



>gb|KGN66184.1| hypothetical protein Csa_1G575000 [Cucumis sativus]
Length=366

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 160/299 (54%), Positives = 208/299 (70%), Gaps = 17/299 (6%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWA++KIQ  FR YLARKALR LKGLVK+QAL+RGYLVRKQA+ATL+SMQAL+RAQAT
Sbjct  68    RERWASVKIQTCFRAYLARKALRALKGLVKLQALVRGYLVRKQATATLYSMQALIRAQAT  127

Query  658   VLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSV  831
             V +Q++R   IN  +KS ++ ++ +SE+  SVHS R  ASL +    +   K+VE+DT  
Sbjct  128   VRSQRTR-RFINDARKSTERFEDTKSEHTVSVHSRRLSASLDNTTFMEESPKIVEIDTG-  185

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTSQDFQDLDTSQISDEYR  993
              PK+   SRR+ T   E   +PF    SSPLP       +I   + F +       D++R
Sbjct  186   RPKSW--SRRTNTSASELSDDPFNHTLSSPLPCRTPSRLQIPDCRHFHENSDFCGGDDWR  243

Query  994   F-STAQTTPRF-ANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAP  1167
               STAQ+TPRF  +  GSN P T +KSM  E +FR Y  +P YMA+TQSF +KLRSQSAP
Sbjct  244   LISTAQSTPRFMGSGGGSNGPPTPAKSMCGENFFRGYLNFPNYMANTQSFKAKLRSQSAP  303

Query  1168  KQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             KQRPE+G    +KRVSLNE+MESR S SGV+MQ+SCS  QE +NFK+AV+ +L R +++
Sbjct  304   KQRPEIGS---KKRVSLNELMESRNSLSGVKMQRSCSQVQEAINFKNAVMSKLDRPSEF  359



>emb|CDP03247.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   264 bits (675),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 212/442 (48%), Positives = 262/442 (59%), Gaps = 60/442 (14%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgs----------------ggataatgLCHnpttippni  279
             MG+  +WLK LF  ++  G +  +                 G   A GLC NP TIPPNI
Sbjct  1     MGRATRWLKSLFGIKRDKGQKEINPNSGSQRENKWTGMGHSGRDTADGLCSNPNTIPPNI  60

Query  280   tpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR  459
             TPAEAAWL SFY  SG +E S HA    AA  AAA  A  AA  A A    R+ S+ RG 
Sbjct  61    TPAEAAWLRSFYADSGDKEQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSQGRGG  118

Query  460   GGPLFCR---ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
                       E+WA  KIQ+ FRG+LARKALR LKGLVK+QAL+RGYLVRKQA AT HSM
Sbjct  119   SMFGGGGGSREKWAVTKIQSVFRGFLARKALRALKGLVKLQALVRGYLVRKQAFATFHSM  178

Query  631   QALMRAQATVLAQKSRPSIIN---------HPQKSIDKNKEARSENITSVHSGRYFASLG  783
             QAL+RAQA V AQK+R  + +         H   S +K  E RS    S H+ R  AS  
Sbjct  179   QALIRAQANVRAQKTRGLLDSTAASSNRQFHAANSAEKFDEGRSRQ-NSFHNRRLSASFD  237

Query  784   SEN----DVITKVVEMDTSVTPKASRKSRRSKTWVPE-FQGNP----------FGPPHSS  918
             S N    D I K+VE+DT   PK+  +   S  WV +   G+           + PPH S
Sbjct  238   SINSNAIDEIPKIVEIDTG-RPKSRSRR--SSAWVSDSISGDAQTLSSSCQCRYPPPHLS  294

Query  919   PLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY  1098
                  I   ++ QD D     DE RFST Q+TPRF+N  G+N P+T +KS+ +E  FRN 
Sbjct  295   -----IPDCRNSQDSDWGLTGDECRFSTPQSTPRFSNSCGTNPPVTPAKSVCVESLFRN-  348

Query  1099  EGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
                P YMA+TQSF +KLRS SAPKQRPE  PG +R R+SLNEMMESR+S SGVRMQ+SCS
Sbjct  349   --CPNYMANTQSFKAKLRSYSAPKQRPE--PGSKR-RLSLNEMMESRSSLSGVRMQRSCS  403

Query  1279  HAQEVMNFKSAVIGRLGRCTDY  1344
               QEV++F++AV+GRL R +++
Sbjct  404   QVQEVLSFRNAVVGRLARSSEF  425



>ref|XP_007160280.1| hypothetical protein PHAVU_002G308100g [Phaseolus vulgaris]
 gb|ESW32274.1| hypothetical protein PHAVU_002G308100g [Phaseolus vulgaris]
Length=437

 Score =   263 bits (672),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 203/435 (47%), Positives = 269/435 (62%), Gaps = 50/435 (11%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsg-------gataatgLCHnpttippnitpAEAAWLS  306
             MG+ I+WLKGLF  +     +  S            + GLCHNPTTIPPNI+PAEAAWL 
Sbjct  1     MGRAIRWLKGLFGVKIDRERKENSNHGTKWCHSDRDSRGLCHNPTTIPPNISPAEAAWLQ  60

Query  307   SFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR-----GGPL  471
             SFY  +  E++ +       AA  AAA  A  AA  AA AVVR+ S   GR     GG  
Sbjct  61    SFYSETEKEQNKH---AIAVAAATAAAADAAVAAAQAAVAVVRLTSHGNGRDTMFGGG--  115

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
               RER A +KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQ
Sbjct  116   --RERLAVVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIRAQ  173

Query  652   ATVLAQKSRPSII---------NHPQKSIDKNKEARSENITSVHSGR----YFASLGSEN  792
             ATV ++KSR  +             ++S+++  + +SE I  +HS R    + A++ + N
Sbjct  174   ATVRSKKSRGIMSTKNETHRFQTQARRSMERFDDIKSEYIAPIHSRRLSSSFDATMNNAN  233

Query  793   DVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPY---KISTSQDF  954
             + I    K+VE+DT   PK+  +SRRS T + +F  +P      SPLP+    I   + F
Sbjct  234   NSIDGSPKIVEVDTG-RPKS--RSRRSNTSMSDFGDDPSFQTLPSPLPFTHLSIPNHRTF  290

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NYEGYPKYM  1119
              D +     +E RFSTAQ+TPRF N     +    P+T  +S+  E +F   Y  +P YM
Sbjct  291   HDSEWGLTGEECRFSTAQSTPRFTNSCSCGSLVVAPMT-PRSVCTENFFYGQYHNFPNYM  349

Query  1120  ASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             A+TQSF +KLRS SAPKQRP+ G    +K+++LNEMMESR+S SG RMQ+SCS  QE +N
Sbjct  350   ANTQSFKAKLRSHSAPKQRPDPGS---KKKLTLNEMMESRSSLSGARMQRSCSQIQEAIN  406

Query  1300  FKSAVIGRLGRCTDY  1344
             FK+AV+ +L + T++
Sbjct  407   FKNAVMSKLQKSTEF  421



>gb|KHN26986.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=435

 Score =   260 bits (665),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 207/442 (47%), Positives = 274/442 (62%), Gaps = 50/442 (11%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg-LCHnpttippnitpAEAAWLSSFYGPS  324
             MG+ I+WLKGLF  R     +  S  +   +  LCHNPTTIPPNI+PAEAAWL SFY  +
Sbjct  1     MGRAIRWLKGLFGIRTDRERKENSNHSDRDSRGLCHNPTTIPPNISPAEAAWLQSFYSET  60

Query  325   GGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR-----GGPLFCRERW  489
               E++ +       AA  AAA  A   A  AA AVVR+ S   GR     GG    +ER 
Sbjct  61    EKEQNKH---AIAVAAATAAAADAAVTAAQAAVAVVRLTSHGNGRDTMFGGG---GQERL  114

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             A +KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQATV ++
Sbjct  115   AVVKIQTFFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIRAQATVRSK  174

Query  670   KSR--PSIIN-------HPQKSIDKNKEARSENITSVHSGR----YFASLGSENDVIT--  804
             KS    S  N         ++S+++  + +SE I  +HS R    + A++ + N V    
Sbjct  175   KSHGLSSTKNEAHLFQTQARRSMERFDDIKSEYIAPIHSRRLSSSFDATMNNANSVDGSP  234

Query  805   KVVEMDT-SVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQI-  978
             K+VE+DT S  PK+  +SRRS T + +F  +P      SPLP+   +  + ++   S+  
Sbjct  235   KIVEVDTGSGRPKS--RSRRSNTSMSDFGDDPSFQALPSPLPFAHLSIPNLRNYHNSEWG  292

Query  979   ----SDEYRFSTAQTTPRFANVRGSNN----PITLS-KSMFMEPYFR-NYEGYPKYMAST  1128
                  +E RFSTAQ+TPRF N     +    P++++ KS+  E +F   Y  +P YMAST
Sbjct  293   LTGEEEECRFSTAQSTPRFTNSCSCGSVVVAPMSMTPKSVCTENFFYGQYHNFPNYMAST  352

Query  1129  QSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKS  1308
             QSF +KLRS SAPKQRP+ GP   +KR++LNEMMESR+S SG RMQ+SCS  QE +NFK+
Sbjct  353   QSFKAKLRSHSAPKQRPDPGP---KKRLTLNEMMESRSSLSGTRMQRSCSQIQEAINFKN  409

Query  1309  AVIGR------LGRCTDYPYMN  1356
             AV+ +      LGR T+  + N
Sbjct  410   AVMSKLQKSAELGRDTELNFSN  431



>ref|XP_011080380.1| PREDICTED: protein IQ-DOMAIN 14-like [Sesamum indicum]
Length=398

 Score =   259 bits (661),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 158/303 (52%), Positives = 201/303 (66%), Gaps = 29/303 (10%)
 Frame = +1

Query  451   RGRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLH  624
             +GRGG LF   RERWAA+KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRK+A+ATLH
Sbjct  106   QGRGG-LFAGGRERWAAVKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLH  164

Query  625   SMQALMRAQATVLAQKSRPSIIN----HPQ----KSIDKNKEARSENITSVHSGRYFASL  780
             SMQAL+RAQA + +Q++R S  N     P+    KSI++  EARS+     HS R  AS 
Sbjct  165   SMQALIRAQAAIRSQRARRSTNNEHRFQPEMRVRKSIERFDEARSDQF---HSKRISASY  221

Query  781   G---SENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YK  933
                 +  D   K+VE+DT   PK+  +SRR  T + E+  + +    SSPLP      + 
Sbjct  222   NPYLNAFDESPKIVEIDT-YGPKS--RSRRMSTCMSEYGDDQYYQVTSSPLPCSFPNHFP  278

Query  934   ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPK  1113
             I   +  QD D     ++Y+F+TAQ+TPRFA    SN P T +KS+  +  FR Y  YP 
Sbjct  279   IPDCRHVQDSDWGYTEEDYKFATAQSTPRFACTGRSNAPATPAKSVCADSLFRPYSNYPS  338

Query  1114  YMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEV  1293
             YMA+TQSF +KLRS SAPKQRPELGP   ++R+SLNE+M SR+S SGVRMQ+SCS  QE 
Sbjct  339   YMANTQSFRAKLRSHSAPKQRPELGP---KRRLSLNEVMSSRSSFSGVRMQRSCSQVQEE  395

Query  1294  MNF  1302
               F
Sbjct  396   FEF  398



>ref|XP_006353577.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=416

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 209/433 (48%), Positives = 261/433 (60%), Gaps = 62/433 (14%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsn----------------ggrsgsggataatgLCHnpttippni  279
             MGK IKWLKGLF  ++                     +    A  +  LCHNPTTIPPNI
Sbjct  1     MGKAIKWLKGLFGIKKLQIDEKGKIGTTCFGHSGRDTTAVAVAAVSDRLCHNPTTIPPNI  60

Query  280   tpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR  459
             TPAEAAWLSSFYG    +E S HA    AA  AAA  +  A A  A     R+ S+  GR
Sbjct  61    TPAEAAWLSSFYGDESDKEQSKHAIAVAAATAAAAGASPAAHAAVAVV---RLTSQ--GR  115

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
                +F RE+ AA KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVR+QA+ATL+SMQAL
Sbjct  116   SSAVFGREKLAATKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRRQANATLYSMQAL  175

Query  640   MRAQATVLAQKSRPS-IIN------HPQKSIDKNKEARSENITSVHSGRYFASLGSE--N  792
             MRAQA+V AQK++    IN       P+KS++K +E+RS +   + S R  +S  +   N
Sbjct  176   MRAQASVRAQKNKGGFFINQQNSQFQPRKSLEKFEESRSGSTKQMPSRRLSSSFEANNIN  235

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTS  972
             +   K+VEMDT   PK   +SRR+ TW      NP   P    LP   S + D+      
Sbjct  236   EESAKIVEMDTG-RPKT--RSRRTNTWA----SNPCDDPFEQVLP---SWASDWA-----  280

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP-YFR------NYEGYPKYMASTQ  1131
                 +    TAQ+TPRFAN  GSN P   +KS+ +E  YFR      N   YP YMA TQ
Sbjct  281   ----QQPVGTAQSTPRFANSCGSNTPT--AKSVCVESHYFRNNYYDTNNNYYPNYMAKTQ  334

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE--VMNFK  1305
             SF +KLRS SAPKQRPEL  GP+ K++SLNEMMESR S SG +MQ+SCS AQE   +NFK
Sbjct  335   SFKAKLRSHSAPKQRPEL--GPKVKKMSLNEMMESRVSLSGAKMQRSCSQAQEKISINFK  392

Query  1306  SAVIGRLGRCTDY  1344
             + V+ +LG  +++
Sbjct  393   NVVMSKLGNSSEF  405



>ref|XP_007152967.1| hypothetical protein PHAVU_004G175300g [Phaseolus vulgaris]
 gb|ESW24961.1| hypothetical protein PHAVU_004G175300g [Phaseolus vulgaris]
Length=456

 Score =   259 bits (662),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 203/440 (46%), Positives = 264/440 (60%), Gaps = 60/440 (14%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsg-------------gataatgLCHnpttippnitpA  288
             MG+  +W+K LF   +    +  S                + +  LCHNP TIPPNI+ A
Sbjct  20    MGRATRWMKSLFGITREKEKKKNSKGGEAKSTESGCSESTSNSRALCHNPGTIPPNISQA  79

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGP  468
             EAAWL SFY      E  N+      AA  AAA  A  AA  AA AVVR+ S+  GRGG 
Sbjct  80    EAAWLQSFY-----TEKDNNKHAIAVAAVTAAAADAAVAAAQAAVAVVRLTSQ--GRGGT  132

Query  469   LFCR--ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM  642
             +F    E WAAIKIQA FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+
Sbjct  133   MFGVGPEIWAAIKIQAVFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALV  192

Query  643   RAQATVLAQKSRPSII---------NHPQKSIDKNKEARSENITSVH----SGRYFASLG  783
             RAQAT+ + +SR  +          +  ++S+++  + RS+    +H    S  + A++ 
Sbjct  193   RAQATLRSHQSRRLMSTKNEAFRSQHRARRSMERFDDTRSDYAVPIHIRKASSSFDATVN  252

Query  784   SENDVIT--KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL----------P  927
               N V    K VE+DT   PK+  +  R    + +F   P     SSP+           
Sbjct  253   INNSVDGSPKTVEVDT-FRPKSRSRRSRRT--ISDFGDEPSLQALSSPIFPISYRVTPTR  309

Query  928   YKISTSQDFQDLDTSQISDEYRFSTAQTTPRFAN--VRGSNNPITLSKSMFMEPYFRNYE  1101
             + I+  ++FQD +     +E RFSTAQ+TPRF N    GS  P+T + ++F+    R Y 
Sbjct  310   WSIADQRNFQDSEWGLTGEECRFSTAQSTPRFTNPCSCGSVAPMT-NDNLFL----RQYG  364

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YMASTQSF +KLRS SAPKQRPE  P   RKR+SLNEMMESR+S SGVRMQ+SCS 
Sbjct  365   KFPNYMASTQSFKAKLRSHSAPKQRPEPSP---RKRLSLNEMMESRSSLSGVRMQRSCSK  421

Query  1282  AQEVMNFKSAVIGRLGRCTD  1341
             AQEV+NFK+AV+G+L + T+
Sbjct  422   AQEVINFKNAVMGKLQKSTE  441



>ref|XP_010688345.1| PREDICTED: protein IQ-DOMAIN 14 [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   259 bits (661),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 198/447 (44%), Positives = 262/447 (59%), Gaps = 58/447 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg--------------------LCHnptti  267
             MGK  +WLKG+F  + +N  +                               LC+NPTTI
Sbjct  1     MGKATRWLKGIFGIKNTNTNKDTQNNNQTYNSGDRKRSSFGHSGRGSGAKRELCNNPTTI  60

Query  268   ppnitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASR  447
             PPNI+ +EAAWL S+Y  S  ++ S HA    AA  AAA  A  AA  A A    R+ + 
Sbjct  61    PPNISTSEAAWLKSYYEDSE-KQQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTNH  117

Query  448   ERGRGGPLFC----RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASA  615
              RG   P  C    +E WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRKQA+A
Sbjct  118   GRGPMYPGSCGGGGKENWAAVKIQTTFRGYLARKALRALKGLVKIQALVRGYLVRKQATA  177

Query  616   TLHSMQALMRAQATVLAQKSRPSIINH-----------PQKSIDKNKEARSENITSVHSG  762
             TLH MQAL+RAQATV +++++    N+            ++S++   + RS++  S HS 
Sbjct  178   TLHGMQALIRAQATVKSKRAQARFANYEYSGFSQPEFRARRSLEIYDDTRSDHSASTHSR  237

Query  763   RYFASLGSE-----NDVITKVVEMD-TSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL  924
             R  AS  S      ++ I K+VE+D       +SR  R + +  P+ + +P+ PP  S  
Sbjct  238   RLSASFESRTINPISEDIPKIVEVDPGRPRSSSSRGWRSNNSPGPKPEPDPYYPPRIS--  295

Query  925   PYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNN--PITLSKSM-----FMEP  1083
                I   Q + D +     DE RFSTAQ+TPRF N+ G  N  PIT SKS+     +   
Sbjct  296   ---IPNCQHWHDTEWGLTGDECRFSTAQSTPRFMNMSGPPNPVPITPSKSVCGDNTYFLR  352

Query  1084  YFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             ++ NY   P YMA+TQSF +K+RSQSAPKQRPE G    +K++SLNE+MESR S SGV+M
Sbjct  353   HYGNYHQNPNYMANTQSFRAKVRSQSAPKQRPESGYS--KKKLSLNEIMESRNSLSGVKM  410

Query  1264  QKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             Q+SCS  QE +NFK+AV+G+LGR  D+
Sbjct  411   QRSCSQVQEAINFKNAVMGKLGRSYDF  437



>ref|XP_003517637.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
 gb|KHN40376.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=420

 Score =   256 bits (654),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 201/439 (46%), Positives = 256/439 (58%), Gaps = 61/439 (14%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsg-------------sggataatgLCHnpttippnitpA  288
             MG+  +W+K LF  R+    +               S   + +T LCHN  TIPPN++ A
Sbjct  1     MGRATRWVKSLFGIRREKEKKLNFRCGEAKSMELCCSESTSNSTVLCHNSGTIPPNLSQA  60

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRG--  462
             EAAWL SF       +H+        AA  AAA  A  AA  AA AVVR+ S+ RGR   
Sbjct  61    EAAWLQSFCTEKEQNKHAI-----AVAAATAAAADAAVAAAQAAVAVVRLTSQGRGRTMF  115

Query  463   --GPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
               GP    E WAAIKIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRK A+ATLHSMQA
Sbjct  116   GVGP----EMWAAIKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRKLATATLHSMQA  171

Query  637   LMRAQATVLAQKS-RPSII--------NHPQKSIDKNKEARSENITSVHSGR----YFAS  777
             L+RAQA + + KS RP           N  ++S+++  + +SE    +HS R    + A+
Sbjct  172   LVRAQARMRSHKSLRPMTTKNEAYKPHNRARRSMERFDDTKSECAVPIHSRRVSSSFDAT  231

Query  778   LGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP--------YK  933
             + +  D   K+VE+DT   PK+     RS+  + +F   P     SSPLP          
Sbjct  232   INNSVDGSPKIVEVDT-FRPKS-----RSRRAISDFGDEPSLEALSSPLPVPYRTPTRLS  285

Query  934   ISTSQDFQDLDTSQISDEYRFSTAQTTPRFAN--VRGSNNPITLSKSMFMEPY--FRNYE  1101
             I   ++ QD +     +E RFSTA +TPRF N    GS  P+T  KS+  + Y   R Y 
Sbjct  286   IPDQRNIQDSEWGLTGEECRFSTAHSTPRFTNSCTCGSVAPLT-PKSVCTDNYLFLRQYG  344

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YM STQSF +KLRS SAPKQRPE GP   RKR+SLNEMMESR S SGVRMQ+SCS 
Sbjct  345   NFPNYMTSTQSFKAKLRSHSAPKQRPEPGP---RKRISLNEMMESRNSLSGVRMQRSCSQ  401

Query  1282  AQEVMNFKSAVIGRLGRCT  1338
              QEV+NFK+ V+G+L + T
Sbjct  402   VQEVINFKNVVMGKLQKST  420



>ref|XP_004503494.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X3 [Cicer arietinum]
 ref|XP_004503495.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X4 [Cicer arietinum]
Length=435

 Score =   256 bits (655),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 262/441 (59%), Gaps = 58/441 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsgga------------taatgLCHnpttippnitpAE  291
             MG+  +WLK LF  ++    ++ S                 + GLCHNP TIPPNI+PAE
Sbjct  1     MGRATRWLKSLFGIKRDKEHKNNSSTKWTPPPPPHAFSERDSRGLCHNPATIPPNISPAE  60

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
             AAW+ SFY  +  +E + HA    AA  AAA  A  AA  A A   +    R+   GG  
Sbjct  61    AAWVQSFYSETE-KEQNKHAIAVAAATAAAADAAVAAAQAAVAVVRLTSHGRDSMFGG--  117

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
                +R+AA+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQ
Sbjct  118   -GHQRFAAVKIQTIFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  176

Query  652   ATVLAQKSRPSIIN----------HPQKSIDK-NKEARSENITS--VHSGR----YFASL  780
             ATV + KSR  +IN            ++S ++ N+  RSE   S  +HS R    + A++
Sbjct  177   ATVRSHKSR-GLINTKNETHRSQTQARRSTERYNESNRSEYTASIPIHSRRLSSSFDATM  235

Query  781   GSENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK-----I  936
              + N       K+VE+DT   PK+  +SRRS T + +F  +P     SSPLP       I
Sbjct  236   NNTNSYEIESPKIVEVDTG-RPKS--RSRRSNTSISDFGDDPSFQTLSSPLPITPSQLFI  292

Query  937   STSQDFQDLDTSQISDEYRFSTAQTTPRFAN-----VRGSNNPITLSKSMFMEPYFRNYE  1101
                ++F + D     +EY+FSTAQ+TPRF N         + P T+    F   Y   Y 
Sbjct  293   PNQRNFNESDWGITGEEYKFSTAQSTPRFKNSCTCGFIAPSTPKTICGDNF---YIGEYG  349

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YMA+TQSF +KLRS SAPKQRPE      +KRVSLNEMMESR+S SGVRMQ+SCS 
Sbjct  350   DFPNYMANTQSFKAKLRSHSAPKQRPEP-----KKRVSLNEMMESRSSLSGVRMQRSCSQ  404

Query  1282  AQEVMNFKSAVIGRLGRCTDY  1344
              QE +NFK+AV+ +L R TD+
Sbjct  405   IQEAVNFKNAVMRKLDRSTDF  425



>ref|XP_004503492.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Cicer arietinum]
Length=462

 Score =   256 bits (655),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 262/441 (59%), Gaps = 58/441 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsgga------------taatgLCHnpttippnitpAE  291
             MG+  +WLK LF  ++    ++ S                 + GLCHNP TIPPNI+PAE
Sbjct  28    MGRATRWLKSLFGIKRDKEHKNNSSTKWTPPPPPHAFSERDSRGLCHNPATIPPNISPAE  87

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
             AAW+ SFY  +  +E + HA    AA  AAA  A  AA  A A   +    R+   GG  
Sbjct  88    AAWVQSFYSETE-KEQNKHAIAVAAATAAAADAAVAAAQAAVAVVRLTSHGRDSMFGG--  144

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
                +R+AA+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQ
Sbjct  145   -GHQRFAAVKIQTIFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  203

Query  652   ATVLAQKSRPSIIN----------HPQKSIDK-NKEARSENITS--VHSGR----YFASL  780
             ATV + KSR  +IN            ++S ++ N+  RSE   S  +HS R    + A++
Sbjct  204   ATVRSHKSR-GLINTKNETHRSQTQARRSTERYNESNRSEYTASIPIHSRRLSSSFDATM  262

Query  781   GSENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK-----I  936
              + N       K+VE+DT   PK+  +SRRS T + +F  +P     SSPLP       I
Sbjct  263   NNTNSYEIESPKIVEVDTG-RPKS--RSRRSNTSISDFGDDPSFQTLSSPLPITPSQLFI  319

Query  937   STSQDFQDLDTSQISDEYRFSTAQTTPRFAN-----VRGSNNPITLSKSMFMEPYFRNYE  1101
                ++F + D     +EY+FSTAQ+TPRF N         + P T+    F   Y   Y 
Sbjct  320   PNQRNFNESDWGITGEEYKFSTAQSTPRFKNSCTCGFIAPSTPKTICGDNF---YIGEYG  376

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YMA+TQSF +KLRS SAPKQRPE      +KRVSLNEMMESR+S SGVRMQ+SCS 
Sbjct  377   DFPNYMANTQSFKAKLRSHSAPKQRPEP-----KKRVSLNEMMESRSSLSGVRMQRSCSQ  431

Query  1282  AQEVMNFKSAVIGRLGRCTDY  1344
              QE +NFK+AV+ +L R TD+
Sbjct  432   IQEAVNFKNAVMRKLDRSTDF  452



>ref|XP_004503493.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Cicer arietinum]
Length=453

 Score =   256 bits (654),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 203/441 (46%), Positives = 262/441 (59%), Gaps = 58/441 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsgga------------taatgLCHnpttippnitpAE  291
             MG+  +WLK LF  ++    ++ S                 + GLCHNP TIPPNI+PAE
Sbjct  19    MGRATRWLKSLFGIKRDKEHKNNSSTKWTPPPPPHAFSERDSRGLCHNPATIPPNISPAE  78

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
             AAW+ SFY  +  +E + HA    AA  AAA  A  AA  A A   +    R+   GG  
Sbjct  79    AAWVQSFYSETE-KEQNKHAIAVAAATAAAADAAVAAAQAAVAVVRLTSHGRDSMFGG--  135

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
                +R+AA+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQ
Sbjct  136   -GHQRFAAVKIQTIFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQ  194

Query  652   ATVLAQKSRPSIIN----------HPQKSIDK-NKEARSENITS--VHSGR----YFASL  780
             ATV + KSR  +IN            ++S ++ N+  RSE   S  +HS R    + A++
Sbjct  195   ATVRSHKSR-GLINTKNETHRSQTQARRSTERYNESNRSEYTASIPIHSRRLSSSFDATM  253

Query  781   GSENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK-----I  936
              + N       K+VE+DT   PK+  +SRRS T + +F  +P     SSPLP       I
Sbjct  254   NNTNSYEIESPKIVEVDTG-RPKS--RSRRSNTSISDFGDDPSFQTLSSPLPITPSQLFI  310

Query  937   STSQDFQDLDTSQISDEYRFSTAQTTPRFAN-----VRGSNNPITLSKSMFMEPYFRNYE  1101
                ++F + D     +EY+FSTAQ+TPRF N         + P T+    F   Y   Y 
Sbjct  311   PNQRNFNESDWGITGEEYKFSTAQSTPRFKNSCTCGFIAPSTPKTICGDNF---YIGEYG  367

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YMA+TQSF +KLRS SAPKQRPE      +KRVSLNEMMESR+S SGVRMQ+SCS 
Sbjct  368   DFPNYMANTQSFKAKLRSHSAPKQRPEP-----KKRVSLNEMMESRSSLSGVRMQRSCSQ  422

Query  1282  AQEVMNFKSAVIGRLGRCTDY  1344
              QE +NFK+AV+ +L R TD+
Sbjct  423   IQEAVNFKNAVMRKLDRSTDF  443



>ref|XP_004251641.1| PREDICTED: protein IQ-DOMAIN 14 [Solanum lycopersicum]
Length=409

 Score =   254 bits (649),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 211/433 (49%), Positives = 258/433 (60%), Gaps = 64/433 (15%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrs--------------gsggataatgLCHnpttippnitp  285
             MGK IKWLKGLF  ++                     +  A  +  LCHNPTTIPPNITP
Sbjct  1     MGKAIKWLKGLFGIKKLEIDEKGKIGTTCFGHSGRDTTAVAAVSDRLCHNPTTIPPNITP  60

Query  286   AEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGG  465
             AEAAWLSSFYG    +E S HA    AA  AAA  A  AA  A A    R+ S+  GR  
Sbjct  61    AEAAWLSSFYGDESDKEQSKHAIAVAAATAAAADAAVAAAHAAVAVV--RLTSQ--GRSS  116

Query  466   PLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMR  645
              +F RE+ AA KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVR+QA+AT HSMQALMR
Sbjct  117   AVFGREKMAATKIQTVFRGFLARKALRALKGLVKLQALVRGYLVRRQANATFHSMQALMR  176

Query  646   AQATVLAQKSRPSI-INH------PQKSIDKNKEARSENITSVHSGRYFASLGSE--NDV  798
              QA+V A K      +NH       +KSI+K +E+RS +   + S R  +S  +   N+ 
Sbjct  177   VQASVRALKINGGFYVNHQNSQFQQRKSIEKFEESRSGSTKQMSSRRLSSSFEANNINEE  236

Query  799   ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQI  978
               K+VEMDT   PK+  +SRR+ TW      NP   P              F+ + +S  
Sbjct  237   SAKIVEMDTG-RPKS--RSRRTNTWA----SNPCDDP--------------FEQVLSSWA  275

Query  979   SD--EYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP-YFR-------NYEGYPKYMAST  1128
             SD  +    TAQ+TPRFAN  GSN P   +KS+ +E  YFR       N   YP YMA T
Sbjct  276   SDWAQQPVGTAQSTPRFANSCGSNTPT--AKSVCVESKYFRNNNYYDTNNNYYPNYMAKT  333

Query  1129  QSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE--VMNF  1302
             QSF +KLRS SAPKQRPEL  G R K++SLNEMMESR S SGV+MQ+SCS AQE   +NF
Sbjct  334   QSFKAKLRSHSAPKQRPEL--GSRVKKMSLNEMMESRVSSSGVKMQRSCSQAQEKISINF  391

Query  1303  KSAVIGRLGRCTD  1341
             K+ V+ +LG  T+
Sbjct  392   KNVVMSKLGNSTE  404



>ref|XP_008342322.1| PREDICTED: protein IQ-DOMAIN 14-like [Malus domestica]
Length=431

 Score =   253 bits (647),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 265/444 (60%), Gaps = 59/444 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsgga---------------taatgLCHnpttippnit  282
             MG+  +WLKGLF  +  +  +  +  +                AAT LCHNP TIPPNI+
Sbjct  1     MGRATRWLKGLFGIKTKDKYQKPNSTSGDFKHKKGSSFGREDAAATLLCHNPATIPPNIS  60

Query  283   pAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR-  459
             P+EAAWL S+Y  +   E   +      AA  AAA  A  AA  AA  VVR+ S  RG  
Sbjct  61    PSEAAWLRSYYTET---EQEQNKHAIAVAAATAAAADAAVAAANAAVEVVRLTSHGRGTM  117

Query  460   --GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQ  633
               GG    RERWAA+K+Q  FRGYLARKALR LKGLVK+QAL+RGYLVRKQ +ATL SMQ
Sbjct  118   FGGG----RERWAAVKVQTCFRGYLARKALRALKGLVKLQALVRGYLVRKQXTATLKSMQ  173

Query  634   ALMRAQATVLAQKSR--------PSIINHPQKSIDKNKEARSENITSVHSGRYFAS-LGS  786
             AL+RAQATV + K+R               +KS+++   +RSE     HS R  AS LG 
Sbjct  174   ALIRAQATVRSHKNRRLFGIESNNRFEIRARKSMERFDXSRSEQTAPSHSRRLSASXLGD  233

Query  787   EN----DVITKVVEMDTSVTPKASRKSRRSKTW-VPEFQGNP-FGPPHSSPL-----PYK  933
              N    D   K+VE+DT   PK+  +SRR+ T    EF  +P +    SSP+     P +
Sbjct  234   SNFNNTDENPKIVEVDTGSRPKS--RSRRTNTCSASEFSDDPTYQQALSSPILCRGTPAR  291

Query  934   IS--TSQDFQDLDTSQISDEYR-FSTAQTTPRFANVRG----SNNPITLSKSMFMEPYFR  1092
             +S   S+++QD D     +E R  STAQ+TPRF N  G    SN   T SKS+  E  FR
Sbjct  292   LSIPDSRNYQDSDWGLSVEECRMISTAQSTPRFMNSCGGGANSNATGTPSKSVCNENCFR  351

Query  1093  NYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKS  1272
              Y   P YMAST+SF +KLRS SAPKQRPE GP   +KR+SLNEM+ESR S SGVRMQ+S
Sbjct  352   GYA--PNYMASTRSFKAKLRSHSAPKQRPEPGP---KKRLSLNEMLESRNSLSGVRMQRS  406

Query  1273  CSHAQEVMNFKSAVIGRLGRCTDY  1344
             CS  ++ + FK+AVIG+L R + +
Sbjct  407   CSQVKDAIVFKNAVIGKLERSSGF  430



>emb|CDO97967.1| unnamed protein product [Coffea canephora]
Length=402

 Score =   251 bits (640),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/289 (51%), Positives = 194/289 (67%), Gaps = 22/289 (8%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E+WAAIKIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL+RAQA V
Sbjct  121   EKWAAIKIQNVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQAAV  180

Query  661   LAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVE  816
              +Q++R S  N          ++SI++  E RSE  +   S  Y ASL   +D   K+VE
Sbjct  181   RSQRARRSTNNDYRYPPEMRARRSIERFDECRSEFHSKRLSASYDASLSGFDDS-PKIVE  239

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGN--PF---GPPHSSPLPYKIS--TSQDFQDLDTSQ  975
             +DT + P++  +SRR  T      G+  P+     P   P+P ++S      FQD D S 
Sbjct  240   IDT-IKPRS--RSRRITTTCMSDSGDDQPYQAMSSPLPCPVPARLSIPDCHHFQDYDWSF  296

Query  976   ISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRS  1155
             + DE  F+TAQ+TPRF N   SN P+T SKS+  + +FR Y  +P YMA+TQSF +KLRS
Sbjct  297   LGDECGFATAQSTPRFVNSGRSNVPVTPSKSVCGDSFFRPYSNHPNYMANTQSFRAKLRS  356

Query  1156  QSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
              SAPKQRPE GP   +KR+SLNE+M SR S +G+RMQ++C+  +E +NF
Sbjct  357   HSAPKQRPEQGP---KKRLSLNEIMASRTSFTGIRMQRTCAQVEEDLNF  402



>ref|XP_009352560.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=430

 Score =   251 bits (642),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 208/444 (47%), Positives = 267/444 (60%), Gaps = 59/444 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsgga---------------taatgLCHnpttippnit  282
             MG+  +WLKGL   +  +  +     +                 AT LCHNP TIPPNI+
Sbjct  1     MGRATRWLKGLCGIKTKDKHQKPKSTSGDFKHKKGSSFGREDAEATLLCHNPATIPPNIS  60

Query  283   pAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR-  459
             P+EAAWL S+Y  +   E   +      AA  AAA  A  AA  AA  VVR+ S  RG  
Sbjct  61    PSEAAWLRSYYTET---EQKQNKHAIAVAAATAAAADAAVAAANAAVEVVRLTSHGRGTM  117

Query  460   --GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQ  633
               GG    RERWAA+K+Q  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATL+SMQ
Sbjct  118   FGGG----RERWAAVKVQTCFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLNSMQ  173

Query  634   ALMRAQATVLAQKSRP--SIINH------PQKSIDKNKEARSENITSVHSGRYFAS-LGS  786
             AL+RAQATV + K+R    I ++       ++S+++  ++RSE     HS R  AS LG 
Sbjct  174   ALIRAQATVRSHKNRGLFGIESNNRFEIRARQSMERFNDSRSEQTAPSHSRRLSASNLGD  233

Query  787   EN----DVITKVVEMDTSVTPKASRKSRRSKTW-VPEFQGNP-FGPPHSSPL-----PYK  933
              N    D   K+VE+DT   PK+  +SRR+ T    EF  +P +    SSP+     P +
Sbjct  234   NNFNNTDENPKIVEVDTGSRPKS--RSRRTNTCSASEFSDDPTYQQALSSPILCRGTPAR  291

Query  934   IS--TSQDFQDLDTSQISDEYR-FSTAQTTPRFANVRG----SNNPITLSKSMFMEPYFR  1092
             +S   S+++QD D     +E R  STAQ+TPRF N  G    SN   T SKS+  E +F 
Sbjct  292   LSIPDSRNYQDSDWGLSVEECRMISTAQSTPRFMNSCGGGANSNATGTPSKSVCNEVFFG  351

Query  1093  NYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKS  1272
              Y   P YMASTQSF +KLRS SAPKQRPE GP   +KR+SLNEM++SR S SGVRMQ+S
Sbjct  352   GYA--PNYMASTQSFKAKLRSHSAPKQRPEPGP---KKRLSLNEMLDSRNSLSGVRMQRS  406

Query  1273  CSHAQEVMNFKSAVIGRLGRCTDY  1344
             CS   + + FK+AVIG+L R + +
Sbjct  407   CSQVLDAIVFKNAVIGKLERSSGF  430



>ref|XP_010110878.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXC28697.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=428

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 204/445 (46%), Positives = 261/445 (59%), Gaps = 71/445 (16%)
 Frame = +1

Query  148   MGKVIKWLKGL------------------FttrqsnggrsgsggataatgLCHnpttipp  273
             MG+ I+WLKGL                  F  ++     S  G  + +  LCHNP+TIPP
Sbjct  1     MGRAIRWLKGLLGLKKDKEHTKPNSHLNDFRDKKGTWSCSSFGRDSNSDELCHNPSTIPP  60

Query  274   nitpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRER  453
             N++ AEAAWL S+Y  +  E++ +       AA  AAA  A  AA  AA AVVR+ S   
Sbjct  61    NLSAAEAAWLRSYYTDAETEQNKH---AIAVAAATAAAADAAVAAAQAAVAVVRLTSH--  115

Query  454   GRGGPL-FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GRG  L    E+ AAIKIQ  FRGYLARKALR LKG+VK+QAL+RGYLVRKQA+ATLHSM
Sbjct  116   GRGSMLGASHEKTAAIKIQTVFRGYLARKALRALKGVVKLQALMRGYLVRKQATATLHSM  175

Query  631   QALMRAQATVLAQKSRPSIINH------------PQKSI----DKNKEARSENITSVHSG  762
             QAL+RAQATV + K+R  ++N+             +KS+    ++  + RS++    HS 
Sbjct  176   QALIRAQATVRSHKNRELLLNNYNNEEANKFEARARKSMSNLQERFDDTRSDHTVPGHSR  235

Query  763   RYFASLGSENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK  933
             R  ASL S  + I    K+VE+DT   PK   +SRR+ T V +F         SSPLP +
Sbjct  236   RLSASLESSFNAIDGSPKIVEVDTG-RPKC--RSRRTITSVSDFGEESSYQAISSPLPSR  292

Query  934   I-------STSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFR  1092
             +           +FQD D     DE RFSTAQ+TPRF N   SN P T   S        
Sbjct  293   LPNRISIPDCRGNFQDPDWGLNGDECRFSTAQSTPRFLN---SNAPTTPRASA-------  342

Query  1093  NYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKS  1272
                     + S++SF +KLRS SAPKQRPE GPG  +KR+SLNE+MESR S SGVRMQ+S
Sbjct  343   -------RITSSESFKAKLRSYSAPKQRPEPGPGS-KKRLSLNELMESRNSLSGVRMQRS  394

Query  1273  CSHAQEVMNFKSAVIGRLGRCTDYP  1347
             CS AQE ++FK+AV+G+L R +D P
Sbjct  395   CSQAQEAISFKNAVMGKLDRSSDQP  419



>ref|XP_003630704.1| hypothetical protein MTR_8g102400 [Medicago truncatula]
 gb|AET05180.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=429

 Score =   249 bits (636),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 191/449 (43%), Positives = 254/449 (57%), Gaps = 80/449 (18%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggr-----------------sgsggataatgLCHnpttippn  276
             MG+ I+W K LF  ++                      S       + GLCHNP TIPPN
Sbjct  1     MGRTIRWFKSLFGIKKDRDNSNSNSSSTKWNPSLPHPPSQDFSKRDSRGLCHNPATIPPN  60

Query  277   itpAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERG  456
             I+PAEAAW+ SFY  +  E++ +                   A  A   AVVR+ S  R 
Sbjct  61    ISPAEAAWVQSFYSETEKEQNKH-----------------AIAVAALPWAVVRLTSHGRD  103

Query  457   R---GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
                 GG     +++AA+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHS
Sbjct  104   TMFGGG----HQKFAAVKIQTTFRGYLARKALRALKGLVKLQALVRGYLVRKQATATLHS  159

Query  628   MQALMRAQATVLAQKSRPSIINHPQKSIDK--------------NKEARSENITS--VHS  759
             MQAL+RAQATV + KSR  II+   ++ ++              N+  R+E   S  +HS
Sbjct  160   MQALIRAQATVRSHKSRGLIISTKNETNNRFQTQARRSTERYNHNESNRNEYTASIPIHS  219

Query  760   GR----YFASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP  927
              R    + A++ S +    K+VE+DT   PK+  +SRRS T + +F  +P     SSPL 
Sbjct  220   RRLSSSFDATMNSYDIGSPKIVEVDTG-RPKS--RSRRSNTSISDFGDDPSFQTLSSPLQ  276

Query  928   YK-----ISTSQDFQDLDTSQISDEYRFSTAQTTPRFAN-----VRGSNNPITLSKSMFM  1077
                    I   +++ + D     +E RFSTAQ+TPRF +         + P T+    F 
Sbjct  277   VTPSQLYIPNQRNYNESDWGITGEECRFSTAQSTPRFTSSCSCGFVAPSTPKTICGDSF-  335

Query  1078  EPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGV  1257
               Y  +Y  YP YMA+TQSF +KLRS SAPKQRPE GP   +KR+SLNE+MESR S SGV
Sbjct  336   --YIGDYGNYPNYMANTQSFKAKLRSHSAPKQRPEPGP---KKRLSLNELMESRNSLSGV  390

Query  1258  RMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             RMQ+SCS  Q+ +NFK+AV+ +L + TD+
Sbjct  391   RMQRSCSQIQDAINFKNAVMSKLDKSTDF  419



>ref|XP_011072442.1| PREDICTED: protein IQ-DOMAIN 31-like [Sesamum indicum]
Length=386

 Score =   244 bits (624),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 148/284 (52%), Positives = 184/284 (65%), Gaps = 19/284 (7%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RER AA+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL+RAQA 
Sbjct  102   RERCAAVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQAA  161

Query  658   VLAQKSRPSIIN----HPQKSIDKNKEARSENITSVHSGRYFASLG---SENDVITKVVE  816
             V +Q++R SI       P+    K+ E   EN +  HS R  AS     +  D   K+VE
Sbjct  162   VRSQRARRSISADCRFQPEMRARKSIERFDENRSEFHSKRLSASYDPSLNAFDESPKIVE  221

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTSQDFQDLDTSQI  978
             +DT   PK+  +SRR  T + E+  + +    SSPLP        I   +  QD D   I
Sbjct  222   IDT-CRPKS--RSRRINTCMSEYGDDQYYQAISSPLPCPVPARLSIPDCRHLQDFDWGFI  278

Query  979   SDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQ  1158
             +++Y+F TAQ TPRF     +  P+T SKS+  + +FR Y   P YMA+TQSF +KLRSQ
Sbjct  279   TEDYKFPTAQNTPRFGCSGRAYAPVTPSKSVCGDSFFRPYSNCPNYMANTQSFRAKLRSQ  338

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
             SAPKQRPELGP   +KR+SLNE+M SR S SGVRM K CS  QE
Sbjct  339   SAPKQRPELGP---KKRLSLNEIMASRTSFSGVRMHKPCSQVQE  379



>ref|XP_006584809.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Glycine max]
 ref|XP_006584810.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Glycine max]
Length=436

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 197/439 (45%), Positives = 265/439 (60%), Gaps = 43/439 (10%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg-LCHnpttippnitpAEAAWLSSFYGPS  324
             MG+ I+WLKGLF  R     +  S  +   +  LCHNPTTIPPNI+PAEAAWL SFY  +
Sbjct  1     MGRAIRWLKGLFGIRTDRERKENSNHSDRDSRGLCHNPTTIPPNISPAEAAWLQSFYSET  60

Query  325   GGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIA-SRERGRGGPLFCRERWAAIK  501
               E++ +  A+A A A AA A  A A A  A   +     SR+   GG    +ER A +K
Sbjct  61    EKEQNKHAIAVAAATAAAADAAVAAAQAAVAVVRLTSHGNSRDTTFGGA--GQERLAVVK  118

Query  502   IQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKSRP  681
             IQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQATV ++KSR 
Sbjct  119   IQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIRAQATVRSKKSRN  178

Query  682   S---IINHPQKSIDKNKEARSENITSVHSGR----YFASLGSENDVIT--KVVEMDTSVT  834
                      ++S+++  + +S  I  + S R    + A++ + N V    K+VE+DT   
Sbjct  179   EAHRFQTQARRSMERFDDIKSVYIAPIQSRRLSSSFDATMNNANSVDGSPKIVEVDTG-R  237

Query  835   PKASRKSRRSKTWVPEFQGNPFG-PPHSSPLPY---KISTSQDFQDLDTSQISDEYRFST  1002
             PK+  +SRRS T + +F  +P       SPLP+    I   +++ + +     +E RFST
Sbjct  238   PKS--RSRRSNTSMSDFGDDPSSFQALPSPLPFAHLSIPNLRNYHNSEWGLTGEECRFST  295

Query  1003  AQTTPRF-ANVRGSNNPITLSK----SMFMEP----------YFRNYEGYPKYMASTQSF  1137
             AQ+TPRF  N       + ++     SM M P          Y + ++ +P YMASTQSF
Sbjct  296   AQSTPRFTTNSCSCGGSVVVAAPTNMSMSMTPKSVCTENNFFYGQYHDNFPNYMASTQSF  355

Query  1138  MSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVI  1317
              +KLRS SAPKQRP+  P   +KR++LNEMMESR S SG RMQ+SCS  QE ++FK+AV+
Sbjct  356   KAKLRSHSAPKQRPD--PAGPKKRLTLNEMMESRCSLSGTRMQRSCSQIQEAISFKNAVM  413

Query  1318  GRL------GRCTDYPYMN  1356
              +L      GR T+  + N
Sbjct  414   SKLQKSAEIGRDTELNFSN  432



>ref|XP_006356137.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=400

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 191/303 (63%), Gaps = 28/303 (9%)
 Frame = +1

Query  451   RGRGGPLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             +GRG    C RE+WAA KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATLHS
Sbjct  107   KGRGAMFTCGREKWAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHS  166

Query  628   MQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLG  783
             MQAL+RAQA V +Q++R S+ N          ++SI++  E RSE     HS R   S  
Sbjct  167   MQALIRAQAAVRSQRARRSMTNDTRHQPEIRARRSIERFDEYRSE----FHSKRLSTSND  222

Query  784   SENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST----  942
             +  D      K+VE+DT  T   SR  R +   + E          SSPLP  + T    
Sbjct  223   TSYDGFDESPKIVEIDTFRT--KSRSRRMNNACMSESGDEQHYQAMSSPLPCPLPTRLSI  280

Query  943   --SQDFQDLDTSQISDEY-RFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPK  1113
                +  QD++ S ++DE  +F++AQTTPRFA    SN P T +KS+  + YFR Y  +P 
Sbjct  281   PDCRHLQDVNWSFLADEQCKFASAQTTPRFAGSGRSNAPPTPAKSICGDGYFRAYANFPN  340

Query  1114  YMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEV  1293
             YM +TQSF +KLRS SAPKQRPE GP   +KR+SLNE+M SR S SGVRMQKSCS  QE 
Sbjct  341   YMTNTQSFRAKLRSHSAPKQRPEPGP---KKRLSLNEIMASRTSFSGVRMQKSCSQVQEE  397

Query  1294  MNF  1302
               F
Sbjct  398   YCF  400



>ref|XP_007024326.1| Iq-domain 14 isoform 1 [Theobroma cacao]
 ref|XP_007024327.1| Iq-domain 14 isoform 1 [Theobroma cacao]
 gb|EOY26948.1| Iq-domain 14 isoform 1 [Theobroma cacao]
 gb|EOY26949.1| Iq-domain 14 isoform 1 [Theobroma cacao]
Length=406

 Score =   243 bits (619),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 149/297 (50%), Positives = 190/297 (64%), Gaps = 27/297 (9%)
 Frame = +1

Query  463   GPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G LF   RERWAA+KIQ  FRGYLARKALR LKGLV++QAL+RGYLVRK+A+ATL SMQA
Sbjct  120   GTLFGGGRERWAAVKIQTVFRGYLARKALRALKGLVRLQALVRGYLVRKRATATLRSMQA  179

Query  637   LMRAQATVLAQKSRPSII--------NHPQKSIDKNKEARSENITSVHSGRYFASLG-SE  789
             L+RAQA V +Q+ R S          N P+KSI++  + RS    ++HS R  AS+  S 
Sbjct  180   LIRAQAAVRSQRLRRSFNKENRYYPENRPRKSIERFDDPRS----AIHSKRLSASIEISA  235

Query  790   NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGN-PF---GPPHSSPLPYKIST--SQD  951
              D   K+VE+DT    K   +SRR  T + +   + P+     P   P+P + S    Q+
Sbjct  236   YDESPKIVEIDTF---KTRSRSRRYNTALSDCGDDLPYQIISSPLPCPVPARASVPNCQN  292

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
               D +     DE RFSTA +TPRFAN   SN P T +KS+  + YFR Y  +P YMA+TQ
Sbjct  293   LHDFEWCFTGDECRFSTAHSTPRFANTAMSNAPTTPAKSVCGDGYFRPYSNFPNYMANTQ  352

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             SF +KLRS SAPKQRPE G    +KR+SLNE+M +R S SGVRM KSC   +E ++F
Sbjct  353   SFKAKLRSHSAPKQRPEPGV---KKRLSLNEIMAARNSMSGVRMNKSCYQVEEALDF  406



>emb|CAN69979.1| hypothetical protein VITISV_011284 [Vitis vinifera]
Length=387

 Score =   241 bits (616),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 189/299 (63%), Gaps = 28/299 (9%)
 Frame = +1

Query  463   GPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G LF   R+RWAA KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+ATLHSMQA
Sbjct  98    GTLFGGGRDRWAATKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLHSMQA  157

Query  637   LMRAQATVLAQKS--------RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN  792
             L+RAQA V +Q++        R      P++SI++ +E RSE     HS R   S  +  
Sbjct  158   LIRAQAAVRSQRTLRARNKENRFPPEMRPRRSIERFEETRSE----FHSKRMSTSFETSV  213

Query  793   DVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTS  945
             +      K+VE+DT   PK SR  R   T   +   +P     SSPLP        I   
Sbjct  214   NAFDESPKIVEIDT-FKPK-SRSRRMMNTSTSDSGEDPPYQTLSSPLPCPVPARLSIPDC  271

Query  946   QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAS  1125
             ++FQD +     DE RFSTAQ+TPR AN   +  P+T +KS+  + +FR Y  +P YMA+
Sbjct  272   RNFQDFEWCFTGDECRFSTAQSTPRLANTSRAVAPVTPAKSVCGDSFFRPYSNFPNYMAN  331

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             TQSF +KLRS SAPKQRPE  PGP+R R SLNE+M SR S SGVRMQ+SCS  QE +NF
Sbjct  332   TQSFKAKLRSHSAPKQRPE--PGPKR-RFSLNEIMASRTSLSGVRMQRSCSQVQEALNF  387



>ref|XP_002515955.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46375.1| conserved hypothetical protein [Ricinus communis]
Length=404

 Score =   241 bits (616),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 153/297 (52%), Positives = 190/297 (64%), Gaps = 26/297 (9%)
 Frame = +1

Query  454   GRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             GRG  LF   RERWAAIKIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLHS
Sbjct  116   GRGA-LFGGGRERWAAIKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHS  174

Query  628   MQALMRAQATVLAQKSRPSII--------NHPQKSIDKNKEARSENITSVHSGRYFASLG  783
             MQAL+RAQ  V  Q++R SI         + P+KSI++  + RSE     HS R   S  
Sbjct  175   MQALIRAQTAVRTQRARRSINKENRFHPESRPRKSIERFDDTRSE----FHSKRLSTSYE  230

Query  784   SEN-DVITKVVEMDTSVTPKASRKSRRSKTWVPE---FQGNPFGPPHSSPLPYKIS--TS  945
             +   D   K+VE+DT  T   SR+   + +   E   +QG     P   P+P +IS    
Sbjct  231   TNAFDESPKIVEIDTYKTRSRSRRITSALSECSEEFPYQG--ISSPLPCPIPARISIPDC  288

Query  946   QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAS  1125
             +  QD D     +E RFSTAQ+TPRFAN   SN P+T +KS+  + YFR Y  +P YMA+
Sbjct  289   RHHQDFDWYFTGEECRFSTAQSTPRFANTIRSNAPVTPAKSVCGDSYFRPYSNFPNYMAN  348

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVM  1296
             TQSF +KLRS SAPKQRPE GP   +K++SLNE+M +R S S VRMQ+S S   E +
Sbjct  349   TQSFKAKLRSHSAPKQRPEPGP---KKKLSLNEIMAARNSISSVRMQRSYSQFDEGL  402



>ref|XP_002277925.2| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654610.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654611.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654612.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
 ref|XP_010654613.1| PREDICTED: protein IQ-DOMAIN 14-like [Vitis vinifera]
Length=402

 Score =   241 bits (615),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 151/299 (51%), Positives = 189/299 (63%), Gaps = 28/299 (9%)
 Frame = +1

Query  463   GPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G LF   R+RWAA KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+ATLHSMQA
Sbjct  113   GTLFGGGRDRWAATKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLHSMQA  172

Query  637   LMRAQATVLAQKS--------RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN  792
             L+RAQA V +Q++        R      P++SI++ +E RSE     HS R   S  +  
Sbjct  173   LIRAQAAVRSQRTLRARNKENRFPPEMRPRRSIERFEETRSE----FHSKRMSTSFETSV  228

Query  793   DVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTS  945
             +      K+VE+DT   PK SR  R   T   +   +P     SSPLP        I   
Sbjct  229   NAFDESPKIVEIDT-FKPK-SRSRRMMNTSTSDSGEDPPYLTLSSPLPCPVPARLSIPDC  286

Query  946   QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAS  1125
             ++FQD +     DE RFSTAQ+TPR AN   +  P+T +KS+  + +FR Y  +P YMA+
Sbjct  287   RNFQDFEWCFTGDECRFSTAQSTPRLANTSRAVAPVTPAKSVCGDSFFRPYSNFPNYMAN  346

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             TQSF +KLRS SAPKQRPE  PGP+R R SLNE+M SR S SGVRMQ+SCS  QE +NF
Sbjct  347   TQSFKAKLRSHSAPKQRPE--PGPKR-RFSLNEIMASRTSLSGVRMQRSCSQVQEALNF  402



>ref|XP_009404542.1| PREDICTED: uncharacterized protein LOC103987843 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404543.1| PREDICTED: uncharacterized protein LOC103987843 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404544.1| PREDICTED: uncharacterized protein LOC103987843 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404546.1| PREDICTED: uncharacterized protein LOC103987843 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009404547.1| PREDICTED: uncharacterized protein LOC103987843 [Musa acuminata 
subsp. malaccensis]
Length=445

 Score =   242 bits (617),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 169/329 (51%), Positives = 211/329 (64%), Gaps = 33/329 (10%)
 Frame = +1

Query  433   RIASRERG--RGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQ  606
             R+ S  RG   GG L   ER AA+KIQ AFRGYLA+KALR LK LVK+QAL+RGYLVRKQ
Sbjct  109   RLTSHGRGAISGGSL---ERRAAVKIQTAFRGYLAKKALRALKALVKLQALVRGYLVRKQ  165

Query  607   ASATLHSMQALMRAQATVLAQKSRPSIINHP--------QKSIDKNKEA-RSENITSVHS  759
             A+ATLHSMQAL+RAQATV AQ++R  + N          ++S+++  E+ RSEN++S H 
Sbjct  166   ATATLHSMQALIRAQATVRAQRARNLVRNEKRFQPEIRHRRSLERFDESCRSENLSSFHG  225

Query  760   GRYFASLGSEN---DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPY  930
              R  ASL S +   D   K+VE+DT   PK+SR SRR+   V +   +      SSPLP 
Sbjct  226   RRLSASLDSASNGFDRSPKIVEIDT-CRPKSSRSSRRANPSVLDPADDFHSSSISSPLPC  284

Query  931   KIST------SQDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSMFMEP--  1083
             +I         ++FQD D     D+ R S TAQ+TPR+ N   SN P+T +KSM      
Sbjct  285   QIPARISIPDCRNFQDYDWCLAGDKCRLSATAQSTPRYMNS-ISNLPVTPAKSMCGADSA  343

Query  1084  --YFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSG  1254
                F N    P YM+ST+SF +K RSQSAPKQRPE  P   RKR+ L E M+ESRAS SG
Sbjct  344   LLRFTNVPNCPNYMSSTRSFEAKSRSQSAPKQRPE--PAGTRKRLPLTEVMLESRASLSG  401

Query  1255  VRMQKSCSHAQEVMNFKSAVIGRLGRCTD  1341
             V MQ+SCS  QE  NFKSAV+GRL RC++
Sbjct  402   VGMQRSCSRVQEAFNFKSAVVGRLDRCSE  430



>gb|KDP40852.1| hypothetical protein JCGZ_24851 [Jatropha curcas]
Length=403

 Score =   241 bits (614),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 218/356 (61%), Gaps = 35/356 (10%)
 Frame = +1

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---  459
             +AAWL S+ G S  E++ +       AA  AAA  A  AA  AA AVVR+ S  RG    
Sbjct  65    DAAWLRSYLGESEREQNKH---AIAVAAAPAAAADAAVAAAQAAVAVVRLTSHGRGTLFG  121

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             GG    RE+WAAIK+Q  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLHSMQAL
Sbjct  122   GG----REKWAAIKVQTVFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQAL  177

Query  640   MRAQATVLAQKS--------RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLG-SEN  792
             +RAQ  V  Q++        R    N P+KSI++  + RSE     HS R  AS   +  
Sbjct  178   IRAQTAVRTQRACRSANKENRFQHENRPRKSIERFDDTRSE----YHSKRLSASYEMNAF  233

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWV----PEFQGNPFGPPHSSPLPYKIST--SQDF  954
             D   K+VE+DT    K   +SRR    +     EF  +    P   P+P +IS    +  
Sbjct  234   DRSPKIVEIDTY---KPRSRSRRMTAALSECDEEFPYHAMSSPLPCPIPARISIPDCKYH  290

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
             QD D     +E RFSTAQ+TPRF+N   SN P T +KS+  + YFR Y  +P YMA+TQS
Sbjct  291   QDFDWYLTGEECRFSTAQSTPRFSNSVRSNAPATPAKSVCGDSYFRPYSNFPNYMANTQS  350

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             F +KLRS SAPKQRPELGP   +K++SLNE+M +R S S VRMQ+SCS+  E +  
Sbjct  351   FKAKLRSYSAPKQRPELGP---KKKLSLNEIMAARNSISSVRMQRSCSYVDESLGL  403



>ref|XP_010062543.1| PREDICTED: uncharacterized protein LOC104449924 [Eucalyptus grandis]
 ref|XP_010062544.1| PREDICTED: uncharacterized protein LOC104449924 [Eucalyptus grandis]
 gb|KCW69686.1| hypothetical protein EUGRSUZ_F03081 [Eucalyptus grandis]
Length=408

 Score =   239 bits (611),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 150/301 (50%), Positives = 192/301 (64%), Gaps = 27/301 (9%)
 Frame = +1

Query  454   GRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             GRG  LF   RE+WA++KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATL S
Sbjct  115   GRGA-LFGGGREQWASVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLLS  173

Query  628   MQALMRAQATVLAQKSRPSII--------NHPQKSIDKNKEARSENITSVHSGRYFASLG  783
             MQAL+RAQA V + ++R S+         N P++SI++ +E RSE  +   S  Y   + 
Sbjct  174   MQALIRAQANVRSHRARRSVNKENRSYFENRPRRSIERFEEPRSEFHSKRLSALYETPV-  232

Query  784   SENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGN--------PFGPPHSSPLPYKIS  939
             +  D   K+VE+DT    K   +SRR  + + E+  +        P   P  +P    I 
Sbjct  233   NPFDESPKIVEIDTC---KPRSRSRRMNSVLTEYGEDFSYHAVSSPLPCPGPAPARLSIP  289

Query  940   TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY-EGYPKY  1116
               +  QD D     DE RFSTAQ+TPR AN  G   P T +KS+  + +FR Y  G+P Y
Sbjct  290   DCRHMQDFDWCFAGDECRFSTAQSTPRLANSLGYFAPATPAKSVCGDHFFRPYGSGFPSY  349

Query  1117  MASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVM  1296
             MA+TQSF +KLRS SAPKQRPE G    +KR+SLNE+M SR S SGVRMQ+SCSH QEV+
Sbjct  350   MANTQSFNAKLRSHSAPKQRPEPGS---KKRLSLNEIMASRNSMSGVRMQRSCSHLQEVL  406

Query  1297  N  1299
             N
Sbjct  407   N  407



>ref|XP_004241751.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum lycopersicum]
 ref|XP_010322697.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum lycopersicum]
Length=405

 Score =   239 bits (611),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 153/303 (50%), Positives = 191/303 (63%), Gaps = 30/303 (10%)
 Frame = +1

Query  454   GRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             GRG  +F   RE+WAA KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATLHS
Sbjct  113   GRGA-MFTGGREKWAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHS  171

Query  628   MQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLG  783
             MQAL+RAQA V +Q++R S+ N          ++SI++  E RSE     HS R   S  
Sbjct  172   MQALIRAQAAVRSQRARRSMTNDTRNQPETRARRSIERFDEYRSE----FHSKRLSTSND  227

Query  784   SENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKI  936
             +  D      K+VE+DT  T   SR  R +   + E          SSPLP        I
Sbjct  228   TSYDGFDESPKIVEIDTFRT--KSRSRRMNNACMSESGDEQHSQAMSSPLPCPLPARLSI  285

Query  937   STSQDFQDLDTSQISDEY-RFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPK  1113
                +  QD++ S ++DE  +F++AQTTPRFA    SN P T +KS+  + YFR Y  +P 
Sbjct  286   PDCRHLQDVNWSFLADEQCKFASAQTTPRFAGSGRSNAPPTPAKSICGDGYFRAYANFPN  345

Query  1114  YMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEV  1293
             YM++TQSF +KLRS SAPKQRPE GP   +KR+SLNE+M SR S SGVRMQKSCS  QE 
Sbjct  346   YMSNTQSFRAKLRSHSAPKQRPEPGP---KKRLSLNEIMASRTSFSGVRMQKSCSQVQEE  402

Query  1294  MNF  1302
               F
Sbjct  403   YCF  405



>gb|EYU27263.1| hypothetical protein MIMGU_mgv1a007196mg [Erythranthe guttata]
Length=415

 Score =   237 bits (605),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 204/421 (48%), Positives = 260/421 (62%), Gaps = 29/421 (7%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYGPSG  327
             MG+  +W K LF  +  +   +   G  AA G CHNPTTIPPNITPAEAAWL SFYG S 
Sbjct  1     MGRATRWFKDLFGIKSRDKDTNEYSGRDAAAGFCHNPTTIPPNITPAEAAWLRSFYGDSD  60

Query  328   GEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR----GGPLFCRERWAA  495
              +   N  AIAVAAATAAAADAAVAAA AA A V R+ S+ RG     GG    RE+WAA
Sbjct  61    SDRDQNKHAIAVAAATAAAADAAVAAAQAAVAVV-RLTSQGRGTAVVFGG---SREKWAA  116

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK-  672
             +KIQ  FRGYLARKALR L+GLVKIQAL+RG+LVRK+A+ATL+SMQAL+RAQ +V A K 
Sbjct  117   VKIQTLFRGYLARKALRALRGLVKIQALVRGFLVRKEAAATLYSMQALLRAQKSVRAHKM  176

Query  673   -SRPSIINH---PQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              +RP  IN    P     + + +  +    +    +  +   E     K+VE+D    PK
Sbjct  177   RTRPVNINQDNFPPLQFLQARTSLEKKYEELERSEHCPTTTVEES--PKIVEVDMGCRPK  234

Query  841   ASRKSRRSKTWVPEFQGNPF--GPPHSSPLPYKISTSQDFQDLDTS-QISDEYRFSTAQT  1011
             +  +SRR+ +   +  G      P   S LP  ++ +++  DL+    + +E  FSTAQ+
Sbjct  235   S--RSRRANSGGEDSFGKTIYNSPLVKSRLP--VAEARNIPDLEWGLMMGEECHFSTAQS  290

Query  1012  TPRFANVRGSNNPITL-----SKSMFMEPYFRNYEGY-PKYMASTQSFMSKLRSQSAPKQ  1173
             TPRFA                +KS   E  FR Y G  P YMA T+SF +K+RSQSAPKQ
Sbjct  291   TPRFATSTCVCGGGGGGTVTPAKSACTESEFRRYGGEKPNYMAKTKSFKAKVRSQSAPKQ  350

Query  1174  RPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDYPYM  1353
             R E+  GPRR R++L EMMESR S SGVRMQ+SCS AQ+ + FK+AV+G L R +D+   
Sbjct  351   RAEVVVGPRR-RLTLQEMMESRNSLSGVRMQRSCSQAQDTVLFKNAVMGNLARSSDFVTQ  409

Query  1354  N  1356
             N
Sbjct  410   N  410



>ref|XP_008794100.1| PREDICTED: protein IQ-DOMAIN 14-like [Phoenix dactylifera]
Length=441

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 156/321 (49%), Positives = 201/321 (63%), Gaps = 32/321 (10%)
 Frame = +1

Query  454   GRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQ  633
             GRG      ER AA+KIQ AFRGYLA+KALR LK LVK+QAL+RGYLVRKQA+ATL SMQ
Sbjct  112   GRGSLFGVHERRAAVKIQTAFRGYLAKKALRALKALVKLQALVRGYLVRKQAAATLQSMQ  171

Query  634   ALMRAQATVLAQKSRPSIIN--------HPQKSIDKNKEARSENITSVHSGRYFASLGSE  789
             AL+RAQ TV AQ+SR  + N         P++S+++  + RSE++ SVHS R  ASL + 
Sbjct  172   ALIRAQETVRAQRSRNLVPNDRRSQPEFRPRRSLERFDDTRSEHMASVHSRRLSASLDNA  231

Query  790   N---DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPH--SSPLPYKIST----  942
             +   D   K+VE+DT      S +                 PP   SSPLP +I +    
Sbjct  232   SNGFDRSPKIVEIDTCRPRSRSSRRTSPSV----LDLADELPPQSISSPLPCQIPSRISI  287

Query  943   --SQDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFRNY---E  1101
                ++FQD D     ++ R S TAQ+TPR+ N   +  P+T +KS+   E  FR +    
Sbjct  288   PDCRNFQDYDWCLTGEKCRLSATAQSTPRYMNSTAA-MPVTPAKSLSVAEGVFRRFLSNA  346

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSGVRMQKSCS  1278
               P YMA+TQSF +K+RSQSAPKQRPE  P   RKR+ L+E M+ESRAS SGV MQ+SC+
Sbjct  347   HCPSYMANTQSFEAKVRSQSAPKQRPE--PAGTRKRLPLSEVMVESRASLSGVGMQRSCA  404

Query  1279  HAQEVMNFKSAVIGRLGRCTD  1341
              AQE  NFKSAV+GRL R ++
Sbjct  405   RAQEAFNFKSAVVGRLDRSSE  425



>ref|XP_010925518.1| PREDICTED: protein IQ-DOMAIN 14-like [Elaeis guineensis]
 ref|XP_010925519.1| PREDICTED: protein IQ-DOMAIN 14-like [Elaeis guineensis]
Length=439

 Score =   235 bits (600),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 181/379 (48%), Positives = 228/379 (60%), Gaps = 41/379 (11%)
 Frame = +1

Query  286   AEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGG  465
             A+ AWL S Y  S  +E S HA    AA  AAA  A  AA  A A    R+ S+  GRG 
Sbjct  60    ADTAWLRSIYAESE-KEQSKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSQ--GRGT  114

Query  466   PLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMR  645
                  ER AA+KIQ AFR YLA+KALR LK LVK+QAL+RGYLVRKQA+ TL SMQAL+R
Sbjct  115   LFGVHERRAAVKIQTAFRAYLAKKALRALKALVKLQALVRGYLVRKQAALTLQSMQALIR  174

Query  646   AQATVLAQKSR----------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN-  792
             AQATV AQ+SR          P I   P++S+++  + RSE++ SVHS R  ASL + + 
Sbjct  175   AQATVRAQRSRNLLPSERRFQPEI--RPRRSLERFDDTRSEHMASVHSRRLSASLDNASN  232

Query  793   --DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPH--SSPLPYKIST------  942
               D   K+VE+DT      S +                 PP   SSPLP +I +      
Sbjct  233   GFDRSPKIVEIDTCRPRSRSSRRTSPSV----LDLADELPPQSISSPLPCQIPSRISIPD  288

Query  943   SQDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFR---NYEGY  1107
              ++FQD D     ++ RFS TAQ+TPR+ N  G+  P+T +KS+   E  FR   N    
Sbjct  289   CRNFQDYDWCLTGEKCRFSATAQSTPRYMNSAGT-MPVTPAKSLSVAEGVFRRFLNTSHC  347

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSGVRMQKSCSHA  1284
             P YMA+TQSF +K+RSQSAPKQRPE  P   RKR+ L+E M+ESRAS SGV MQ+SC+  
Sbjct  348   PSYMANTQSFEAKVRSQSAPKQRPE--PAGIRKRLPLSEVMVESRASLSGVGMQRSCTRV  405

Query  1285  QEVMNFKSAVIGRLGRCTD  1341
             QE  NFKSAV+GRL R ++
Sbjct  406   QEAFNFKSAVVGRLDRSSE  424



>ref|XP_009777311.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana sylvestris]
 ref|XP_009777312.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana sylvestris]
 ref|XP_009777313.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana sylvestris]
Length=402

 Score =   234 bits (596),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 145/292 (50%), Positives = 186/292 (64%), Gaps = 24/292 (8%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RE+WAA KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL+RAQA 
Sbjct  118   REKWAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQAA  177

Query  658   VLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT---  804
             V +Q++R S+ N          ++SI++  E R+E     HS R   S  +  D      
Sbjct  178   VRSQRARRSMTNDSRYQPDMRARRSIERFDEYRNE----FHSKRLSTSNETSYDGFDDSP  233

Query  805   KVVEMDTSVTPKASRKSRRSKTWV---PEFQGNPFGPPHSSPLPYKIS--TSQDFQDLDT  969
             K+VE+DT  T   SR+   +        E        P   PLP ++S    +  QD++ 
Sbjct  234   KIVEIDTYRTKSRSRRMNNAACMSESGDEQHYQVMSSPLPCPLPARVSIPDCRHLQDINW  293

Query  970   SQISDEY-RFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSK  1146
             S ++DE  +F++AQ+TPRFA    SN P T +KS+  + YFR Y  +P YMA+TQSF +K
Sbjct  294   SFLADEQCKFASAQSTPRFACSGRSNAPPTPAKSVCGDGYFRPYANFPSYMANTQSFRAK  353

Query  1147  LRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             LRS SAPKQRPE GP   +KR+SLNE+M SR S SGVRMQ+SCS  QE   F
Sbjct  354   LRSHSAPKQRPEPGP---KKRLSLNEIMASRTSFSGVRMQRSCSQVQEDYCF  402



>ref|XP_009622656.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana tomentosiformis]
 ref|XP_009622657.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana tomentosiformis]
 ref|XP_009622658.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana tomentosiformis]
 ref|XP_009622659.1| PREDICTED: protein IQ-DOMAIN 31-like [Nicotiana tomentosiformis]
Length=402

 Score =   233 bits (595),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 149/307 (49%), Positives = 191/307 (62%), Gaps = 24/307 (8%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S+ RG       RE+WAA KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+
Sbjct  103   RLTSQGRGAMFTGGGREKWAAAKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAA  162

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRY  768
             ATLHSMQAL+RAQA V +Q++R S+ N          ++SI++  E R+E     HS R 
Sbjct  163   ATLHSMQALIRAQAAVRSQRARRSMTNDSRYQPEMRARRSIERFDEYRNE----FHSKRL  218

Query  769   FASLGSENDVIT---KVVEMDTSVTPKASRKSRRSKTWV---PEFQGNPFGPPHSSPLPY  930
               S  +  D      K+VE+DT  T   SR+            E        P   PLP 
Sbjct  219   STSNETSYDGFDDSPKIVEIDTYRTKSRSRRMNNVACMSESGDEQHYQVMSSPLPCPLPA  278

Query  931   KIS--TSQDFQDLDTSQISDEY-RFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYE  1101
             ++S    +  QD++ S ++DE  +F++AQ+TPRFA    SN P T +KS+  + YFR Y 
Sbjct  279   RVSIPDCRHLQDINWSFLADEQCKFASAQSTPRFACSGRSNAPPTPAKSVCGDGYFRPYA  338

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YMA+TQSF +KLRS SAPKQRPE GP   +KR+SLNE+M SR S SGVRMQ+SCS 
Sbjct  339   NFPSYMANTQSFRAKLRSHSAPKQRPEPGP---KKRLSLNEIMASRTSFSGVRMQRSCSQ  395

Query  1282  AQEVMNF  1302
              QE   F
Sbjct  396   VQEDYCF  402



>ref|XP_008798581.1| PREDICTED: protein IQ-DOMAIN 14-like [Phoenix dactylifera]
Length=500

 Score =   232 bits (592),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 154/326 (47%), Positives = 208/326 (64%), Gaps = 33/326 (10%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             +GRG  +   ER AA+KIQ AFRGYLA+KALR LK LVK+QAL+RGYLVRKQA+ATL  M
Sbjct  170   KGRGATIGVHERQAAVKIQTAFRGYLAKKALRALKALVKLQALVRGYLVRKQAAATLQRM  229

Query  631   QALMRAQATVLAQKSRPSIIN----HPQKS----IDKNKEARSENITSVHSGRYFASLGS  786
             QAL+RAQATV AQK R  + N     P+      +++  + RSE + SVH+ R  A L +
Sbjct  230   QALIRAQATVRAQKCRNLLPNDRRFQPEICSRGYLERFDDTRSERLASVHNRRLSACLDN  289

Query  787   ENDV----ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHS--SPLPYKIST--  942
              +++      K+VE+DT   P+ SR +RR+   VP+   +   PP S  SPLP +I    
Sbjct  290   ASNIGFDRSPKIVEIDTG-RPR-SRSARRTSPSVPDLADDL--PPQSIYSPLPCQIPARI  345

Query  943   ----SQDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSMF-MEPYFR---N  1095
                  ++FQD D     ++ RFS TA++TPR+ +    N P+T +KS+   +  FR   N
Sbjct  346   SIPDRRNFQDCDWCLTGEKCRFSATARSTPRYMSY-TQNMPVTPAKSLSGADGVFRRFLN  404

Query  1096  YEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMM-ESRASQSGVRMQKS  1272
                 P YMA+TQSF +K+RS SAP+QRPE  P   RKR+ L+E+M ESRAS S V MQKS
Sbjct  405   APTCPSYMANTQSFEAKVRSHSAPRQRPE--PAGTRKRLPLSELMVESRASLSDVGMQKS  462

Query  1273  CSHAQEVMNFKSAVIGRLGRCTDYPY  1350
             C+ AQE  NF+SAV+GR+ R ++  +
Sbjct  463   CTQAQEAFNFRSAVVGRIDRSSELSW  488



>gb|KHN16648.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=367

 Score =   227 bits (579),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 153/340 (45%), Positives = 209/340 (61%), Gaps = 41/340 (12%)
 Frame = +1

Query  442   SRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATL  621
             SR+   GG    +ER A +KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATL
Sbjct  30    SRDTTFGGA--GQERLAVVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATL  87

Query  622   HSMQALMRAQATVLAQKSRPS---IINHPQKSIDKNKEARSENITSVHSGR----YFASL  780
             HSMQAL+RAQATV ++KSR          ++S+++  + +S  I  + S R    + A++
Sbjct  88    HSMQALIRAQATVRSKKSRNEAHRFQTQARRSMERFDDIKSVYIAPIQSRRLSSSFDATM  147

Query  781   GSENDVIT--KVVEMDT-SVTPKASRKSRRSKTWVPEFQGNPFG-PPHSSPLPY---KIS  939
              + N V    K+VE+DT S  PK+  +SRRS T + +F  +P       SPLP+    I 
Sbjct  148   NNANSVDGSPKIVEVDTGSGRPKS--RSRRSNTSMSDFGDDPSSFQALPSPLPFAHLSIP  205

Query  940   TSQDFQDLDTSQISDEYRFSTAQTTPRF-ANVRGSNNPITLSK----SMFMEP-------  1083
               +++ + +     +E RFSTAQ+TPRF  N       + ++     SM M P       
Sbjct  206   NLRNYHNSEWGLTGEECRFSTAQSTPRFTTNSCSCGGSVVVAAPTNMSMSMTPKSVCTEN  265

Query  1084  ---YFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSG  1254
                Y + ++ +P YMASTQSF +KLRS SAPKQRP+  P   +KR++LNEMMESR S SG
Sbjct  266   NFFYGQYHDNFPNYMASTQSFKAKLRSHSAPKQRPD--PAGPKKRLTLNEMMESRCSLSG  323

Query  1255  VRMQKSCSHAQEVMNFKSAVIGRL------GRCTDYPYMN  1356
              RMQ+SCS  QE ++FK+AV+ +L      GR T+  + N
Sbjct  324   TRMQRSCSQIQEAISFKNAVMSKLQKSAEIGRDTELNFSN  363



>ref|XP_010098153.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXB74590.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=288

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 142/285 (50%), Positives = 181/285 (64%), Gaps = 21/285 (7%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RE+ AA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLHSMQAL+RAQ  
Sbjct  6     REKLAAVKIQTVFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQALIRAQTA  65

Query  658   VLAQKSRPSIIN--------HPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVV  813
             V  Q++R S           +P+KSI++  E RSE  +   S    AS+ +  D   K+V
Sbjct  66    VRTQRARRSFNKENRLGPEFYPRKSIERFDEPRSEFHSKRLSTTCEASINA-FDESPKIV  124

Query  814   EMDTSVTPKASRKSRRSKTWVPEFQGN-PF---GPPHSSPLPYKIST--SQDFQDLDTSQ  975
             E+DT    K   +SRR  T + E   + P+     P   P+P +IS    Q  QD +   
Sbjct  125   EIDTY---KPRSRSRRFSTALSECSEDLPYQTISSPLPCPVPARISIPDCQHLQDFEWYF  181

Query  976   ISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRS  1155
               +E +FSTA +TPRFAN   SN P T +KS+  + +FR Y  +P YMA+TQSF +KLRS
Sbjct  182   SGNECKFSTAHSTPRFANPTWSNAPATPAKSVCGDSFFRPYSNFPSYMANTQSFNAKLRS  241

Query  1156  QSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
              SAPKQRPE  P   +KR+SLNE+M +R S S VRM +S S  QE
Sbjct  242   HSAPKQRPEPAP---KKRLSLNEIMAARNSISSVRMHRSYSQFQE  283



>ref|XP_011013968.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
Length=409

 Score =   226 bits (575),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 141/300 (47%), Positives = 188/300 (63%), Gaps = 26/300 (9%)
 Frame = +1

Query  463   GPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G LF   +E+WAA KIQ  FRGYLARKALR LKGLVK+QA++RGYLVRK+A+ATLHSMQA
Sbjct  111   GTLFGGGKEKWAARKIQTVFRGYLARKALRALKGLVKLQAVVRGYLVRKRAAATLHSMQA  170

Query  637   LMRAQATVLAQKSRPSI-------INHPQKSIDKNKEARSENITSVHSGRYFASLGSEN-  792
             L+RAQ +VL+Q +R S+        + P+KS+++  + RSE     HS R   S  +   
Sbjct  171   LIRAQNSVLSQHARRSLNKENRFSKHRPRKSLERFDDMRSE----FHSKRLSTSYDTNVF  226

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWV----PEFQGNPFGPPHSSPLPYKIST--SQDF  954
             D   K+VE+DT    K   +SRR    +     E        P   P P +IS    +++
Sbjct  227   DESPKIVEIDTY---KPRSRSRRINIALSECGEELPYQAISSPLPCPTPARISIPECKNY  283

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
             QDL+     +E RFSTA +TPRFAN    N P T ++S+  + YF+ Y  +  YMA+TQS
Sbjct  284   QDLEWYFTGEECRFSTAHSTPRFANSARCNAPATPARSICGDAYFKPYSNFHNYMANTQS  343

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAV  1314
             F +KLRS SAPKQRP+ G    +KR+SLNE+M+SR S SGVRMQ+SC+   E +  +  V
Sbjct  344   FNAKLRSHSAPKQRPDPGS---KKRLSLNEIMDSRNSISGVRMQRSCTKVDEDLVIEELV  400



>ref|XP_006465703.1| PREDICTED: protein IQ-DOMAIN 14-like [Citrus sinensis]
Length=415

 Score =   225 bits (574),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 143/295 (48%), Positives = 183/295 (62%), Gaps = 31/295 (11%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
              RE+WAA+KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL+RAQ 
Sbjct  125   VREKWAAVKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQT  184

Query  655   TVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLGSE---NDVI  801
              V  Q++R S             +KS+++  E RSE    +HS R   SL S     D  
Sbjct  185   AVRTQRARRSFNKENRFLPEFRQRKSLERFDETRSE----IHSKRISTSLESPISGFDES  240

Query  802   TKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK---------ISTSQDF  954
              K+VE+DT   P+A  ++RR    + E  G+ F     S              ++ SQ+ 
Sbjct  241   PKIVEIDT-FKPRA--RTRRFHAALSEC-GDDFSYQAMSSPLPIPCPVPPRISVTNSQNL  296

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
              D +     DEY+FS+A++TPRFAN   SN P T +KS+  + YFR Y  +P YM++TQS
Sbjct  297   HDFEWCFTGDEYKFSSAKSTPRFANSIRSNAPPTPAKSVCCDNYFRPYSNHPSYMSNTQS  356

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             F +KLRS SAPKQRPE GP   +KR SLNE+M SR S S VRMQKSC   Q+  N
Sbjct  357   FNAKLRSYSAPKQRPEQGP---KKRHSLNEIMASRNSISSVRMQKSCFQDQQGSN  408



>ref|XP_007216908.1| hypothetical protein PRUPE_ppa019001mg [Prunus persica]
 gb|EMJ18107.1| hypothetical protein PRUPE_ppa019001mg [Prunus persica]
Length=409

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 142/291 (49%), Positives = 181/291 (62%), Gaps = 22/291 (8%)
 Frame = +1

Query  460   GGPLFCR-ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             GG +F + ERWAA+KIQ  FRGYLARKA R L+GLVK+QAL+RGYLVRK+A+ATLHSMQA
Sbjct  116   GGLMFGKKERWAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGYLVRKRAAATLHSMQA  175

Query  637   LMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLGSEN  792
             L RAQ TV  Q++R S             +KS+++  +ARSE  +   S  Y  S+    
Sbjct  176   LFRAQTTVRFQRARRSFNKENRFLPEIKARKSVERFDDARSEFYSRRLSATYETSINGF-  234

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGN-PF---GPPHSSPLPYKIS--TSQDF  954
             D   K+VE+DT    K   +SRR  T + E   + P+     P   P P +IS    Q  
Sbjct  235   DESPKIVEIDTF---KTRSRSRRFNTVLSECSEDLPYQTISSPLPCPFPTRISIPDRQKP  291

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
             QD +     DE +FSTA  TPRF N   SN P T +KS+  + +F+ Y  +P YM+STQS
Sbjct  292   QDFEWCFNGDECKFSTAHNTPRFTNSFRSNAPSTPAKSVCGDTFFQPYSNFPNYMSSTQS  351

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             F +K RS SAPKQRPE GP   +KR+SLNEMM +R S SGVRM +SC+  Q
Sbjct  352   FNAKSRSHSAPKQRPEPGP---KKRLSLNEMMAARNSISGVRMHRSCNQVQ  399



>ref|XP_006426860.1| hypothetical protein CICLE_v10025716mg [Citrus clementina]
 gb|ESR40100.1| hypothetical protein CICLE_v10025716mg [Citrus clementina]
Length=415

 Score =   223 bits (569),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 183/296 (62%), Gaps = 33/296 (11%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
              RE+WAA+KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL+RAQ 
Sbjct  125   VREKWAAVKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQT  184

Query  655   TVLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSE---NDV  798
              V  Q++R S            H +KS+++  E RSE    +HS R   SL S     D 
Sbjct  185   AVRTQRARRSFNKENRFQPEFRH-RKSLERFDETRSE----IHSKRISTSLESPISGFDE  239

Query  799   ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP---------YKISTSQD  951
               K+VE+DT   P++  +SRR    + E  G+ F     S              ++ SQ+
Sbjct  240   SPKIVEIDT-FKPRS--RSRRFHAALSEC-GDDFSYQAMSSPLPIPCPVPPRISVTNSQN  295

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
               D       DEY+FS+A++TPRFAN   SN P T +KS+  + YFR Y  +P YM++TQ
Sbjct  296   LHDFVWCFTGDEYKFSSAKSTPRFANSILSNAPPTPAKSVCCDSYFRPYSNHPSYMSNTQ  355

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             SF +KLRS SAPKQRPE GP   +KR SLNE+M SR S S VRMQKSC   Q+  N
Sbjct  356   SFNAKLRSYSAPKQRPEQGP---KKRHSLNEIMASRNSISSVRMQKSCFQVQQGSN  408



>gb|EYU21448.1| hypothetical protein MIMGU_mgv1a007787mg [Erythranthe guttata]
Length=395

 Score =   223 bits (568),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 139/293 (47%), Positives = 180/293 (61%), Gaps = 39/293 (13%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RE+WAA +IQ+ FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL RAQ +
Sbjct  124   REKWAAARIQSVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALFRAQTS  183

Query  658   VLAQKSRPSIINHPQKSIDKNKEARSENIT--SVHSGRYFASLGS-----ENDVITKVVE  816
             V AQ++R SI          N E+R+ N T    HS R  +S  S       D   K+VE
Sbjct  184   VRAQRARRSI----------NTESRARNSTESEFHSKRLSSSYDSSVNNNSYDESPKIVE  233

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTS---------QDFQDLDT  969
             +DT    K+  +SRR  T       N     HS    Y+I            Q+ Q+ D 
Sbjct  234   IDTCGAHKS--RSRRMTT------NNSCMSEHSDDQYYQIPARLSIPDCRHLQELQEFDW  285

Query  970   SQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY--EGYPKYMASTQSFMS  1143
               + ++Y+F TAQ TPRFA    ++ P T +KS+  + +FR Y     P YMA+TQSF +
Sbjct  286   GYVREDYKFPTAQNTPRFACSGRAHAPATPAKSLCGDHFFRPYSNSNCPSYMANTQSFRA  345

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             KLRS SAP+QRP++GP   +KR+SLNE+M SR S SGVRM K+CS  +E + F
Sbjct  346   KLRSHSAPRQRPDVGP---KKRLSLNEIMASRTSFSGVRMHKACSQVEEDLEF  395



>gb|KDO51826.1| hypothetical protein CISIN_1g014980mg [Citrus sinensis]
Length=415

 Score =   223 bits (567),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 144/296 (49%), Positives = 183/296 (62%), Gaps = 33/296 (11%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
              RE+WAA+KIQ  FRG+LARKALR LKGLVK+QAL+RGYLVRK+A+ATLHSMQAL+RAQ 
Sbjct  125   VREKWAAVKIQNVFRGFLARKALRALKGLVKLQALVRGYLVRKRAAATLHSMQALIRAQT  184

Query  655   TVLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSE---NDV  798
              V  Q++R S            H +KS+++  E RSE    +HS R   SL S     D 
Sbjct  185   AVRTQRARRSFNKENRFQPEFRH-RKSLERFDETRSE----IHSKRISTSLESPISGFDE  239

Query  799   ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP---------YKISTSQD  951
               K+VE+DT   P++  +SRR    + E  G+ F     S              ++ SQ+
Sbjct  240   SPKIVEIDT-FKPRS--RSRRFHAALSEC-GDDFSYQAMSSPLPIPCPVPPRISVTNSQN  295

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
               D       DEY+FS+A++TPRFAN   SN P T +KS+  + YFR Y  +P YM++TQ
Sbjct  296   LHDFVWCFTGDEYKFSSAKSTPRFANSILSNAPPTPAKSVCCDSYFRPYSNHPSYMSNTQ  355

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             SF +KLRS SAPKQRPE GP   +KR SLNE+M SR S S VRMQKSC   Q+  N
Sbjct  356   SFNAKLRSYSAPKQRPEQGP---KKRHSLNEIMASRNSISSVRMQKSCFQDQQGSN  408



>ref|XP_002299740.2| hypothetical protein POPTR_0001s19140g [Populus trichocarpa]
 gb|EEE84545.2| hypothetical protein POPTR_0001s19140g [Populus trichocarpa]
Length=409

 Score =   222 bits (566),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 185/303 (61%), Gaps = 31/303 (10%)
 Frame = +1

Query  433   RIASRERGR---GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRK  603
             R+ S  RG    GG    RERWAA+KIQ  FRGYLARKALR LKGLVK+QA++RGYLVRK
Sbjct  104   RLTSHGRGTMFGGG----RERWAAVKIQTVFRGYLARKALRALKGLVKLQAVVRGYLVRK  159

Query  604   QASATLHSMQALMRAQATVLAQKSRPSI-------INHPQKSIDKNKEARSENITSVHSG  762
             +A+ATLHSMQAL+RAQ  + +Q++R S         + P+K+I++  + RSE     HS 
Sbjct  160   RATATLHSMQALIRAQNAIRSQRARRSFNKENRFSEHRPRKAIERFDDTRSE----FHSK  215

Query  763   RYFASLG-SENDVITKVVEMDTSVTPKASRKSRR----SKTWVPEFQGNPFGPPHSSPLP  927
             R   S   +  D   K+VE+DT    K   +SRR    S     E        P   P+P
Sbjct  216   RLSTSCDMTAFDESPKIVEIDTY---KPRSRSRRINVASSECGEELPYQAISSPLPCPMP  272

Query  928   YKIST--SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYE  1101
              +IS    + +QD +     +E RFST+ +TPRFAN   S  P T +KS+  + YFR Y 
Sbjct  273   ARISIPECKGYQDFEWYFNGEECRFSTSHSTPRFANSAQSIAPATPAKSICGDAYFRPYL  332

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +P YMA+TQSF +KLRS SAPKQRPE G    +KR+SLNE+M SR S S VRMQ+ C+ 
Sbjct  333   NFPNYMANTQSFKAKLRSHSAPKQRPEPGS---KKRLSLNEIMASRNSISSVRMQRPCTQ  389

Query  1282  AQE  1290
               E
Sbjct  390   VDE  392



>ref|XP_011000945.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
 ref|XP_011000946.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
 ref|XP_011000947.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
 ref|XP_011000948.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
Length=413

 Score =   221 bits (564),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 157/351 (45%), Positives = 201/351 (57%), Gaps = 32/351 (9%)
 Frame = +1

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR---  459
             + AWL S+   +   E + HA    A+               AA AVVR+ S  RG    
Sbjct  61    DDAWLRSYLSETE-REQNKHAIAVAASTXXXXXXXXXXXXSRAAVAVVRLTSHGRGTMFG  119

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             GG    RERWAA+KIQ  FRGYLARKALR LKGLVK+QA++RGYLVRK+A+ATLHSMQAL
Sbjct  120   GG----RERWAAVKIQTVFRGYLARKALRALKGLVKLQAVVRGYLVRKRATATLHSMQAL  175

Query  640   MRAQATVLAQKSRPSI-------INHPQKSIDKNKEARSENITSVHSGRYFASLG-SEND  795
             +RAQ  + +Q++R S         + P+KSI++  + RSE     HS R   S   +  D
Sbjct  176   IRAQNAIRSQRARRSFNKENRFPEHRPRKSIERFDDTRSE----FHSKRLSTSCDMTAFD  231

Query  796   VITKVVEMDTSVTPKASRKSRR----SKTWVPEFQGNPFGPPHSSPLPYKISTSQ--DFQ  957
                K+VE+DT    K   +SRR    S     E        P   P+P +IS  +   +Q
Sbjct  232   ESPKIVEIDTY---KPRSRSRRFNVASSECGEELPYQAISSPLPCPMPARISIPECKGYQ  288

Query  958   DLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSF  1137
             D +     +E R ST+ +TPRFAN   S  P T +KS+  + YFR Y  +P YMA+TQSF
Sbjct  289   DFEWYFTGEECRISTSHSTPRFANSAQSIAPATPAKSICGDAYFRPYSNFPNYMANTQSF  348

Query  1138  MSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
              +KLRS SAPKQRPE G    +KR+SLNE+M SR S S VRMQ+ C    E
Sbjct  349   KAKLRSHSAPKQRPEPGS---KKRLSLNEIMASRNSISSVRMQRPCPQVDE  396



>ref|XP_002304223.2| hypothetical protein POPTR_0003s04620g [Populus trichocarpa]
 gb|EEE79202.2| hypothetical protein POPTR_0003s04620g [Populus trichocarpa]
Length=409

 Score =   221 bits (563),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 140/302 (46%), Positives = 186/302 (62%), Gaps = 25/302 (8%)
 Frame = +1

Query  454   GRGGPLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GRG  L   +E+WAA+KIQ  FRGYLARKALR LKGLVK+QA++RGYLVRK+A+ATLHSM
Sbjct  109   GRGTMLGGGKEKWAAVKIQTVFRGYLARKALRALKGLVKLQAVVRGYLVRKRAAATLHSM  168

Query  631   QALMRAQATVLAQKSRPSI-------INHPQKSIDKNKEARSENITSVHSGRYFASLGSE  789
             QAL+RAQ +VL+Q +R  +        + P+KS+++  + RSE     HS R   S  + 
Sbjct  169   QALIRAQNSVLSQHARRWLNKEIRFSEHRPRKSLERFDDMRSE----FHSKRLSTSYDTT  224

Query  790   N-DVITKVVEMDTSVTPKASRKSRRSKTWV----PEFQGNPFGPPHSSPLPYKIST--SQ  948
               D   K+VE+DT    K   +SRR    +     E        P   P P +IS    +
Sbjct  225   VFDESPKIVEIDTY---KPRSRSRRINIALSECGEELPYQAISSPLPCPTPARISIPECK  281

Query  949   DFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAST  1128
              +QDL+     +E RFSTA +TPRFAN    N P T ++S+  + YF+ Y  +  YMA+T
Sbjct  282   HYQDLEWYFTGEECRFSTAHSTPRFANSARCNAPATPARSICGDAYFKPYSNFHNYMANT  341

Query  1129  QSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKS  1308
             QSF +KLRS SAPKQRP+ G    +KR+ LNE+M SR S SGVRMQ+SC+   E +  + 
Sbjct  342   QSFKAKLRSHSAPKQRPDPGS---KKRLPLNEIMASRNSISGVRMQRSCTKVDEDLVIEE  398

Query  1309  AV  1314
              V
Sbjct  399   LV  400



>ref|XP_006583044.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=396

 Score =   220 bits (561),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 145/294 (49%), Positives = 181/294 (62%), Gaps = 28/294 (10%)
 Frame = +1

Query  451   RGRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLH  624
             +GRG  LF   RE+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLH
Sbjct  103   QGRGA-LFSGSREKWAAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLH  161

Query  625   SMQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGR----Y  768
             SMQAL+RAQ  V  Q++R S+            +KS+++  E RSE     HS R    Y
Sbjct  162   SMQALIRAQTAVRTQRARRSMSKENRFLPEVLARKSVERFDETRSE----FHSKRLPTSY  217

Query  769   FASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPE-FQGNPFGPPHSSPLPYKIST-  942
               SL    D   K+VE+DT  T   SR+   + +   E    +    P   P+P +IS  
Sbjct  218   ETSLNG-FDESPKIVEIDTYKTRSRSRRFTSTMSECGEDMSCHAISSPLPCPVPGRISVP  276

Query  943   -SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYM  1119
               +  QD D     DE RFSTA +TPRF N    N P T +KS+  + +FR Y  +P YM
Sbjct  277   DCRYIQDFDWYYNVDECRFSTAHSTPRFTNYVRPNVPATPAKSVCGDTFFRPYSNFPNYM  336

Query  1120  ASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             A+TQSF +KLRS SAPKQRPE      +KR+SLNEMM +R S SGVRMQ+  S+
Sbjct  337   ANTQSFNAKLRSHSAPKQRPEP-----KKRLSLNEMMAARNSISGVRMQRPSSN  385



>ref|XP_010665888.1| PREDICTED: protein IQ-DOMAIN 14-like [Beta vulgaris subsp. vulgaris]
Length=390

 Score =   220 bits (560),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 140/294 (48%), Positives = 185/294 (63%), Gaps = 10/294 (3%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S+ RG       R+R AAIKIQ  FRGYLAR+AL+ LKGLVK+QA +RGYLVRK+A+
Sbjct  103   RLTSKGRGTLFSAGGRDRMAAIKIQTLFRGYLARRALKALKGLVKLQAHVRGYLVRKRAA  162

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVH-SGRYFASLGSE  789
             ATLHSMQAL+RAQA+V +Q++  +  N  +K +++  E RS+   S   S  Y     + 
Sbjct  163   ATLHSMQALIRAQASVRSQRANLA-QNRSRKLMERLDETRSDQFHSKRLSTSYERVYNNA  221

Query  790   NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFG-PPHSSPLPYKI--STSQDFQD  960
              +   K+VE+DT   P++  +SRR    + +F G     P  SSPLPY      S   +D
Sbjct  222   YEGSPKIVEIDTYNKPRS--RSRRINPSLYDFSGEDMQYPTMSSPLPYPYPGRVSIPSKD  279

Query  961   LDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFM  1140
              D S   DE R STAQ+TPRF+N   SN P T +KS+  + +FR Y   P YMA TQSF 
Sbjct  280   YDWSFYGDECRISTAQSTPRFSNSARSNGPPTPTKSVCGDSFFRPYSNSPSYMADTQSFR  339

Query  1141  SKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             +KLRSQSAPKQRPE      + R+SL+E+M +R S SGVRMQ+  S  Q+ +N 
Sbjct  340   AKLRSQSAPKQRPE---ARTKSRLSLDEIMAARNSISGVRMQRCSSQVQDTLNL  390



>ref|XP_009421295.1| PREDICTED: uncharacterized protein LOC104000876 [Musa acuminata 
subsp. malaccensis]
Length=435

 Score =   221 bits (563),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 155/315 (49%), Positives = 196/315 (62%), Gaps = 29/315 (9%)
 Frame = +1

Query  463   GPLFCR--ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G +F R  ER AA+KIQ+AFR YLA+KALR LK LVK+QAL+RGYLVRKQA+ATLHSMQA
Sbjct  117   GAMFGRSIERLAAVKIQSAFRAYLAKKALRALKALVKLQALVRGYLVRKQAAATLHSMQA  176

Query  637   LMRAQATV--------LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN  792
             L+RAQATV        L    R  +    Q   ++ +E RSEN++S HS R  A L + +
Sbjct  177   LIRAQATVRARRARNLLRDDRRLQLEFRHQPPFERFEEVRSENMSSFHSRRLSAGLDNVS  236

Query  793   ---DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIST------S  945
                D   K+VE+D    PK+SR SRR+   V +   +      SSPLP +I         
Sbjct  237   NGFDRSPKIVEIDI-CRPKSSRSSRRTNPSVLDPADDLHSSSISSPLPCQIPARIFIPDC  295

Query  946   QDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSMF----MEPYFRNYEGYP  1110
             ++FQ+ D     D+ R S TAQ+TPR+ N  G N P+T +KS+     +   F N    P
Sbjct  296   RNFQEYDWCLAGDKCRLSHTAQSTPRYVNASG-NAPVTPTKSVCGADGVLRRFMNVPDCP  354

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSGVRMQKSCSHAQ  1287
              YMASTQSF +K RSQSAPKQRPE  P   RKR+  +E M+ESRAS SG  MQ+SC+  Q
Sbjct  355   NYMASTQSFEAKARSQSAPKQRPE--PAGTRKRLPPSEVMVESRASLSGAMMQRSCTRVQ  412

Query  1288  EVMNFKSAVIGRLGR  1332
             E  NFK+AV+GRL R
Sbjct  413   EAFNFKTAVVGRLDR  427



>emb|CBI36045.3| unnamed protein product [Vitis vinifera]
Length=1097

 Score =   229 bits (585),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 145/295 (49%), Positives = 185/295 (63%), Gaps = 36/295 (12%)
 Frame = +1

Query  463   GPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G LF   R+RWAA KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+ATLHSMQA
Sbjct  113   GTLFGGGRDRWAATKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLHSMQA  172

Query  637   LMRAQATVLAQKSR----------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGS  786
             L+RAQA V +Q++           P +   P++SI++ +E RSE     HS R   S  +
Sbjct  173   LIRAQAAVRSQRTLRARNKENRFPPEM--RPRRSIERFEETRSE----FHSKRMSTSFET  226

Query  787   ENDVIT---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQ  957
               +      K+VE+DT   PK SR  R   T   +   +P     SSPLPY         
Sbjct  227   SVNAFDESPKIVEIDT-FKPK-SRSRRMMNTSTSDSGEDPPYLTLSSPLPY---------  275

Query  958   DLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSF  1137
               +     DE RFSTAQ+TPR AN   +  P+T +KS+  + +FR Y  +P YMA+TQSF
Sbjct  276   -FEWCFTGDECRFSTAQSTPRLANTSRAVAPVTPAKSVCGDSFFRPYSNFPNYMANTQSF  334

Query  1138  MSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
              +KLRS SAPKQRPE  PGP+R R SLNE+M SR S SGVRMQ+SCS ++++  F
Sbjct  335   KAKLRSHSAPKQRPE--PGPKR-RFSLNEIMASRTSLSGVRMQRSCSQSKDMDGF  386



>ref|XP_008380848.1| PREDICTED: uncharacterized protein LOC103443739 [Malus domestica]
 ref|XP_008380849.1| PREDICTED: uncharacterized protein LOC103443739 [Malus domestica]
Length=410

 Score =   218 bits (554),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 138/285 (48%), Positives = 180/285 (63%), Gaps = 23/285 (8%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R L+GLVK+QAL+RG+LVRK+A+ATL+SMQAL+RAQ T
Sbjct  122   RERWAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGFLVRKRAAATLYSMQALLRAQTT  181

Query  658   VLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             V  Q++R S          IN  +K +++ ++ARSE  +   S  Y  S+ S  D   K+
Sbjct  182   VRYQRARRSFNKENRFLPEIN-ARKCVERFEDARSEFYSRRLSATYETSVDS-FDESPKI  239

Query  811   VEMDTSVTPKASRKSRRSKTWV----PEFQGNPFGPPHSSPLPYKIST--SQDFQDLDTS  972
             VE+DT   P++  +SRR  T +     +        P   P+P +IS   SQ  QD +  
Sbjct  240   VEIDT-FKPRS--RSRRFNTILSDRGEDLHYQTISSPLPCPMPTRISIPDSQKPQDFEWY  296

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
                DE +F TA  TPRFA    SN P T SKS+  + +FR Y  +P YM+STQSF +K R
Sbjct  297   FNGDECKFLTAHNTPRFATSFRSNAPGTPSKSVCGDSFFRPYSNFPNYMSSTQSFNAKSR  356

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             S SAPKQRPE GP   +KR+SLNEMM +R S S +RM +SC+  Q
Sbjct  357   SHSAPKQRPEPGP---KKRLSLNEMMAARNSISSIRMHRSCNQVQ  398



>ref|XP_006585563.1| PREDICTED: protein IQ-DOMAIN 14-like [Glycine max]
Length=402

 Score =   217 bits (552),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 143/293 (49%), Positives = 179/293 (61%), Gaps = 28/293 (10%)
 Frame = +1

Query  454   GRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             GRG  LF   RE+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLHS
Sbjct  103   GRGA-LFSGSREKWAAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHS  161

Query  628   MQALMRAQATVLAQKSRPSIINHP--------QKSIDKNKEARSENITSVHSGR----YF  771
             MQAL+RAQ  V  Q++R S+            +K +++  E RSE     HS R    Y 
Sbjct  162   MQALIRAQTAVRTQRARRSMSKEDRFLPEVLARKPVERFDETRSE----FHSKRLPTSYE  217

Query  772   ASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPE-FQGNPFGPPHSSPLPYKIST--  942
              SL    D   K+VE+DT  T   SR+   + +   E    +    P   P+P +IS   
Sbjct  218   TSLNG-FDESPKIVEIDTYKTRSRSRRFTSTMSECGEDMSCHAISSPLPCPVPGRISVPD  276

Query  943   SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMA  1122
              +  QD D     DE RFSTA +TPRF N   +N P T +KS+  + +FR    +P YMA
Sbjct  277   CRHIQDFDWYYNVDECRFSTAHSTPRFTNYVRANAPATPAKSVCGDTFFRPCSNFPNYMA  336

Query  1123  STQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             +TQSF +KLRS SAPKQRPE      +KR+SLNEMM +R S SGVRMQ+  S+
Sbjct  337   NTQSFNAKLRSHSAPKQRPEP-----KKRLSLNEMMAARNSISGVRMQRPSSN  384



>ref|XP_009392681.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
Length=444

 Score =   218 bits (554),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 149/321 (46%), Positives = 200/321 (62%), Gaps = 28/321 (9%)
 Frame = +1

Query  451   RGRGGPL-FCRERW-AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLH  624
             RG G  L  CRER+ AA+KIQ +FRGYLA+KALR LK LVK+QAL+RGYLVRKQA+ATL 
Sbjct  113   RGTGAALDSCRERYMAAVKIQTSFRGYLAKKALRALKALVKLQALVRGYLVRKQATATLR  172

Query  625   SMQALMRAQATVLAQKSRPSIINHP---------QKSIDKNKEARSENITSVHSGRYFAS  777
             SMQAL+RAQATV AQ+SR +++ H          ++S+++  + RSEN +S HS R  A 
Sbjct  173   SMQALIRAQATVRAQRSR-NLLPHDRRFQLEFRHRRSLERFDDTRSENTSSFHSRRLSAC  231

Query  778   LGSEN---DVITKVVEMDTSVTPKASRKSRRSKTWVP--EFQGNPFGPPHSSPLPYKIST  942
             L + +   D   K+VE+DT      S +        P  +   +    P    +P +IS 
Sbjct  232   LDNVSNSFDRSPKIVEVDTGRPRSRSSRRSTPSVLDPAEDLHWSSITSPLPCQIPARISV  291

Query  943   --SQDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSMFMEP----YFRNYE  1101
                +DFQD D     ++ R S TAQ+TPR A+   SN P+T +KS+  E      F N  
Sbjct  292   PDCRDFQDYDWCLAFEKCRQSATAQSTPRCASS-CSNWPVTGAKSVCDEDGVLRRFSNVP  350

Query  1102  GYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSGVRMQKSCS  1278
               P YMAST+SF +KLRSQSAPKQRP+  P   RKR+ L+E  +ES A+ SGV  Q+ CS
Sbjct  351   SCPNYMASTESFEAKLRSQSAPKQRPD--PAGTRKRLPLSEATVESMAALSGVGFQRPCS  408

Query  1279  HAQEVMNFKSAVIGRLGRCTD  1341
              AQE  NF+SAV+G++ + ++
Sbjct  409   RAQEDFNFRSAVVGKIDQSSE  429



>ref|XP_009364672.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=395

 Score =   216 bits (549),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 183/286 (64%), Gaps = 23/286 (8%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+ATL+SMQAL RAQ  
Sbjct  113   RERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLYSMQALFRAQTN  172

Query  658   VLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             V  Q++R S          IN  +KS+++ ++ARSE  +   S  Y  S+ S  D   K+
Sbjct  173   VRYQRARRSFNKENRFQPEINA-RKSVERFEDARSEFYSRRLSATYETSVNS-FDESPKI  230

Query  811   VEMDTSVTPKASRKSRRSKTWVPEF-QGNPF---GPPHSSPLPYKIS--TSQDFQDLDTS  972
             VE+DT   P++  +SRR  T + +  +  P+     P   P+P +IS   S+  QD +  
Sbjct  231   VEIDT-FKPRS--RSRRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWY  287

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
                +E +F TA  TPRFA    SN P T SKS+  + +FR Y   P YM+STQSF +K R
Sbjct  288   FNGNECKFPTAHNTPRFATSFRSNAPGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSR  347

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
             S SAPKQRPE GP   +KR+SLNEMM +R S SG+RM +SC+  QE
Sbjct  348   SHSAPKQRPEPGP---KKRLSLNEMMAARNSISGIRMHRSCNQIQE  390



>ref|XP_007135626.1| hypothetical protein PHAVU_010G144700g [Phaseolus vulgaris]
 ref|XP_007135627.1| hypothetical protein PHAVU_010G144700g [Phaseolus vulgaris]
 gb|ESW07620.1| hypothetical protein PHAVU_010G144700g [Phaseolus vulgaris]
 gb|ESW07621.1| hypothetical protein PHAVU_010G144700g [Phaseolus vulgaris]
Length=395

 Score =   215 bits (548),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 146/306 (48%), Positives = 182/306 (59%), Gaps = 37/306 (12%)
 Frame = +1

Query  454   GRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             GRG  LF   RE+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLHS
Sbjct  104   GRGA-LFSGSREKWAAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHS  162

Query  628   MQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGR----YF  771
             MQAL+RAQ  V +Q++R S+            +KS+++  E RSE     HS R    Y 
Sbjct  163   MQALIRAQTAVRSQRARRSLSKESRFLPEVLARKSVERFDETRSE----FHSKRLPTSYE  218

Query  772   ASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YK  933
              SL    D   K+VE+DT    K   +SRR  + + E   +      SSPLP        
Sbjct  219   TSLNG-FDESPKIVEIDTY---KTRSRSRRFTSTMSECGEDMSSQAMSSPLPCHVPGRIS  274

Query  934   ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPK  1113
             +   +  QD D     DE RFSTA +TPRF N    N P T +KS+  + +FR    +P 
Sbjct  275   VPECRHLQDFDWYLNVDECRFSTAHSTPRFTNYARPNAPATPAKSVCGDTFFRPCSNFPN  334

Query  1114  YMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH---A  1284
             YM +TQSF +KLRS SAPKQRPE      +KR+SLNE+M +R S S VRMQ+  S+    
Sbjct  335   YMTNTQSFKAKLRSHSAPKQRPEP-----KKRLSLNEVMAARNSISSVRMQRPSSNFFQT  389

Query  1285  QEVMNF  1302
             QE  NF
Sbjct  390   QESWNF  395



>ref|XP_009347221.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
 ref|XP_009347223.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=405

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 183/286 (64%), Gaps = 23/286 (8%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+ATL+SMQAL RAQ  
Sbjct  123   RERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLYSMQALFRAQTN  182

Query  658   VLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             V  Q++R S          IN  +KS+++ ++ARSE  +   S  Y  S+ S  D   K+
Sbjct  183   VRYQRARRSFNKENRFQPEIN-ARKSVERFEDARSEFYSRRLSATYETSVNS-FDESPKI  240

Query  811   VEMDTSVTPKASRKSRRSKTWVPEF-QGNPF---GPPHSSPLPYKIS--TSQDFQDLDTS  972
             VE+DT   P++  +SRR  T + +  +  P+     P   P+P +IS   S+  QD +  
Sbjct  241   VEIDT-FKPRS--RSRRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWY  297

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
                +E +F TA  TPRFA    SN P T SKS+  + +FR Y   P YM+STQSF +K R
Sbjct  298   FNGNECKFPTAHNTPRFATSFRSNAPGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSR  357

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
             S SAPKQRPE GP   +KR+SLNEMM +R S SG+RM +SC+  QE
Sbjct  358   SHSAPKQRPEPGP---KKRLSLNEMMAARNSISGIRMHRSCNQIQE  400



>ref|XP_008228411.1| PREDICTED: protein IQ-DOMAIN 14 [Prunus mume]
Length=406

 Score =   215 bits (548),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 142/292 (49%), Positives = 179/292 (61%), Gaps = 23/292 (8%)
 Frame = +1

Query  460   GGPLFCR-ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             GG +F + ER AA+KIQ  FRGYLARKA R L+GLVK+QAL+RGYLVRK+A+ATLHSMQA
Sbjct  108   GGLMFGKKERCAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGYLVRKRAAATLHSMQA  167

Query  637   LMRAQATVLAQKSRPSIINH--------PQKSI-DKNKEARSENITSVHSGRYFASLGSE  789
             L RAQ TV  Q++R S             +KS+ ++  +ARSE  +   S  Y  S+   
Sbjct  168   LFRAQTTVRFQRARRSFNKENRFLPEIKARKSVQERFDDARSEFYSRRLSATYETSING-  226

Query  790   NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGN-PF---GPPHSSPLPYKIS--TSQD  951
              D   K+VE+DT    K   +SRR  T + E     P+     P   P P +IS    Q 
Sbjct  227   FDESPKIVEIDTF---KTRSRSRRFNTILSECSEELPYQTISSPLPCPFPTRISIPDRQQ  283

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
              QD +     DE +FSTA  TPRF N   SN P T +KS+  + +FR Y  +P YM+STQ
Sbjct  284   PQDFEWCFNGDECKFSTAHNTPRFTNSFRSNAPDTPAKSVCGDSFFRPYSNFPNYMSSTQ  343

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             SF +K RS SAPKQRPE GP   +KR+SLNEMM +R S SGVRM +SC+  Q
Sbjct  344   SFNAKSRSHSAPKQRPEPGP---KKRLSLNEMMAARNSISGVRMHRSCNQVQ  392



>ref|XP_008360734.1| PREDICTED: uncharacterized protein LOC103424428 [Malus domestica]
 ref|XP_008360735.1| PREDICTED: uncharacterized protein LOC103424428 [Malus domestica]
Length=405

 Score =   215 bits (548),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 140/286 (49%), Positives = 183/286 (64%), Gaps = 23/286 (8%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+ATL+SMQAL RAQ T
Sbjct  123   RERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAATLYSMQALFRAQTT  182

Query  658   VLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             V  Q++R S          IN  +KS+++ ++ARSE  +   S  Y  S+ S  D   K+
Sbjct  183   VRYQRARRSFNKENRFLPEINA-RKSVERFEDARSEFYSRRLSATYETSVNS-FDESPKI  240

Query  811   VEMDTSVTPKASRKSRRSKTWVPEF-QGNPF---GPPHSSPLPYKIS--TSQDFQDLDTS  972
             VE+DT   P++  +S R  T + +  +  P+     P   P+P +IS   S+  QD +  
Sbjct  241   VEIDT-FKPRS--RSHRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWY  297

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
                +E +F TA  TPRFA    SN P T SKS+  + +FR Y   P YM+STQSF +K R
Sbjct  298   FNGNECKFPTAHNTPRFATSFRSNAPGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSR  357

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
             S SAPKQRPE GP   +KR+SLNEMM +R S SG+RM +SC+  QE
Sbjct  358   SHSAPKQRPEPGP---KKRLSLNEMMAARNSISGIRMHRSCNQIQE  400



>ref|XP_009338738.1| PREDICTED: uncharacterized protein LOC103931052 [Pyrus x bretschneideri]
 ref|XP_009338739.1| PREDICTED: uncharacterized protein LOC103931052 [Pyrus x bretschneideri]
Length=405

 Score =   213 bits (542),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 139/286 (49%), Positives = 182/286 (64%), Gaps = 23/286 (8%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R LKGLVK+QAL+RG+LVRK+A+A L+SMQAL RAQ  
Sbjct  123   RERWAAMKIQTVFRGYLARKAHRALKGLVKLQALVRGFLVRKRAAAALYSMQALFRAQTK  182

Query  658   VLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             V  Q++R S          IN  +KS+++ ++ARSE  +   S  Y  S+ S  D   K+
Sbjct  183   VRYQRARRSFNKENRFLPEINA-RKSVERFEDARSEFYSRRLSATYETSVNS-FDESPKI  240

Query  811   VEMDTSVTPKASRKSRRSKTWVPEF-QGNPF---GPPHSSPLPYKIS--TSQDFQDLDTS  972
             VE+DT   P++  +SRR  T + +  +  P+     P   P+P +IS   S+  QD +  
Sbjct  241   VEIDT-FKPRS--RSRRFNTILSDCGEDLPYQTISSPLPCPMPARISIPDSKKPQDFEWY  297

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
                +E +F TA  TPRFA    SN P T SKS+  + +FR Y   P YM+STQSF +K R
Sbjct  298   FNGNECKFPTAHNTPRFATSFRSNAPGTPSKSVCGDSFFRPYSDSPNYMSSTQSFNAKSR  357

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
             S SAPKQRPE GP   +KR+SLNEMM +R S SG+RM +SC+  QE
Sbjct  358   SHSAPKQRPEPGP---KKRLSLNEMMAARNSISGIRMHRSCNQIQE  400



>ref|XP_003524408.1| PREDICTED: protein IQ-DOMAIN 14-like, partial [Glycine max]
Length=368

 Score =   209 bits (533),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 175/376 (47%), Positives = 231/376 (61%), Gaps = 39/376 (10%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatg-LCHnpttippnitpAEAAWLSSFYGPS  324
             MG+ I+WLKGLF  R     +  S  +   +  LCHNPTTIPPNI+PAEAAWL SFY  +
Sbjct  1     MGRAIRWLKGLFGIRTDRERKENSNHSDRDSRGLCHNPTTIPPNISPAEAAWLQSFYSET  60

Query  325   GGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR-----GGPLFCRERW  489
               E++ +       AA  AAA  A   A  AA AVVR+ S   GR     GG    +ER 
Sbjct  61    EKEQNKH---AIAVAAATAAAADAAVTAAQAAVAVVRLTSHGNGRDTMFGGG---GQERL  114

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             A +KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQATV ++
Sbjct  115   AVVKIQTFFRGYLARKALRALKGLVKLQALVRGYLVRKQAAATLHSMQALIRAQATVRSK  174

Query  670   KSR--PSIIN-------HPQKSIDKNKEARSENITSVHSGR----YFASLGSENDVIT--  804
             KS    S  N         ++S+++  + +SE I  +HS R    + A++ + N V    
Sbjct  175   KSHGLSSTKNEAHLFQTQARRSMERFDDIKSEYIAPIHSRRLSSSFDATMNNANSVDGSP  234

Query  805   KVVEMDT-SVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPY---KISTSQDFQDLDTS  972
             K+VE+DT S  PK+  +SRRS T + +F  +P      SPLP+    I + +++ D +  
Sbjct  235   KIVEVDTGSGRPKS--RSRRSNTSMSDFGDDPSFQALPSPLPFAHLSIPSHRNYHDSEWG  292

Query  973   QISDEYRFSTAQTTPRFANVRGSNN----PITLS-KSMFMEPYFRN-YEGYPKYMASTQS  1134
                +E RFSTAQ+TPRF N     +    P++++ KS+  E +F   Y  +P YMASTQS
Sbjct  293   LTREECRFSTAQSTPRFTNSCSCGSVVVAPMSMTPKSVCTENFFYGQYHNFPNYMASTQS  352

Query  1135  FMSKLRSQSAPKQRPE  1182
             F +KLRS SAPKQRP+
Sbjct  353   FKAKLRSHSAPKQRPD  368



>ref|XP_010915110.1| PREDICTED: protein IQ-DOMAIN 14-like [Elaeis guineensis]
Length=433

 Score =   211 bits (537),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 146/311 (47%), Positives = 190/311 (61%), Gaps = 29/311 (9%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E+WAA+KIQ AFRGYLA+KALR LK LVK+QAL+RG+LVRKQA+ATLH +QAL+RAQA  
Sbjct  117   EQWAAVKIQTAFRGYLAKKALRALKALVKLQALVRGFLVRKQAAATLHRLQALIRAQAAA  176

Query  661   LAQKSR---------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN---DVIT  804
               Q SR         P+ I  P++S ++  EARSE +  VHS R  + L S +   D   
Sbjct  177   RQQNSRSLPSKEGRFPADI-RPRQSYERFNEARSEQLAPVHS-RRLSCLDSPSYSIDRSP  234

Query  805   KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK------ISTSQDFQDLD  966
             K+VEMDT      SR SRR+   V E   +      SSP P +      I T Q  QD D
Sbjct  235   KIVEMDTCRI--KSRSSRRTTPSVSEPTEDQHTLSISSPFPCQTPTRLSIRTRQISQDRD  292

Query  967   TS-QISDEYRFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFR---NYEGYPKYMAST  1128
             +S    D+ R+S TA  TPR+     SN P+T +KS+  ++  FR   +    P YM +T
Sbjct  293   SSLSRDDKCRYSKTAYNTPRYVGY-ASNTPVTPAKSLNTVDGVFRRVLHLPNRPNYMTNT  351

Query  1129  QSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKS  1308
             +S ++K+RSQSAPKQRPEL    +   ++LNE +ESRAS SGV  +KSCS A    NFKS
Sbjct  352   RSSVAKVRSQSAPKQRPELAGLRKWVSLNLNEAVESRASLSGVESRKSCSQAHGAFNFKS  411

Query  1309  AVIGRLGRCTD  1341
             AV+ RL +  +
Sbjct  412   AVVERLDKSVE  422



>ref|XP_009344480.1| PREDICTED: uncharacterized protein LOC103936369 [Pyrus x bretschneideri]
Length=384

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 132/279 (47%), Positives = 174/279 (62%), Gaps = 32/279 (11%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R L+GLVK+QAL+RG+LVRK+A+ATL+SMQAL RAQ T
Sbjct  122   RERWAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGFLVRKRAAATLYSMQALFRAQTT  181

Query  658   VLAQKSRPSI---------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             V  Q++R S          IN  +KS+++ ++ARSE  +   S  Y  S+ S  D   K+
Sbjct  182   VRYQRARRSFNKENRFLPEIN-ARKSVERFEDARSEFYSRRLSATYETSVDS-FDESPKI  239

Query  811   VEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEY  990
             VE+DT   P++  +SRR  T + +             L Y+       +D +     DE 
Sbjct  240   VEIDT-FKPRS--RSRRFNTVLSD---------RGEDLHYQT------KDFEWYFNGDEC  281

Query  991   RFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPK  1170
             +FSTA  TPRFA    SN P T SKS+  + +FR Y  +P YM+ST+SF +K RS SAPK
Sbjct  282   KFSTAHNTPRFATSFRSNAPGTPSKSVCGDSFFRRYSNFPNYMSSTRSFNAKSRSHSAPK  341

Query  1171  QRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             QRPE GP   +KR+SLNEMM +R S   +RM +SC+  Q
Sbjct  342   QRPEPGP---KKRLSLNEMMAARNSICSIRMHRSCNQVQ  377



>ref|XP_004305257.1| PREDICTED: protein IQ-DOMAIN 14-like [Fragaria vesca subsp. vesca]
Length=407

 Score =   208 bits (529),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 136/297 (46%), Positives = 184/297 (62%), Gaps = 20/297 (7%)
 Frame = +1

Query  451   RGRGGPLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             +G GG LF  RERWAA+KIQ  FRGYLARKA R L+GLVK+QAL+RG+LVRK+A+ATL  
Sbjct  118   KGSGGQLFGKRERWAAMKIQTVFRGYLARKAHRALRGLVKLQALVRGFLVRKRAAATLLG  177

Query  628   MQALMRAQATVLAQKSRPSII--------NHPQKSIDKNKEARSENITSVHSGRYFASLG  783
             MQAL+RAQ +V  Q++R S          + P+KSI++  EARSE  +   S  Y  SL 
Sbjct  178   MQALIRAQTSVRYQRARRSFNKENRFLPESRPRKSIERFDEARSEFYSKRLSASYEPSLN  237

Query  784   SENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPF--GPPHSSPLPYKISTSQ--D  951
             S  D   K+VE+DT    K   +SRR  T + E   +      P   P+P +IS  +   
Sbjct  238   S-FDESPKIVEIDTF---KTRSRSRRFNTILSECGEDMHYTSSPLPCPIPTRISVPEGHQ  293

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
              QD +     DE +++TA +TPR A+   SN P T +KS+  + +F      P YM+ST+
Sbjct  294   LQDYEWYFNPDECKYTTAHSTPRLASSFRSNAPNTPAKSVCGDSFFLPCSNCPNYMSSTK  353

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             SF +K RS SAPKQRPE  P   RK++SL+E+M +R S SG+RM +  +  QEV+N+
Sbjct  354   SFKAKSRSHSAPKQRPEPLP---RKKLSLDEIMAARNSVSGIRMHRPYNQVQEVLNY  407



>gb|KHG10609.1| Protein IQ-DOMAIN 14 -like protein [Gossypium arboreum]
Length=403

 Score =   207 bits (528),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 140/293 (48%), Positives = 173/293 (59%), Gaps = 29/293 (10%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ+ FRGYL+RKALR LKGLV++QAL+RGYLVRK+  ATLHSMQAL+RAQ T
Sbjct  122   RERWAAMKIQSVFRGYLSRKALRALKGLVRLQALVRGYLVRKRTIATLHSMQALLRAQTT  181

Query  658   VLAQ-------KSRPSIINH-PQKSIDKNKEARSENITSVHSGRYFASLGSEN-DVITKV  810
             V +Q       K     + H P+ SI++  E RS     +HS R  AS+ +   D   K+
Sbjct  182   VRSQRIHRSFNKDHSCCLEHKPRSSIERFDEPRS----VIHSKRLSASMETNAYDDSPKI  237

Query  811   VEMDTSVTPKASRKSRRSKTWVPEFQGNPFG-----PPHSSPLPYKIST--SQDFQDLDT  969
             VE+DT    K   +SRR         G+ F       P   P+P + ST   Q+  D + 
Sbjct  238   VEIDTF---KTRSRSRRFNLNALSECGDDFASHTNTSPLLCPVPVRTSTPHHQNVDDFEW  294

Query  970   SQISDEYRFSTAQTTPRFAN-VRGSNNPITLSKSMFMEPYFRN-YEGYPKYMASTQSFMS  1143
                 DE R STAQ+TPRFAN VR    P T   S+  E YFR  +   P YMA TQSF +
Sbjct  295   CFADDECRLSTAQSTPRFANPVRTPIAPAT-PLSVCGEGYFRRPHSNLPNYMAKTQSFKA  353

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             KLRS SAPKQRPE G    +KR+SLN +M +R S SGVRM  SC    E +  
Sbjct  354   KLRSHSAPKQRPEPGT---KKRLSLNGLMAARNSISGVRMNTSCYQVDEGLEL  403



>ref|XP_003627052.1| IQ domain-containing protein [Medicago truncatula]
 gb|AET01528.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=414

 Score =   207 bits (528),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 151/309 (49%), Positives = 186/309 (60%), Gaps = 49/309 (16%)
 Frame = +1

Query  451   RGRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLH  624
             +GRG  LF   RE+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLH
Sbjct  114   QGRGT-LFSGSREKWAAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLH  172

Query  625   SMQALMRAQATVLAQKSR----------PSIINHPQKSIDKNKEARSENITSVHSGR---  765
             SMQAL RAQ +V  Q++R          P II   +KS+++  E RSE     HS R   
Sbjct  173   SMQALFRAQTSVRTQRARRSMSKESRFLPEII--ARKSLERYDETRSE----FHSKRLPT  226

Query  766   -YFASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPH--SSPL-PYK  933
              Y  SL   +D   K+VE+DT    K   KSRR  + + E  G    P H  SSP+ P +
Sbjct  227   SYETSLNGYDDQSPKIVEIDTC---KTRSKSRRFSSAMSEC-GEELPPFHALSSPIPPGR  282

Query  934   IST------SQDFQDLD-TSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSM----FME  1080
             IS        Q  Q+ D      +E R+ T   TPRF+N   +  P T SKS+       
Sbjct  283   ISVPDCRNHHQHQQEFDWYFNNLEECRYPTTHNTPRFSNS-STRPPNTPSKSVCGGDIFR  341

Query  1081  PYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVR  1260
             PY+  Y  +P YMA+TQSF +KLRS SAPKQRPE+     +KR+SLNEMM +R S SGVR
Sbjct  342   PYY--YSNFPNYMANTQSFKAKLRSHSAPKQRPEV-----KKRLSLNEMMSARNSISGVR  394

Query  1261  MQKSCSHAQ  1287
             MQK  S+ Q
Sbjct  395   MQKPSSNFQ  403



>ref|XP_004510319.1| PREDICTED: protein IQ-DOMAIN 14-like [Cicer arietinum]
Length=410

 Score =   207 bits (526),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 149/310 (48%), Positives = 187/310 (60%), Gaps = 42/310 (14%)
 Frame = +1

Query  463   GPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G LF   RE+WAA+KIQ  FRGYLARKALR LKGLVKIQAL+RGYLVRK+A+ATLHSMQA
Sbjct  113   GTLFSGSREKWAAVKIQTFFRGYLARKALRALKGLVKIQALVRGYLVRKRAAATLHSMQA  172

Query  637   LMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGR----YFASL  780
             L+RAQ +V  Q++R S+            +KS+++  E RSE     HS R    Y  S+
Sbjct  173   LIRAQTSVRTQRARRSMSKENRFLPEVLARKSLERFDETRSE----FHSKRVPTLYETSM  228

Query  781   GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGN-PFGPPHSSPLPYKISTSQDF-  954
                +D   K+VE+DT    K   KSRR  + + E   + P     SSPLP  I       
Sbjct  229   NGFDDQSPKIVEIDTY---KTRSKSRRFTSTMSECGEDLPHCHGISSPLPCSIPGRVSVP  285

Query  955   -------QDLDTSQISDEYRF-STAQTTPRFAN--VRGSNNPI-TLSKSMFMEPYFRN-Y  1098
                    QD D     +E RF +TA  TPRF N  +R +NN + T SKS+  + +FR+ Y
Sbjct  286   DHCRHVQQDFDWYFNVEECRFPTTAHNTPRFNNSSMRPNNNGLGTPSKSVCGDTFFRSYY  345

Query  1099  EGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK--S  1272
               +P YMA+TQSF +KLRS SAPKQRPE      +KR+SLNEMM +R S SGVRMQ+  +
Sbjct  346   SNFPNYMANTQSFKAKLRSHSAPKQRPEP-----KKRLSLNEMMAARNSISGVRMQRPSN  400

Query  1273  CSHAQEVMNF  1302
                 QE  NF
Sbjct  401   LQTQQESWNF  410



>gb|EYU45838.1| hypothetical protein MIMGU_mgv1a021295mg [Erythranthe guttata]
Length=386

 Score =   205 bits (521),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/273 (48%), Positives = 173/273 (63%), Gaps = 22/273 (8%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ--  669
             +KIQA FRGYLARKALR L+GLVK+QAL RGYLVRK+A+ TL+SMQAL+RAQ+ V +Q  
Sbjct  124   VKIQAFFRGYLARKALRALRGLVKLQALFRGYLVRKRAAKTLYSMQALIRAQSAVRSQMA  183

Query  670   --KSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKA  843
               +S+P   +  QKSI+      SE  +  HS  Y   L ++ D   K+VE+DT   PK+
Sbjct  184   RRRSKPE--SRSQKSIE------SEFHSKRHSASYDPCLNNQFDESPKIVEIDT-CGPKS  234

Query  844   SRKSRRSKTWVPEFQGNPF---GPPHSSP-LPYKISTSQDFQDLDTSQISDEYRFSTAQT  1011
               +SRR  + + EF  + +       SSP LP  I T     D D   +   Y+  TAQT
Sbjct  235   --RSRRMSSCMSEFVEDQYYYGSMMMSSPLLPGPIPTHSPVDDFDWGYVEANYKCPTAQT  292

Query  1012  TPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGP  1191
             TPRF     ++ P T +KS+  +  FR Y   P YM++TQSF +KLRS SAPKQRPE GP
Sbjct  293   TPRFGYSGRAHGPATPAKSVCGDGLFRAYSNCPNYMSNTQSFRAKLRSLSAPKQRPEAGP  352

Query  1192  GPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
                +KR+SL+E+M +R S SGVRM++SCS  +E
Sbjct  353   ---KKRLSLDEIMAARTSFSGVRMRRSCSQVRE  382



>ref|XP_008775821.1| PREDICTED: uncharacterized protein LOC103696080 [Phoenix dactylifera]
Length=434

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 147/318 (46%), Positives = 194/318 (61%), Gaps = 28/318 (9%)
 Frame = +1

Query  463   GPLF--CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             G +F  C E WAA+KIQ AFRGYLA+KALR LK LVK+QAL+RGYLVRKQA+ATLH +QA
Sbjct  109   GTMFNGCMEPWAAVKIQTAFRGYLAKKALRALKALVKLQALVRGYLVRKQAAATLHRLQA  168

Query  637   LMRAQA--------TVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN  792
             ++RAQA        ++L +  R      P+KS ++  E RSE +  VHS R    L S +
Sbjct  169   IIRAQAAARQQNIHSLLPKDGRFPPAIRPRKSYERFNEPRSEQLAPVHSRRLSLCLDSPS  228

Query  793   ---DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK------ISTS  945
                D   K+VEMDT  T   SR SRR+   V E  G+      SSP P +      I T 
Sbjct  229   YSVDRSPKIVEMDTCRT--KSRSSRRTTPSVSETTGDQHSLLISSPFPCQTPPRLSIPTR  286

Query  946   QDFQDLDTSQISD-EYRFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFR---NYEGY  1107
             + +QD D+S  +D + R+S TA  TPR+ N   S+ P+T +K +   +   R   N    
Sbjct  287   RIYQDQDSSLSTDGKCRYSKTAYNTPRYMNY-ASSTPVTPAKGLNAFDGVLRRILNMPNR  345

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             P YMA+T+S ++K+RSQSAPKQRPE+    +R   +LN+ +ESRAS SGV  +KSCS AQ
Sbjct  346   PNYMANTRSSVAKVRSQSAPKQRPEIAGLRKRVPSNLNDAVESRASLSGVVSRKSCSPAQ  405

Query  1288  EVMNFKSAVIGRLGRCTD  1341
                NFKSAV+ RL +  +
Sbjct  406   GAFNFKSAVVERLDKSVE  423



>gb|KHG03794.1| Protein IQ-DOMAIN 31 -like protein [Gossypium arboreum]
Length=358

 Score =   199 bits (506),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 130/283 (46%), Positives = 164/283 (58%), Gaps = 47/283 (17%)
 Frame = +1

Query  463   GPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL-  639
             G +F  ERWAA+KIQ AFRGYLAR+ALR LKGLVKIQA +RGYLVRKQA+   H      
Sbjct  114   GTMFGHERWAAVKIQTAFRGYLARRALRALKGLVKIQARVRGYLVRKQATIRSHKANRFD  173

Query  640   MRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEM  819
             +RA+ ++     R    NH    ID+N                           +K+VE+
Sbjct  174   IRARKSM----ERLYSFNHTTNGIDEN---------------------------SKIVEV  202

Query  820   DTSVTPKASRKSRRSKTWVPEFQGNPFGPPH---SSP----LPYKISTSQDFQDLDTSQI  978
                V PK+  +SRR+        G+ + P H   SSP    +P +IS     +D   +  
Sbjct  203   VDIVRPKS--RSRRNVNASESDFGDDYQPVHRTLSSPFLSRVPARISIPDGGRDWGLT--  258

Query  979   SDEYRFSTAQTTPRFANVRGSN-NPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRS  1155
              DEYRF TAQ TPR  +  GSN N     KS+  + +FR+Y  +P YMA+TQSF +KLRS
Sbjct  259   GDEYRFCTAQNTPRVISSCGSNSNASVPPKSVCSDNWFRHYGNFPNYMANTQSFKAKLRS  318

Query  1156  QSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHA  1284
             QSAPKQRPELGP   RKR+SL+EMMESR S SGVR+Q+ CS  
Sbjct  319   QSAPKQRPELGP---RKRLSLDEMMESRCSLSGVRLQRWCSQV  358



>ref|XP_008462411.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis melo]
Length=430

 Score =   197 bits (502),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 162/413 (39%), Positives = 218/413 (53%), Gaps = 51/413 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatgLCHnpttippnitpA-------------  288
             MGK  +WLKGL   ++       S   + +T L  +        + A             
Sbjct  1     MGKATRWLKGLLGIKKDKDPSPNSNSNSNSTTLAADNRKDKKRWSFAKSTRDSVQTLPPP  60

Query  289   -EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGG  465
              E AW  S Y     +E + HA    AA  AAA  A  AA  A A    R+ S+ RGR  
Sbjct  61    LETAWFRSSYISDSDKEQNKHAIAVAAATAAAADAAVAAAQAAVAVV--RLTSQGRGRAS  118

Query  466   PLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM  642
                  R+RWAA+KIQ  FRGYLARKALR LKGLVK+QA++RG+LVRK+A+ATLHSMQAL 
Sbjct  119   LYITGRDRWAAVKIQTVFRGYLARKALRALKGLVKLQAVVRGFLVRKRAAATLHSMQALF  178

Query  643   RAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGRYFASLGSEN--  792
             RAQ  V  Q++R S            P+KS ++  E RSE     HS R   +   E   
Sbjct  179   RAQTAVRTQRARRSFNKENRFIPDIRPRKSSERFDETRSE---LFHSKRLSVASSYETCM  235

Query  793   ---DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP--------YKIS  939
                D   K+VE+DT  T     +SRR  + + E   +      +SP+P            
Sbjct  236   NSLDESPKIVEIDTYRT---RARSRRYISTLSECGADDIA-FQTSPIPCSNRPRGVVDCH  291

Query  940   TSQDFQDLDTSQISDEYRFSTAQTTPRFAN--VRGSNNPITLSKSMFMEPYFRNYEGY-P  1110
              +   +D +   + ++ +F TA +TPR +N     +N P+T SKS+  + ++R Y  Y P
Sbjct  292   NNNVLRDFEWCLMGEDCKFPTAHSTPRLSNNSFVSANVPVTPSKSVCGDSFYRPYMNYCP  351

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK  1269
              YMA+TQSF +KLRSQSAPKQRPE G    +K++SLNE+M +R S S VRMQ+
Sbjct  352   NYMANTQSFKAKLRSQSAPKQRPEPGS---KKKLSLNEIMAARNSLSSVRMQR  401



>ref|XP_006853731.1| hypothetical protein AMTR_s00056p00168250 [Amborella trichopoda]
 gb|ERN15198.1| hypothetical protein AMTR_s00056p00168250 [Amborella trichopoda]
Length=464

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 160/352 (45%), Positives = 193/352 (55%), Gaps = 64/352 (18%)
 Frame = +1

Query  433   RIASRERGR---GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRK  603
             R+ S  RG    GG    RERWAA+KIQ  FRGYLA+KALR LKGLVK+QAL+RGYLVR+
Sbjct  111   RLTSHGRGTMFSGGVAGSRERWAAVKIQTVFRGYLAKKALRALKGLVKLQALVRGYLVRR  170

Query  604   QASATLHSMQALMRAQATVLAQKSRPSIINH---PQKSIDKNKEARSENITSVHSGRYFA  774
             QA+ATLHSMQAL+RAQATV  Q++  S+      P+KSI++++E      +  HS R  A
Sbjct  171   QAAATLHSMQALIRAQATVRTQRAHRSLQTEPTRPRKSIERHEEP-----SFHHSRRLSA  225

Query  775   SL--GSENDVIT--KVVEMD-----TSVTPKASRKS-----RRSKTW-------VPEFQG  891
             S       DVI   K+VE+D     TS T   SR S     R S +W        P  + 
Sbjct  226   STEPAFSLDVIETPKIVEIDTCRPRTSDTCCPSRVSDTSRPRTSDSWRRGPPPLRPTRKR  285

Query  892   NP----------------------FGPPH--SSPLPYKISTSQDFQDLDTSQISDEYRFS  999
             NP                        P H  SSPL               +   DE RFS
Sbjct  286   NPSISDSTSNFDQSFSSAPTELAWMEPGHALSSPLGSYYEPDWTMGSNLLAPNLDECRFS  345

Query  1000  TAQTTPRFA-NVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQR  1176
             TAQ+TPRF+ +VR  N P   +KS   E    +Y G   YMA TQSF +KLRS SAPKQR
Sbjct  346   TAQSTPRFSISVRAPNTP---TKSTCGEMSC-HYSGSKGYMADTQSFRAKLRSHSAPKQR  401

Query  1177  PELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGR  1332
             PE G G  RKR S+    E R+S SG RMQ+SCSH QE   F+S V+ RL R
Sbjct  402   PEGGLGFGRKRYSIG-GEEGRSSLSGARMQRSCSHVQEA--FRSTVVTRLER  450



>ref|XP_010924446.1| PREDICTED: protein IQ-DOMAIN 14-like [Elaeis guineensis]
Length=433

 Score =   195 bits (496),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 140/313 (45%), Positives = 178/313 (57%), Gaps = 33/313 (11%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAAIKIQ AFRGYLA++ALR LK LVKIQAL+RGYLVRKQA+ATLH +QAL+RAQAT 
Sbjct  117   ERWAAIKIQTAFRGYLAKRALRALKALVKIQALVRGYLVRKQAAATLHRLQALIRAQATA  176

Query  661   LAQKS----------RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN---DVI  801
               Q S           P I   P++S ++  E  SE +  VHS R    L S     +  
Sbjct  177   RKQNSCSLSTKYGRFEPEIF--PRRSYERFNERSSEQLAPVHSRRLSTCLDSPTYRFNRS  234

Query  802   TKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDF------QDL  963
              K+VEMDT  T   S +        P    +    P +SP PY+I            +D 
Sbjct  235   PKIVEMDTCRTKSRSSRRISHSVSKPTEDNHSL--PIASPFPYQIPPRLSIPIGRISEDR  292

Query  964   DTSQISDE-YRFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFR---NYEGYPKYMAS  1125
              +S   D+ YR+S TA  TPR+ +   SN P T  +S+  ++   R   N    P YMA+
Sbjct  293   ASSLGGDDKYRYSKTAHNTPRYVSY-ASNTPATPVQSLDAVDGVLRRILNIRNQPNYMAN  351

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLN-EMMESRASQSGVRMQKSCSHAQEVMNF  1302
             T SF +K+RSQS PKQRPE+    +RK+VSLN   +ESRAS  G   +KSCS AQ    F
Sbjct  352   TSSFTAKVRSQSTPKQRPEM--AGQRKKVSLNSNEVESRASSIGFGSRKSCSQAQGAYKF  409

Query  1303  KSAVIGRLGRCTD  1341
             KSAV+ RL +  +
Sbjct  410   KSAVVERLDQSVE  422



>ref|XP_009135486.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
Length=373

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 130/316 (41%), Positives = 186/316 (59%), Gaps = 60/316 (19%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S  RG G      ERWAA+KIQ  F+GYLARKALR LKGLVK+QAL+RGYLVRK A+
Sbjct  90    RLTSNGRGGGYSGTTMERWAAVKIQTIFKGYLARKALRALKGLVKLQALVRGYLVRKCAA  149

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASL----  780
              T HSMQAL+RAQ +V +Q+   + I HP+ S++K+ ++RS+    +HS R   S+    
Sbjct  150   ETFHSMQALIRAQTSVRSQRINRNNILHPRHSLEKSDDSRSD----IHSKRISVSVEKHS  205

Query  781   --GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDF  954
                + N+   K+VE+DT  T   SR+                       L   +S  +D 
Sbjct  206   NNNTYNETSPKIVEIDTYKTKSRSRR-----------------------LNVDVSEHED-  241

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY--P  1110
              D++ S   D+ +F TAQ TPRF +   +N+     P + +KS+  +PYFR ++ G   P
Sbjct  242   -DIEWSFPGDKCKFPTAQNTPRFYSSAVNNHHYYYTPPSPAKSVCRDPYFRPSHPGLMSP  300

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK-------  1269
              YMA+TQSF +K+RS SAP+QRP+      +K++SL E+M +R+S SGVRM +       
Sbjct  301   SYMANTQSFKAKVRSHSAPRQRPD------KKKLSLEEIMAARSSVSGVRMAQPQQEKRS  354

Query  1270  SCSHA----QEVMNFK  1305
             SCS+     QE ++F+
Sbjct  355   SCSYDRQFPQERVDFR  370



>emb|CDX82400.1| BnaA03g34210D [Brassica napus]
Length=373

 Score =   191 bits (484),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 129/316 (41%), Positives = 185/316 (59%), Gaps = 60/316 (19%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S  RG G      ERWA +KIQ  F+GYLARKALR LKGLVK+QAL+RGYLVRK A+
Sbjct  90    RLTSNGRGGGYSGTTMERWATVKIQTIFKGYLARKALRALKGLVKLQALVRGYLVRKCAA  149

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASL----  780
              T HSMQAL+RAQ +V +Q+   + I HP+ S++K+ ++RS+    +HS R   S+    
Sbjct  150   ETFHSMQALIRAQTSVRSQRINRNNILHPRHSLEKSDDSRSD----IHSKRISVSVEKHS  205

Query  781   --GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDF  954
                + N+   K+VE+DT  T   SR+                       L   +S  +D 
Sbjct  206   NNNTYNETSPKIVEIDTYKTKSRSRR-----------------------LNVDVSEHED-  241

Query  955   QDLDTSQISDEYRFSTAQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY--P  1110
              D++ S   D+ +F TAQ TPRF +   +N+     P + +KS+  +PYFR ++ G   P
Sbjct  242   -DIEWSFPGDKCKFPTAQNTPRFYSSAVNNHHYYYTPPSPAKSVCRDPYFRPSHPGLMSP  300

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM-------QK  1269
              YMA+TQSF +K+RS SAP+QRP+      +K++SL E+M +R+S SGVRM       + 
Sbjct  301   SYMANTQSFKAKVRSHSAPRQRPD------KKKLSLEEIMAARSSVSGVRMAQPQQEKRS  354

Query  1270  SCSHA----QEVMNFK  1305
             SCS+     QE ++F+
Sbjct  355   SCSYDRQFPQERVDFR  370



>ref|XP_004141786.1| PREDICTED: uncharacterized protein LOC101204536 [Cucumis sativus]
Length=426

 Score =   191 bits (485),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 133/304 (44%), Positives = 179/304 (59%), Gaps = 35/304 (12%)
 Frame = +1

Query  433   RIASRERGRGGPLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQA  609
             R+ S+ RGR       R+RWAA+KIQ  FRGYLARKALR LKGLVK+QA++RG+LVRK+A
Sbjct  108   RLTSQGRGRASHYITGRDRWAAVKIQTVFRGYLARKALRALKGLVKLQAVVRGFLVRKRA  167

Query  610   SATLHSMQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGR  765
             +ATLHSMQAL RAQ  V  Q++R S            P+KS ++  E RSE     HS R
Sbjct  168   AATLHSMQALFRAQTAVRTQRARRSFNKENRFNPDIRPRKSSERFDETRSE---LFHSKR  224

Query  766   YFASLGSEN-----DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP-  927
                +   E      D   K+VE+DT  T   SR+   +   + E  G+      SSP+P 
Sbjct  225   LSVASSYETCMNSLDESPKIVEIDTYRTRSRSRRYIST---LSECGGDDIA-FQSSPIPC  280

Query  928   -------YKISTSQDFQDLDTSQISDEYRFSTAQTTPRFAN--VRGSNNPITLSKSMFME  1080
                         +   +D +   + ++ +F TA +TPR +N     +N P+T SKS+  +
Sbjct  281   SNRPRVVVDCHNNNVLRDFEWCLMGEDCKFPTAHSTPRLSNNSFVSANVPVTPSKSVCGD  340

Query  1081  PYFRNYEGY-PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGV  1257
              ++R Y  Y P YMA+TQSF +KLRSQSAPKQRPE G    +K++SLNE+M +R S S V
Sbjct  341   SFYRPYINYCPNYMANTQSFKAKLRSQSAPKQRPEPGS---KKKLSLNEIMAARNSLSSV  397

Query  1258  RMQK  1269
             RMQ+
Sbjct  398   RMQR  401



>ref|XP_010051558.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
 gb|KCW82318.1| hypothetical protein EUGRSUZ_C03722 [Eucalyptus grandis]
Length=473

 Score =   192 bits (487),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 185/468 (40%), Positives = 248/468 (53%), Gaps = 73/468 (16%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggat-------aatgLCHnpttippnitpAEAAWLS  306
             MG+ ++WLKGLF   +       S           A  GLC+NP TIPPNI+ AEAAWL 
Sbjct  1     MGRAVRWLKGLFGIGKDREVVKDSADRRCHPERRHAGGGLCNNPATIPPNISAAEAAWLR  60

Query  307   SFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFCR--  480
             SFY     EE S HA    AA  AAA  A  AA  A A    R+ SR R      F    
Sbjct  61    SFYAEEREEEQSKHAVAVAAATAAAADAAVAAAHAAVAVV--RLTSRGRNTAFGGFGGFG  118

Query  481   --ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
               ERWAA+KIQA+FRGYLAR+AL+ L+ LVK+QA++RGYLVRKQA+A    MQ+L RAQA
Sbjct  119   GPERWAAVKIQASFRGYLARRALKALRALVKLQAVVRGYLVRKQATAAFQCMQSLFRAQA  178

Query  655   TVLAQKSRPSIINH----------PQKSI--------------------------DKNKE  726
             TV ++++R  +             P+ S                           +++ +
Sbjct  179   TVRSRRARAPLAGPGVCATAAECPPRHSTVRFGHRNASASAPFRDELVHACRLLQERSDD  238

Query  727   ARSENITSVHSGRYFASLGSENDVIT-----KVVEMDTSVTPKASRKSRRSKTWV---PE  882
             A SE   S HS R  +SL +   + T     K+VE+DT        +   + T++   P 
Sbjct  239   AGSEYSASFHSMRLSSSLDAATVITTAEGSPKIVEVDTGGPHSRPARPHPADTYLYAEPP  298

Query  883   FQGNPFGPPHSSPLPYK------ISTSQDFQDLDTS-QISDEYRFST-AQTTPRFA--NV  1032
              Q  P  P  SSPLP +      I   + F D + +    D YRFST A +TPR A  ++
Sbjct  299   PQPPPPHPTFSSPLPLRAPPRLSIPERRSFPDPEWALSGGDGYRFSTTAHSTPRLAGSSL  358

Query  1033  RGSNNPITLS----KSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPR  1200
              G + P T S    +      + R     P YMAST+S  +KLRSQSAPKQRPE  PG +
Sbjct  359   CGPSGPATPSDRSGECGDGSSWGRIGGRSPNYMASTESSAAKLRSQSAPKQRPE--PGSK  416

Query  1201  RKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             R+   L+    SR+S SG RMQ++CS AQEV++FK+A++G+LGR +++
Sbjct  417   RRLSLLDAAAGSRSSLSGARMQRACSRAQEVISFKNAILGKLGRPSEF  464



>ref|XP_009114713.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
 ref|XP_009114718.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
 ref|XP_009114727.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
 ref|XP_009114733.1| PREDICTED: protein IQ-DOMAIN 14-like [Brassica rapa]
Length=389

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 172/275 (63%), Gaps = 42/275 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ  F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSMQAL RAQ +V
Sbjct  113   ERWAAVKIQTVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALFRAQTSV  172

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN-------DVITKVVEM  819
              +Q+   + + HP+ S+++  ++RSE    VHS R   S+  EN       +   K+VE+
Sbjct  173   RSQRINRNNMLHPRHSLERFDDSRSE----VHSKRISISVERENFNNNVYDETSPKIVEI  228

Query  820   DTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFS  999
             DT    K   +SRR    V E  G+ F           I   +DF+    S   D+ +F 
Sbjct  229   DTY---KTKSRSRRMNVAVSEC-GDDF-----------IYQGKDFE---WSFPGDKCKFP  270

Query  1000  TAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLRSQ  1158
             TAQ TPRF++   SN+    P + +KS+  +  FR +Y G   P YMA+TQSF +K+RS 
Sbjct  271   TAQNTPRFSSSMASNHHYYTPPSPAKSVSRDVCFRPSYSGLMTPSYMANTQSFKAKVRSH  330

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  331   SAPRQRPD------RKRLSLDEIMAARSSVSGVRM  359



>emb|CDY68636.1| BnaAnng27880D [Brassica napus]
Length=389

 Score =   190 bits (482),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 127/275 (46%), Positives = 172/275 (63%), Gaps = 42/275 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ  F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSMQAL RAQ +V
Sbjct  113   ERWAAVKIQTVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALFRAQTSV  172

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN-------DVITKVVEM  819
              +Q+   + + HP+ S+++  ++RSE    VHS R   S+  EN       +   K+VE+
Sbjct  173   RSQRINRNNMLHPRHSLERFDDSRSE----VHSKRISISVERENFNNNVYDETSPKIVEI  228

Query  820   DTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFS  999
             DT    K   +SRR    V E  G+ F           I   +DF+    S   D+ +F 
Sbjct  229   DTY---KTKSRSRRMNVAVSEC-GDDF-----------IYQGKDFE---WSFPGDKCKFP  270

Query  1000  TAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLRSQ  1158
             TAQ TPRF++   SN+    P + +KS+  +  FR +Y G   P YMA+TQSF +K+RS 
Sbjct  271   TAQNTPRFSSSMASNHHYYTPPSPAKSVSRDVCFRPSYSGLMTPSYMANTQSFKAKVRSH  330

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  331   SAPRQRPD------RKRLSLDEIMAARSSVSGVRM  359



>gb|KGN45577.1| hypothetical protein Csa_7G452320 [Cucumis sativus]
Length=566

 Score =   191 bits (485),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 133/304 (44%), Positives = 179/304 (59%), Gaps = 35/304 (12%)
 Frame = +1

Query  433   RIASRERGRGGPLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQA  609
             R+ S+ RGR       R+RWAA+KIQ  FRGYLARKALR LKGLVK+QA++RG+LVRK+A
Sbjct  108   RLTSQGRGRASHYITGRDRWAAVKIQTVFRGYLARKALRALKGLVKLQAVVRGFLVRKRA  167

Query  610   SATLHSMQALMRAQATVLAQKSRPSIINH--------PQKSIDKNKEARSENITSVHSGR  765
             +ATLHSMQAL RAQ  V  Q++R S            P+KS ++  E RSE     HS R
Sbjct  168   AATLHSMQALFRAQTAVRTQRARRSFNKENRFNPDIRPRKSSERFDETRSE---LFHSKR  224

Query  766   YFASLGSEN-----DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP-  927
                +   E      D   K+VE+DT  T   SR+   +   + E  G+      SSP+P 
Sbjct  225   LSVASSYETCMNSLDESPKIVEIDTYRTRSRSRRYIST---LSECGGDDIA-FQSSPIPC  280

Query  928   -------YKISTSQDFQDLDTSQISDEYRFSTAQTTPRFAN--VRGSNNPITLSKSMFME  1080
                         +   +D +   + ++ +F TA +TPR +N     +N P+T SKS+  +
Sbjct  281   SNRPRVVVDCHNNNVLRDFEWCLMGEDCKFPTAHSTPRLSNNSFVSANVPVTPSKSVCGD  340

Query  1081  PYFRNYEGY-PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGV  1257
              ++R Y  Y P YMA+TQSF +KLRSQSAPKQRPE G    +K++SLNE+M +R S S V
Sbjct  341   SFYRPYINYCPNYMANTQSFKAKLRSQSAPKQRPEPGS---KKKLSLNEIMAARNSLSSV  397

Query  1258  RMQK  1269
             RMQ+
Sbjct  398   RMQR  401



>ref|XP_010051559.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
Length=505

 Score =   190 bits (482),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 171/440 (39%), Positives = 241/440 (55%), Gaps = 45/440 (10%)
 Frame = +1

Query  145   KMGKVIKWLKGLFttrqsnggrsgsggat-------aatgLCHnpttippnitpAEAAWL  303
             +MG+ ++WLKGLF   +       +           A  GLC+NP TIPPNI+ AEAAWL
Sbjct  62    EMGRAVRWLKGLFGIGKDREVVKDAADRRCHPERRRAGGGLCNNPATIPPNISAAEAAWL  121

Query  304   SSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRG-GPLFCR  480
              SFY     EE S        AA   AA  A  AA  AA  VVR+ SR R    G   C 
Sbjct  122   RSFYVEEREEEQSK--HAVAVAAATVAAADAAVAAAHAAVDVVRLTSRGRSTAFGGFGCP  179

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQA+FRGYLAR+AL+ L+ LVK+QA++RGYLVRKQA+A    MQ+L RAQATV
Sbjct  180   ERWAAVKIQASFRGYLARRALKALRALVKLQAVVRGYLVRKQATAAFQCMQSLFRAQATV  239

Query  661   LAQKSRPSIINH------------PQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT  804
              ++++   +               P+ S +++ +A SE   S HS R  +SL +   + T
Sbjct  240   RSRRAGAPLTASDVYATAATAECPPRHSSERSDDAGSEYSASFHSMRLLSSLDAATAITT  299

Query  805   -----KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP------YKISTSQD  951
                   +++++T        +   + T++      P  P  S+ LP        I   + 
Sbjct  300   AEGCPTIMKVNTGGPHSRPARPHLADTYLYSELPPPPHPTFSATLPLHAPPLLSIPERRS  359

Query  952   FQDLDTS-QISDEYRFS-TAQTTPRFA--NVRGSNNPITLS----KSMFMEPYFRNYEGY  1107
             F D + +    +  RFS TA  TPR A  ++ G + P T S    +      + R     
Sbjct  360   FLDPEWALSGGNGCRFSTTAHNTPRLASSSLCGPSGPATPSHRSGECGDGSSWGRISGRS  419

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMME-SRASQSGVRMQKSCSHA  1284
             P YMA T+S  +KLRSQSAPKQRPELG    ++R+SL++    SR+S S  RMQ++CS A
Sbjct  420   PNYMAITESSAAKLRSQSAPKQRPELG---SKRRLSLHDAAAGSRSSLSEARMQRACSRA  476

Query  1285  QEVMNFKSAVIGRLGRCTDY  1344
             QEV++FK+A++G+L R +++
Sbjct  477   QEVISFKNAILGKLARPSEF  496



>ref|NP_188270.1| protein IQ-domain 26 [Arabidopsis thaliana]
 dbj|BAB01148.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAV34769.1| At3g16490 [Arabidopsis thaliana]
 gb|AAW78596.1| At3g16490 [Arabidopsis thaliana]
 gb|AEE75826.1| protein IQ-domain 26 [Arabidopsis thaliana]
Length=389

 Score =   187 bits (474),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 126/292 (43%), Positives = 180/292 (62%), Gaps = 43/292 (15%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S  R  G      ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+
Sbjct  90    RLTSNGRSGGYSGNAMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAA  149

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSE-  789
              TLHSMQAL+RAQ +V +Q+   + + HP+ S+++  ++RSE    +HS R   S+  + 
Sbjct  150   ETLHSMQALIRAQTSVRSQRINRNNMFHPRHSLERLDDSRSE----IHSKRISISVEKQS  205

Query  790   -------NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQ  948
                    ++   K+VE+DT    K   +S+R    V E  G+ F           I  ++
Sbjct  206   NHNNNAYDETSPKIVEIDTY---KTKSRSKRMNVAVSEC-GDDF-----------IYQAK  250

Query  949   DFQDLDTSQISDEYRFSTAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NYEGY--  1107
             DF+    S   ++ +F TAQ TPRF++   +NN    P + +KS+  +  FR +Y G   
Sbjct  251   DFE---WSFPGEKCKFPTAQNTPRFSSSMANNNYYYTPPSPAKSVCRDACFRPSYPGLMT  307

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             P YMA+TQSF +K+RS SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  308   PSYMANTQSFKAKVRSHSAPRQRPD------RKRLSLDEIMAARSSVSGVRM  353



>ref|XP_006297850.1| hypothetical protein CARUB_v10013891mg [Capsella rubella]
 gb|EOA30748.1| hypothetical protein CARUB_v10013891mg [Capsella rubella]
Length=394

 Score =   186 bits (472),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 126/280 (45%), Positives = 171/280 (61%), Gaps = 47/280 (17%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSMQAL+RAQ +V
Sbjct  111   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALIRAQTSV  170

Query  661   LAQKSRPSIIN---------HPQKSIDKNKEARSENITSVHSGRYFASLGSE-------N  792
              +Q+   SI           HP+ S+++  ++RSE    VHS R   S+  +       +
Sbjct  171   RSQRINRSITRDNNNNNNMFHPRHSLERFDDSRSE----VHSKRISISVEKQSNYNNAYD  226

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTS  972
             +   K+VE+DT    K   +S+R    V E  G+ F           I   +DF+    S
Sbjct  227   ETSPKIVEIDTY---KTKSRSKRMNVAVSEC-GDDF-----------IYHGKDFE---WS  268

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMS  1143
                D+ +F TAQ TPRF+N      P + +KS+  E  FR +Y G   P YMA+TQSF +
Sbjct  269   FPGDKCKFPTAQNTPRFSNNHHYYAPPSPAKSVSREACFRPSYPGLMTPSYMANTQSFKA  328

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             K+RS SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  329   KVRSHSAPRQRPD------RKRLSLDEIMAARSSVSGVRM  362



>ref|XP_010504374.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=394

 Score =   182 bits (463),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 123/278 (44%), Positives = 171/278 (62%), Gaps = 45/278 (16%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSM AL+RAQ +V
Sbjct  112   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMHALIRAQTSV  171

Query  661   LAQKSRPSIIN------HPQKSIDKNKEARSENITSVHSGRYFASL--GSENDVIT----  804
              +Q+   S+I       HP+ S+++  ++RSE    +HS R   S+   S N+ I     
Sbjct  172   RSQRINRSLIRDNNNMFHPRHSLERLDDSRSE----IHSKRISISVEKQSNNNNIAYDET  227

Query  805   --KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQI  978
               K+VE+DT    K   +S+R    V E  G+ F                  +DL+ S  
Sbjct  228   SPKIVEIDTC---KTKSRSKRMSVAVSEC-GDDF--------------IYQGKDLEWSFP  269

Query  979   SDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKL  1149
              ++ ++ TAQ TPRF+N      P + +KS+  +  FR +Y G   P YMA+TQSF +K+
Sbjct  270   GEKCKYPTAQNTPRFSNNHHYYTPPSPAKSVCRDACFRPSYPGMMTPSYMANTQSFKAKV  329

Query  1150  RSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             RS SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  330   RSHSAPRQRPD------RKRLSLDEIMAARSSVSGVRM  361



>ref|XP_008795506.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008795507.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008795508.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008795509.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008795510.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
 ref|XP_008795511.1| PREDICTED: protein IQ-DOMAIN 1-like [Phoenix dactylifera]
Length=433

 Score =   183 bits (464),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 140/317 (44%), Positives = 175/317 (55%), Gaps = 35/317 (11%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ AFRGYLA+KALR LK LVK+QAL+RGYLVRKQA ATLH +QAL+RAQA  
Sbjct  117   ERWAAVKIQTAFRGYLAKKALRALKSLVKLQALVRGYLVRKQAFATLHRLQALIRAQAAA  176

Query  661   LAQKS----------RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN---DVI  801
               Q S           P I   P++S ++  E R E +  VHS R    L S     D  
Sbjct  177   RKQNSCSLPAKYGRFSPEIF--PRRSYERFNELRGEQLAPVHSRRLSTCLDSPTYSFDRS  234

Query  802   TKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDF------QDL  963
              K+VEMDT  T   S +        P  + +    P SS  P +I            +D 
Sbjct  235   PKIVEMDTYRTKSRSSRRISHSVSNPT-EEDQHSLPISSSFPCRIPPRLSIPIRRISEDQ  293

Query  964   DTSQISDE-YRFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFR---NYEGYPKYMAS  1125
             D+S   D+ YR S TA +TPR  +   SN P T ++S+  ++   R   N    P Y A+
Sbjct  294   DSSLSGDDIYRCSKTAYSTPRSTSY-ASNTPATPAQSLDAVDGVLRRILNKPNQPNYTAN  352

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFK  1305
             T+SF +K+R+QS PKQRPE+     RK+V LN   E RAS SG   +KS S AQ   NFK
Sbjct  353   TRSFTAKVRTQSTPKQRPEM--AGLRKKVPLNSNEEYRASFSGFGSRKSPSQAQGAFNFK  410

Query  1306  SAVIGRLGRC----TDY  1344
             SAV+ RL R     TDY
Sbjct  411   SAVVERLDRSAELGTDY  427



>ref|XP_002885142.1| IQ-domain 26 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61401.1| IQ-domain 26 [Arabidopsis lyrata subsp. lyrata]
Length=390

 Score =   181 bits (460),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 124/291 (43%), Positives = 180/291 (62%), Gaps = 42/291 (14%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S  R  G      ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+
Sbjct  90    RLTSNGRTGGYSGTTMERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAA  149

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSE-  789
              TLHSMQAL+RAQ +V +Q+   + + +P+ S+++  ++RSE    +HS R   S+  + 
Sbjct  150   ETLHSMQALIRAQTSVRSQRINRNNLFNPRHSLERFDDSRSE----IHSKRISISVEKQS  205

Query  790   ------NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQD  951
                   ++   K+VE+DT    K   +S+R    V E  G+ F           I  ++D
Sbjct  206   NNNNAYDETSPKIVEIDTY---KTKSRSKRMNVAVSEC-GDDF-----------IYQAKD  250

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NYEGY--P  1110
             F+    S   ++ +F TAQ TPRF++   +N+    P + +KS+  +  FR +Y G   P
Sbjct  251   FE---WSFPGEKCKFPTAQNTPRFSSSAANNHYYYTPPSPAKSVCRDVCFRPSYPGLMTP  307

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
              YMA+TQSF +K+RS SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  308   SYMANTQSFKAKVRSHSAPRQRPD------RKRLSLDEIMAARSSVSGVRM  352



>gb|KFK38994.1| hypothetical protein AALP_AA3G186300 [Arabis alpina]
Length=386

 Score =   181 bits (459),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 127/296 (43%), Positives = 181/296 (61%), Gaps = 48/296 (16%)
 Frame = +1

Query  433   RIASRERG-RGGPLFC---RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVR  600
             R+ S  RG  GG  F     ERWAA+KIQ  F+GYLARKALR LKGLVK+QAL+RG+LVR
Sbjct  89    RLTSNGRGYSGGNGFTGNTMERWAAVKIQTVFKGYLARKALRALKGLVKLQALVRGFLVR  148

Query  601   KQASATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASL  780
             K+AS TLHSMQAL+RAQ +V +Q+   + + HP+ S+++  ++RSE    +HS R   S+
Sbjct  149   KRASETLHSMQALIRAQTSVRSQRINRNNMFHPRHSLERFDDSRSE----IHSKRISISV  204

Query  781   GSE---------NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYK  933
               +         ++   K+VE+DT    K   +S+R    V E  G+ F           
Sbjct  205   EKQNNNINNNVYDETSPKIVEIDTY---KTKSRSKRMNIAVSEC-GDDF-----------  249

Query  934   ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NY  1098
             I   +DF+    S   ++ +F TAQ TPRF+++  +N+    P + +KS+  +  FR +Y
Sbjct  250   IYQGKDFE---WSFPGEKCKFPTAQNTPRFSSLVANNHYYYTPPSPAKSVCRDACFRPSY  306

Query  1099  EGY--PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVR  1260
              G   P YMA+TQSF +K+RS SAP+QRP+      RKR+SL+E+M +R+S SGVR
Sbjct  307   PGLMTPSYMANTQSFKAKVRSHSAPRQRPD------RKRLSLDEIMAARSSVSGVR  356



>ref|XP_010487511.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=396

 Score =   180 bits (457),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/282 (42%), Positives = 170/282 (60%), Gaps = 53/282 (19%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSM AL+RAQ +V
Sbjct  112   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMHALIRAQTSV  171

Query  661   LAQKSRPSIIN-------HPQKSIDKNKEARSENITSVHSGRYFASLGSE-------NDV  798
              +Q+   S+I        HP+ S+++  ++RSE    +HS R   S+  +       ++ 
Sbjct  172   RSQRINRSLIRDNNNNMFHPRHSLERLDDSRSE----IHSKRISISVEKQSNNNNAYDET  227

Query  799   ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDF----QDLD  966
               K+VE+DT    K   +S+R    V E +                    DF    +DL+
Sbjct  228   SPKIVEIDTY---KTKSRSKRMSVAVSECE-------------------DDFIYQGKDLE  265

Query  967   TSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFR-NYEGY--PKYMASTQSF  1137
              S   ++ ++ TAQ TPRF+N      P + +KS+  +  FR +Y G   P YMA+TQSF
Sbjct  266   WSFPGEKCKYPTAQNTPRFSNNHHYYTPPSPAKSVCRDACFRPSYPGMMTPSYMANTQSF  325

Query  1138  MSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
              +K+RS SAP+QRP+      RKR+SL+E+M +R+S SG+RM
Sbjct  326   KAKVRSHSAPRQRPD------RKRLSLDEIMAARSSVSGLRM  361



>emb|CDY67178.1| BnaCnng53860D [Brassica napus]
Length=388

 Score =   180 bits (456),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 127/295 (43%), Positives = 179/295 (61%), Gaps = 52/295 (18%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ  F+GYLARKALR LKGLV++QAL+RGYLVRK+A+ TLHSMQAL+RAQ +V
Sbjct  111   ERWAAVKIQTIFKGYLARKALRALKGLVRLQALVRGYLVRKRAAETLHSMQALIRAQTSV  170

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASL---GSEN-----DVITKVVE  816
              +Q+   + + HP+ S++   ++RSE    VHS R    +   GS N     +   K+VE
Sbjct  171   RSQRINRNNMLHPRHSLEMFDDSRSE----VHSKRISICVERQGSSNNNAYDETSPKIVE  226

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRF  996
             +DT    K   +SRR    V E  G+ F           I   +DF+    S   D+ +F
Sbjct  227   IDTY---KTKSRSRRMNVAVSEC-GDDF-----------IYQGKDFE---WSFPGDKCKF  268

Query  997   STAQTTPRFANVRGSNN----PITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLRS  1155
              TAQ TPRF++   +N+    P + +KS+  +  FR +Y G   P YMA+TQSF +K+RS
Sbjct  269   PTAQNTPRFSSSMANNHHYYTPPSPAKSVSRDVCFRPSYPGLLTPSYMANTQSFKAKVRS  328

Query  1156  QSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM---------QKSCSHAQEV  1293
              SAP+QRP+      RKR+S +E+M +R+S SGVRM         + SCS+ +++
Sbjct  329   HSAPRQRPD------RKRLSRDEIMAARSSVSGVRMVQPQPQQEKRSSCSYDRQL  377



>ref|XP_010465672.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=397

 Score =   179 bits (454),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 122/277 (44%), Positives = 172/277 (62%), Gaps = 44/277 (16%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSMQAL+RAQ  V
Sbjct  112   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALIRAQTGV  171

Query  661   LAQK-----SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASL--GSENDVIT-----  804
              +Q+     +R + + HP+ S+++  ++RSE    ++S R   S+   S N+ I      
Sbjct  172   RSQRMNRSLARDNSMFHPRHSLERLDDSRSE----IYSKRISISVEKQSNNNNIAYDETS  227

Query  805   -KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQIS  981
              K+VE+DT    K   KS+R    V E  G+ F                  +DL+ S   
Sbjct  228   PKIVEIDTY---KTKSKSKRMSVAVSEC-GDDF--------------IYQGKDLEWSFPG  269

Query  982   DEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLR  1152
             ++ ++ TAQ TPRF+N      P + +KS+  +  FR +Y G   P YMA+T+SF +K+R
Sbjct  270   EKCKYPTAQNTPRFSNNHHYYTPPSPAKSVCKDACFRPSYPGMMTPSYMANTKSFKAKVR  329

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             S SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  330   SHSAPRQRPD------RKRLSLDEIMAARSSVSGVRM  360



>emb|CDX75883.1| BnaC03g39660D [Brassica napus]
Length=375

 Score =   177 bits (449),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 125/318 (39%), Positives = 185/318 (58%), Gaps = 62/318 (19%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ S  R  G      ERWAA+KIQ  F+GYLARKALR LKG+VK+QAL+RGYLVRK+ +
Sbjct  90    RLTSNGRSGGYSGTTMERWAAVKIQTIFKGYLARKALRALKGIVKLQALVRGYLVRKRPA  149

Query  613   ATLHSMQALMRAQATVLAQK-SRPSIIN-HPQKSIDKNKEARSENITSVHSGRYFASLGS  786
              TLHSMQAL+RAQ +V +Q+ +R ++++ HP+ S++++ ++RSE    VHS R   S+  
Sbjct  150   ETLHSMQALIRAQTSVRSQRINRNNMLHIHPRHSLERSDDSRSE----VHSKRISVSVEK  205

Query  787   ENDVIT------KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQ  948
              N+  T      K+VE+DT  T   SR+                           +  S+
Sbjct  206   HNNNNTYNETSPKIVEIDTYKTKSRSRR-------------------------LNVDVSE  240

Query  949   DFQDLDTSQISDEYRFSTAQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY-  1107
                D++ S   D+ +F TAQ TPRF +   +N+     P + +KS+  +  FR ++ G  
Sbjct  241   HGDDIEWSFPGDKCKFPTAQNTPRFYSSAVNNHHYYYTPPSPAKSVCRDACFRPSHPGLM  300

Query  1108  -PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM-------  1263
              P YMA+T SF +K+RS SAP+QRP+      +K++SL E+M +R+S SGVRM       
Sbjct  301   SPSYMANTLSFKAKVRSHSAPRQRPD------KKKLSLEEIMAARSSVSGVRMVQPQQEK  354

Query  1264  QKSCSHA----QEVMNFK  1305
             + SCS+     QE ++F+
Sbjct  355   RSSCSYDRQFPQERVDFR  372



>emb|CDX92076.1| BnaA05g23310D [Brassica napus]
Length=387

 Score =   177 bits (448),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 168/275 (61%), Gaps = 48/275 (17%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TL+SMQAL+RAQ +V
Sbjct  112   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLYSMQALIRAQTSV  171

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASL------GSENDVITKVVEMD  822
              +Q+   + + HP+ S+++  ++RSE    +HS R   S+       + ++   K+VE+D
Sbjct  172   RSQRINRNNMLHPRHSLERFDDSRSE----IHSKRMSISVEKHINNNTYDETSPKIVEID  227

Query  823   TSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFST  1002
             T  T   SR+                       +   +S   D +D + S   ++ +F T
Sbjct  228   TYKTKSRSRR-----------------------MNVAVSECGD-EDFEWSFRGEKCKFPT  263

Query  1003  AQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLRSQ  1158
             AQ TPRF++    NN     P + +KS+  +  ++ +Y G   P YMA+TQSF +K RS 
Sbjct  264   AQNTPRFSSSAAMNNNYYYTPPSPAKSVCRDACYKPSYPGLMTPSYMANTQSFRAKARSH  323

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  324   SAPRQRPD------RKRLSLDEIMAARSSVSGVRM  352



>ref|XP_009146082.1| PREDICTED: protein IQ-DOMAIN 14 [Brassica rapa]
Length=387

 Score =   176 bits (447),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 115/275 (42%), Positives = 167/275 (61%), Gaps = 48/275 (17%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TL+SMQAL+RAQ +V
Sbjct  112   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLYSMQALIRAQTSV  171

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSE------NDVITKVVEMD  822
              +Q+   + + HP+ S+++  ++RSE    +HS R   S+         ++   K+VE+D
Sbjct  172   RSQRINRNNMLHPRHSLERFDDSRSE----IHSKRMSISVEKHINNNIYDETSPKIVEID  227

Query  823   TSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFST  1002
             T  T   SR+                       +   +S   D +D + S   ++ +F T
Sbjct  228   TYKTKSRSRR-----------------------MNVAVSECGD-EDFEWSFRGEKCKFPT  263

Query  1003  AQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLRSQ  1158
             AQ TPRF++    NN     P + +KS+  +  ++ +Y G   P YMA+TQSF +K RS 
Sbjct  264   AQNTPRFSSSAAMNNNYYYTPPSPAKSVCRDACYKPSYPGLMTPSYMANTQSFRAKARSH  323

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             SAP+QRP+      RKR+SL+E+M +R+S SGVRM
Sbjct  324   SAPRQRPD------RKRLSLDEIMAARSSVSGVRM  352



>gb|KCW82319.1| hypothetical protein EUGRSUZ_C03723 [Eucalyptus grandis]
Length=469

 Score =   177 bits (449),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 170/465 (37%), Positives = 241/465 (52%), Gaps = 71/465 (15%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggat-------aatgLCHnpttippnitpAEAAWLS  306
             MG+ ++WLKGLF   +       +           A  GLC+NP TIPPNI+ AEAAWL 
Sbjct  1     MGRAVRWLKGLFGIGKDREVVKDAADRRCHPERRRAGGGLCNNPATIPPNISAAEAAWLR  60

Query  307   SFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRG-GPLFCRE  483
             SFY     EE S        AA   AA  A  AA  AA  VVR+ SR R    G   C E
Sbjct  61    SFYVEEREEEQSK--HAVAVAAATVAAADAAVAAAHAAVDVVRLTSRGRSTAFGGFGCPE  118

Query  484   RWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVL  663
             RWAA+KIQA+FRGYLAR+AL+ L+ LVK+QA++RGYLVRKQA+A    MQ+L RAQATV 
Sbjct  119   RWAAVKIQASFRGYLARRALKALRALVKLQAVVRGYLVRKQATAAFQCMQSLFRAQATVR  178

Query  664   AQKS--------------------------------------RPSIINHPQKSIDKNKEA  729
             ++++                                      R  +++  +   +++ +A
Sbjct  179   SRRAGAPLTASDVYATAATAECPPRHSSVRFGHRNASALTSFRDELVHGCRLLQERSDDA  238

Query  730   RSENITSVHSGRYFASLGSENDVIT-----KVVEMDTSVTPKASRKSRRSKTWVPEFQGN  894
              SE   S HS R  +SL +   + T      +++++T        +   + T++      
Sbjct  239   GSEYSASFHSMRLLSSLDAATAITTAEGCPTIMKVNTGGPHSRPARPHLADTYLYSELPP  298

Query  895   PFGPPHSSPLPY------KISTSQDFQDLDTS-QISDEYRFST-AQTTPRFAN--VRGSN  1044
             P  P  S+ LP        I   + F D + +    +  RFST A  TPR A+  + G +
Sbjct  299   PPHPTFSATLPLHAPPLLSIPERRSFLDPEWALSGGNGCRFSTTAHNTPRLASSSLCGPS  358

Query  1045  NPITLS----KSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRV  1212
              P T S    +      + R     P YMA T+S  +KLRSQSAPKQRPELG    ++R+
Sbjct  359   GPATPSHRSGECGDGSSWGRISGRSPNYMAITESSAAKLRSQSAPKQRPELG---SKRRL  415

Query  1213  SLNEMME-SRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTDY  1344
             SL++    SR+S S  RMQ++CS AQEV++FK+A++G+L R +++
Sbjct  416   SLHDAAAGSRSSLSEARMQRACSRAQEVISFKNAILGKLARPSEF  460



>ref|XP_006406831.1| hypothetical protein EUTSA_v10020849mg [Eutrema salsugineum]
 gb|ESQ48284.1| hypothetical protein EUTSA_v10020849mg [Eutrema salsugineum]
Length=406

 Score =   174 bits (442),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 124/287 (43%), Positives = 175/287 (61%), Gaps = 51/287 (18%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ  F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ T HSMQAL RAQ +V
Sbjct  118   ERWAAVKIQTVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETFHSMQALFRAQTSV  177

Query  661   LAQKS-RPSIIN-------HPQKSIDKNKEARSENITSVHSGRYFASL--GSENDVIT--  804
              +Q+  R S+         HP+ S+++  ++RSE    +HS R   S+   S N+ +   
Sbjct  178   RSQRMIRSSLTRDNNNNMFHPRYSLERFDDSRSE----IHSKRISISVEKQSNNNAVYDE  233

Query  805   ---KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQ  975
                K+VE+DT  T     +S+R    V E  G+ F           I   +DF+    S 
Sbjct  234   TSPKIVEIDTFRTKS---RSKRMNVAVSEC-GDDF-----------IYQGKDFE---WSF  275

Query  976   ISDEYRFSTAQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY--PKYMASTQ  1131
               ++ +F TAQ TPRF++   +N+     P + +KS+  +  FR +Y G   P YMA+TQ
Sbjct  276   PGEKSKFPTAQNTPRFSSSAANNHHYYYTPPSPAKSVCRDACFRPSYPGLMTPSYMANTQ  335

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKS  1272
             SF +K+RS SAP+QRP+      RKR+SL+E+M +R+S SGVRM ++
Sbjct  336   SFKAKVRSHSAPRQRPD------RKRLSLDEIMAARSSVSGVRMAQT  376



>ref|XP_009385779.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
 ref|XP_009385780.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
Length=406

 Score =   174 bits (442),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 132/301 (44%), Positives = 183/301 (61%), Gaps = 30/301 (10%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
              R++ AA+KIQ AFRG+LARKALR L+ LVK+QAL+RGYLVRKQA+ TLHSMQAL+RAQA
Sbjct  108   ARDQLAAVKIQTAFRGFLARKALRALRALVKLQALVRGYLVRKQAAKTLHSMQALVRAQA  167

Query  655   TVLAQKS---RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSE-NDVITKVVEMD  822
             TV AQ++   RP I +  ++S++++K+     ++S    R   SL S   D   K+VE+D
Sbjct  168   TVRAQRARNLRPEIRH--RRSLERSKDL----MSSFQRWRLPTSLDSTIIDRSPKMVEID  221

Query  823   TSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIS--TSQDFQDLDTSQIS-DEYR  993
              S  PK    SR + T   +   +      SS +P +IS  + ++F++ D   I+ D  R
Sbjct  222   ASY-PKKLSSSRPTATSFTDPADDIPLRGFSSQIPARISVPSRRNFEENDWYCINGDRCR  280

Query  994   FS-TAQTTPRFANVRGSNNPITLSKSMFMEPYFR---NYEGYPKYMASTQSFMSKLRSQS  1161
              S TAQ+TPR+ N         LS  +   P  R   +    P YMA TQS  +KLRSQS
Sbjct  281   CSVTAQSTPRYVN---------LSCDVAATPVLRQSLSVSNSPTYMAKTQSSKAKLRSQS  331

Query  1162  APKQRPELGPGPRRKRVSLNEM-MESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCT  1338
             A KQ P+  P   R+R  L+E+ +E+RA+ +G+  +K    AQE  NFK AVIGRL R +
Sbjct  332   AAKQPPD--PAETRRRQPLSEVNVEARANVAGIATKKPRPQAQEAFNFKKAVIGRLDRSS  389

Query  1339  D  1341
             +
Sbjct  390   E  390



>ref|NP_001054836.1| Os05g0187500 [Oryza sativa Japonica Group]
 gb|AAS86400.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF16750.1| Os05g0187500 [Oryza sativa Japonica Group]
 gb|EAY96822.1| hypothetical protein OsI_18746 [Oryza sativa Indica Group]
Length=497

 Score =   175 bits (444),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 136/355 (38%), Positives = 190/355 (54%), Gaps = 78/355 (22%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA++IQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SMQAL+RAQATV A 
Sbjct  136   AAVRIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQALVRAQATVRAH  195

Query  670   KSRPSI------INH----PQKSIDK------------------------------NKEA  729
             +S          ++H    P++S+ +                                + 
Sbjct  196   RSGAGAAANLPHLHHAPFWPRRSLVRRWLNLADDIAMYMFDVDVVCWRWMQQERCAGDDT  255

Query  730   RSENITSVHSGRYFASLGSEN---DVITKVVEMDTSVTPK----------------ASRK  852
             RSE+  + +S R  AS+ S +   D   K+VE+DT   PK                A+  
Sbjct  256   RSEHGVAAYSRRLSASIESSSYGYDRSPKIVEVDTG-RPKSRSSSSRRASSPLLLDAAGC  314

Query  853   SRRSKTWVPEFQGNP---FGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPRF  1023
             +   + W      +P   + P  + P    + TS+ F D D   + ++ R +TAQ+TPR+
Sbjct  315   ASGGEDWCANSMSSPLPCYLPGGAPPPRIAVPTSRHFPDYDWCAL-EKARPATAQSTPRY  373

Query  1024  ANVRGSNNPITLSKSMFMEPYFRNYE----GYPKYMASTQSFMSKLRSQSAPKQRPELGP  1191
             A+      P T +KS+                P YM++TQSF +K+RSQSAPKQRPE G 
Sbjct  374   AHA-----PPTPTKSVCGGGGGGGIHSSPLNCPNYMSNTQSFEAKVRSQSAPKQRPETGG  428

Query  1192  GPR---RKRVSLNEMM--ESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRCTD  1341
                   RKRV L+E++  ESRAS SGV MQ+SC+  QE  NFK+AV+GRL R ++
Sbjct  429   AGAGGGRKRVPLSEVVVVESRASLSGVGMQRSCNRVQEAFNFKTAVVGRLDRSSE  483



>ref|XP_006597052.1| PREDICTED: uncharacterized protein LOC100806729 isoform X1 [Glycine 
max]
 ref|XP_006597053.1| PREDICTED: uncharacterized protein LOC100806729 isoform X2 [Glycine 
max]
 ref|XP_006597054.1| PREDICTED: uncharacterized protein LOC100806729 isoform X3 [Glycine 
max]
Length=378

 Score =   172 bits (436),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 173/311 (56%), Gaps = 26/311 (8%)
 Frame = +1

Query  436   IASRERGRGGPLF-CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             + S+   RG  L   RE WAA+ IQ+ FRGYLARKALR LKGLVKIQAL+RGYLVRK+ +
Sbjct  77    VRSKSCDRGNLLIGSREGWAAVLIQSFFRGYLARKALRALKGLVKIQALVRGYLVRKRVA  136

Query  613   ATLHSMQALMRAQATVLAQKSRPSIIN----HPQ----KSIDKNKEARSENITSVHSGRY  768
             ATLHS+QA++RAQA   + ++R S+      HPQ    K + +  EAR+  + +     Y
Sbjct  137   ATLHSVQAMLRAQAVARSVRARRSMDKENRFHPQTPSRKYMQRFDEARNYQLHNRRVPIY  196

Query  769   FASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPE-FQGNPFGPPHSSPLPYKISTS  945
               +  +  D   KVVE+DT +   +SR    + +   E             P+  +IS  
Sbjct  197   CKAPFNGFDESQKVVEVDTHMPHSSSRSINTAMSECGEDLHYQAMSSSLGCPIQGRISLH  256

Query  946   -----QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYP  1110
                  Q+F+ L      +  +FSTA  TPR         P+   KS+  + +FR    +P
Sbjct  257   ERQHPQEFEWLFNVDEGNN-KFSTAHNTPRLPKCMPPGTPV---KSICGKTFFRPCSNFP  312

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH--A  1284
              YMA+T S  +KLRS SAPKQRPEL     +KR+S+NEM+ +R S SGVRMQ S S+   
Sbjct  313   NYMANTHSSKAKLRSHSAPKQRPEL-----KKRLSINEMIAARNSFSGVRMQWSSSNPKT  367

Query  1285  QEVMNFKSAVI  1317
             QE   F   VI
Sbjct  368   QEDCCFFERVI  378



>gb|KHM98712.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=378

 Score =   172 bits (435),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 128/311 (41%), Positives = 173/311 (56%), Gaps = 26/311 (8%)
 Frame = +1

Query  436   IASRERGRGGPLF-CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             + S+   RG  L   RE WAA+ IQ+ FRGYLARKALR LKGLVKIQAL+RGYLVRK+ +
Sbjct  77    VRSKSCDRGTLLIGSREGWAAVLIQSFFRGYLARKALRALKGLVKIQALVRGYLVRKRVA  136

Query  613   ATLHSMQALMRAQATVLAQKSRPSIIN----HPQ----KSIDKNKEARSENITSVHSGRY  768
             ATLHS+QA++RAQA   + ++R S+      HPQ    K + +  EAR+  + +     Y
Sbjct  137   ATLHSVQAMLRAQAVARSVRARRSMDKENRFHPQTPSRKYMQRFDEARNYQLHNRRVPIY  196

Query  769   FASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPE-FQGNPFGPPHSSPLPYKISTS  945
               +  +  D   KVVE+DT +   +SR    + +   E             P+  +IS  
Sbjct  197   CKAPFNGFDESQKVVEVDTHMPHSSSRSINTAMSECGEDLHYQAMSSSLGCPIQGRISLH  256

Query  946   -----QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYP  1110
                  Q+F+ L      +  +FSTA  TPR         P+   KS+  + +FR    +P
Sbjct  257   ERQHPQEFEWLFNVDEGNN-KFSTAHNTPRLPKCMPPGTPV---KSICGKTFFRPCSNFP  312

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH--A  1284
              YMA+T S  +KLRS SAPKQRPEL     +KR+S+NEM+ +R S SGVRMQ S S+   
Sbjct  313   NYMANTHSSKAKLRSHSAPKQRPEL-----KKRLSINEMIAARNSFSGVRMQWSSSNPKT  367

Query  1285  QEVMNFKSAVI  1317
             QE   F   VI
Sbjct  368   QEDCCFFERVI  378



>ref|XP_008656305.1| PREDICTED: uncharacterized protein LOC103635692 isoform X2 [Zea 
mays]
 gb|AFW82008.1| hypothetical protein ZEAMMB73_604777 [Zea mays]
Length=469

 Score =   173 bits (439),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 141/335 (42%), Positives = 193/335 (58%), Gaps = 54/335 (16%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             +GR  PLF     AA++IQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SM
Sbjct  129   KGRA-PLFAVA--AAVRIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSM  185

Query  631   QALMRAQATVLAQKSRPSIINH-------PQKSIDKN--KEARSENITSVHSGRYF-ASL  780
             QAL+RAQATV A+++  + + H       P+ S+ +    +AR E+  + HS R   AS+
Sbjct  186   QALVRAQATVRARRAGAAALPHLHHLPGRPRYSMQERCADDARIEHGVAAHSSRRLSASV  245

Query  781   GSEN---DVITKVVEMD-----------TSVTPKASRKSRRSKTWVPEFQGNPFGPPHSS  918
              S +   D   K+VE+D            S  P     S   + W           P SS
Sbjct  246   ESSSYGYDRSPKIVEVDPGRPKSRSSSRRSSAPLLDAGSCCGEEWCASAN------PASS  299

Query  919   PLPYKIS----------TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKS  1068
             PLP  +S          TS+ F D D   + ++ R +TAQ+TPR   +  ++ P T +KS
Sbjct  300   PLPCYLSAGPPTRIAVPTSRQFPDYDWCAL-EKARPATAQSTPRC--LLQAHAPATPTKS  356

Query  1069  MFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELG--PGPRRKRVSLNEMM---E  1233
             +    +  +  G P YM+STQ+  +K RSQSAPKQRPEL    G  RKRV L+E++    
Sbjct  357   VVAG-HSPSLNGCPNYMSSTQASEAKARSQSAPKQRPELACCCGGARKRVPLSEVVLVDS  415

Query  1234  SRASQSG-VRMQKSCSH-AQEVMNFKSAVIGRLGR  1332
             SRAS SG V MQ+ CS  AQE  +F++AV+GR+ R
Sbjct  416   SRASLSGVVGMQRGCSTGAQEAFSFRTAVVGRIDR  450



>ref|XP_004960892.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Setaria italica]
 ref|XP_004960893.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Setaria italica]
Length=473

 Score =   173 bits (438),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 183/319 (57%), Gaps = 43/319 (13%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             ++IQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATLHSMQAL+RAQATV A ++
Sbjct  145   VRIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLHSMQALVRAQATVRAHRA  204

Query  676   R-PSIINH-------PQKSIDKN--KEARSENITSVHSGRYF-ASLGSEN---DVITKVV  813
               P +  H       P+ S+ +    + RSE+    +  R   AS+ S +   D   K+V
Sbjct  205   GVPVVFPHLHHPPVRPRYSLQERYADDTRSEHGAPAYGSRRMSASVESSSYAYDRSPKIV  264

Query  814   EMD-----------TSVTPKASRKSRRSKTWVPEFQGNPF------GPPHSSPLPYKIST  942
             E+D            + +P     S   + W      +P       GPP   P    + T
Sbjct  265   EVDPGRPKSRSSSRRASSPLVDAGSSGGEEWCANSACSPLPCYLSGGPPQ--PPRIAVPT  322

Query  943   SQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMA  1122
             S+ F D D   + ++ R +TAQ TPR+ +V  ++ P T +KS+    Y  +  G   YM+
Sbjct  323   SRQFPDYDWCAL-EKARPATAQNTPRYLHVH-AHAPATPTKSVAG--YSPSLNGCRNYMS  378

Query  1123  STQSFMSKLRSQSAPKQRPELG-PGPRRKRVSLNEMM---ESRASQSG-VRMQKSC-SHA  1284
             STQ+  +K+RSQSAPKQRPEL   G  RKRV L+E++    SRAS SG V MQ+ C   A
Sbjct  379   STQASEAKVRSQSAPKQRPELACGGGARKRVPLSEVVVVESSRASLSGVVGMQRGCGGRA  438

Query  1285  QEVMNFKSAVIGRLGRCTD  1341
              E  +FKSAV+GR+ R  +
Sbjct  439   HEAFSFKSAVVGRIDRTLE  457



>ref|NP_001242174.1| uncharacterized protein LOC100806729 [Glycine max]
 gb|ACU18000.1| unknown [Glycine max]
Length=378

 Score =   171 bits (432),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 127/311 (41%), Positives = 172/311 (55%), Gaps = 26/311 (8%)
 Frame = +1

Query  436   IASRERGRGGPLF-CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             + S+   RG  L   RE WAA+ IQ+ FRGYLARKALR LKGLVKIQ L+RGYLVRK+ +
Sbjct  77    VRSKSCDRGNLLIGSREGWAAVLIQSFFRGYLARKALRALKGLVKIQTLVRGYLVRKRVA  136

Query  613   ATLHSMQALMRAQATVLAQKSRPSIIN----HPQ----KSIDKNKEARSENITSVHSGRY  768
             ATLHS+QA++RAQA   + ++R S+      HPQ    K + +  EAR+  + +     Y
Sbjct  137   ATLHSVQAMLRAQAVARSVRARRSMDKENRFHPQTPSRKYMQRFDEARNYQLHNRRVPIY  196

Query  769   FASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPE-FQGNPFGPPHSSPLPYKISTS  945
               +  +  D   KVVE+DT +   +SR    + +   E             P+  +IS  
Sbjct  197   CKAPFNGFDESQKVVEVDTHMPHSSSRSINTAMSECGEDLHYQAMSSSLGCPIQGRISLH  256

Query  946   -----QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYP  1110
                  Q+F+ L      +  +FSTA  TPR         P+   KS+  + +FR    +P
Sbjct  257   ERQHPQEFEWLFNVDEGNN-KFSTAHNTPRLPKCMPPGTPV---KSICGKTFFRPCSNFP  312

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH--A  1284
              YMA+T S  +KLRS SAPKQRPEL     +KR+S+NEM+ +R S SGVRMQ S S+   
Sbjct  313   NYMANTHSSKAKLRSHSAPKQRPEL-----KKRLSINEMIAARNSFSGVRMQWSSSNPKT  367

Query  1285  QEVMNFKSAVI  1317
             QE   F   VI
Sbjct  368   QEDCCFFERVI  378



>gb|EEC70092.1| hypothetical protein OsI_00721 [Oryza sativa Indica Group]
Length=465

 Score =   171 bits (432),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 186/330 (56%), Gaps = 44/330 (13%)
 Frame = +1

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             GG L  R R AA+KIQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SMQAL
Sbjct  129   GGVLDPRGRAAAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQAL  188

Query  640   M------------RAQATVLAQKSRPSIINHPQKSIDKN--KEARSENITSVHSGRYFAS  777
             +            R  A           +  P+ S+ +    + RSE+  + +S R  AS
Sbjct  189   VRAQAAVRAARSSRGAALPPLHLHHHPPV-RPRYSLQERYMDDTRSEHGVAAYSRRLSAS  247

Query  778   LGSEN---DVITKVVEMDTSVTPKASRKSRRS----------KTWVPEFQGNPFGPPHSS  918
             + S +   D   K+VEMDT   PK+   S R+          + W      +P  P H  
Sbjct  248   IESSSYGYDRSPKIVEMDTG-RPKSRSSSVRTSPPVVDAGAAEEWYANSVSSPLLPFHQL  306

Query  919   P-LPYKIS--TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYF  1089
             P  P +IS  +++ F + D   + ++ R +TAQ+TPR A++     P+T +KS+     +
Sbjct  307   PGAPPRISAPSARHFPEYDWCPL-EKPRPATAQSTPRLAHM-----PVTPTKSVCGGGGY  360

Query  1090  RNYEGYPKYMASTQSFMSKLRSQSAPKQRPE-----LGPGPRRKRVSLNEM-MESRASQS  1251
                     YM+STQS  +K+RSQSAPKQRPE        G  RKRV L+E+ +E+RAS S
Sbjct  361   GASPNCRGYMSSTQSSEAKVRSQSAPKQRPEPGVAGGTGGGARKRVPLSEVTLEARASLS  420

Query  1252  GVRMQKSCSHAQEVMNFKSAVIGRLGRCTD  1341
             GV MQ+SC+  QE  NFK+AV+ R  R ++
Sbjct  421   GVGMQRSCNRVQEAFNFKTAVLSRFDRSSE  450



>ref|NP_001042265.1| Os01g0190500 [Oryza sativa Japonica Group]
 dbj|BAA99426.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF04179.1| Os01g0190500 [Oryza sativa Japonica Group]
 gb|EAZ10861.1| hypothetical protein OsJ_00700 [Oryza sativa Japonica Group]
Length=465

 Score =   171 bits (432),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 134/330 (41%), Positives = 186/330 (56%), Gaps = 44/330 (13%)
 Frame = +1

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             GG L  R R AA+KIQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SMQAL
Sbjct  129   GGVLDPRGRAAAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQAL  188

Query  640   M------------RAQATVLAQKSRPSIINHPQKSIDKN--KEARSENITSVHSGRYFAS  777
             +            R  A           +  P+ S+ +    + RSE+  + +S R  AS
Sbjct  189   VRAQAAVRAARSSRGAALPPLHLHHHPPV-RPRYSLQERYMDDTRSEHGVAAYSRRLSAS  247

Query  778   LGSEN---DVITKVVEMDTSVTPKASRKSRRS----------KTWVPEFQGNPFGPPHSS  918
             + S +   D   K+VEMDT   PK+   S R+          + W      +P  P H  
Sbjct  248   IESSSYGYDRSPKIVEMDTG-RPKSRSSSVRTSPPVVDAGAAEEWYANSVSSPLLPFHQL  306

Query  919   P-LPYKIS--TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYF  1089
             P  P +IS  +++ F + D   + ++ R +TAQ+TPR A++     P+T +KS+     +
Sbjct  307   PGAPPRISAPSARHFPEYDWCPL-EKPRPATAQSTPRLAHM-----PVTPTKSVCGGGGY  360

Query  1090  RNYEGYPKYMASTQSFMSKLRSQSAPKQRPE-----LGPGPRRKRVSLNEM-MESRASQS  1251
                     YM+STQS  +K+RSQSAPKQRPE        G  RKRV L+E+ +E+RAS S
Sbjct  361   GASPNCRGYMSSTQSSEAKVRSQSAPKQRPEPGVAGGTGGGARKRVPLSEVTLEARASLS  420

Query  1252  GVRMQKSCSHAQEVMNFKSAVIGRLGRCTD  1341
             GV MQ+SC+  QE  NFK+AV+ R  R ++
Sbjct  421   GVGMQRSCNRVQEAFNFKTAVLSRFDRSSE  450



>ref|XP_008649419.1| PREDICTED: protein IQ-DOMAIN 14-like [Zea mays]
 ref|XP_008649420.1| PREDICTED: protein IQ-DOMAIN 14-like [Zea mays]
Length=462

 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 134/316 (42%), Positives = 190/316 (60%), Gaps = 46/316 (15%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA++IQ  FRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SMQAL+RAQA V   
Sbjct  139   AAVRIQTVFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQALVRAQAAV---  195

Query  670   KSRPSIINH----PQKSIDKN--KEARSENITSVHSGRYF-ASLGSEN---DVITKVVEM  819
             + R + ++H    P+ S+ +    + RSE+  + +S R   AS+ S +   D   K+VE+
Sbjct  196   RERRAALHHQPVRPRYSLQERYADDTRSEHGVAAYSSRRLSASVESPSYGYDRSPKIVEV  255

Query  820   DTSVTPKASRKSRRSKTWVPEFQGNPFGP--------PHSSPLP---------YKISTSQ  948
             D    PK+   SRR+   + + + +  G         P SSPLP           + TS+
Sbjct  256   DPG-RPKSRSSSRRASAPLLDARSSGSGGGEEWCANNPASSPLPCYLPSGPRRIAVPTSR  314

Query  949   DFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAST  1128
              F D D   + ++ R +TAQ+TPR+     ++ P T +KS+    Y  +    P YM+ST
Sbjct  315   QFPDYDWC-VLEKARPATAQSTPRYLQ---AHAPATPTKSVAG--YSPSLNACPNYMSST  368

Query  1129  QSFMSKLRSQSAPKQRPEL---GPGPRRKRVSLNEMM---ESRASQSGVR-MQKSCS-HA  1284
             Q+  +K+RSQSAPKQRPEL   G GP RKRV L+E++    SRAS S V  MQ+ C   A
Sbjct  369   QASEAKVRSQSAPKQRPELACCGGGP-RKRVPLSEVVVVESSRASLSAVMGMQRGCGPRA  427

Query  1285  QEVMNFKSAVIGRLGR  1332
             QE  +F++AV+GR+ R
Sbjct  428   QEAFSFRTAVVGRMDR  443



>ref|XP_004486789.1| PREDICTED: protein IQ-DOMAIN 14-like [Cicer arietinum]
Length=359

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 116/291 (40%), Positives = 163/291 (56%), Gaps = 28/291 (10%)
 Frame = +1

Query  436   IASRERGRGGPLFCR--ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQA  609
             + S   GRG  L CR  E WAA+KIQ+ FRGYLARKA R LKGLVKIQAL+RG+LVRK+ 
Sbjct  78    VRSLSHGRG-TLLCRSMEWWAAVKIQSFFRGYLARKAHRALKGLVKIQALVRGFLVRKRV  136

Query  610   SATLHSMQALMRAQATVLAQKSRPSIINHP---QKSIDKNKEARSENITSVHSGRYFASL  780
             +ATLHSMQALMRAQA +  Q++R SI N     Q  I + K A+  + T     + + + 
Sbjct  137   AATLHSMQALMRAQAVIRLQRARNSIDNKENISQYEIRQRKHAQMFDETRNEQHKKWLNN  196

Query  781   GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGN---PFGPPHSSPLPYKISTSQD  951
              S   V  + + +   + P  S    R         G+    F   ++S LPY+I +   
Sbjct  197   SSSRFVQNQKIVL---IDPHRSHSRFRCDGATMSDCGDNLHHFYEANASSLPYQIPSRIS  253

Query  952   FQDLDTSQISD--------EYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY  1107
               +   SQ S+        + +  TA +TPR +N   +N P+   K++  +  F  Y  +
Sbjct  254   VHECQHSQDSEWCFHNNVNDRKLYTAHSTPRLSNSSQANTPV---KNVSGDALFSPYSNF  310

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVR  1260
             P YMA+T +  +++RS SAPKQRPE+     +KRV L+E+M +R S S VR
Sbjct  311   PNYMANTHASKARVRSLSAPKQRPEI-----KKRVPLDEIMAARNSISCVR  356



>emb|CDY43103.1| BnaC05g36740D [Brassica napus]
Length=368

 Score =   166 bits (419),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 111/284 (39%), Positives = 167/284 (59%), Gaps = 53/284 (19%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             ERWAA+KIQ+ F+GYLARKALR LKGLVK+QAL+RGYLVRK+A+ TLHSMQAL+RAQ   
Sbjct  112   ERWAAVKIQSVFKGYLARKALRALKGLVKLQALVRGYLVRKRAAETLHSMQALIRAQTNA  171

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSE------NDVITKVVEMD  822
              +Q+   + + HP+ S+++  ++RSE    +HS R   S+         ++   K+VE+D
Sbjct  172   RSQRINRNHMFHPRHSLERFDDSRSE----IHSKRMSISVEKHINNNIYDETSPKIVEID  227

Query  823   TSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFST  1002
             T  T   SR+                       +   +S   D +D + S   ++ +F T
Sbjct  228   TYKTKSRSRR-----------------------MNVAVSECGD-EDFEWSFRGEKCKFPT  263

Query  1003  AQTTPRFANVRGSNN-----PITLSKSMFMEPYFR-NYEGY--PKYMASTQSFMSKLRSQ  1158
             AQ TPRF++    NN     P + +KS+  +  ++ +Y G   P YMA+T SF +K RS 
Sbjct  264   AQNTPRFSSSAAMNNNYYYTPPSPAKSVCRDACYKPSYPGLMTPSYMANTLSFRAKARSH  323

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
             SAP+QRP+      RKR+SL+E+M +R+S+     + SC++ ++
Sbjct  324   SAPRQRPD------RKRLSLDEIMAARSSK-----RSSCNYDRQ  356



>ref|XP_010535189.1| PREDICTED: protein IQ-DOMAIN 14 [Tarenaya hassleriana]
Length=391

 Score =   165 bits (418),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 118/282 (42%), Positives = 167/282 (59%), Gaps = 52/282 (18%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RER AA +IQ  FRGYLARKALR LKGLVK+QAL+RGYLVRK+A+ATL SMQAL+RAQ +
Sbjct  109   RERRAAARIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKRAAATLQSMQALIRAQTS  168

Query  658   VLAQKSRPSI-------INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT----  804
             V +Q+   S+       +  P++S+++  ++RSE    +HS R   S+   N+       
Sbjct  169   VRSQRLNRSLNIRDCNNVFQPRQSMERFDDSRSE----IHSKRMSISVEQNNNAYDENSP  224

Query  805   KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISD  984
             K+VE+DT  T   S++            GN         +P  +S   D +D + S  S+
Sbjct  225   KIVEIDTYKTRSRSKR------------GN---------IPPMMSEFGDDKDFEWSFPSE  263

Query  985   EYRFSTAQTTPRFA---------NVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSF  1137
             + +FSTAQ+TPRF+         N      P + +KS+  +  + +    P YMA+T+SF
Sbjct  264   KCKFSTAQSTPRFSYPGNNNSNNNNHRFYGPPSPAKSLCGDSSYGSCL-TPSYMANTKSF  322

Query  1138  MSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
              +KLRS SAP+QRPE      RKR+SL+E+M +R+S S VRM
Sbjct  323   KAKLRSHSAPRQRPE------RKRLSLDEVMAARSSVSSVRM  358



>gb|EYU30698.1| hypothetical protein MIMGU_mgv1a007190mg [Erythranthe guttata]
Length=416

 Score =   166 bits (419),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 178/442 (40%), Positives = 224/442 (51%), Gaps = 82/442 (19%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggr---------sgsggataatgLCHnpttippnitpAEAAW  300
             MG+  +WLKGLF        R         S          LC NP TIPPNITPAEAAW
Sbjct  1     MGRATRWLKGLFGVETKENDRMEYSVVHRWSSGNSVRGPIVLCRNPATIPPNITPAEAAW  60

Query  301   LSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFCR  480
             L SFY      E S HA    AA  AAA  A  AA  AA     R+ S  RGR       
Sbjct  61    LRSFYS-EPDTEQSKHARAVAAATAAAADAAVAAAQAAAEVV--RLTSHGRGR-------  110

Query  481   ERWAAIK-IQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             E+WAA   IQ  FRG+LARKA R LKGLVKIQA++RG+LVRK+A+ATL  M+AL+RAQA+
Sbjct  111   EKWAAAALIQRVFRGHLARKARRALKGLVKIQAVVRGFLVRKRAAATLLRMEALVRAQAS  170

Query  658   VLAQKSRPSI----------------INHPQKSIDKNKEAR------SENITSVHSGRYF  771
             V A K+R  I                IN  ++S     +AR       EN  SV S R  
Sbjct  171   VRALKTRRKINDGGGIFPPPFQARRKINSGEQSFPPQLQARKSLEKFDEN-ESVDSRRLS  229

Query  772   ASLGSENDVITKVVEMDTSVTPKASRKSRRS----KTWVPEFQGNPFGPPHSSPLPYKIS  939
             +S  S      K+VE+DT   PK SR SRR+     TW+ +           SP P +I 
Sbjct  230   SSYDS-----PKIVEVDTGCWPK-SRSSRRAANSNNTWMSDSGDESPAKVTCSPFPVRIP  283

Query  940   ---TSQDFQDLDTSQISDEYRF---------STAQTTPRFANVRGSNNPITLSKSMFMEP  1083
                TSQ+  +L+   I               +TAQ+TPRFA         T ++S     
Sbjct  284   TPRTSQNTAELEWGIIGGGGGDDYKYKYNAAATAQSTPRFATYSAVAGAATPARSA----  339

Query  1084  YFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
                   G   YM  TQSF +K RSQSAPKQR    PGP R R+SL+E+M +R  + G + 
Sbjct  340   ------GESHYMVKTQSFKAKQRSQSAPKQR-TGEPGPNR-RISLHELMGTRNQKPGPQA  391

Query  1264  QKSCSHAQEVMNFKSAVIGRLG  1329
             ++     +E +NFK+AV+G++G
Sbjct  392   EE-----EEAINFKNAVVGKIG  408



>ref|XP_009399809.1| PREDICTED: protein IQ-DOMAIN 31-like [Musa acuminata subsp. malaccensis]
Length=429

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 159/372 (43%), Positives = 202/372 (54%), Gaps = 37/372 (10%)
 Frame = +1

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
             AAWL S+     GEE S HA    AA  AAA  A  AA  A A    R+ SR  G     
Sbjct  58    AAWLRSYE--QSGEEQSKHAIAVAAATAAAADAAVAAARAAVAMV--RLTSR--GSATTS  111

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
             F   R AA+KIQ  FRGYLARKALR LKGLVK+QAL+RGYLVRKQA+A+LHS+QAL R+Q
Sbjct  112   FGSARLAAVKIQTVFRGYLARKALRALKGLVKLQALVRGYLVRKQAAASLHSVQALARSQ  171

Query  652   ATVLAQKSR---PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT-----K  807
             ATV AQ+SR   P     P     + + +   N T     R   SL    D  T     K
Sbjct  172   ATVRAQRSRDLLPDDRCFPPAEFRRRRSSERINDTRGEQLRLSTSL----DTATLSRSPK  227

Query  808   VVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSP----LPYKIS--TSQDFQDLDT  969
             +VE+DT   PK     R + +   +   +      SSP    +P +IS  + ++FQ+ + 
Sbjct  228   IVEIDT-CHPKLRSFCRAATSCATDPTDDLPLHASSSPIACQIPARISVPSRRNFQENND  286

Query  970   SQISDEY-RFS-TAQTTPRFANVRGSNNPITLSKSM-FMEPYFRNYEGY---PKYMASTQ  1131
               ++ E  R S TA +TPR+    G +   T +KS+   E   R Y      PKYMASTQ
Sbjct  287   WCVNGEQCRLSATAHSTPRYMTAPGFDEAATPAKSVRGGEGGLRQYANVSDSPKYMASTQ  346

Query  1132  SFMSKLRSQSAPKQRPELGPGPR-RKRVSLNEM-MESRASQSGVRMQKSCSHAQEVMNFK  1305
             S  +KLR  SA K  P+    PR RKR  L E+ +E +A+  GV MQKSC  AQE  +FK
Sbjct  347   SSKAKLRHLSALKHLPD----PRTRKRQPLGEVNVEVKANLGGVGMQKSCPQAQEAFSFK  402

Query  1306  SAVIGRLGRCTD  1341
              AV+ RL R ++
Sbjct  403   RAVVERLDRSSE  414



>ref|XP_006645590.1| PREDICTED: protein IQ-DOMAIN 14-like [Oryza brachyantha]
Length=394

 Score =   163 bits (413),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 135/323 (42%), Positives = 185/323 (57%), Gaps = 46/323 (14%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA+KIQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SMQAL+RAQA + A 
Sbjct  64    AAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQALVRAQAAIRAA  123

Query  670   KSRPSIIN-----------HPQKSIDKN--KEARSENITSVHSGRYFASLGSE---NDVI  801
             +S  +               P+ S+ +    + RSE+  + +S R  AS+ S     D  
Sbjct  124   RSSRAAALPPLHLHHHPPVRPRYSLQERYMDDTRSEHGVAAYSRRLSASIESSLYGYDRS  183

Query  802   TKVVEMDTSVTPKASRKSRRS-----------KTWVPEFQGNPFGPPHSSP-LPYKIS--  939
              K+VEMDT   PK+   S R+           + W      +P  P +  P  P +IS  
Sbjct  184   PKIVEMDTG-RPKSRSSSVRTSPPVVDAGGAGEEWYANSVSSPLPPFNQLPGAPPRISAP  242

Query  940   TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRN--YEGYPK  1113
             +++ F + D   +  + R +TAQ+TPR A++     P+T +KS+          Y   P 
Sbjct  243   SARHFPEYDWCTLEIKARPATAQSTPRLAHM-----PVTPTKSVCGGGGGGGCAYGASPN  297

Query  1114  ---YMASTQSFMSKLRSQSAPKQRPELG---PGPRRKRVSLNE-MMESRASQSGVRMQKS  1272
                YM+STQS  +K+RSQSAPKQRPE G    GP RKRV L E  + +RAS SGV MQ+S
Sbjct  298   CRGYMSSTQSSEAKVRSQSAPKQRPEPGVPAAGP-RKRVPLGEGNLGARASLSGVGMQRS  356

Query  1273  CSHAQEVMNFKSAVIGRLGRCTD  1341
             C+  QE  +FKSAV+ R  R ++
Sbjct  357   CNRVQEAFSFKSAVLSRFDRSSE  379



>ref|XP_008656304.1| PREDICTED: uncharacterized protein LOC103635692 isoform X1 [Zea 
mays]
Length=483

 Score =   164 bits (415),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 141/349 (40%), Positives = 193/349 (55%), Gaps = 68/349 (19%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYL--------------ARKALRCLKGLVKIQALLRG  588
             +GR  PLF     AA++IQ AFRG+L              A+KALR LK LVK+QAL+RG
Sbjct  129   KGRA-PLFAVA--AAVRIQTAFRGFLCSVAALPRCVPSTQAKKALRALKALVKLQALVRG  185

Query  589   YLVRKQASATLHSMQALMRAQATVLAQKSRPSIINH-------PQKSIDKN--KEARSEN  741
             YLVR+QA+ATL SMQAL+RAQATV A+++  + + H       P+ S+ +    +AR E+
Sbjct  186   YLVRRQAAATLQSMQALVRAQATVRARRAGAAALPHLHHLPGRPRYSMQERCADDARIEH  245

Query  742   ITSVHSGRYF-ASLGSEN---DVITKVVEMD-----------TSVTPKASRKSRRSKTWV  876
               + HS R   AS+ S +   D   K+VE+D            S  P     S   + W 
Sbjct  246   GVAAHSSRRLSASVESSSYGYDRSPKIVEVDPGRPKSRSSSRRSSAPLLDAGSCCGEEWC  305

Query  877   PEFQGNPFGPPHSSPLPYKIS----------TSQDFQDLDTSQISDEYRFSTAQTTPRFA  1026
                       P SSPLP  +S          TS+ F D D   + ++ R +TAQ+TPR  
Sbjct  306   ASAN------PASSPLPCYLSAGPPTRIAVPTSRQFPDYDWCAL-EKARPATAQSTPRC-  357

Query  1027  NVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELG--PGPR  1200
              +  ++ P T +KS+    +  +  G P YM+STQ+  +K RSQSAPKQRPEL    G  
Sbjct  358   -LLQAHAPATPTKSVVAG-HSPSLNGCPNYMSSTQASEAKARSQSAPKQRPELACCCGGA  415

Query  1201  RKRVSLNEMM---ESRASQSG-VRMQKSCSH-AQEVMNFKSAVIGRLGR  1332
             RKRV L+E++    SRAS SG V MQ+ CS  AQE  +F++AV+GR+ R
Sbjct  416   RKRVPLSEVVLVDSSRASLSGVVGMQRGCSTGAQEAFSFRTAVVGRIDR  464



>ref|XP_002869449.1| hypothetical protein ARALYDRAFT_491843 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45708.1| hypothetical protein ARALYDRAFT_491843 [Arabidopsis lyrata subsp. 
lyrata]
Length=385

 Score =   161 bits (407),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 167/415 (40%), Positives = 215/415 (52%), Gaps = 55/415 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFt---trqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYG  318
             MG+  +W KGLF    +  S G  SG+        LC +  TIPPNI+  EAAWL SFY 
Sbjct  1     MGRATRWFKGLFGIKPSSCSGGTDSGAISNRLDRSLCDSYETIPPNISEKEAAWLRSFYA  60

Query  319   PSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLF---CRERW  489
              +G EE          AA  AAA  A  AA  AAAAVVR+  +  G+ GPL    CRE  
Sbjct  61    -AGEEEKERRTHAIAVAAATAAAADAAVAAAKAAAAVVRLQGQ--GKSGPLGGGKCRENR  117

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA++IQ AFRGYLARKALR L+G+VKIQAL+RG+LVRKQA+ATL SM+AL+RAQ TV  Q
Sbjct  118   AAMQIQCAFRGYLARKALRALRGVVKIQALVRGFLVRKQAAATLRSMEALVRAQTTVKFQ  177

Query  670   KSRPSIINH--PQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTP  837
             ++   I N    +KS +                R+  SL + N  +   K+VE+DT   P
Sbjct  178   RALRRIGNAAPARKSTE----------------RFSGSLENRNNGEETAKIVEVDTGTRP  221

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTP  1017
               + K R       +F  NPF    SSPL  ++         +  + S   +F TAQ+TP
Sbjct  222   -GTYKIRAPVLTGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWEECSS--KFPTAQSTP  278

Query  1018  RFA------NVRGSNNPITLSKSMFMEPY---FRNYEGYPKYMASTQSFMSKLRSQSAPK  1170
             RF+      +V  S   +        + +   F + E    YMA T SF +KLRS SAP+
Sbjct  279   RFSGGSPARSVCCSGGGVEAEVDTEADAHRFCFLSGEFNSGYMADTTSFRAKLRSHSAPR  338

Query  1171  QRPELGPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSAVIGRLGR  1332
             QRPE         VS      S     GVRMQ+ SCS  +E      AV+G + R
Sbjct  339   QRPE-------SNVSGGGWRRSIGGGGGVRMQRPSCSGVRE------AVVGNIER  380



>ref|XP_007150597.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
 ref|XP_007150598.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
 gb|ESW22591.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
 gb|ESW22592.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
Length=366

 Score =   160 bits (406),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 119/295 (40%), Positives = 163/295 (55%), Gaps = 34/295 (12%)
 Frame = +1

Query  442   SRERGRGGPLF-CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASAT  618
             SR  GR   L   +E WAA+ IQ+ FRGYLARKALR LKGLVKIQAL+RGYLVRK+ +AT
Sbjct  73    SRRCGRDTLLIGSKECWAAVSIQSFFRGYLARKALRALKGLVKIQALVRGYLVRKRVAAT  132

Query  619   LHSMQALMRAQATVLAQKSRPSIIN----HPQKSIDKNKEARSENITSVHSGRYFASLGS  786
             LHS+QA++R+QA   + ++R S+      HP+    K  +   +   +   G   A++ S
Sbjct  133   LHSVQAMIRSQAVARSVRARRSMDKENRFHPESPSRKYVQQLFDETRNYQCGNRRATIYS  192

Query  787   EN-----DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQD  951
             +      D  +KVVE+DT +     R    + +   E+Q      P   P+  +IS  Q 
Sbjct  193   KEPWNGFDESSKVVEVDTRMAHSRCRSINTAMSECGEYQAMSSSLP--CPVQGRISLHQK  250

Query  952   --------FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY  1107
                     F +LD     ++ +F+TA  TPR         P+   KS+  +  FR    +
Sbjct  251   QHPQEFEWFFNLD-----EDNKFTTAHNTPRLPKCMIPATPL---KSVCGDT-FRPCSNF  301

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKS  1272
             P YMA+T S  +KLRS SAPKQRPEL     RKR+S+NE+M +R S SGV  Q S
Sbjct  302   PNYMANTHSSKAKLRSHSAPKQRPEL-----RKRLSINEIMAARNSVSGVGKQWS  351



>ref|XP_002457200.1| hypothetical protein SORBIDRAFT_03g003180 [Sorghum bicolor]
 gb|EES02320.1| hypothetical protein SORBIDRAFT_03g003180 [Sorghum bicolor]
Length=480

 Score =   162 bits (409),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 134/331 (40%), Positives = 179/331 (54%), Gaps = 55/331 (17%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RGR G        AA+KIQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SM
Sbjct  142   RGRAG--------AAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSM  193

Query  631   QALMRAQATVLAQ---KSRPSI--INHPQK-----SIDKN--KEARSENITSVHSGRYFA  774
             QAL+RAQATV A    ++ PS+  ++HP       S+ +    + RSE+  + +S R  A
Sbjct  194   QALVRAQATVRAARGCRALPSLPPLHHPAAFRPRFSLQERYADDTRSEHGVAAYSRRLSA  253

Query  775   SL------GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPP-HSSPLPYK  933
             S+      G   D   K+VEMDT+     +   R    W  +   +P  PP H  P    
Sbjct  254   SIESASYGGGGYDRSPKIVEMDTARPRSRASSLRTEDEWYAQSVSSPLQPPCHHLPPRIA  313

Query  934   ISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSM-----FMEPYFRNY  1098
             + TS+ F D D     ++ R +TAQ TPRFA       P T +KS+         Y+ ++
Sbjct  314   VPTSRHFPDYDWC-APEKPRPATAQCTPRFA-------PPTPAKSVCGGGGGNGGYYAHH  365

Query  1099  -----EGYPKYMASTQ--SFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSG  1254
                     P YM+STQ     S  RS SAPKQRP     P RKRV L+E ++E+RAS  G
Sbjct  366   LAAGSPNCPGYMSSTQSSEAKSSSRSHSAPKQRPPEQQQPSRKRVPLSEVVLEARASLGG  425

Query  1255  V---RMQKSC----SHAQEVMNFKSAVIGRL  1326
             V    M K C    +  QE  +F++AV+ R 
Sbjct  426   VGVGMMHKPCNTRAAQPQEPFDFRAAVVSRF  456



>ref|XP_007150595.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
 ref|XP_007150596.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
 gb|ESW22589.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
 gb|ESW22590.1| hypothetical protein PHAVU_005G165500g [Phaseolus vulgaris]
Length=365

 Score =   159 bits (402),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 119/294 (40%), Positives = 162/294 (55%), Gaps = 33/294 (11%)
 Frame = +1

Query  442   SRERGRGGPLF-CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASAT  618
             SR  GR   L   +E WAA+ IQ+ FRGYLARKALR LKGLVKIQAL+RGYLVRK+ +AT
Sbjct  73    SRRCGRDTLLIGSKECWAAVSIQSFFRGYLARKALRALKGLVKIQALVRGYLVRKRVAAT  132

Query  619   LHSMQALMRAQATVLAQKSRPSIIN----HPQ----KSIDKNKEARSENITSVHSGRYFA  774
             LHS+QA++R+QA   + ++R S+      HP+    K +    E R+    +  +  Y  
Sbjct  133   LHSVQAMIRSQAVARSVRARRSMDKENRFHPESPSRKYVQLFDETRNYQCGNRRATIYSK  192

Query  775   SLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQD-  951
                +  D  +KVVE+DT +     R    + +   E+Q      P   P+  +IS  Q  
Sbjct  193   EPWNGFDESSKVVEVDTRMAHSRCRSINTAMSECGEYQAMSSSLP--CPVQGRISLHQKQ  250

Query  952   -------FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYP  1110
                    F +LD     ++ +F+TA  TPR         P+   KS+  +  FR    +P
Sbjct  251   HPQEFEWFFNLD-----EDNKFTTAHNTPRLPKCMIPATPL---KSVCGDT-FRPCSNFP  301

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKS  1272
              YMA+T S  +KLRS SAPKQRPEL     RKR+S+NE+M +R S SGV  Q S
Sbjct  302   NYMANTHSSKAKLRSHSAPKQRPEL-----RKRLSINEIMAARNSVSGVGKQWS  350



>ref|XP_006285646.1| hypothetical protein CARUB_v10007101mg [Capsella rubella]
 gb|EOA18544.1| hypothetical protein CARUB_v10007101mg [Capsella rubella]
Length=384

 Score =   156 bits (395),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 165/419 (39%), Positives = 211/419 (50%), Gaps = 64/419 (15%)
 Frame = +1

Query  148   MGKVIKWLKGLFtt--rqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYGP  321
             MG+  +W KGLF       +G  +G+        LC +  TIPPNI+  EAAWL SFY  
Sbjct  1     MGRATRWFKGLFGIKPSSCSGSDTGAISNRLDRSLCDSYETIPPNISEKEAAWLRSFYA-  59

Query  322   SGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLF---CRERWA  492
             +G EE          AA  A A  A  A+  AAAAVVR+  +  G+ GPL     RE  A
Sbjct  60    AGEEEKERRTHAIAVAAATAYAADAALASAKAAAAVVRLQGQ--GKSGPLGGGNTRENRA  117

Query  493   AIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK  672
             A++IQ +FRGYLARKALR LKG+VKIQAL+RGYLVRKQA+ATL SM+AL+RAQATV  Q+
Sbjct  118   AMQIQCSFRGYLARKALRALKGVVKIQALVRGYLVRKQAAATLRSMEALIRAQATVKFQR  177

Query  673   SRPSIINH--PQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTPK  840
             +   I N    +KS +                R+  SL + N  +   K+VE+DT   P 
Sbjct  178   ALRRIGNAAPARKSTE----------------RFSGSLENRNNGEETAKIVEVDTGTRPG  221

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
               R  R       +F  NPF    SSPL  +I         +  + S   +F TAQ+TPR
Sbjct  222   TYR-IRGPVLSGSDFLDNPFRRTLSSPLSGRIPPRLSMPKPEWDECSS--KFPTAQSTPR  278

Query  1021  FANVR----------GSNNPITLSKSMFMEPY-FRNYEGYPKYMASTQSFMSKLRSQSAP  1167
             FA             G+   +          + F + E    Y A T SF +KLRS SAP
Sbjct  279   FAGGSPARSVCCSGVGAEAEVDAEADAIAHRFCFLSGEFNSGYTADTMSFRAKLRSHSAP  338

Query  1168  KQRPE---LGPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSAVIGRLGR  1332
             +QRPE    G G R            R+   GVRMQ+ SCS  +E      AV+G + R
Sbjct  339   RQRPESNATGGGLR------------RSIGGGVRMQRPSCSGVRE------AVVGNIER  379



>ref|XP_009409690.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
Length=411

 Score =   156 bits (395),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 123/312 (39%), Positives = 169/312 (54%), Gaps = 43/312 (14%)
 Frame = +1

Query  454   GRGGPL-FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GRG    F +E  AA+KIQ AFRG+LAR ALR LK LVK+QAL+RGYLVRKQA+ATLHSM
Sbjct  110   GRGATFSFPKEELAAVKIQTAFRGHLARIALRALKALVKLQALVRGYLVRKQAAATLHSM  169

Query  631   QALMRAQATVLAQKS----------RPSIINHPQKSIDKNKEARSENITSVHSGRYFASL  780
             QAL+RAQAT  AQ+           RP + +  ++S+++  +AR E+  +     +  SL
Sbjct  170   QALVRAQATARAQRYGNLLPDDRSFRPEVRH--RRSLERFIDARIEHTPAFQRRSFSTSL  227

Query  781   GSEN-DVITKVVEMDTSVTPKASRKSRRSKTWVPEF--QGNPFGPPHSSPLPYKISTS--  945
             G    D   K VE+D         +SR S   +P      + F  P   P+P ++ST   
Sbjct  228   GGATPDRSPKTVEIDV-----CGPRSRSSCRAIPSAVDPADHFSSPIPCPVPARVSTPSR  282

Query  946   QDFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSMF-MEPYFRNY---EGYP  1110
             ++ Q+ D     ++ R S TAQ TPR+ N  G    +T +KS++  E  +R Y      P
Sbjct  283   RNSQENDWCNSGEKCRISATAQGTPRYTNSPGKVG-VTQAKSVYDAEGVYRRYVSESSSP  341

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE  1290
              YMA+TQS  +K R+QSAPK  PE+     RKR  L +            +  SC  AQ 
Sbjct  342   NYMANTQSSKAKRRAQSAPKHLPEV--AGMRKRQPLGD------------LSNSCFQAQV  387

Query  1291  VMNFKSAVIGRL  1326
             V+N   A  G++
Sbjct  388   VLNLNKAEQGKV  399



>ref|XP_003543618.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Glycine max]
 ref|XP_006595119.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Glycine max]
 ref|XP_006595120.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X3 [Glycine max]
 ref|XP_006595121.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X4 [Glycine max]
 gb|KHN32656.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=380

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 122/293 (42%), Positives = 162/293 (55%), Gaps = 25/293 (9%)
 Frame = +1

Query  487   WAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLA  666
             WAA+ IQ+ FRGYLARKALR LKGLVKIQAL+RGYLVRK+ +ATLHS+QA++RAQA   +
Sbjct  97    WAAVLIQSFFRGYLARKALRALKGLVKIQALVRGYLVRKRVAATLHSVQAMIRAQAVARS  156

Query  667   QKSRPSIIN----HPQ----KSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMD  822
              ++R S+      HPQ    K + +  EAR+  + +        +  +  D   KVVE+D
Sbjct  157   ARARRSMDKENRFHPQTPSRKHVQRFDEARNYQLPNRRVPICCKAPFNRFDGSQKVVEVD  216

Query  823   TSVTPKASRKSRRSKTWVPE-FQGNPFGPPHSSPLPYKISTS-----QDFQDLDTSQISD  984
             T +    SR    + +   E             P+  +IS       Q+F+ L      +
Sbjct  217   THMPHSRSRSINTAMSECGEDLNYEAMSSSLGCPVQGRISLHERQHPQEFEWLFNVDEGN  276

Query  985   EYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSA  1164
               +FST   TPR         P+   KS+  E +FRN   +P YMA+T S  +KLRS SA
Sbjct  277   N-KFSTTHNTPRLQKCMLPGTPV---KSVCGETFFRNCSNFPNYMANTHSSKAKLRSHSA  332

Query  1165  PKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH--AQEVMNFKSAVI  1317
             PKQRPEL     +KR+S+NEMM +R S SGV MQ S S+   QE   F   VI
Sbjct  333   PKQRPEL-----KKRLSINEMMAARNSVSGVGMQWSSSNPKTQEDYFFFERVI  380



>dbj|BAK07171.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=465

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 130/320 (41%), Positives = 187/320 (58%), Gaps = 47/320 (15%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA+KIQ AFRG+LA+KALR LKGLVK+QAL+RGYLVRKQA+ATL SMQAL+RAQA + A 
Sbjct  139   AAVKIQTAFRGFLAKKALRALKGLVKLQALVRGYLVRKQAAATLQSMQALVRAQACIRAA  198

Query  670   -----------KSRPSIINHPQKSIDKN---KEARSEN-ITSVHSGRYFASLGSEN----  792
                        +  P+ I  P+ S+ +    +++RS++ +   +S R  AS+ S +    
Sbjct  199   RSRAAALPTNLRVHPTPI-RPRYSLQERYSAEDSRSDHGVVPYYSRRLSASVESSSCYGY  257

Query  793   ----DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL-----PYKISTS  945
                 D   K+VEMDT   PK+   S R+ +  P      +    SSPL     P +I+ +
Sbjct  258   GYGYDRSPKIVEMDTG-RPKSRSSSLRTTS--PGASEECYANSVSSPLMPCRAPPRIA-A  313

Query  946   QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY---PKY  1116
                + L   +  ++ R +TAQ+TPR+A    S  P+T +KS+     + N       P Y
Sbjct  314   PTARHLPEYEWCEKARPATAQSTPRYA----SYAPVTPTKSVCGGYTYSNSPSTLNCPSY  369

Query  1117  MASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMM---ESRASQSGVRMQKSCSHA-  1284
             M+ST+S ++K+RSQSAPKQRPE   G  RKRV L+E++   E+RAS  G   Q+SC+   
Sbjct  370   MSSTRSSVAKVRSQSAPKQRPE--EGAVRKRVPLSEVIVLQEARASLGGGGTQRSCNRPA  427

Query  1285  -QEVMNFKSAVIGRLGRCTD  1341
              +E  +FK AV+ R  R ++
Sbjct  428   QEEAFSFKKAVVSRFDRSSE  447



>ref|NP_194644.2| protein IQ-domain 25 [Arabidopsis thaliana]
 gb|AEE85592.1| protein IQ-domain 25 [Arabidopsis thaliana]
Length=399

 Score =   155 bits (393),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 163/421 (39%), Positives = 215/421 (51%), Gaps = 51/421 (12%)
 Frame = +1

Query  121   IKSLKNESKMGKVIKWLKGLFtt--rqsnggrsgsggataatgLCHnpttippnitpAEA  294
             +  +K E+KMG+  +W KGLF       +G  SG+        LC +  TIPPNI+  EA
Sbjct  8     LTRVKRETKMGRATRWFKGLFGIKPSSCSGTDSGTISNRLDRSLCDSYETIPPNISEKEA  67

Query  295   AWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLF  474
             AWL SFY  +G EE          AA  AAA  A  AA  AAAAVVR+  +  G+ GPL 
Sbjct  68    AWLRSFYA-AGEEEKERRTHAIAVAAATAAAADAAVAAAKAAAAVVRLQGQ--GKSGPLG  124

Query  475   ---CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMR  645
                 RE  AA++IQ AFRGYLARKALR L+G+VKIQAL+RG+LVR QA+ATL SM+AL+R
Sbjct  125   GGKSREHRAAMQIQCAFRGYLARKALRALRGVVKIQALVRGFLVRNQAAATLRSMEALVR  184

Query  646   AQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEM  819
             AQ TV             Q+++ +N  A     ++    R+  SL + N  +   K+VE+
Sbjct  185   AQKTV-----------KIQRALRRNGNAAPARKSTE---RFSGSLENRNNGEETAKIVEV  230

Query  820   DTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFS  999
             DT   P   R  R       +F  NPF    SSPL  ++         +  + S   +F 
Sbjct  231   DTGTRPGTYR-IRAPVLSGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWEECSS--KFP  287

Query  1000  TAQTTPRFANVRGSNNPITLSKSMFMEP---------YFRNYEGYPKYMASTQSFMSKLR  1152
             TAQ+TPRF+    + +       +  E           F + E    YMA T SF +KLR
Sbjct  288   TAQSTPRFSGGSPARSVCCSGGGVEAEVDTEADANRFCFLSGEFNSGYMADTTSFRAKLR  347

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSAVIGRLG  1329
             S SAP+QRPE        R S+           GVRMQ+ SCS  +E      AV+G + 
Sbjct  348   SHSAPRQRPESNASAGGWRRSIG--------GGGVRMQRQSCSGVRE------AVVGNIE  393

Query  1330  R  1332
             R
Sbjct  394   R  394



>ref|XP_003597665.1| IQ domain-containing protein [Medicago truncatula]
 gb|AES67916.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=355

 Score =   154 bits (388),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 115/289 (40%), Positives = 161/289 (56%), Gaps = 38/289 (13%)
 Frame = +1

Query  454   GRGGPLF-CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GR   LF  +E  AA+KIQ  FRGYLARKA R LKGLV+IQAL+RG+LVRK+ +ATLHSM
Sbjct  86    GRKSLLFGSKEMLAAVKIQTFFRGYLARKARRALKGLVRIQALVRGFLVRKRVAATLHSM  145

Query  631   QALMRAQATVLAQKSRPSI----INHPQKSIDKNKEARSENITSVHSGRYFASLGSENDV  798
             QALMRAQA V ++++R SI    +  P+    K+ +   E     H+ ++  +  S    
Sbjct  146   QALMRAQAVVQSRRARNSIDKENMCQPEIRGRKHVQMFDETRNRQHN-KWLPNSSSRFAQ  204

Query  799   ITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI---------STSQD  951
               KVV +D    P  S     S++ + E+  + +    ++ LP +I           SQD
Sbjct  205   NPKVVLID----PHKS----GSRSAMSEYGDDLYDSYEATSLPCQIPRRISVHDCQYSQD  256

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSN---NPITLSKSMFMEPYFRNYEGYPKYMA  1122
             F D   + ++DE R  TA +TPR  N   +N     ++   S+FM      Y  +P YMA
Sbjct  257   F-DWCNNNVNDERRLYTAHSTPRLVNSSQANPLAKSVSEDTSLFMP-----YSNFPNYMA  310

Query  1123  STQSFMSK-LRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQ  1266
             +T S   + +RS SAPKQRP+L     +KR  L+E+M +R S S VRM 
Sbjct  311   NTHSSKGRVVRSHSAPKQRPDL-----KKRAPLDEIMATRNSISCVRMH  354



>emb|CDM81723.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   156 bits (394),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 132/319 (41%), Positives = 188/319 (59%), Gaps = 47/319 (15%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA+KIQ AFRG+LA+KALR LKGLVK+QAL+RGYLVRKQA+ATL SMQAL+RAQA + A 
Sbjct  139   AAVKIQTAFRGFLAKKALRALKGLVKLQALVRGYLVRKQAAATLQSMQALVRAQACIRAA  198

Query  670   KSRPSIIN-----HP---------QKSIDKNKEARSEN-ITSVHSGRYFASLGSEN----  792
             +SR + +      HP         Q+     +++RS++ +   +S R  AS+ S +    
Sbjct  199   RSRAAALPTNLRVHPTPVRPRYSLQERYSTTEDSRSDHRVAPYYSRRLSASVESSSCYGY  258

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL-----PYKIS--TSQD  951
             D   K+VEMDT   PK+   S R+ +  P      +    SSPL     P +I+  T++ 
Sbjct  259   DRSPKIVEMDTG-RPKSRSSSLRTTS--PGASEECYAHSVSSPLMPCRAPPRIAAPTARH  315

Query  952   FQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY---PKYMA  1122
             F + +     ++ R +TAQ+TPR+     S  P+T +KS+     + N       P YM+
Sbjct  316   FPEYE---WCEKARPATAQSTPRYT----SYAPVTPTKSVCGGYTYSNSPSTLNCPSYMS  368

Query  1123  STQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMM---ESRAS-QSGVRMQKSCSHA--  1284
             STQS ++K+RSQSAPKQRPE G    RKRV L+E++   E+RAS   G   Q+SC+    
Sbjct  369   STQSSVAKVRSQSAPKQRPEEGAV--RKRVPLSEVIILQEARASLGGGGGTQRSCNRPAQ  426

Query  1285  QEVMNFKSAVIGRLGRCTD  1341
             +E  +FK AV+ R  R ++
Sbjct  427   EEAFSFKKAVVSRFDRSSE  445



>ref|XP_004968459.1| PREDICTED: uncharacterized protein LOC101775005 [Setaria italica]
Length=468

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 137/327 (42%), Positives = 183/327 (56%), Gaps = 45/327 (14%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RGR G        AA+KIQ AFRG+LA+KALR LK LVK+QAL+RGYLVRKQA+A L SM
Sbjct  148   RGRAG--------AAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRKQAAAALQSM  199

Query  631   QALMRAQATVLAQKSR-----PSIINH----PQKSIDKN--KEARSENITSVHSGRYFAS  777
              AL+RAQA V A + R     P + +H    P+ S+ +    + RSE+  + +S R  AS
Sbjct  200   HALVRAQAAVRAARGRAVPQLPPLHSHPPVRPRFSLQERYADDTRSEHGVAAYSRRLSAS  259

Query  778   LGSEN----DVITKVVEMDTSVTPKASRKSRRS---KTWVPEFQGNPFGP---PHSSPLP  927
             + S +    D   K+VEMDT   P++   S R+   + W  +   +P  P   P  +  P
Sbjct  260   IESASYGGYDRSPKIVEMDTG-RPRSRASSLRTVDDEWWAAQSVSSPLLPCGLPGGAAPP  318

Query  928   -YKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEG  1104
                + +S+ F D +     ++ R +TAQ TPR A    +  P T +KS+           
Sbjct  319   RIAVPSSRHFPDYEWC-APEKPRPATAQCTPRCAAPYLA--PPTPAKSVCGGSGSAGAGI  375

Query  1105  Y------PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MMESRASQSGVRM  1263
             Y      P YM+STQS  +K RSQSAPKQRPE  P   RKRV L+E ++E RAS SGV M
Sbjct  376   YLASPNCPGYMSSTQSSEAKSRSQSAPKQRPEQQP---RKRVPLSEVVLEPRASLSGVGM  432

Query  1264  QKSCSHAQ-EVMNFKSAVIGRLGRCTD  1341
             QK C  A  E  +F++AV+ R  R  D
Sbjct  433   QKPCGRAALEAFDFRAAVVSRFERPPD  459



>ref|XP_009413858.1| PREDICTED: protein IQ-DOMAIN 31-like [Musa acuminata subsp. malaccensis]
 ref|XP_009413859.1| PREDICTED: protein IQ-DOMAIN 31-like [Musa acuminata subsp. malaccensis]
 ref|XP_009413860.1| PREDICTED: protein IQ-DOMAIN 31-like [Musa acuminata subsp. malaccensis]
Length=442

 Score =   153 bits (387),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 134/318 (42%), Positives = 189/318 (59%), Gaps = 30/318 (9%)
 Frame = +1

Query  454   GRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQ  633
             G GG +   ER AA++IQ AFRGYLARKALR LK LVK+QAL+RG+LVRKQA+ATLHSMQ
Sbjct  119   GGGGGV---ERLAAVRIQTAFRGYLARKALRALKALVKLQALVRGFLVRKQAAATLHSMQ  175

Query  634   ALMRAQATVLAQKSRPSIINH----PQ----KSIDKNKEARSENITSVHSGRYFASLGSE  789
             AL+RAQA V A+++R  + +     P+    +S++K  + R    +S  + R+  S+ S 
Sbjct  176   ALVRAQAAVRARRARNLLPDDGNLVPEIRRRRSLEKFADPRGLQTSSFQNRRFSTSIDSP  235

Query  790   NDVIT-KVVEMDTSVT-PKASRKSRRSKTWVPEFQGNP---FGPPHSSPLPYKIS--TSQ  948
                 + K+VE+D   T P+++R++  S   V      P   F  P    +P +IS  + +
Sbjct  236   ILARSPKIVEIDRCRTKPRSARRA--SLPAVDPADDLPLYAFSSPLPCQIPARISIPSRR  293

Query  949   DFQDLDTSQISDEYRFS-TAQTTPRFANVRGSNNPITLSKSMF-MEPYFRNYEGY---PK  1113
             + Q+ D     ++ R S TAQ+TPR+ N  G N  +T +KS+   E  FR Y      P 
Sbjct  294   NLQENDWCINGEKCRLSATAQSTPRYMNSFG-NVAVTPAKSVCGAESVFRPYSSVTSSPS  352

Query  1114  YMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEM-MESRASQSGVRMQKSCSHAQE  1290
             YMA+TQS  +K+RSQ AP+  PE      RKR  L E+ +E+RA+  G+ M K  S  QE
Sbjct  353   YMANTQSSKAKVRSQGAPRHPPE--SAETRKRQPLGEVNLEARANFGGIGMHKPRSQIQE  410

Query  1291  -VMNFKSAVIGRLGRCTD  1341
                +FK AVIGRL R ++
Sbjct  411   AAFSFKRAVIGRLDRSSE  428



>gb|KFK29473.1| hypothetical protein AALP_AA7G138200 [Arabis alpina]
Length=381

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 156/410 (38%), Positives = 205/410 (50%), Gaps = 49/410 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYGPSG  327
             MG+  +W KGLF  + S+        +     LC +  TIPPNI+  EAAWL SFY   G
Sbjct  1     MGRATRWFKGLFGIKPSSYPNRLDRSSFTGMSLCDSYETIPPNISEKEAAWLRSFYA-EG  59

Query  328   GEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC-----RERWA  492
              EE          A   AAA  A   A  AAAAVVR+  +  G+ GPL       RE  A
Sbjct  60    EEEKERRTHAIAVAVATAAAADAAVVAAKAAAAVVRLTGQ--GKSGPLRSGQQQSRENRA  117

Query  493   AIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK  672
             A++IQ AFRGYLARKA R L+G+VKIQAL+RGYLVRKQA+ATL SM+AL+RAQATV  Q+
Sbjct  118   AMQIQCAFRGYLARKAFRALRGVVKIQALVRGYLVRKQAAATLRSMEALVRAQATVKFQR  177

Query  673   S--RPSIINHPQKSIDKNKEARSENITSVHSGRYFASL---GSENDVITKVVEMDTSVTP  837
             +  R       +KS +                R+  SL    +  +   K+VE+DT   P
Sbjct  178   ALRRAGNATPARKSTE----------------RFSGSLENRSNSGEETAKIVEVDTGNRP  221

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTP  1017
                R  R       +F  NPF    SSPL  ++         +  + S   +F TAQ+TP
Sbjct  222   GTYR-IRGPVLTGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWDECSSN-KFPTAQSTP  279

Query  1018  RFANVRGSNNPITLSKSMF---MEPY-FRNYEGYPKYMASTQSFMSKLRSQSAPKQRPEL  1185
             RFA    S +     ++       P+ F + E    YM  T SF +KLRS SAP+QRPE 
Sbjct  280   RFAGGSPSRSVCCSGEAEVDAEAHPFCFLSGEFNSSYMEDTTSFRAKLRSHSAPRQRPE-  338

Query  1186  GPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSAVIGRLGR  1332
                      +     +S     GV++Q+ SCS  +E      AV+G + R
Sbjct  339   ------SNAAGGGWKKSIRGGGGVKVQRPSCSGVRE------AVVGNIER  376



>ref|XP_008447560.1| PREDICTED: LOW QUALITY PROTEIN: protein IQ-DOMAIN 14-like [Cucumis 
melo]
Length=384

 Score =   152 bits (383),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 116/276 (42%), Positives = 153/276 (55%), Gaps = 27/276 (10%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
               +KIQ+ FRG+LARKALR L+GLVK+QAL+RG+LVRK+A+ATL SMQAL+RAQ TV +Q
Sbjct  128   GVVKIQSVFRGFLARKALRALRGLVKLQALVRGFLVRKRAAATLMSMQALIRAQTTVRSQ  187

Query  670   KSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASR  849
             ++R    N   KS+    E   EN T         SL S+     K+VEMDT      SR
Sbjct  188   RARRRSYNKENKSLP---EKTPENDTR--------SLYSDETEHPKIVEMDTMFKRPKSR  236

Query  850   KSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQD----LDTSQISDEYRFSTAQTTP  1017
              SRR  + V E      G    SP  + +++          L   +        TAQ+TP
Sbjct  237   -SRRFNSLVSE-----LGEERPSPYLWTMASPARISGGEWCLGGGEEYGRMSTGTAQSTP  290

Query  1018  RFANVRGSNNPITLSKSM-FMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPG  1194
             R    R      T  +S+     Y      YP YMAST+S  +KLRS+SAPKQRPE+   
Sbjct  291   RGGRCRWGR--ATPGRSVYGEGYYRGYGNYYPNYMASTKSSKAKLRSRSAPKQRPEIWT-  347

Query  1195  PRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
               +KRV+LNE+M +R S S +RMQ+SC+  +    F
Sbjct  348   --KKRVALNEIMGARNSISSIRMQRSCNGMEGEEGF  381



>ref|XP_010033830.1| PREDICTED: protein IQ-DOMAIN 31-like [Eucalyptus grandis]
 gb|KCW53665.1| hypothetical protein EUGRSUZ_J02932 [Eucalyptus grandis]
Length=355

 Score =   150 bits (380),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 116/287 (40%), Positives = 160/287 (56%), Gaps = 51/287 (18%)
 Frame = +1

Query  454   GRGG-PLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GRG  P   RERWAA+KIQ AFRG+LARKALR LKGLVK+QA +RGYLVRK+ASA L SM
Sbjct  108   GRGTMPRGGRERWAAVKIQTAFRGFLARKALRALKGLVKLQAFVRGYLVRKRASAALRSM  167

Query  631   QALMRAQATV--------LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFAS--L  780
             QA++RAQA V        L +++R S+ N P++S++K  + RS    + HS R+  S  +
Sbjct  168   QAIVRAQAAVRSHQARHSLDKENRYSLENRPRRSMEKVCDPRS----AFHSKRFSTSSEV  223

Query  781   GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQD  960
              S  +   K+VE+DT   P    +SR  +                SPL   I    D+  
Sbjct  224   TSNFEESPKIVEVDT-FKP----RSRLCQI--------------HSPLMECIYDGLDY--  262

Query  961   LDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFM  1140
                  +S +Y        P   N   +  P+   +S   + Y+      P+YMASTQSF 
Sbjct  263   ----AVSKQY-----SEWPLAGNECRTPTPV---RSPCGDGYYGPRSELPRYMASTQSFK  310

Query  1141  SKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             +K RS SAP+QRP+ G    +KR +L+E++ +R S S + M +SCS 
Sbjct  311   AKSRSLSAPRQRPDEGS---KKRFTLSEIIAARNSVSAIGMHRSCSQ  354



>ref|XP_004149189.1| PREDICTED: protein IQ-DOMAIN 14-like [Cucumis sativus]
 gb|KGN58025.1| hypothetical protein Csa_3G435550 [Cucumis sativus]
Length=385

 Score =   151 bits (381),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 118/288 (41%), Positives = 152/288 (53%), Gaps = 26/288 (9%)
 Frame = +1

Query  457   RGGPLF--CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RG  L    +E    +KIQ+ FRG+LARKALR L+GLVK+QAL+RG+LVRK+A+ATL SM
Sbjct  115   RGSALLNGGKEIMGVVKIQSVFRGFLARKALRALRGLVKLQALVRGFLVRKRAAATLQSM  174

Query  631   QALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             QAL+RAQ TV +Q++R    N   KS     E   EN           SL S+     K+
Sbjct  175   QALIRAQTTVRSQRARRRSYNKENKS---QPEKSPEND--------IRSLYSDETEHPKI  223

Query  811   VEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQD----LDTSQI  978
             VEMDT      SR SRR  + V E      G    SP  + +++          L   + 
Sbjct  224   VEMDTMFKRPKSR-SRRFNSLVSE-----LGEERPSPYLWTMASPARISGGEWCLGGGEE  277

Query  979   SDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQ  1158
                    TAQ+TPR    R                Y      YP YMAST+S  +KLRS+
Sbjct  278   YGRMSTGTAQSTPRGGRCRWGAVATPGRSVYGEGYYRGYGNYYPNYMASTKSSKAKLRSR  337

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNF  1302
             SAPKQRPE+     +KRV+LNE+M +R S S VRMQ+SC+  +    F
Sbjct  338   SAPKQRPEIWT---KKRVALNEIMGARNSISSVRMQRSCNGIEGEEGF  382



>emb|CAB43929.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB79673.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAO41944.1| unknown protein [Arabidopsis thaliana]
Length=383

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 160/412 (39%), Positives = 209/412 (51%), Gaps = 51/412 (12%)
 Frame = +1

Query  148   MGKVIKWLKGLFtt--rqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYGP  321
             MG+  +W KGLF       +G  SG+        LC +  TIPPNI+  EAAWL SFY  
Sbjct  1     MGRATRWFKGLFGIKPSSCSGTDSGTISNRLDRSLCDSYETIPPNISEKEAAWLRSFYA-  59

Query  322   SGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLF---CRERWA  492
             +G EE          AA  AAA  A  AA  AAAAVVR+  +  G+ GPL     RE  A
Sbjct  60    AGEEEKERRTHAIAVAAATAAAADAAVAAAKAAAAVVRLQGQ--GKSGPLGGGKSREHRA  117

Query  493   AIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK  672
             A++IQ AFRGYLARKALR L+G+VKIQAL+RG+LVR QA+ATL SM+AL+RAQ TV    
Sbjct  118   AMQIQCAFRGYLARKALRALRGVVKIQALVRGFLVRNQAAATLRSMEALVRAQKTV----  173

Query  673   SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTPKAS  846
                      Q+++ +N  A     ++    R+  SL + N  +   K+VE+DT   P   
Sbjct  174   -------KIQRALRRNGNAAPARKSTE---RFSGSLENRNNGEETAKIVEVDTGTRPGTY  223

Query  847   RKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFA  1026
             R  R       +F  NPF    SSPL  ++         +  + S   +F TAQ+TPRF+
Sbjct  224   R-IRAPVLSGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWEECSS--KFPTAQSTPRFS  280

Query  1027  NVRGSNNPITLSKSMFMEP---------YFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP  1179
                 + +       +  E           F + E    YMA T SF +KLRS SAP+QRP
Sbjct  281   GGSPARSVCCSGGGVEAEVDTEADANRFCFLSGEFNSGYMADTTSFRAKLRSHSAPRQRP  340

Query  1180  ELGPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSAVIGRLGR  1332
             E        R S+           GVRMQ+ SCS  +E      AV+G + R
Sbjct  341   ESNASAGGWRRSIG--------GGGVRMQRQSCSGVRE------AVVGNIER  378



>gb|KCW79610.1| hypothetical protein EUGRSUZ_C00964 [Eucalyptus grandis]
Length=419

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 169/429 (39%), Positives = 219/429 (51%), Gaps = 68/429 (16%)
 Frame = +1

Query  148   MGKVIKWLKGLF------ttrqsnggrsgsggataatgLCHnpttippnitpAEAAWLSS  309
             MG+  +W+KGLF          SN   +     + ++GLC+NP TIPPNI+ AE+AWL S
Sbjct  1     MGRATRWIKGLFGIKKDREEVDSNDNSNSKRQLSNSSGLCNNPATIPPNISAAESAWLRS  60

Query  310   FYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFCRERW  489
                    E+  N   IAVAAATAAAADAAVAAA        R+ S  RG    +  R+  
Sbjct  61    CSCTDEAEKEQNKRVIAVAAATAAAADAAVAAAAVI-----RLTSHGRG---AMLGRQEH  112

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA+KIQ  FRG+LARKALR LKGLVK+QA +RGYLVRKQA+ATLHS +ALMRAQA+   +
Sbjct  113   AAVKIQTVFRGFLARKALRALKGLVKLQARVRGYLVRKQAAATLHSFEALMRAQASARLR  172

Query  670   KSRPSIINHPQKSID-----KNKEARSENITSVH----------------SGRYFASLGS  786
             +S            D     ++   R ++ T                   S     +L  
Sbjct  173   RSARGRSRGGGGGGDDCTATRDPTERYDDKTRNARARARAAVAHNRKPSASAADSPTLRP  232

Query  787   ENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLD  966
               +  +++VE+D   TP +S              GN    P  +P       +  F+  D
Sbjct  233   AIEDTSRIVEVDDGATPFSS-------------SGNTL--PRRAP-------AGRFRSSD  270

Query  967   TSQISDEYRFSTAQTTPRFANVRG-SNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMS  1143
                + D    +T  +TPR  N    S         +F     R     P YM+ TQS  +
Sbjct  271   --WLDDPGPCTTPASTPRSMNTPARSEAGGGGGGCLFRRRDDRGLLLAPSYMSGTQSSKA  328

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNE-MME---SRASQS---GVRMQKSCSHA-QEVMN  1299
             KLRSQSAPKQR   G  P R+RVSL E MME   SR+S S   GVRMQ+SCS A QE   
Sbjct  329   KLRSQSAPKQRVGAGEAPTRRRVSLQEAMMEFERSRSSLSGAVGVRMQRSCSQAQQEAGA  388

Query  1300  FKSAVIGRL  1326
             FK++V G++
Sbjct  389   FKNSVAGKM  397



>ref|XP_010047665.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
Length=442

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 170/436 (39%), Positives = 222/436 (51%), Gaps = 68/436 (16%)
 Frame = +1

Query  127   SLKNESKMGKVIKWLKGLF------ttrqsnggrsgsggataatgLCHnpttippnitpA  288
             +L+    MG+  +W+KGLF          SN   +     + ++GLC+NP TIPPNI+ A
Sbjct  17    NLQRHLNMGRATRWIKGLFGIKKDREEVDSNDNSNSKRQLSNSSGLCNNPATIPPNISAA  76

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGP  468
             E+AWL S       E+  N   IAVAAATAAAADAAVAAA        R+ S  RG    
Sbjct  77    ESAWLRSCSCTDEAEKEQNKRVIAVAAATAAAADAAVAAAAVI-----RLTSHGRG---A  128

Query  469   LFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRA  648
             +  R+  AA+KIQ  FRG+LARKALR LKGLVK+QA +RGYLVRKQA+ATLHS +ALMRA
Sbjct  129   MLGRQEHAAVKIQTVFRGFLARKALRALKGLVKLQARVRGYLVRKQAAATLHSFEALMRA  188

Query  649   QATVLAQKSRPSIINHPQKSID-----KNKEARSENITSVH----------------SGR  765
             QA+   ++S            D     ++   R ++ T                   S  
Sbjct  189   QASARLRRSARGRSRGGGGGGDDCTATRDPTERYDDKTRNARARARAAVAHNRKPSASAA  248

Query  766   YFASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTS  945
                +L    +  +++VE+D   TP +S              GN    P  +P       +
Sbjct  249   DSPTLRPAIEDTSRIVEVDDGATPFSS-------------SGNTL--PRRAP-------A  286

Query  946   QDFQDLDTSQISDEYRFSTAQTTPRFANVRG-SNNPITLSKSMFMEPYFRNYEGYPKYMA  1122
               F+  D   + D    +T  +TPR  N    S         +F     R     P YM+
Sbjct  287   GRFRSSD--WLDDPGPCTTPASTPRSMNTPARSEAGGGGGGCLFRRRDDRGLLLAPSYMS  344

Query  1123  STQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNE-MME---SRASQS---GVRMQKSCSH  1281
              TQS  +KLRSQSAPKQR   G  P R+RVSL E MME   SR+S S   GVRMQ+SCS 
Sbjct  345   GTQSSKAKLRSQSAPKQRVGAGEAPTRRRVSLQEAMMEFERSRSSLSGAVGVRMQRSCSQ  404

Query  1282  A-QEVMNFKSAVIGRL  1326
             A QE   FK++V G++
Sbjct  405   AQQEAGAFKNSVAGKM  420



>ref|XP_006412875.1| hypothetical protein EUTSA_v10025424mg [Eutrema salsugineum]
 gb|ESQ54328.1| hypothetical protein EUTSA_v10025424mg [Eutrema salsugineum]
Length=390

 Score =   147 bits (371),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 160/395 (41%), Positives = 210/395 (53%), Gaps = 43/395 (11%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgsgga--------taatgLCHnpttippnitpAEAAWL  303
             MG+  +W KGLF  + S+   SG             A   LC +  TIPPNI+  EAAWL
Sbjct  1     MGRATRWFKGLFGIKPSSCSGSGVISNRLDRSALPAAGVSLCDSYETIPPNISEKEAAWL  60

Query  304   SSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLF---  474
              SFY  +G EE    A     AA  AAA  A  AA  AAAAVV++  +  G+ GPL    
Sbjct  61    RSFYA-AGEEEIERRAHAIAIAAATAAAADAAVAAAKAAAAVVKLTGQ--GKSGPLSGGK  117

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
              RE  AA++IQ AFRGYLARKALR LKG+VKIQAL+RG+LVRKQA+ATL SM+AL+RAQA
Sbjct  118   SRENRAAMQIQCAFRGYLARKALRALKGVVKIQALVRGFLVRKQAAATLRSMEALVRAQA  177

Query  655   TVLAQKSRPSIIN-HPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSV  831
             TV  Q++   I N  P +   K+ E  S ++ + +SG   A          K+VE+DT  
Sbjct  178   TVKFQRALRRIGNAAPAR---KSTERFSGSLENRNSGEETA----------KIVEVDTGT  224

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQT  1011
              P   R  R       +F  NPF    SSPL  ++         +    S   +F +AQ+
Sbjct  225   RPGPYRI-RGPVLSGSDFLDNPFRRTLSSPLSGRVPPRLTMPKSEWEDCSS--KFPSAQS  281

Query  1012  TPRFA------NVRGSNNPITLSKSMFMEPY---FRNYEGYPKYMASTQSFMSKLRSQSA  1164
             TPRFA      +V  S   +       ++ +     + + +  YMA   SF +KLRSQSA
Sbjct  282   TPRFAGGSPSRSVCCSGGGVEADAEAEVDAHRFCLLSGDYHSSYMADATSFRAKLRSQSA  341

Query  1165  PKQRPELGP--GPRRKRVSLNEMME-SRASQSGVR  1260
             P+QRP++    G  RK +  N  +   R S SGVR
Sbjct  342   PRQRPDINTACGGWRKSIGGNGGLPVQRPSCSGVR  376



>emb|CDO99100.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 114/289 (39%), Positives = 157/289 (54%), Gaps = 41/289 (14%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM------  642
             E  AAIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+      
Sbjct  142   EEAAAIKIQSVFRAYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTVQARA  201

Query  643   RAQATVLAQKSRPSIIN--HPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVE  816
             RAQ   +AQ+S+P+ +   H +KS  +N+ ++S               G E +V  K+VE
Sbjct  202   RAQRIQMAQESKPNNLKQFHHRKSTQENRFSQSYQDFDK---------GMEENV--KIVE  250

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGNPF---------GPPHSSPLPYKISTSQDFQDLDT  969
             MD    PK S KSR S +   + +                  SPLP  I+   D      
Sbjct  251   MDIG-DPKGSTKSRNSYSNNGQTERTDHRISTHRAYSNQEQISPLPSAIT---DLSPRAC  306

Query  970   SQISDEYRFSTAQTTPRFANVRGSNNP----ITLSKSMFMEPYFRNYEGYPKYMASTQSF  1137
             S   +EY F T+Q++P++ +     +P     + ++S + +  +  Y  YP YMA+T+S 
Sbjct  307   SGHFEEYSFGTSQSSPQYCSAISKPDPSKGAFSYARSEYGDSLYNEYPFYPSYMANTESS  366

Query  1138  MSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              +K+RS SAPKQRPE     P R+R S+    E R     VRMQ+S SH
Sbjct  367   RAKVRSHSAPKQRPESFERQPSRRRPSI----EGRNVPRAVRMQRSSSH  411



>ref|XP_009629604.1| PREDICTED: protein IQ-DOMAIN 1 [Nicotiana tomentosiformis]
Length=465

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 116/288 (40%), Positives = 159/288 (55%), Gaps = 39/288 (14%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQ+ FRGYLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  141   EEPAAVKIQSVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQARA  200

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGS-ENDVITKVVEMDTSVTP  837
              AQ+ R +   +P      N   +S +  S    ++  S    E D+  K+VEMD   + 
Sbjct  201   RAQRLRMAEDENP------NNPRQSVHRKSTQDNKFRHSYQDYEEDI--KIVEMDIGES-  251

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDT--SQISD---------  984
             K S KSR S +     QG      H     +K  ++Q++Q + +  S I+D         
Sbjct  252   KGSTKSRNSYS----NQGQTERTEHRIST-HKAYSNQEYQHISSAPSAITDNSPRACSGH  306

Query  985   --EYRFSTAQTTPRFANVRG----SNNPITLSKSMFMEP--YFRNYEGYPKYMASTQSFM  1140
               EY + TAQ++P++ +       S  P + ++S + EP   +  Y  YP YMA+T+S M
Sbjct  307   FEEYSYGTAQSSPQYHSAMSKPDPSKIPFSYARSEYAEPECLYNEYPFYPSYMANTKSSM  366

Query  1141  SKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             +K RS SAPKQRPE     P R+R S+    E R     VRMQ+S SH
Sbjct  367   AKARSHSAPKQRPESFERQPSRRRPSI----EGRNVPRAVRMQRSSSH  410



>ref|XP_010529030.1| PREDICTED: protein IQ-DOMAIN 14-like [Tarenaya hassleriana]
Length=297

 Score =   143 bits (361),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 110/288 (38%), Positives = 157/288 (55%), Gaps = 56/288 (19%)
 Frame = +1

Query  478   RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQAT  657
             RERWAA+KIQ  FRGYLARKA R LKGLVK+QAL+RGY+VRK+A+ TLH MQ+L+RAQA 
Sbjct  51    RERWAAVKIQTVFRGYLARKAHRALKGLVKLQALVRGYVVRKRAAETLHCMQSLVRAQAA  110

Query  658   VLAQKSRPSIIN-------HPQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT----  804
             V +++   S+ N        P+ S+++  E+RSE    +HS R   S+  + +       
Sbjct  111   VRSRRINRSLDNRDCNDKFQPRHSMERFDESRSE----IHSKRMSISVKQQWNSACDGNS  166

Query  805   -KVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQIS  981
              K+VEMDT  +    R+ R +   + EF  +                 QDF         
Sbjct  167   PKIVEMDTCKSRSRPRR-RMNIAALSEFGDD-----------------QDF---------  199

Query  982   DEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQS  1161
              E+ +S  +   +F+    +NN + L +S   +         P YMA+TQSF +K RS S
Sbjct  200   -EWSYSPLEKC-KFSY--SNNNNLYLPQSPAAKSVCYGPRTPPSYMANTQSFKAKQRSHS  255

Query  1162  APKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFK  1305
             AP+QRPE      RKR++L+E+M +R S S VR   S    ++ M F+
Sbjct  256   APRQRPE------RKRLTLDEVMAARFSVSSVR---SVQQQRDSMQFR  294



>ref|XP_009757400.1| PREDICTED: protein IQ-DOMAIN 14 [Nicotiana sylvestris]
Length=465

 Score =   146 bits (369),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 113/287 (39%), Positives = 156/287 (54%), Gaps = 37/287 (13%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQ+ FRGYLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  141   EEPAAVKIQSVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQARA  200

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ+ R +   +P           +++    HS + +       D   K+VEMD   + K
Sbjct  201   RAQRLRMAEDENPSNPRQSVHRKSTQDNKFRHSYQDY-------DEDIKIVEMDIGES-K  252

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLD--TSQISD----------  984
              S KSR S +     QG      H     +K  ++Q++Q +    S I+D          
Sbjct  253   GSTKSRNSYS----NQGQTERTEHRFST-HKAYSNQEYQHISPAPSAITDNSPRACSGHF  307

Query  985   -EYRFSTAQTTPRFANVRG----SNNPITLSKSMFMEP--YFRNYEGYPKYMASTQSFMS  1143
              EY + TAQ++P++ +       S  P + ++S ++EP   +  Y  YP YMA+T+S M+
Sbjct  308   EEYSYGTAQSSPQYYSAMSKPDPSKIPFSYARSEYVEPESLYNGYPFYPSYMANTKSSMA  367

Query  1144  KLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             K RS SAPKQRPE     P R+R S+    E R     VRMQ+S SH
Sbjct  368   KARSHSAPKQRPESFERQPSRRRPSI----EGRNVPRAVRMQRSSSH  410



>ref|XP_006838975.1| hypothetical protein AMTR_s00002p00271290 [Amborella trichopoda]
 gb|ERN01544.1| hypothetical protein AMTR_s00002p00271290 [Amborella trichopoda]
Length=472

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 119/297 (40%), Positives = 151/297 (51%), Gaps = 37/297 (12%)
 Frame = +1

Query  466   PLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMR  645
             P    ER AAI+IQA FR YLARKAL  LKGLVKIQAL+RG+LVRKQA+ATL  MQAL+ 
Sbjct  133   PSLIEER-AAIRIQAMFRAYLARKALCALKGLVKIQALVRGHLVRKQATATLRCMQALLT  191

Query  646   AQATVLAQKSRPSIIN-HP--QKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVE  816
              QA   AQ+ + S    HP  QK    ++ +  +N       R    +    D   K+VE
Sbjct  192   VQARARAQRIQSSCEEIHPVIQKQTSIHRRSFQDN-----QFRQSTDMEKTMDENVKIVE  246

Query  817   MDTSVTPKASRKSRRSKTWVP-EFQGNPFG-----------PPHS----SPLPYKISTSQ  948
             MD   + + S KSR S +  P E   + F            PPH     SP P     S 
Sbjct  247   MDLGES-RGSSKSRISYSNPPVERTEHRFSMHYATHKEHSLPPHPKLDLSPAP-----SP  300

Query  949   DFQDLDTSQIS---DEYRFSTAQTTPRFANV---RGSNNPITLSKSMFMEPYFRNYEGYP  1110
              F DL     S   ++Y F+TAQ++P + +      S  P T S+  + E     Y  +P
Sbjct  301   AFPDLSPRTSSGHFEDYSFTTAQSSPHYCSAISRADSTGPFTPSRPEYAESLSHEYSFFP  360

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              YMA+T+S  +K RSQSAPKQRP+    P           E R    GVRMQ+S SH
Sbjct  361   NYMANTESSKAKARSQSAPKQRPDSYEKPASNNSKRRSSTEGRGIPRGVRMQRSSSH  417



>ref|XP_010033552.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
 gb|KCW84050.1| hypothetical protein EUGRSUZ_B009321 [Eucalyptus grandis]
Length=470

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 166/307 (54%), Gaps = 45/307 (15%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ +   GRG  +   E  AAIKIQ+ FR YLARKALR LKGLVK+QAL+RG+LVRKQA+
Sbjct  131   RLTAAANGRGSAI---EEAAAIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQAT  187

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKS-IDKNKEARSENITSVHSGRYFASLGSE  789
             ATL  +QAL+  QA   A + R + +  P    +  ++++  +N         F ++  E
Sbjct  188   ATLRCIQALVTVQARARANRLRSAEVPKPTDPRLSTHRKSTQDN--------RFRNIYHE  239

Query  790   NDVI----TKVVEMDTSVTPKASRKSRRSKT------WV-PEFQGNP--FGPPHS--SPL  924
             ++ +     K+VEMD   + KAS KSR S +      W+ P+F  +   F P ++  SP 
Sbjct  240   SEKMMEENIKIVEMDIGES-KASTKSRNSYSTHPEPEWIDPKFSAHRAYFKPENNQISPA  298

Query  925   PYKI------STSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPY  1086
             P  +      + S  F+D     +    +FS+A + P  A +     P    +S + E  
Sbjct  299   PSALTELSPRTCSGHFEDYSLGMVQSSPQFSSAVSKPDPAPI-----PFAFPRSEYAESL  353

Query  1087  FRNYEGYPKYMASTQSFMSKLRSQSAPKQRPEL--GPGPRRKRVSLNEMMESRASQSGVR  1260
               +Y  YP YMA+T+S  +K RSQSAPKQRP++     P R+R SL    E R     +R
Sbjct  354   SYDYPLYPNYMANTESSRAKARSQSAPKQRPDIYYERQPSRRRPSL----EGRNVPRAMR  409

Query  1261  MQKSCSH  1281
             MQ+S SH
Sbjct  410   MQRSSSH  416



>ref|XP_010034632.1| PREDICTED: protein IQ-DOMAIN 14-like [Eucalyptus grandis]
 gb|KCW84166.1| hypothetical protein EUGRSUZ_B01029 [Eucalyptus grandis]
Length=470

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 166/307 (54%), Gaps = 45/307 (15%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ +   GRG  +   E  AAIKIQ+ FR YLARKALR LKGLVK+QAL+RG+LVRKQA+
Sbjct  131   RLTAAANGRGSAI---EEAAAIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQAT  187

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKS-IDKNKEARSENITSVHSGRYFASLGSE  789
             ATL  +QAL+  QA   A + R + +  P    +  ++++  +N         F ++  E
Sbjct  188   ATLRCIQALVTVQARARANRLRSAEVPKPTDPRLSTHRKSTQDN--------RFRNIYHE  239

Query  790   NDVI----TKVVEMDTSVTPKASRKSRRSKT------WV-PEFQGNP--FGPPHS--SPL  924
             ++ +     K+VEMD   + KAS KSR S +      W+ P+F  +   F P ++  SP 
Sbjct  240   SEKMMEENIKIVEMDIGES-KASTKSRNSYSTHPEPEWIDPKFSAHRAYFKPENNQISPA  298

Query  925   PYKI------STSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPY  1086
             P  +      + S  F+D     +    +FS+A + P  A +     P    +S + E  
Sbjct  299   PSALTELSPRTCSGHFEDYSLGMVQSSPQFSSAVSKPDPAPI-----PFAFPRSEYAESL  353

Query  1087  FRNYEGYPKYMASTQSFMSKLRSQSAPKQRPEL--GPGPRRKRVSLNEMMESRASQSGVR  1260
               +Y  YP YMA+T+S  +K RSQSAPKQRP++     P R+R SL    E R     +R
Sbjct  354   SYDYPLYPNYMANTESSRAKARSQSAPKQRPDIYYERQPSRRRPSL----EGRNVPRAMR  409

Query  1261  MQKSCSH  1281
             MQ+S SH
Sbjct  410   MQRSSSH  416



>ref|XP_009137830.1| PREDICTED: uncharacterized protein LOC103861873 [Brassica rapa]
Length=388

 Score =   142 bits (359),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 147/371 (40%), Positives = 199/371 (54%), Gaps = 50/371 (13%)
 Frame = +1

Query  148   MGKVIKWLKGLFttrqsnggrsgs------ggataatgLCHnpttippnitpAEAAWLSS  309
             MG+  +W +GLF  + S+   SG+        + A   LC +  TIPPNI+  EAAWL S
Sbjct  1     MGRATRWFRGLFGIKHSSCSGSGTISNRIDRSSLAGVSLCDSYETIPPNISEREAAWLRS  60

Query  310   FYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC---R  480
             FY  +G EE    A     AA  AAA     AA  AAAAVVR+  +  G+ GPL     R
Sbjct  61    FYA-AGEEEIERRAHAVAVAAATAAAADVAVAAAKAAAAVVRLTGQ--GKSGPLAVGNGR  117

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA++IQ  FRGYLARKALR LKG+VKIQAL+RG+LVRKQA+ATL SM+AL+RAQATV
Sbjct  118   ENRAAMQIQCTFRGYLARKALRALKGVVKIQALVRGFLVRKQAAATLRSMEALVRAQATV  177

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVT  834
               Q++         + I     AR        + R+  SL + N  +   K+VE+DT + 
Sbjct  178   KFQRA--------LRRIGNTAPARKS------TERFSGSLENRNNGEETAKIVEVDTGIR  223

Query  835   PKASRKSRRSKTWVPEFQGNPFGPPHSSPL----PYKISTSQ-DFQDLDTSQISDEYRFS  999
             P   R  R       +F  NPF    SSPL    P ++S  + +++D  +       +F 
Sbjct  224   PGHYRL-RVPVLSGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWEDCSS-------KFP  275

Query  1000  TAQTTPRFA------NVRGSNNPITLSKSMFMEPY---FRNYEGYPKYMASTQSFMSKLR  1152
             TAQ+TPR+A      NV  S   +       ++ +   F + E +  +   T SF  +LR
Sbjct  276   TAQSTPRYAGGSPARNVCCSGGGVEAEADAEVDAHQLCFLSGEFHSNFTTDTTSFRGRLR  335

Query  1153  SQSAPKQRPEL  1185
             S SAP+QRP +
Sbjct  336   SHSAPRQRPGI  346



>emb|CDY30233.1| BnaA03g49370D [Brassica napus]
Length=388

 Score =   142 bits (359),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 145/376 (39%), Positives = 195/376 (52%), Gaps = 60/376 (16%)
 Frame = +1

Query  148   MGKVIKWLKGLFt------trqsnggrsgsggataatgLCHnpttippnitpAEAAWLSS  309
             MG+  +W +GLF       +            + A   LC +  TIPPNI+  EAAWL S
Sbjct  1     MGRATRWFRGLFGIKPSSCSGSGTISNRIDRSSLAGVSLCDSYETIPPNISEREAAWLRS  60

Query  310   FYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC---R  480
             FY  +G EE    A     AA  AAA     AA  AAAAVVR+  +  G+ GPL     R
Sbjct  61    FYA-AGEEEIERRAHAVAVAAATAAAADVAVAAAKAAAAVVRLTGQ--GKSGPLGVGNGR  117

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA++IQ  FRGYLARKALR LKG+VKIQAL+RG+LVRKQA+ATL SM+AL+RAQATV
Sbjct  118   ENRAAMQIQCTFRGYLARKALRALKGVVKIQALVRGFLVRKQAAATLRSMEALVRAQATV  177

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVT  834
               Q++         + I     AR        + R+  SL + N  +   K+VE+DT + 
Sbjct  178   KFQRA--------LRRIGNTAPARKS------TERFSGSLENRNNGEETAKIVEVDTGIR  223

Query  835   PKASRKSRRSKTWVP-----EFQGNPFGPPHSSPL----PYKISTSQ-DFQDLDTSQISD  984
             P   R        VP     +F  NPF    SSPL    P ++S  + +++D  +     
Sbjct  224   PGHYR------IRVPVLSGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWEDCSS-----  272

Query  985   EYRFSTAQTTPRFA------NVRGSNNPITLSKSMFMEPY---FRNYEGYPKYMASTQSF  1137
               +F TAQ+TPR+A      NV  S   +       ++ +   F + E +  +   T SF
Sbjct  273   --KFPTAQSTPRYAGGSPARNVCCSGGGVEAEADAEVDAHQLCFLSGEFHSNFTTDTTSF  330

Query  1138  MSKLRSQSAPKQRPEL  1185
               +LRS SAP+QRP +
Sbjct  331   RGRLRSHSAPRQRPGI  346



>ref|XP_002439404.1| hypothetical protein SORBIDRAFT_09g005870 [Sorghum bicolor]
 gb|EES17834.1| hypothetical protein SORBIDRAFT_09g005870 [Sorghum bicolor]
Length=493

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 133/330 (40%), Positives = 188/330 (57%), Gaps = 60/330 (18%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             ++IQ AFRG+LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SMQAL+RAQA V A+++
Sbjct  154   VRIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQALVRAQAAVRARRA  213

Query  676   RPSIINH-------------PQKSIDKN--KEARSENITSVHSGRYF-ASLGSEN----D  795
               + ++              P+ S+ +    + RSE+  + +S R   AS+ S +    D
Sbjct  214   AAAALSQSHLHHHHHPPPVRPRYSLQERYADDTRSEHGVAAYSSRRLSASVESSSYGGYD  273

Query  796   VITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFG--------PPHSSPLPYKIS----  939
                K+VE+D       S  SRR+ + + +  G   G        P  SSPLP  +S    
Sbjct  274   RSPKIVEVDPGRPKSRSSSSRRASSPLLDAAGGSSGGEDWCAANPASSSPLPCYLSAAGG  333

Query  940   -------TSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY  1098
                    TS+ F D D   + ++ R +TAQ+TPR+        P T +KS+       + 
Sbjct  334   PPRIAVPTSRQFPDYDWCAL-EKARPATAQSTPRYL------LPATPTKSVAGNSP--SL  384

Query  1099  EGYPKYMASTQSFMSKLRSQSAPKQRPEL------GPGPRRKRVSLNEMM---ESRASQS  1251
              G P YM+STQ+  +K+RSQSAPKQRPEL      G G  RKRV L+E++    SRAS S
Sbjct  385   HGCPNYMSSTQASEAKVRSQSAPKQRPELACCAGGGGGGARKRVPLSEVVVVESSRASLS  444

Query  1252  G-VRMQKSC--SHAQEVMNFKSAVIGRLGR  1332
             G V MQ+ C  + AQE  +F++AV+GR+ R
Sbjct  445   GVVGMQRGCGGARAQEAFSFRAAVVGRMDR  474



>ref|XP_002517079.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF45242.1| calmodulin binding protein, putative [Ricinus communis]
Length=455

 Score =   143 bits (361),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 115/309 (37%), Positives = 163/309 (53%), Gaps = 42/309 (14%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQA FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ TL  MQAL+ AQA  
Sbjct  132   EEVAAIKIQAFFRSYLARKALCALKGLVKLQALVRGHLVRKQATTTLRCMQALVTAQARA  191

Query  661   LAQKSRPSIINHP---QKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSV  831
              AQ+ R +   +P   ++SI +    RS          Y    G E ++  K+VEMD   
Sbjct  192   RAQRIRMAEDGNPATQKQSIHR----RSTQDNRFRHSNYDIDGGMEENI--KIVEMDLGQ  245

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQIS----------  981
             + K   KSR S +  P+ +       H     Y  S+++ +   D SQ+S          
Sbjct  246   S-KGITKSRNSYSNNPQTE-------HRISTHY-ASSNRGYYMPDDSQVSPAPSALTEMS  296

Query  982   --------DEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSF  1137
                     ++Y F+TAQ++P++ +     +P +  +  + E    +Y  +P YMA+T+S 
Sbjct  297   PRACSGHFEDYSFNTAQSSPQYYSAVTKPDPFSFPRPEYAESLSYDYPLFPNYMANTESS  356

Query  1138  MSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH-AQEVMNFKSA  1311
              +K+RSQSAPKQRPE     P R+R S+    E R     +RMQ+S SH      N++  
Sbjct  357   RAKVRSQSAPKQRPEAFERQPSRRRPSV----EGRNVPRAMRMQRSSSHVGATAQNYQHP  412

Query  1312  VIGRLGRCT  1338
                +L R T
Sbjct  413   WSIKLDRST  421



>emb|CDY47784.1| BnaC07g41760D [Brassica napus]
Length=388

 Score =   142 bits (358),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 160/429 (37%), Positives = 211/429 (49%), Gaps = 80/429 (19%)
 Frame = +1

Query  148   MGKVIKWLKGLFt------trqsnggrsgsggataatgLCHnpttippnitpAEAAWLSS  309
             MG+  +W  GLF       +            + A   LC +  TIPPNI+  EAAWL S
Sbjct  1     MGRATRWFMGLFGIKPSSCSGSGTISNRIDRSSLAGVSLCDSYETIPPNISEREAAWLRS  60

Query  310   FYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC---R  480
             FY  +G EE    A     AA  AAA  A  AA  AAAAVVR+  R +G+ GPL     R
Sbjct  61    FY-KAGEEEIERRAHAVAVAAATAAAADAAVAAAKAAAAVVRL--RGQGKSGPLGVGNSR  117

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA++IQ  FRGYLARKALR LKG+VKIQAL+RG+LVRKQA+ATL SM+AL+RAQATV
Sbjct  118   ENRAAMQIQCTFRGYLARKALRALKGVVKIQALVRGFLVRKQAAATLRSMEALVRAQATV  177

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVT  834
               Q++         + +     AR        + R+  SL + N  +   K+VE+DT + 
Sbjct  178   KFQRA--------LRRMGNTAPARKS------TERFSGSLDNRNNGEETAKIVEVDTGIR  223

Query  835   PKASRKSRRSKTWVP-----EFQGNPFGPPHSSPL-----PYKISTSQDFQDLDTSQISD  984
             P   R        VP     +F  NPF    SSPL     P  +    +++D  +     
Sbjct  224   PGHYR------IRVPVLSGSDFLDNPFRRTLSSPLSGRVPPRLLMPKPEWEDCSS-----  272

Query  985   EYRFSTAQTTPRFANVRGSNNPITLSKSMFM---------EPYFRNYEGYPKYMASTQSF  1137
               +F TAQ+TPR+A    + N       +           +  F + E +  + A T SF
Sbjct  273   --KFPTAQSTPRYAGGSPARNICCYGGGVEAEAEAEVDAHQLCFLSGEFHSNFTADTTSF  330

Query  1138  MSKLRSQSAPKQRPEL---GPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFK  1305
                +RS SAP+QRP +   G G RR          S     GVR Q+ SCS  +E     
Sbjct  331   RGGMRSHSAPRQRPGINAAGSGWRR----------SVGGNGGVRGQRPSCSGVRE-----  375

Query  1306  SAVIGRLGR  1332
              AV+G + R
Sbjct  376   -AVVGNIER  383



>ref|XP_009407024.1| PREDICTED: protein IQ-DOMAIN 14-like [Musa acuminata subsp. malaccensis]
Length=397

 Score =   142 bits (358),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 134/355 (38%), Positives = 178/355 (50%), Gaps = 40/355 (11%)
 Frame = +1

Query  289   EAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGP  468
             EAAWL SFY  +  EE S HA     A  AAA  AA AA  A      R+    R    P
Sbjct  58    EAAWLRSFYDDT--EEESKHAMAVAVATVAAANVAATAAQAAMV----RLKGLGREGATP  111

Query  469   LFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRA  648
                 + WAA+KIQ AFR +LA+KALR LKGLVK+QAL+RG LVRKQA+ TL  +QAL+RA
Sbjct  112   CTSYQWWAAVKIQTAFRCHLAKKALRALKGLVKLQALVRGCLVRKQAAITLRRLQALVRA  171

Query  649   QATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN----DVITKVVE  816
             QA V  +++R  ++ H  +  D     R+      + G     +G E     D   K++E
Sbjct  172   QAVVRPREAR--VLPHQSRRFDAEFCHRTSFERFDNRGDRCRHIGLEQSNDLDASPKILE  229

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRF  996
             MDT      S+  RR+ +   E        P SSPLP+K+ +            S   + 
Sbjct  230   MDTFQL--RSKSFRRTSSNFDESMV-----PISSPLPFKVPSRLSISSCRNPDKSPNSK-  281

Query  997   STAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY---EGYPKYMASTQSFMSKLRSQSAP  1167
              TAQ TPR         P T ++S   +   R        P YMA+T SF +K+R QS P
Sbjct  282   -TAQNTPRL-------RPETPARSTTADMVPRQTPSPSSCPNYMANTSSFAAKVRPQSTP  333

Query  1168  KQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGR  1332
             KQRPE    PR+K+V  +E  ESR ++S +R       A    N  +  +G+L R
Sbjct  334   KQRPEKAASPRKKKVLASE-TESR-TRSPLR-------AHNAYNLYNGTVGKLDR  379



>ref|XP_004170997.1| PREDICTED: uncharacterized protein LOC101230453 [Cucumis sativus]
Length=364

 Score =   141 bits (356),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 116/277 (42%), Positives = 150/277 (54%), Gaps = 41/277 (15%)
 Frame = +1

Query  457   RGGPLF--CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RG  L    +E    +KIQ+ FRG+LARKALR L+GLVK+QAL+RG+LVRK+A+ATL SM
Sbjct  115   RGSALLNGGKEIMGVVKIQSVFRGFLARKALRALRGLVKLQALVRGFLVRKRAAATLQSM  174

Query  631   QALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             QAL+RAQ TV +Q++R    N   KS     E   EN           SL S+     K+
Sbjct  175   QALIRAQTTVRSQRARRRSYNKENKS---QPEKSPEN--------DIRSLYSDETEHPKI  223

Query  811   VEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEY  990
             VEMDT      SR SRR  + V E      G    SP  + +       D+D     D  
Sbjct  224   VEMDTMFKRPKSR-SRRFNSLVSE-----LGEERPSPYLWTM-------DVD----GDGA  266

Query  991   RFSTAQTTPRFANVRGSNNPITLSKSM-FMEPYFRNYEGYPKYMASTQSFMSKLRSQSAP  1167
               +  +  P  A         T  +S+     Y      YP YMAST+S  +KLRS+SAP
Sbjct  267   EHAKRREVPVGAVA-------TPGRSVYGEGYYRGYGNYYPNYMASTKSSKAKLRSRSAP  319

Query  1168  KQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
             KQRPE+     +KRV+LNE+M +R S S VRMQ+SC+
Sbjct  320   KQRPEIWT---KKRVALNEIMGARNSISSVRMQRSCN  353



>ref|XP_008344115.1| PREDICTED: protein IQ-DOMAIN 1-like [Malus domestica]
Length=284

 Score =   139 bits (349),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 128/285 (45%), Positives = 160/285 (56%), Gaps = 38/285 (13%)
 Frame = +1

Query  148  MGKVIKWLKGLFttrqsnggrsgsgga---------------taatgLCHnpttippnit  282
            MG+  +WLKGLF  +  +  +  +  +                AAT LCHNP TIPPNI+
Sbjct  1    MGRATRWLKGLFGIKTKDKYQKPNSTSGDFKHKKGSSFGREDAAATLLCHNPATIPPNIS  60

Query  283  pAEAAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGR-  459
            P+EAAWL S+Y  +   E   +      AA  AAA  A  AA  AA  VVR+ S  RG  
Sbjct  61   PSEAAWLRSYYTET---EQEQNKHAIAVAAATAAAADAAVAAANAAVEVVRLTSHGRGTM  117

Query  460  -GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             GG    RERWAA+K+Q  FRGYLARKALR LKGLVK+QAL+RGYLVRKQ +ATL SMQA
Sbjct  118  FGGG---RERWAAVKVQTCFRGYLARKALRALKGLVKLQALVRGYLVRKQXTATLKSMQA  174

Query  637  LMRAQATVLAQKSR--------PSIINHPQKSIDKNKEARSENITSVHSGRYFAS-LGSE  789
            L+RAQATV + K+R               +KS+++   +RSE     HS R  AS LG  
Sbjct  175  LIRAQATVRSHKNRRLFGIESNNRFEIRARKSMERFDGSRSEQTAPSHSRRLSASXLGDS  234

Query  790  N----DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPH  912
            N    D   K+VE+DT   PK+  +SRR+ T   +  G      H
Sbjct  235  NFNNTDENPKIVEVDTGSRPKS--RSRRTNTCSDDLHGTEHAAVH  277



>ref|XP_002314666.2| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEF00837.2| calmodulin-binding family protein [Populus trichocarpa]
Length=430

 Score =   140 bits (354),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 108/280 (39%), Positives = 154/280 (55%), Gaps = 26/280 (9%)
 Frame = +1

Query  493   AIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK  672
             AIKIQ+ FR YLARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  Q    AQ+
Sbjct  106   AIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALVNVQTRARAQR  165

Query  673   SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASRK  852
                +   +P +    ++++  EN    H+      +  EN    K+VEMD   + K S K
Sbjct  166   IWMNEDVNPSQRQSIHRKSTQENRIR-HTNYENERVMDEN---IKIVEMDVGES-KGSIK  220

Query  853   SRRSKTWVPEFQ------GNPFGPPHSSPLP--YKISTS----QDFQDLDTSQISDEYRF  996
             SR S +  P+             P H+ P    Y+IS +     D     +S   ++Y F
Sbjct  221   SRNSYSHHPQTDRAEHRFSTHSAPNHAYPKQENYQISPAPSALTDMSPRASSGHFEDYSF  280

Query  997   STAQTTPRFANVRGSNNPITL----SKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSA  1164
             STAQ++P++ +     +P T+     +  + E    +Y  +P YMA+T+S  +K+RS SA
Sbjct  281   STAQSSPQYYSTVSKPDPSTIPFAFPRPEYAESLTYDYSLFPNYMANTESSRAKVRSHSA  340

Query  1165  PKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             PKQRP+     P R++VS+    E R     VRMQ+S SH
Sbjct  341   PKQRPDSFERQPNRRKVSI----EGRNVPRAVRMQRSSSH  376



>ref|XP_010526431.1| PREDICTED: protein IQ-DOMAIN 14 [Tarenaya hassleriana]
Length=360

 Score =   138 bits (348),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 159/414 (38%), Positives = 205/414 (50%), Gaps = 78/414 (19%)
 Frame = +1

Query  148   MGKVIKWLKGLFt---trqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYG  318
             MGK  +W K LF    +  S   +  S     A  LC N TTIPPNI+ +EAAWL SFY 
Sbjct  1     MGKATRWFKVLFGFRPSSSSGDRQRRSPAGETAGLLCDNYTTIPPNISESEAAWLRSFYV  60

Query  319   PSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFCRERWAAI  498
                 E+H+   A A AAA  AA  AA AAA        R+ S      GPL  +   AA 
Sbjct  61    AGEAEKHAVAVAAATAAAADAAVAAAKAAAAVV-----RLTS------GPLGGKR--AAT  107

Query  499   KIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS-  675
             +IQ AFRGYLARKALR L+G+VKIQAL+RGYLVR+QA+ TL SM+AL+RAQATV   ++ 
Sbjct  108   RIQCAFRGYLARKALRALRGVVKIQALVRGYLVRRQAAETLRSMEALVRAQATVKFHRAL  167

Query  676   -RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASRK  852
              R      P+KS            T + SG  +    +  +   K+VE+DT  T    +K
Sbjct  168   RRSGYSGSPRKS------------TEMFSG--YLENRNNGEETAKIVEVDTGGTRPGIQK  213

Query  853   SRRSKTWVPEFQGNPFGPPHSSPLPYKIS---TSQDFQDLDTSQISDEYRFSTAQTTPRF  1023
             +RR  +       +PF    SSPL  +I    +S    D       D+ +F TAQ+TPRF
Sbjct  214   TRRPVSTGSVLIDDPFRRTFSSPLSGRIPPRLSSMPKPDW------DDTKFPTAQSTPRF  267

Query  1024  A----------NVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQ  1173
             A          +V G   P    +  F    F      P Y A  +SF +K RSQSAP+Q
Sbjct  268   AGGSPSRSSCFSVSGVGTPEVDHRCFFSSGDFN-----PIYTADKKSFRAKQRSQSAPRQ  322

Query  1174  RPELGPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSAVIGRLGR  1332
             R E         V +       A   GV + + SCS  +E      AVIG++ R
Sbjct  323   RSEA--------VKV-------AGGGGVPVHRPSCSGVRE------AVIGKIDR  355



>ref|NP_175608.1| IQ-domain 27 protein [Arabidopsis thaliana]
 gb|AAD12670.1| Similar to gb|X74772 SF16 protein from Helianthus annuus and 
contains calmodulin-binding motif PF|00612 [Arabidopsis thaliana]
 gb|AAY78649.1| calmodulin-binding family protein [Arabidopsis thaliana]
 gb|AEE32739.1| IQ-domain 27 protein [Arabidopsis thaliana]
Length=351

 Score =   137 bits (346),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 104/288 (36%), Positives = 155/288 (54%), Gaps = 57/288 (20%)
 Frame = +1

Query  454   GRGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHS  627
             GR G +     ERWAA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+A L S
Sbjct  88    GRAGDIIITKEERWAAVKIQKVFRGSLARKALRALKGIVKLQALVRGYLVRKRAAAMLQS  147

Query  628   MQALMRAQATVLAQKSRPSI------INHPQKSIDKNKEARSENITSVHSGRYFASLGSE  789
             +Q L+R Q  + +++   S+      +  P++S DK  EA                  + 
Sbjct  148   IQTLIRVQTAMRSKRINRSLNKEYNNMFQPRQSFDKFDEA------------------TF  189

Query  790   NDVITKVVEMDTSVTPKASRKSRRSKTW----VPEFQGNPFGPPHSSPLPYKISTSQDFQ  957
             +D  TK+VE D     ++S +SR  +      + +++G+           YK +      
Sbjct  190   DDRRTKIVEKDDRYMRRSSSRSRSRQVHNVVSMSDYEGD---------FVYKGN------  234

Query  958   DLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKS---MFMEPYFRNYE---GYPKYM  1119
             DL+     ++++F+TAQ TPR  +   +NN   + +S           +YE     P YM
Sbjct  235   DLELCFSDEKWKFATAQNTPRLLHHHSANNRYYVMQSPAKSVGGKALCDYESSVSTPGYM  294

Query  1120  ASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
               T+SF +K+RS SAP+QR E      R+R+SL+E+M S++S SGV M
Sbjct  295   EKTKSFKAKVRSHSAPRQRSE------RQRLSLDEVMASKSSVSGVSM  336



>ref|XP_010694040.1| PREDICTED: protein IQ-DOMAIN 32 [Beta vulgaris subsp. vulgaris]
Length=474

 Score =   139 bits (350),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 114/319 (36%), Positives = 156/319 (49%), Gaps = 62/319 (19%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQ+ FR YLARKAL+ L+GLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  150   EEAAAVKIQSMFRSYLARKALKALRGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  209

Query  661   LAQKSR----PSIINHPQKSIDKNKEAR--------SEN--ITSVHSGRYFASLGSE---  789
              AQ+ R     SIINH Q +  +N + +         EN  I  +  G + +++ S    
Sbjct  210   RAQRIRSADDESIINHRQSTHRRNSQEKIKHAYHDMEENVKIVEMDEGEFGSNVNSRSSY  269

Query  790   --------NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTS  945
                     ND       MD  ++   S +   SK    ++          SP P  I+  
Sbjct  270   SIPSPRHMND------RMDNRISVYYSSQRENSKQDYQQY----------SPAPSAIT--  311

Query  946   QDFQDLDTSQISDEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPK  1113
              D      S   +EY F+TAQ++P+     +    S  P +     + E     +  YP 
Sbjct  312   -DLSPRTCSGHFEEYSFATAQSSPQCYTAMSRPDPSRAPFSFPNPDYAETMSYEFPFYPN  370

Query  1114  YMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEV  1293
             YMA+TQS  +K RSQSAPKQRPEL   P R R      +E R    G +MQ+S S     
Sbjct  371   YMANTQSSRAKARSQSAPKQRPELERQPSRGR---RPSVEGRNIPKGAKMQRSSSQ----  423

Query  1294  MNFKSAVIGRLGRCTDYPY  1350
                    +G  G+   YP+
Sbjct  424   -------VGSTGQNYHYPW  435



>ref|XP_010433130.1| PREDICTED: uncharacterized protein LOC104717283 [Camelina sativa]
Length=387

 Score =   137 bits (346),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 148/361 (41%), Positives = 191/361 (53%), Gaps = 36/361 (10%)
 Frame = +1

Query  148   MGKVIKWLKGLFtt--rqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYGP  321
             MG+  +W KGLF       +G  +G+        LC N  TIPPNI+  EAAWL SFY  
Sbjct  1     MGRASRWFKGLFGIKPSSCSGSDTGAISNRLDRSLCDNYETIPPNISEKEAAWLRSFYA-  59

Query  322   SGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC---RERWA  492
             +G EE          AA  AAA  A  AA  AAAAVVR+  + +           RE  A
Sbjct  60    AGEEEKERRTHAIAVAAATAAAADAAVAAAKAAAAVVRLQGQGKSGPLGGGGGKSRENRA  119

Query  493   AIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK  672
             A++IQ AFRG+LARKALR L+G+VKIQAL+RGYLVRKQA+ATL SM+AL+RAQATV  Q+
Sbjct  120   AMQIQCAFRGFLARKALRALRGVVKIQALVRGYLVRKQAAATLRSMEALIRAQATVKFQR  179

Query  673   SRPSIINH--PQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTPK  840
             +   I N    +KS +                R+  SL S N  +   K+VE+DT  T  
Sbjct  180   ALRRIGNAAPARKSTE----------------RFSGSLESRNNGEETAKIVEVDTG-TRH  222

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
              + + R       +F  NPF    SSPL  ++         +  + S   +F TAQ+TPR
Sbjct  223   GTFRIRGPVLSGSDFLDNPFRRTLSSPLSGRVPPRLSMPKPEWDECSS--KFPTAQSTPR  280

Query  1021  FA------NVRGSNNPITLSKSMFMEPYFRNYEGYPKYMA-STQSFMSKLRSQSAPKQRP  1179
             FA      +V  S      +++      F + E    YMA ST SF SKLRS SAP+QRP
Sbjct  281   FAGGSPARSVCCSGGAEVDAEADAHRFCFLSGEFNSGYMADSTTSFRSKLRSHSAPRQRP  340

Query  1180  E  1182
             +
Sbjct  341   D  341



>ref|XP_003564676.1| PREDICTED: uncharacterized protein LOC100844448 [Brachypodium 
distachyon]
Length=493

 Score =   138 bits (347),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 133/331 (40%), Positives = 177/331 (53%), Gaps = 57/331 (17%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             ++IQ AFRGYLA+KALR LK LVK+QAL+RGYLVRKQA+ATL SMQAL+RAQA + A   
Sbjct  154   VRIQTAFRGYLAKKALRALKALVKLQALVRGYLVRKQAAATLQSMQALVRAQAAIRAAAR  213

Query  676   ----------RPSIINHPQKSIDKNKEARSENITSV----HSGRYFASLGSEN---DVIT  804
                        P  +  P+ S+   ++ RSE+ + V    +S R  AS+ S +   D   
Sbjct  214   NRAADLRLHLHPLTVRPPRYSL--QEDTRSEHGSGVAPYYYSRRLSASVESSSYGYDRSP  271

Query  805   KVVEMDTSVTPKASRKSRRSKTWVPEFQG----------NPFGP-PHSSPL-PYKISTSQ  948
             K+VEMDT     A  KSR S   V E  G          +P  P  H  P  P +I+   
Sbjct  272   KIVEMDT-----ARPKSRSSSLPVAEPGGGDDYGYYSVSSPLMPCGHGLPCAPPRIAAPS  326

Query  949   DFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRN------YEGYP  1110
                 L      ++ R +TAQ+TPR+A+      P+T +KS+     + N        G  
Sbjct  327   RGFFLPEYYEREKPRPATAQSTPRYASSL-YYTPVTPAKSVCGVGGYSNNSPSTLLSGPR  385

Query  1111  KYMASTQSFMSKLRSQSAPKQRPELGPG-PRRKRVSLNE-MMESRASQSGVRMQ---KSC  1275
              YM+STQS  +K RSQSAPKQRPE G   P RKRV L E ++E+RAS SG   +    SC
Sbjct  386   SYMSSTQSSDAKTRSQSAPKQRPEEGGAVPPRKRVPLREVVLEARASLSGATQRYYASSC  445

Query  1276  SH---------AQEVMNFKSAVIGRLGRCTD  1341
             ++         A E  +FK AV+ R  R ++
Sbjct  446   NNSNNRPPREEAGEKFSFKKAVVSRFDRSSE  476



>ref|XP_011030639.1| PREDICTED: protein IQ-DOMAIN 14-like [Populus euphratica]
Length=430

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 151/283 (53%), Gaps = 32/283 (11%)
 Frame = +1

Query  493   AIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQK  672
             AIKIQ+ FR YLARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  Q    AQ+
Sbjct  106   AIKIQSVFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALVNVQTRARAQR  165

Query  673   SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASRK  852
                +   +P +    ++++  EN    H+      +  EN    K+VEMD   + K S K
Sbjct  166   IWMNEDVNPSQRQSIHRKSTQENRIR-HTNYENERVMEEN---IKIVEMDVGES-KGSIK  220

Query  853   SRRSKTWVPEFQ------GNPFGPPHS---------SPLPYKISTSQDFQDLDTSQISDE  987
             SR S +  P+             P H+         SP P  ++   D      S   ++
Sbjct  221   SRNSYSHHPQADRAEHRFSTHSAPNHAYSRQENYQVSPAPSALT---DMSPRACSGHFED  277

Query  988   YRFSTAQTTPRF----ANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRS  1155
             Y FSTAQ++P++    + +  S  P    +  + E    +Y  +P YMA+T+S  +K+RS
Sbjct  278   YSFSTAQSSPQYYSTVSKLDPSIIPFAFPRPEYAESLSYDYPFFPNYMANTESSRAKVRS  337

Query  1156  QSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              SAPKQRP+     P R++VS+    E R     VRMQ+S SH
Sbjct  338   HSAPKQRPDSFERQPSRRKVSI----EGRNVPRAVRMQRSSSH  376



>ref|XP_010500790.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=355

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 103/290 (36%), Positives = 157/290 (54%), Gaps = 44/290 (15%)
 Frame = +1

Query  454   GRGGPLFCR-ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GR G +  + +RWAA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+A L S+
Sbjct  93    GRAGDIITKKDRWAAVKIQKVFRGSLARKALRALKGIVKLQALVRGYLVRKRAAAMLQSI  152

Query  631   QALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             Q L+R Q  + +++    +      ++ + +++  E          F   G  +    K+
Sbjct  153   QTLIRVQTAMRSKRINRCLNKEDSNNMFQPRQSLLEK---------FDEAGERS---PKI  200

Query  811   VEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEY  990
             VE+D +      R S RSK+   +         +     YK +      DL+ S   ++ 
Sbjct  201   VEIDDTY---KRRTSSRSKS--KQVHNVGAMSEYEDDFVYKEN------DLELSFSDEKL  249

Query  991   RFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY---EG----YPKYMASTQSFMSKL  1149
             +F++AQ TPRF+    +NN   + +S   +   RN    +G     P YM  T+SF +K+
Sbjct  250   KFASAQNTPRFSRHHTANNCYYVMQSS-GKSVCRNVLCDDGGSLSTPGYMEKTKSFKAKV  308

Query  1150  RSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK------SCSH  1281
             RS SAP+QR E      RKR+SL+E+M S++S +GV M +      SCS+
Sbjct  309   RSHSAPRQRTE------RKRLSLDEVMASKSSVTGVNMLQQQPPRYSCSY  352



>ref|XP_002891673.1| IQ-domain 27 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67932.1| IQ-domain 27 [Arabidopsis lyrata subsp. lyrata]
Length=345

 Score =   135 bits (339),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 107/295 (36%), Positives = 156/295 (53%), Gaps = 58/295 (20%)
 Frame = +1

Query  460   GGPLFCRE-RWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
              G L  RE RWAA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+A L  +Q 
Sbjct  85    AGDLITREERWAAVKIQKVFRGSLARKALRALKGIVKLQALVRGYLVRKRAAAMLQRIQT  144

Query  637   LMRAQATVLAQKSRPSIIN-------HPQKSIDKNKEARSENITSVHSGRYFASLGSEND  795
             L+R Q T +  K     +N        P++S+DK  +A                  + ++
Sbjct  145   LIRVQ-TAMRSKRINRCLNKEYNNTFQPRQSLDKFDDA------------------ACDE  185

Query  796   VITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQ  975
                K+VEMD     ++S +S+  +              +     YK +      DL+ S 
Sbjct  186   RRPKIVEMDDIYMRRSSSRSKSRQV-----HNIVAMSDYEDDFVYKAN------DLELSF  234

Query  976   ISDEYRFSTAQTTPRFANVRGSNNPITLSKS-------MFMEPYFRNYEGYPKYMASTQS  1134
               ++++F+TAQ TPRF++   +NN   + +S         +  Y R+    P YM  T+S
Sbjct  235   SDEKWKFATAQNTPRFSHHHSANNRYYVMQSPAKSVCGNTLCDYGRSVST-PGYMEKTKS  293

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK------SCSH  1281
             F +K+RS SAP+QR E      RKR+SL+E+M S++S SGV M +      SCS+
Sbjct  294   FKAKVRSHSAPRQRSE------RKRLSLDEVMASKSSVSGVSMLQQLPPRYSCSY  342



>ref|XP_010447885.1| PREDICTED: uncharacterized protein LOC104730422 [Camelina sativa]
Length=393

 Score =   135 bits (340),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 162/427 (38%), Positives = 211/427 (49%), Gaps = 72/427 (17%)
 Frame = +1

Query  148   MGKVIKWLKGLFtt--rqsnggrsgsggataatgLCHnpttippnitpAEAAWLSSFYGP  321
             MG+  +W KGLF       +G  +G+        LC N  TIPPNI+  EAAWL SFY  
Sbjct  1     MGRASRWFKGLFGIKPSSCSGSDTGAISNRLDRSLCDNYETIPPNISEKEAAWLRSFYA-  59

Query  322   SGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPLFC----RERW  489
             +G EE          AA  AAA  A  AA  AAAAVVR+  + +            RE  
Sbjct  60    AGEEEKERRTHAIAVAAATAAAADAAVAAAKAAAAVVRLQGQGKSGPLGGGGGGKSRENR  119

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AA++IQ AFRG+LARKALR L+G+VKIQAL+RGYLVRKQA+ATL SM+AL+RAQATV  Q
Sbjct  120   AAMQIQCAFRGFLARKALRALRGVVKIQALVRGYLVRKQAAATLRSMEALIRAQATVKFQ  179

Query  670   KSRPSIINH--PQKSIDKNKEARSENITSVHSGRYFASLGSEN--DVITKVVEMDTSVTP  837
             ++   I N    +KS +                R+  SL + N  +   K+VE+DT   P
Sbjct  180   RALRRIGNAAPARKSTE----------------RFSGSLENRNNGEETAKIVEVDTGTRP  223

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTP  1017
               + K R       +F  NPF    SSPL  ++         +  + S   +F TAQ+TP
Sbjct  224   -GTFKIRGPVLSGSDFIDNPFRRTLSSPLSGRVPPRLSMPKPEWDECSS--KFPTAQSTP  280

Query  1018  RFANVRGS-----------------NNPITLSKSMFMEPYFRNYEGYPKYMA-STQSFMS  1143
             RFA   GS                 +      +  F+   F +      YMA ST SF S
Sbjct  281   RFAG--GSPARSVCCSGGGRAEAEVDAEADAHRFCFLSGEFNSG----TYMADSTTSFRS  334

Query  1144  KLRSQSAPKQRPE---LGPGPRRKRVSLNEMMESRASQSGVRMQK-SCSHAQEVMNFKSA  1311
             KLRS SAP+QRP+   +  G  R+ +              VRMQ+ SCS  +E      A
Sbjct  335   KLRSHSAPRQRPDSNAVSGGGWRRSIGGGSGG--------VRMQRPSCSGVRE------A  380

Query  1312  VIGRLGR  1332
             V+G + R
Sbjct  381   VVGNIER  387



>ref|XP_006489449.1| PREDICTED: protein IQ-DOMAIN 14-like [Citrus sinensis]
Length=466

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 165/310 (53%), Gaps = 46/310 (15%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ +   GR   +   E  +AIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+
Sbjct  122   RLTASASGRASVI---EDASAIKIQSIFRAYLARKALCALKGLVKLQALVRGHLVRKQAT  178

Query  613   ATLHSMQALMRAQATVLAQK------SRPSIINHPQKSIDKNKEARSENITSVHSGRYFA  774
             ATL  MQAL+ AQA   AQ+      ++P +  +P++SI + K  +       HS  Y  
Sbjct  179   ATLRCMQALVTAQARARAQRLRVTDETKPPV--NPRQSIHR-KSTQENRFRHGHSEIY--  233

Query  775   SLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVP--EFQGNPFGPPHSSPLPYKISTSQ  948
               G E ++  K+VEMD   + K S KSR S    P  E   + F   +SS   Y   ++Q
Sbjct  234   -RGMEENI--KIVEMDHGES-KGSTKSRNSYASHPLSERAEHRFSAYYSSNHVY---SNQ  286

Query  949   DFQDLD--TSQISD-----------EYRFSTAQTTPRFANVRG----SNNPITLSKSMFM  1077
             D  ++    S ++D           +Y +STAQ++P++ +       S  P    +  + 
Sbjct  287   DNHEVSPAPSALTDMSPRACSGHFEDYSYSTAQSSPQYYSAVSKPDPSKVPFAFPRPDYA  346

Query  1078  EPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP--ELGPGPRRKRVSLNEMMESRASQS  1251
             E    +Y  +P YMA+T+S  +K+RSQSAPK RP       P R R S    ME R    
Sbjct  347   ESLSYDYPLFPNYMANTESSRAKVRSQSAPKSRPADTFERQPSRSRAS----MEGRNIPR  402

Query  1252  GVRMQKSCSH  1281
              VRMQ+S SH
Sbjct  403   AVRMQRSSSH  412



>ref|XP_010256160.1| PREDICTED: protein IQ-DOMAIN 14-like [Nelumbo nucifera]
Length=471

 Score =   136 bits (342),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 112/296 (38%), Positives = 151/296 (51%), Gaps = 48/296 (16%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQA FR YLARKALR LKGLVK+QAL+R +LVRKQA+ATL  MQAL+  QA  
Sbjct  141   EEAAAIKIQAVFRSYLARKALRALKGLVKLQALVRAHLVRKQATATLRCMQALVTVQARA  200

Query  661   LAQKSR--------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVE  816
              AQ+ R        P     P+KS+  N+  ++ N             G E ++  K+VE
Sbjct  201   RAQRIRMAEEAQSTPQRQFTPRKSLQDNRFRQAYNEM---------DRGIEENI--KIVE  249

Query  817   MDTSVTPKASRKSRRSKTWVPE-----------FQGNPFGPPHS-----SPLPYKISTSQ  948
             MD   + +AS KSR   +  P+           + GN            SP P  ++   
Sbjct  250   MDIGES-RASSKSRNGYSNHPQIERADQRFSIYYAGNRANAKQEHQLQMSPAPSALT---  305

Query  949   DFQDLDTSQISDEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKY  1116
             D      S   +EY F T Q++P+     A    +  P    +S + +    +Y  +P Y
Sbjct  306   DMSPRVCSGHFEEYSFLTTQSSPQCYSAVAKPDPTMAPFAFPRSEYADSVSNDYPFFPHY  365

Query  1117  MASTQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             MA+T+S  +K+RSQSAPKQRP+     P R+R S    ME R     +RMQ+S SH
Sbjct  366   MANTESSKAKVRSQSAPKQRPDSYERQPSRRRAS----MEGRNIPRSIRMQRSSSH  417



>ref|XP_006420022.1| hypothetical protein CICLE_v10004919mg [Citrus clementina]
 gb|ESR33262.1| hypothetical protein CICLE_v10004919mg [Citrus clementina]
Length=466

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 118/310 (38%), Positives = 164/310 (53%), Gaps = 46/310 (15%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ +   GR   +   E  +AIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+
Sbjct  122   RLTASASGRASVI---EDASAIKIQSIFRAYLARKALCALKGLVKLQALVRGHLVRKQAT  178

Query  613   ATLHSMQALMRAQATVLAQK------SRPSIINHPQKSIDKNKEARSENITSVHSGRYFA  774
             ATL  MQAL+ AQA   AQ+      ++P +  +P++SI + K  +       HS  Y  
Sbjct  179   ATLRCMQALVTAQARARAQRLRVTDETKPPV--NPRQSIHR-KSTQENRFRHGHSEIY--  233

Query  775   SLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVP--EFQGNPFGPPHSSPLPYKISTSQ  948
               G E  +  K+VEMD   + K S KSR S    P  E   + F   +SS   Y   ++Q
Sbjct  234   -RGMEESI--KIVEMDHGES-KGSTKSRNSYASHPLSERAEHRFSAYYSSNHVY---SNQ  286

Query  949   DFQDLD--TSQISD-----------EYRFSTAQTTPRFANVRG----SNNPITLSKSMFM  1077
             D  ++    S ++D           +Y +STAQ++P++ +       S  P    +  + 
Sbjct  287   DNHEVSPAPSALTDMSPRACSGHFEDYSYSTAQSSPQYYSAVSKPDPSRVPFAFPRPDYA  346

Query  1078  EPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP--ELGPGPRRKRVSLNEMMESRASQS  1251
             E    +Y  +P YMA+T+S  +K+RSQSAPK RP       P R R S    ME R    
Sbjct  347   ESLSYDYPLFPNYMANTESSRAKVRSQSAPKSRPADTFERQPSRSRAS----MEGRNIPR  402

Query  1252  GVRMQKSCSH  1281
              VRMQ+S SH
Sbjct  403   AVRMQRSSSH  412



>ref|XP_006392975.1| hypothetical protein EUTSA_v10012305mg [Eutrema salsugineum]
 gb|ESQ30261.1| hypothetical protein EUTSA_v10012305mg [Eutrema salsugineum]
Length=350

 Score =   134 bits (336),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 102/278 (37%), Positives = 147/278 (53%), Gaps = 48/278 (17%)
 Frame = +1

Query  454   GRGGPLFCRE-RWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GR G +  RE R AA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+A L  +
Sbjct  94    GRPGVINTREERLAAVKIQKVFRGSLARKALRGLKGIVKLQALVRGYLVRKRAAAMLQKI  153

Query  631   QALMRAQATVLAQKSRPSI-----INHPQKSIDKNKEARSENITSVHSGRYFASLGSEND  795
             QAL+R Q T+ +++    +     +  P+ S DK  EA       ++  R          
Sbjct  154   QALIRVQTTMRSRRVNRCLNKEYKMVQPRDSFDKFDEA-------MYDARR---------  197

Query  796   VITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQ  975
                K+VEMD     ++  K   +   + E+ GN F         YK +      DL+ S 
Sbjct  198   --PKIVEMDDRYKRRSKFKEVHNVVAMSEY-GNDF--------VYKGN------DLELSF  240

Query  976   ISDEYRFSTAQTTPRFANV---RGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSK  1146
             + ++++F+TA  TPR ++       NN   ++KS+            P YM  TQSF + 
Sbjct  241   LEEKWKFATAHNTPRLSSSSHHHAGNNRYNVTKSVCGNALCEYGMSTPGYMEETQSFKAN  300

Query  1147  LRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVR  1260
             LRS SAP+QR E      RKR+SL++++  R+S S  R
Sbjct  301   LRSHSAPRQRSE------RKRLSLDDVIAFRSSVSDER  332



>ref|XP_010548880.1| PREDICTED: uncharacterized protein LOC104820211 [Tarenaya hassleriana]
Length=375

 Score =   134 bits (336),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 102/250 (41%), Positives = 136/250 (54%), Gaps = 42/250 (17%)
 Frame = +1

Query  454   GRGGPL--FCRERW-AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLH  624
             GR GPL    RE+  AA KIQ AFRGYLARKALR L+G+VKIQAL+RGYLVR+QA+ATL 
Sbjct  113   GRSGPLRRTGREKLLAATKIQCAFRGYLARKALRALRGVVKIQALVRGYLVRRQAAATLR  172

Query  625   SMQALMRAQATVLAQKS--RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN--  792
             SM+AL+RAQATV   +S  R      P+KS++K                +   L + N  
Sbjct  173   SMEALVRAQATVKLHRSIRRSGYAGPPRKSMEK----------------FSGCLENRNNG  216

Query  793   DVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTS  972
             +   K+VE+DT   P+ + K+RR  +   +   +PF    SSPL  +I         D  
Sbjct  217   EETAKIVEVDTGTRPR-TYKTRRPASNGSDLTDDPFRRTFSSPLSGRIPPRLSIPKPDWD  275

Query  973   QISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
               S   +F TAQ+TPR A   G +  I+   S+       +  G  ++        +KLR
Sbjct  276   DCSSCTKFPTAQSTPRIA---GGSPSISACFSV-------SSRGGGRW--------AKLR  317

Query  1153  SQSAPKQRPE  1182
             S SAP+QRPE
Sbjct  318   SHSAPRQRPE  327



>ref|XP_010092431.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXB51149.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=461

 Score =   134 bits (338),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 109/292 (37%), Positives = 148/292 (51%), Gaps = 38/292 (13%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  133   EEAAAIKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  192

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITS--VHSGRYFASLGSENDVITKVVEMDTSVT  834
              AQ+ R   +    K +        +++    +    +   +G E +V  K+VEMD   T
Sbjct  193   RAQRIR---VVDDTKPVSHRPSTHRKSVQDNWLRHPYHDIDIGMEENV--KIVEMDLGGT  247

Query  835   PKASRKSRRSKTWVPEFQG-----------------NPFGPPHSSPLPYKISTSQDFQDL  963
              K S KSR S +  P+ +                  N       SP P  ++   D    
Sbjct  248   -KGSSKSRNSYSIHPQTERTDCRLSTHRPTSRQENINNNSSCKVSPAPSALT---DMSPR  303

Query  964   DTSQISDEYRFSTAQTTPRFANVRG----SNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
               S   ++Y F TAQ++P++ +       S  P    +  + E    +   YP YMA+T+
Sbjct  304   ACSGHFEDYSFGTAQSSPQYCSAASKPDPSRLPFAFPRPDYAESLSYDCPLYPSYMANTE  363

Query  1132  SFMSKLRSQSAPKQRP--ELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             S  +K+RSQSAPKQRP       P R+R S+    E R     VRMQ+S SH
Sbjct  364   SSRAKVRSQSAPKQRPADSFERQPSRRRASI----EGRNVPRAVRMQRSSSH  411



>gb|KDO74471.1| hypothetical protein CISIN_1g012293mg [Citrus sinensis]
Length=466

 Score =   134 bits (337),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 114/294 (39%), Positives = 158/294 (54%), Gaps = 43/294 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  +AIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  135   EDASAIKIQSIFRAYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  194

Query  661   LAQK------SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMD  822
              AQ+      ++P +  +P++SI + K  +       HS  Y    G E ++  K+VEMD
Sbjct  195   RAQRLRVTDETKPPV--NPRQSIHR-KSTQENRFRHGHSEIY---RGMEENI--KIVEMD  246

Query  823   TSVTPKASRKSRRSKTWVP--EFQGNPFGPPHSSPLPYKISTSQDFQDLD--TSQISD--  984
                + K S KSR S    P  E   + F   +SS   Y   ++QD  ++    S ++D  
Sbjct  247   HGES-KGSTKSRNSYASHPLSERAEHRFSAYYSSNHVY---SNQDNHEVSPAPSALTDMS  302

Query  985   ---------EYRFSTAQTTPRFANVRG----SNNPITLSKSMFMEPYFRNYEGYPKYMAS  1125
                      +Y +STAQ++P++ +       S  P    +  + E    +Y  +P YMA+
Sbjct  303   PRACSGHFEDYSYSTAQSSPQYYSAVSKPDPSRVPFAFPRPDYAESLSYDYPLFPNYMAN  362

Query  1126  TQSFMSKLRSQSAPKQRP--ELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             T+S  +K+RSQSAPK RP       P R R      ME R     VRMQ+S SH
Sbjct  363   TESSRAKVRSQSAPKSRPADTFERQPSRSRA----YMEGRNIPRAVRMQRSSSH  412



>ref|XP_004496689.1| PREDICTED: protein IQ-DOMAIN 1-like [Cicer arietinum]
Length=459

 Score =   134 bits (337),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 107/279 (38%), Positives = 152/279 (54%), Gaps = 22/279 (8%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAI+IQ  FR +LARKAL  L+GLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  137   EDAAAIRIQCVFRSHLARKALCALRGLVKLQALIRGHLVRKQAKATLRCMQALVTAQARA  196

Query  661   LAQKSR-PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTP  837
              AQ+ +  S   H Q          ++    +++       G E+++  K+VEMD   + 
Sbjct  197   RAQRIQMMSEGKHNQNQPTHRNVMENDLFRQIYNE---MDRGMEDNI--KIVEMDVCES-  250

Query  838   KASRKSRRSKTWVPEFQGNPFGP--PHSSPLPYKISTS-QDFQDLDTSQISDEYR--FST  1002
             K +  SR S  +  E   + +     +S    YK+S +     +L     S  +   FST
Sbjct  251   KGNSTSRSSSVYHHEHSEHRYSTNGSYSKEENYKVSPAPSALTELSPKACSGHFEDCFST  310

Query  1003  AQTTPRF----ANVRGSNNPITLSKSMFMEPYFR-NYEGYPKYMASTQSFMSKLRSQSAP  1167
             AQ++P++    +    SN+P +     + EP    +Y  YP YMA+T+S  +K+RSQSAP
Sbjct  311   AQSSPQYYSAVSKTDDSNHPFSFPNPSYGEPIMSYDYPLYPNYMANTKSSSAKVRSQSAP  370

Query  1168  KQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             KQRP+     P R+RVS+    E R     VRMQ+S SH
Sbjct  371   KQRPDSFERQPSRRRVSV----EGRNVPRPVRMQRSSSH  405



>gb|KDP40224.1| hypothetical protein JCGZ_02222 [Jatropha curcas]
Length=453

 Score =   134 bits (337),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 114/318 (36%), Positives = 162/318 (51%), Gaps = 54/318 (17%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM------  642
             E  AAIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+      
Sbjct  124   EEAAAIKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTVQARA  183

Query  643   RAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGR-----YFASLGSENDVITK  807
             RAQ  ++A++++P+     ++SI K          S H  R     Y    G E ++  K
Sbjct  184   RAQRILMAEETKPA---SQRQSIHKK---------STHDNRFRHLNYDTDRGMEENI--K  229

Query  808   VVEMDTSVTPKASRKSRRSKTW--VPEFQGNPFGPPHS--------------SPLPYKIS  939
             +VEMD     K S KSR S +    PE++   F   +               SP P  ++
Sbjct  230   IVEMDLGQA-KGSTKSRNSYSHQPQPEYEDPRFSTYYESLNHVYSKPDKCQLSPAPSALT  288

Query  940   TSQDFQDLDTSQISDEYRFSTAQTTPRFANV---RGSNNPITLSKSMFMEPYFRNYEGYP  1110
                D      S   ++Y  +TA+++P ++ V     S  P    +  + E    +Y  +P
Sbjct  289   ---DMSPRGCSGHFEDYSLNTAESSPYYSAVSKPEPSRVPFAFPQPEYAESLSYDYPLFP  345

Query  1111  KYMASTQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHA-  1284
              YMA+T+S  +K+RS SAPKQRP+     P R+R S+    E R     +RMQ+S SH  
Sbjct  346   NYMANTESSRAKVRSHSAPKQRPDSFERQPSRRRASV----EGRNIPRAMRMQRSSSHVG  401

Query  1285  QEVMNFKSAVIGRLGRCT  1338
                 N++     +L R T
Sbjct  402   ATAQNYQYPWSTKLDRST  419



>ref|XP_010259131.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Nelumbo nucifera]
Length=473

 Score =   133 bits (334),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 106/293 (36%), Positives = 153/293 (52%), Gaps = 34/293 (12%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQA FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  M+AL+ AQA  
Sbjct  139   EEAAAIKIQAVFRSYLARKALSALKGLVKLQALVRGHLVRKQATATLRCMEALVTAQARA  198

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ+ R  +    Q +I +    R     S+   R+   +    +   K+VEMD      
Sbjct  199   RAQRIR--LAEEAQTTIQRQSIHRK----SLQDHRFRQEIDRGVEDTIKIVEMDLG----  248

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLP-YKISTSQDFQ-----------DLDTSQIS-  981
              SR S+    +    Q   F    S     +++++ Q++Q           D+     S 
Sbjct  249   ESRSSKSRNIYSTPPQTERFEQRLSMYYAGHRVNSKQEYQFQMSPAPSALTDMSPRACSG  308

Query  982   --DEYRFSTAQTTPR-FANVRGSNNPI---TLSKSMFMEPYFRNYEGYPKYMASTQSFMS  1143
               D+Y F T Q++P+ +  V   ++ +     S+S + +    +Y  +P YMA+T+S  +
Sbjct  309   HFDDYSFLTTQSSPQCYTAVTKPDSKMGSFAFSRSEYADSVSNDYPFFPHYMANTKSSRA  368

Query  1144  KLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             K+RSQSAPKQRP+     P R+R S+    E R      RMQ+S SH    +N
Sbjct  369   KVRSQSAPKQRPDSFERQPSRRRASI----EGRNIPRSTRMQRSSSHLGSNIN  417



>ref|XP_006574456.1| PREDICTED: uncharacterized protein LOC100810189 isoform X1 [Glycine 
max]
Length=417

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/286 (39%), Positives = 147/286 (51%), Gaps = 27/286 (9%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
             C E  AAIKIQ+ FR YLARKAL  L+GLVK+QAL+RG+LVRKQA  TL  MQAL+ AQ+
Sbjct  102   CVEEAAAIKIQSVFRSYLARKALYALRGLVKLQALVRGHLVRKQARETLRCMQALVIAQS  161

Query  655   TVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVT  834
                AQ++R        + +  N+    EN  S+H      +   EN +I   VEM    +
Sbjct  162   RARAQRARMVSDGKLDQKLSPNRITTEENF-SMHMYNEMHNGLEENAMI---VEMAVCES  217

Query  835   PKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI----------STSQDFQDLDTSQISD  984
                SR   R+ +   E   + F   +SS   Y            ST  +      S   +
Sbjct  218   KGNSRG--RNSSVNREPSDHRFSAYYSSNGSYSKEENYNASPAPSTLTELSPRACSGHFE  275

Query  985   EYRFSTAQTTP-RFANVRGSNNPIT-----LSKSMFMEPYFRNYEGYPKYMASTQSFMSK  1146
             E  FSTAQ++P  ++ V G +N IT          + EP   +Y  +P YMA+T+S  +K
Sbjct  276   ECSFSTAQSSPYYYSEVSGVDNTITKVPFAFPIPAYTEPMSYDYPLFPNYMANTKSSRAK  335

Query  1147  LRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              RSQSAPK RP+     P R+R S    ME R     VRMQ+S SH
Sbjct  336   ARSQSAPKSRPDSYERQPSRRRAS----MEGRNVPKPVRMQRSSSH  377



>ref|XP_009416470.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416471.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=413

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/367 (37%), Positives = 179/367 (49%), Gaps = 47/367 (13%)
 Frame = +1

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
             AAWLS+F+  S  EE + HA     A  AAA  A  AA  A      R+ S    R  P 
Sbjct  56    AAWLSTFHDDS--EEETKHAIAVAVATAAAANAAVTAAQAAMV----RLKSLGTERTTPY  109

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
                ERWAA+KIQ AFR YLA+KALR LK LVK+QAL+RGYLVRKQA+ TL  +QAL+RAQ
Sbjct  110   GIYERWAAVKIQTAFRCYLAKKALRALKALVKLQALVRGYLVRKQAAITLRRLQALVRAQ  169

Query  652   ATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEN----DVITKVVEM  819
             +    +++R ++    ++   +    RS    +V   R     GSE     D   K+VEM
Sbjct  170   SVARPREAR-ALPQQGRRLDAQVCHRRSFERFNVRDAR-CKPTGSEESHGLDRSPKIVEM  227

Query  820   DT-SVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYR-  993
             DT  +  K+ R++  S     E    P     SSPL +KI +        +S+    YR 
Sbjct  228   DTFQLKSKSFRRTGSSSFNALEEPTVPL----SSPLAHKIPSRLSIPSCRSSRDYHYYRN  283

Query  994   ------FSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYE-----GYPKYMASTQSFM  1140
                     TAQ TPR        NP T  + M +      +        P YMA+T S  
Sbjct  284   PERSPCSKTAQNTPRL-------NPQTPPRYMNITADVVVWHTPSPANSPNYMANTSSSA  336

Query  1141  SKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE---VMNFKSA  1311
             +KLR QS PKQRPE     RRK++  NE +       G  +  + S  QE     N K  
Sbjct  337   AKLRPQSTPKQRPE--KANRRKKLYANETV------PGTSLSDTWSPLQEHEAYCNLKYG  388

Query  1312  VIGRLGR  1332
             ++GR+ R
Sbjct  389   MVGRINR  395



>gb|KHN00271.1| Protein IQ-DOMAIN 31 [Glycine soja]
Length=417

 Score =   132 bits (331),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 147/286 (51%), Gaps = 27/286 (9%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
             C E  AAIKIQ+ FR YLARKAL  L+GLVK+QAL+RG+LVRKQA  TL  MQAL+ AQ+
Sbjct  102   CVEEAAAIKIQSVFRSYLARKALYALRGLVKLQALVRGHLVRKQARETLRCMQALVIAQS  161

Query  655   TVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVT  834
                AQ++R        + +  N+    EN  S+H      +   EN    K+VEM    +
Sbjct  162   RARAQRARMVSDGKLDQKLSPNRITTEENF-SMHMYNEMHNGLEEN---AKIVEMAVCES  217

Query  835   PKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI----------STSQDFQDLDTSQISD  984
                SR   R+ +   E   + F   +SS   Y            ST  +      S   +
Sbjct  218   KGNSRG--RNSSVNREPSDHRFSAYYSSNGSYSKEENYNASPAPSTLTELSPRACSGHFE  275

Query  985   EYRFSTAQTTP-RFANVRGSNNPIT-----LSKSMFMEPYFRNYEGYPKYMASTQSFMSK  1146
             E  FSTAQ++P  ++ V G +N IT          + EP   +Y  +P YMA+T+S  +K
Sbjct  276   ECSFSTAQSSPYYYSEVSGVDNTITKVPFAFPIPAYTEPMSYDYPLFPNYMANTKSSRAK  335

Query  1147  LRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              RSQSAPK RP+     P R+R S+    E R     VRMQ+S SH
Sbjct  336   ARSQSAPKSRPDSYERQPSRRRASI----EGRNVPKPVRMQRSSSH  377



>ref|XP_007224458.1| hypothetical protein PRUPE_ppa022210mg [Prunus persica]
 gb|EMJ25657.1| hypothetical protein PRUPE_ppa022210mg [Prunus persica]
Length=484

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 115/315 (37%), Positives = 158/315 (50%), Gaps = 53/315 (17%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             +KIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  LAQ+ 
Sbjct  155   VKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARALAQRI  214

Query  676   R---------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTS  828
             R         P   + P++S+ +N+   + N             G E ++  K+VEMD  
Sbjct  215   RMAEDENTVIPPRHSTPRRSLQENRFRHTYNEM---------DRGMEENI--KIVEMDLG  263

Query  829   VTPK--ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQD-----------FQDLDT  969
              +     SR S  S     E   + F   H+   P +  ++QD             DL  
Sbjct  264   ESKGILKSRNSSYSNLSQTERTEHRFSTQHA---PNQAYSNQDSYNQLSPAPSALTDLSP  320

Query  970   SQIS---DEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAST  1128
                S   ++Y F TAQ++P+     + +  S  P    +  + EP   +Y  +P YMA+T
Sbjct  321   GACSAHLEDYSFGTAQSSPQCYSAMSKLDPSRAPFAFPRPDYGEPLSYDYPLFPNYMANT  380

Query  1129  QSFMSKLRSQSAPKQRP----ELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH-AQEV  1293
             QS  +K RSQSAPKQRP    E  P  R +R S    ME R     V+MQ+S SH +   
Sbjct  381   QSSKAKARSQSAPKQRPADSIERQPS-RPRRAS----MEGRNIPRAVKMQRSSSHVSSTA  435

Query  1294  MNFKSAVIGRLGRCT  1338
              N++     +L R T
Sbjct  436   QNYQYPWYIKLDRST  450



>gb|EMS48192.1| Protein IQ-DOMAIN 31 [Triticum urartu]
Length=332

 Score =   130 bits (327),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 122/315 (39%), Positives = 176/315 (56%), Gaps = 61/315 (19%)
 Frame = +1

Query  526   LARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKSRPSIIN----  693
             +A+KALR LKGLVK+QAL+RGYLVRKQA+ATL SMQAL+RAQA + A +SR + +     
Sbjct  18    VAKKALRALKGLVKLQALVRGYLVRKQAAATLQSMQALVRAQACIRAARSRAAALPTNLR  77

Query  694   -HP---------QKSIDKNKEARSEN-ITSVHSGRYFASLGSEN----DVITKVVEMDTS  828
              HP         Q+     +++RS++ +   +S R  AS+ S +    D   K+VEMDT 
Sbjct  78    VHPTPVRPRYSLQERCSSTEDSRSDHGVAPYYSRRLSASVESSSCYGYDRSPKIVEMDTG  137

Query  829   VTPKASRKSRRSKTWVPEFQGNPFGPPHSSPL-----PYKIS--TSQDFQDLDTSQISDE  987
               PK+   S   +T  P      +    SSPL     P +I+  T++ F + +     ++
Sbjct  138   -RPKSRSSS--LRTTSPGASEECYAHSASSPLMPCRPPPRIAAPTARHFPEYE---WCEK  191

Query  988   YRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY-----------PKYMASTQS  1134
              R +TAQ+TPR+A    S  P+T +KS   +       GY           P YM+ T+S
Sbjct  192   ARPATAQSTPRYA----SYAPVTPTKSACGD------HGYTYSNSPSALNCPSYMSGTRS  241

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMM---ESRAS-QSGVRMQKSCSHA--QEVM  1296
              ++K+RSQSAPKQRPE   G  RKRV L+E++   E+RAS   G   Q+SC+    +E  
Sbjct  242   SVAKVRSQSAPKQRPEE--GAVRKRVPLSEVIILQEARASLGGGGGAQRSCNRPAQEEAF  299

Query  1297  NFKSAVIGRLGRCTD  1341
             +FK AV+ R  R ++
Sbjct  300   SFKKAVLSRFDRSSE  314



>ref|XP_009107802.1| PREDICTED: uncharacterized protein LOC103833471 [Brassica rapa]
Length=370

 Score =   131 bits (329),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 111/275 (40%), Positives = 143/275 (52%), Gaps = 63/275 (23%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AA+KIQA FR +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  99    EDFAAVKIQACFRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  158

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R  I + P      N + R  NI   H          EN+   K+VEMDT     
Sbjct  159   REQRIR-MIGDSPTNPRTSNHKTRIHNI--YH----------ENEENIKIVEMDT-----  200

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK + P     P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  201   ------QSKFYSPA----PSAITDMSPRAY----SSHFEDCNS--------FNTAQSSPQ  238

Query  1021  FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP----ELG  1188
              +  R   N  +LS          +Y  +P YMA+TQS  +K RSQSAPKQRP    E  
Sbjct  239   CSRFREYYNGDSLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPPEIYEKQ  290

Query  1189  PGPRRKRVSLNEMMESRASQSG----VRMQKSCSH  1281
             P  RR+       ME  A ++G    VRMQ+S S 
Sbjct  291   PSGRRR-----SSME--APRNGVPRAVRMQRSSSQ  318



>ref|NP_001242711.1| uncharacterized protein LOC100810189 [Glycine max]
 gb|ACU18163.1| unknown [Glycine max]
Length=416

 Score =   131 bits (330),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 111/286 (39%), Positives = 146/286 (51%), Gaps = 27/286 (9%)
 Frame = +1

Query  475   CRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQA  654
             C E  AAIKIQ+ FR YLARKAL  L+GLVK+QAL+RG+LVRKQA  TL  MQAL+ AQ+
Sbjct  101   CVEEAAAIKIQSVFRSYLARKALYALRGLVKLQALVRGHLVRKQARETLRCMQALVIAQS  160

Query  655   TVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVT  834
                AQ++R        + +  N+    EN  S+H      +   EN +I   VEM    +
Sbjct  161   RARAQRARMVSDGKLDQKLSPNRITTEENF-SMHMYNEMHNGLEENAMI---VEMAVCES  216

Query  835   PKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI----------STSQDFQDLDTSQISD  984
                SR   R+ +   E   + F   +SS   Y            ST  +      S   +
Sbjct  217   KGNSRG--RNSSVNREPSDHRFSAYYSSNGSYSKEENYNASPAPSTLTELSPRACSGHFE  274

Query  985   EYRFSTAQTTP-RFANVRGSNNPIT-----LSKSMFMEPYFRNYEGYPKYMASTQSFMSK  1146
             E  FSTAQ++P  ++ V G +N IT          + EP   +Y  +P YMA T+S  +K
Sbjct  275   ECSFSTAQSSPYYYSEVSGVDNTITKVPFAFPIPAYTEPMSYDYPLFPNYMAKTKSSRAK  334

Query  1147  LRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              RSQSAPK RP+     P R+R S    ME R     VRMQ+S SH
Sbjct  335   ARSQSAPKSRPDSYERQPSRRRAS----MEGRNVPKPVRMQRSSSH  376



>ref|XP_011091033.1| PREDICTED: protein IQ-DOMAIN 14-like [Sesamum indicum]
Length=405

 Score =   131 bits (329),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 109/287 (38%), Positives = 149/287 (52%), Gaps = 33/287 (11%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQ+ FRGYLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  79    EEAAAVKIQSVFRGYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  138

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITS--VHSGRYFASLGSENDVITKVVEMDTSVT  834
               Q+ R   +    K++D+ +    +++      S       G E ++  K+VEMD    
Sbjct  139   REQRIR---MAEEIKAVDQRQYNHRKSMQEHRFRSPNQDFDRGLEENI--KIVEMDLG-D  192

Query  835   PKASRKSRRSKTWVPEF---------QGNPFGPPHS--SPLPYKISTSQDFQDLDTSQIS  981
              K   K+R S + + +                  H+  SP P  I+   D      S   
Sbjct  193   YKPMTKARNSYSNLTQLDRTEHRISTHRTSIKQEHNQISPAPSAIT---DISPRTCSNHF  249

Query  982   DEY-RFSTAQTTPRFANVRGSNNPITL----SKSMFMEPYFRNYEGYPKYMASTQSFMSK  1146
             +EY  F TAQ++P+  +     +P  L     +S + E  +  Y  YP YMA+T+S  +K
Sbjct  250   EEYSSFGTAQSSPQCYSAMSKPDPARLPFSYPRSEYAESLYNEYPFYPNYMANTESSRAK  309

Query  1147  LRSQSAPKQRP--ELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             +RS SAPKQRP       P R+R SL    E R     VRMQ+S SH
Sbjct  310   VRSHSAPKQRPVETFERQPSRRRPSL----EGRNVPRAVRMQRSSSH  352



>emb|CDY36861.1| BnaC08g09860D [Brassica napus]
Length=374

 Score =   130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 145/274 (53%), Gaps = 60/274 (22%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AA+KIQA FR +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  101   EEFAAVKIQACFRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  160

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R  I + P  + +          TS+H  R   ++  EN+   K+VEMDT     
Sbjct  161   REQRIR-MIGDSPTNTTNLR--------TSIHKTR-IHNIYHENEENIKIVEMDT-----  205

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK     +   P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  206   ------QSKF----YSSAPSAITDMSPRAY----SSHFEDCNS--------FNTAQSSPQ  243

Query  1021  FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP----ELG  1188
              +  R   N  +LS          +Y  +P YMA+TQS  +K RSQSAPKQRP    E  
Sbjct  244   CSRFREYYNGDSLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPPEIYEKQ  295

Query  1189  PGPRRKRVSLNEMMESRASQSG----VRMQKSCS  1278
             P  RR+       ME  A ++G    VRMQ+S S
Sbjct  296   PSGRRR-----SSME--APRNGVPRAVRMQRSSS  322



>ref|XP_009416469.1| PREDICTED: uncharacterized protein LOC103997062 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=455

 Score =   132 bits (331),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 138/370 (37%), Positives = 179/370 (48%), Gaps = 53/370 (14%)
 Frame = +1

Query  292   AAWLSSFYGPSGGEEHSNHaaiavaaataaaadaavaaahaaaaavvRIASRERGRGGPL  471
             AAWLS+F+  S  EE + HA     A  AAA  A  AA  A      R+ S    R  P 
Sbjct  98    AAWLSTFHDDS--EEETKHAIAVAVATAAAANAAVTAAQAAMV----RLKSLGTERTTPY  151

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
                ERWAA+KIQ AFR YLA+KALR LK LVK+QAL+RGYLVRKQA+ TL  +QAL+RAQ
Sbjct  152   GIYERWAAVKIQTAFRCYLAKKALRALKALVKLQALVRGYLVRKQAAITLRRLQALVRAQ  211

Query  652   ATVLAQKSRPSIINHPQKSIDKNKEA---RSENITSVHSGRYFASLGSEN----DVITKV  810
             +    +++R      PQ+    + +    RS    +V   R     GSE     D   K+
Sbjct  212   SVARPREAR----ALPQQGRRLDAQVCHRRSFERFNVRDAR-CKPTGSEESHGLDRSPKI  266

Query  811   VEMDT-SVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDE  987
             VEMDT  +  K+ R++  S     E    P     SSPL +KI +        +S+    
Sbjct  267   VEMDTFQLKSKSFRRTGSSSFNALEEPTVPL----SSPLAHKIPSRLSIPSCRSSRDYHY  322

Query  988   YR-------FSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYE-----GYPKYMASTQ  1131
             YR         TAQ TPR        NP T  + M +      +        P YMA+T 
Sbjct  323   YRNPERSPCSKTAQNTPRL-------NPQTPPRYMNITADVVVWHTPSPANSPNYMANTS  375

Query  1132  SFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE---VMNF  1302
             S  +KLR QS PKQRPE     RRK++  NE +       G  +  + S  QE     N 
Sbjct  376   SSAAKLRPQSTPKQRPE--KANRRKKLYANETVP------GTSLSDTWSPLQEHEAYCNL  427

Query  1303  KSAVIGRLGR  1332
             K  ++GR+ R
Sbjct  428   KYGMVGRINR  437



>ref|XP_006283879.1| hypothetical protein CARUB_v10004996mg [Capsella rubella]
 gb|EOA16777.1| hypothetical protein CARUB_v10004996mg [Capsella rubella]
Length=392

 Score =   130 bits (328),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 144/272 (53%), Gaps = 55/272 (20%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AA+KIQA +R +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  Q   
Sbjct  106   EEFAAVKIQACYRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQTKA  165

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R          I  +   R    TS+H  R   +   EN+   K+VEMD      
Sbjct  166   REQRIR---------LIGDSTNPR----TSIHKTR-INNFYHENEENIKIVEMDI-----  206

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK + P     P G    SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  207   ------QSKLYSPA----PSGLTEMSPRAY----SSHFEDCNS--------FNTAQSSPQ  244

Query  1021  -FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP-ELGPG  1194
              F+ ++   N  TLS          +Y  +P YMA+TQS  +K RSQSAPKQRP E+   
Sbjct  245   CFSRIKDYYNGDTLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPAEIYEK  296

Query  1195  PR---RKRVSLNEMMESRASQSGVRMQKSCSH  1281
             P+   R+R S+ E   +      VRMQ+S S 
Sbjct  297   PQTNGRRRSSM-EAPRNNGVPRAVRMQRSSSQ  327



>ref|XP_008655709.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X2 [Zea mays]
 gb|AFW80269.1| hypothetical protein ZEAMMB73_458161 [Zea mays]
 gb|AIB04905.1| orphans transcription factor, partial [Zea mays]
Length=466

 Score =   132 bits (331),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 124/330 (38%), Positives = 173/330 (52%), Gaps = 59/330 (18%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RGR G        AA+KIQ AFRG+LA+KALR LK LV++QAL+RGYLVR+QA+ TL SM
Sbjct  132   RGRAG--------AAVKIQTAFRGFLAKKALRALKALVRLQALVRGYLVRRQATVTLQSM  183

Query  631   QALMRAQATVLAQ---KSRPSI---INHPQK----SIDKN--KEARSENITSVHSGRYFA  774
             QAL+RAQATV A    ++ PS+   ++HP      S+ +    +ARSE+  +    R  A
Sbjct  184   QALVRAQATVRAARCGRALPSLQPRLHHPPARPRFSLQERHADDARSEHGVAACGRRLSA  243

Query  775   SLGSEN---DVITKVVEMDTSVTPKASRKSRRSKT-WVPEFQGNPFGPP------HSSPL  924
             S+  E+   D   K VEMDT+  P++   S R++  W  +   +P  PP      H  P 
Sbjct  244   SVAVESASYDRSPKTVEMDTA-RPRSRAPSLRTEDEWCAQPVSSP-PPPCQQQHHHHLPP  301

Query  925   PYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP--YFRNY  1098
               ++ T + F D       ++ R +TAQ TPR A       P   +K++   P       
Sbjct  302   CIEVPTPRHFPDHGWC-TPEKPRPATAQCTPRCA----PPTPTPAAKTLCGGPASCLAAS  356

Query  1099  EGYPKYMASTQ--SFMSKLRSQSAPKQRPELGPGPRRKRVSLNE--MMESRASQSGVRMQ  1266
                P YM+STQ     S  RSQSAPKQRP       RKRV L+E  ++++RAS  G    
Sbjct  357   PSCPGYMSSTQSSEAKSSSRSQSAPKQRPA------RKRVPLSEVVVLQARASLGGAGGG  410

Query  1267  -----KSC-----SHAQEVMNFKSAVIGRL  1326
                  K C     + A +  + ++AV+ R 
Sbjct  411   AGTHIKPCNARAQAQAPDACDLRAAVVSRF  440



>emb|CDY50677.1| BnaA08g29370D [Brassica napus]
Length=368

 Score =   130 bits (326),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 110/275 (40%), Positives = 145/275 (53%), Gaps = 63/275 (23%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AA+KIQA FR +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  99    EDFAAVKIQACFRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  158

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R  I + P           +   TS+H  R   ++  EN+   K+VEMDT     
Sbjct  159   REQRIR-MIGDSP-----------TNPRTSIHKTR-IHNIYHENEENIKIVEMDT-----  200

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK + P     P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  201   ------QSKFYSPA----PSAITDMSPRAY----SSHFEDCNS--------FNTAQSSPQ  238

Query  1021  FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP----ELG  1188
              +  R   N  +LS          +Y  +P YMA+TQS  +K RSQSAPKQRP    E  
Sbjct  239   CSRFREYYNGDSLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPPEIYEKQ  290

Query  1189  PGPRRKRVSLNEMMESRASQSG----VRMQKSCSH  1281
             P  RR+       ME  A ++G    VRMQ+S S 
Sbjct  291   PSGRRR-----SSME--APRNGVPRAVRMQRSSSQ  318



>ref|XP_010253848.1| PREDICTED: protein IQ-DOMAIN 31-like [Nelumbo nucifera]
Length=263

 Score =   127 bits (320),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 104/151 (69%), Gaps = 12/151 (8%)
 Frame = +1

Query  499  KIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKSR  678
            K Q  FRGYLA+KALR LKGLVK+QAL+RGYLVRKQA+ATLHSMQAL+RAQATV AQK+R
Sbjct  74   KDQTVFRGYLAKKALRALKGLVKLQALVRGYLVRKQATATLHSMQALIRAQATVRAQKTR  133

Query  679  PSIINH-----PQKSIDKNKEARSENITSVHSGRYFASLGSENDVIT---KVVEMDTSVT  834
             +++N      P+KSI+   + RSE+  S+HS R  AS+ +  +      K+VE+DT   
Sbjct  134  -ALLNKEHRYPPRKSIEIFDKTRSEHTASIHSRRLSASIETAINTFEESPKIVEIDTG-R  191

Query  835  PKASRKSRRSKTWVPEFQGNPFGPPHSSPLP  927
            PK+  +SRR  T + E   +P     SSPLP
Sbjct  192  PKS--RSRRINTSMSECGEDPPYQTISSPLP  220



>ref|XP_008655708.1| PREDICTED: uncharacterized protein LOC103634918 isoform X1 [Zea 
mays]
Length=511

 Score =   132 bits (331),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 124/330 (38%), Positives = 173/330 (52%), Gaps = 59/330 (18%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RGR G        AA+KIQ AFRG+LA+KALR LK LV++QAL+RGYLVR+QA+ TL SM
Sbjct  132   RGRAG--------AAVKIQTAFRGFLAKKALRALKALVRLQALVRGYLVRRQATVTLQSM  183

Query  631   QALMRAQATVLAQ---KSRPSI---INHPQK----SIDKN--KEARSENITSVHSGRYFA  774
             QAL+RAQATV A    ++ PS+   ++HP      S+ +    +ARSE+  +    R  A
Sbjct  184   QALVRAQATVRAARCGRALPSLQPRLHHPPARPRFSLQERHADDARSEHGVAACGRRLSA  243

Query  775   SLGSEN---DVITKVVEMDTSVTPKASRKSRRSKT-WVPEFQGNPFGPP------HSSPL  924
             S+  E+   D   K VEMDT+  P++   S R++  W  +   +P  PP      H  P 
Sbjct  244   SVAVESASYDRSPKTVEMDTA-RPRSRAPSLRTEDEWCAQPVSSP-PPPCQQQHHHHLPP  301

Query  925   PYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP--YFRNY  1098
               ++ T + F D       ++ R +TAQ TPR A       P   +K++   P       
Sbjct  302   CIEVPTPRHFPDHGWC-TPEKPRPATAQCTPRCA----PPTPTPAAKTLCGGPASCLAAS  356

Query  1099  EGYPKYMASTQ--SFMSKLRSQSAPKQRPELGPGPRRKRVSLNE--MMESRASQSGVRMQ  1266
                P YM+STQ     S  RSQSAPKQRP       RKRV L+E  ++++RAS  G    
Sbjct  357   PSCPGYMSSTQSSEAKSSSRSQSAPKQRPA------RKRVPLSEVVVLQARASLGGAGGG  410

Query  1267  -----KSC-----SHAQEVMNFKSAVIGRL  1326
                  K C     + A +  + ++AV+ R 
Sbjct  411   AGTHIKPCNARAQAQAPDACDLRAAVVSRF  440



>ref|XP_007034846.1| Iq-domain 31 isoform 2 [Theobroma cacao]
 gb|EOY05772.1| Iq-domain 31 isoform 2 [Theobroma cacao]
Length=466

 Score =   131 bits (329),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 147/283 (52%), Gaps = 32/283 (11%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             IKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA   AQ+ 
Sbjct  141   IKIQSVFRSYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARARAQRI  200

Query  676   RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASRKS  855
             R    ++P  S  ++   RS          +    G E ++  K+VEMD     K S KS
Sbjct  201   RMVEESNP-ASQRQSPHRRSTPDHRFRHAYHEIDRGMEENI--KIVEMDLGDL-KGSLKS  256

Query  856   RRSKTWVPEFQ-------GNPFGPPHS---------SPLPYKISTSQDFQDLDTSQISDE  987
             R S +  P+ +          +   H+         SP P  ++   D      S   ++
Sbjct  257   RNSYSHYPQAERVVEHRFSTHYSSNHAYSKQDNYQVSPAPSALT---DMSPRACSGHFED  313

Query  988   YRFSTAQTTPRFANV----RGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRS  1155
             Y FSTAQ++P + +       S  P    +  + E    +Y  +P YMA+T+S  +K+RS
Sbjct  314   YSFSTAQSSPPYYSAISKPDPSKLPFAFPRPEYAESVSYDYPLFPNYMANTESSRAKVRS  373

Query  1156  QSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             QSAPK RP+     P R+R S+    E R     VRMQ+S SH
Sbjct  374   QSAPKSRPDSFERQPSRRRASI----EGRNVPRAVRMQRSSSH  412



>ref|XP_002265460.1| PREDICTED: protein IQ-DOMAIN 14 [Vitis vinifera]
Length=464

 Score =   131 bits (329),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 149/290 (51%), Gaps = 37/290 (13%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQAAFR +LARKAL  LKGLVK+QAL+RG LVRKQA+ATL  MQAL+  QA  
Sbjct  135   EEAAAVKIQAAFRAHLARKALCALKGLVKLQALVRGNLVRKQATATLRCMQALVTVQARA  194

Query  661   LAQKSRPSIINHP--QKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVT  834
               Q+ R +    P  Q+ + + K  +     + +  +     G E ++  K+VEMD   +
Sbjct  195   RVQRIRMTEETKPVNQRQLTQRKSTQDNRFRNTNHDK---DRGMEENI--KIVEMDQGES  249

Query  835   PKASRKSRRS-------KTWVPEFQGNPFGPPHS---------SPLPYKISTSQDFQDLD  966
              K S K R S       +   P F  N +   H+         SP P  ++   D     
Sbjct  250   -KGSSKGRNSYSNHAQTERAEPRFSTN-YATNHAYSKQDNQQISPAPSALT---DMSPRA  304

Query  967   TSQISDEYRFSTAQTTPRFANVRGSNN----PITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
              S   +EY F+T Q++P+  +     +    P    ++   E    +Y  +P YMA+T+S
Sbjct  305   CSGHFEEYCFTTTQSSPQCYSAVSKPDCTGLPFAFPQTDCAESLSYDYPFFPNYMANTES  364

Query  1135  FMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
               +K+RS SAPKQRPE     P R+R S    ME R     +RMQ+S SH
Sbjct  365   SKAKVRSHSAPKQRPESFERQPSRRRAS----MEGRNIPRAMRMQRSSSH  410



>ref|XP_010435074.1| PREDICTED: uncharacterized protein LOC104718945 [Camelina sativa]
Length=394

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 144/272 (53%), Gaps = 55/272 (20%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AA+KIQA +R +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  107   EEFAAVKIQACYRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  166

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R          I  +   R    TS+H  R  ++L  EN+   K+VEMD      
Sbjct  167   REQRIR---------LIGDSTNPR----TSIHKTR-ISNLYHENEENIKIVEMDI-----  207

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK + P     P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  208   ------QSKLYSPA----PSALTEMSPRAY----SSHFEDCNS--------FNTAQSSPQ  245

Query  1021  -FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP-ELGPG  1194
              F   +   N  TLS          +Y  +P YMA+TQS  +K RSQSAPKQRP E+   
Sbjct  246   CFNRFKEYYNGDTLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPAEIYEK  297

Query  1195  PR---RKRVSLNEMMESRASQSGVRMQKSCSH  1281
             P+   R+R S+ E   +      VRMQ+S S 
Sbjct  298   PQTTGRRRSSM-EAPRNNGVPRAVRMQRSSSQ  328



>ref|XP_010449997.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=395

 Score =   130 bits (326),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 108/272 (40%), Positives = 144/272 (53%), Gaps = 55/272 (20%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AA+KIQA +R +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  107   EEFAAVKIQACYRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  166

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R          I  +   R    TS+H  R  ++L  EN+   K+VEMD      
Sbjct  167   REQRIR---------LIGDSTNPR----TSIHKTR-ISNLYHENEENIKIVEMDI-----  207

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK + P     P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  208   ------QSKLYSPA----PSALTEMSPRAY----SSHFEDCNS--------FNTAQSSPQ  245

Query  1021  -FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP-ELGPG  1194
              F   +   N  TLS          +Y  +P YMA+TQS  +K RSQSAPKQRP E+   
Sbjct  246   CFNRFKEYYNGDTLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPAEIYEK  297

Query  1195  PR---RKRVSLNEMMESRASQSGVRMQKSCSH  1281
             P+   R+R S+ E   +      VRMQ+S S 
Sbjct  298   PQTTGRRRSSM-EAPRNNGVPRAVRMQRSSSQ  328



>ref|XP_010259130.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Nelumbo nucifera]
Length=476

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 109/297 (37%), Positives = 155/297 (52%), Gaps = 39/297 (13%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQA FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  M+AL+ AQA  
Sbjct  139   EEAAAIKIQAVFRSYLARKALSALKGLVKLQALVRGHLVRKQATATLRCMEALVTAQARA  198

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSEND----VITKVVEMDTS  828
              AQ+ R  +    Q +I +    R     S+   R F  + +E D       K+VEMD  
Sbjct  199   RAQRIR--LAEEAQTTIQRQSIHRK----SLQDHR-FRQVNNEIDRGVEDTIKIVEMDLG  251

Query  829   VTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLP-YKISTSQDFQ-----------DLDTS  972
                  SR S+    +    Q   F    S     +++++ Q++Q           D+   
Sbjct  252   ----ESRSSKSRNIYSTPPQTERFEQRLSMYYAGHRVNSKQEYQFQMSPAPSALTDMSPR  307

Query  973   QIS---DEYRFSTAQTTPR-FANVRGSNNPI---TLSKSMFMEPYFRNYEGYPKYMASTQ  1131
               S   D+Y F T Q++P+ +  V   ++ +     S+S + +    +Y  +P YMA+T+
Sbjct  308   ACSGHFDDYSFLTTQSSPQCYTAVTKPDSKMGSFAFSRSEYADSVSNDYPFFPHYMANTK  367

Query  1132  SFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             S  +K+RSQSAPKQRP+     P R+R S+    E R      RMQ+S SH    +N
Sbjct  368   SSRAKVRSQSAPKQRPDSFERQPSRRRASI----EGRNIPRSTRMQRSSSHLGSNIN  420



>gb|EPS70679.1| hypothetical protein M569_04083, partial [Genlisea aurea]
Length=330

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 110/279 (39%), Positives = 149/279 (53%), Gaps = 33/279 (12%)
 Frame = +1

Query  433   RIASRERGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQAS  612
             R+ SR R R     CR +WAA+KIQ+ FRGYLARKALR L+GLVK+QAL+RGYLVRK+A+
Sbjct  81    RLTSRGRERTFSGGCR-KWAAVKIQSVFRGYLARKALRALRGLVKLQALVRGYLVRKRAA  139

Query  613   ATLHSMQALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENI-TSVHSGRYFASLGSE  789
                 S++AL+RAQA  L Q  R    N P+K+      ARS  + T  HS   F S+ SE
Sbjct  140   EAFRSVEALIRAQAQALIQADRHRHRN-PKKTHRHRAAARSHPVRTHNHSRSSFDSVESE  198

Query  790   NDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDT  969
                 TKVVEMDT   P      RR+   +     +   PP      Y      D  D   
Sbjct  199   ---ATKVVEMDTCRPP-----GRRTVHGL-----HNCCPPVPDDYYYYHYYYNDDGDRHC  245

Query  970   SQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP---YFRNYEGYPKYMASTQSFM  1140
              +    Y   + +  P ++ +    +P + +      P   ++ +  G+P YMA T+S  
Sbjct  246   CKRLSSY---SCRIPPTYSAM---PSPASYNYCYGATPARSFYGDGGGFPGYMARTESSR  299

Query  1141  SKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGV  1257
             +KLRSQSAP+QRPE       +R+S   ++ SR S SGV
Sbjct  300   AKLRSQSAPRQRPE-------RRLS-EVLVGSRMSFSGV  330



>ref|XP_010525232.1| PREDICTED: protein IQ-DOMAIN 14-like [Tarenaya hassleriana]
Length=303

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 106/273 (39%), Positives = 140/273 (51%), Gaps = 43/273 (16%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQA FR YLARKALR LKG+VK+QAL RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  9     EEIAAMKIQAYFRSYLARKALRALKGIVKLQALARGHLVRKQATATLRCMQALITLQAKA  68

Query  661   LAQKSRPSIINHPQKSIDKNK-EARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTP  837
             L Q+ R  +I  P+ SI ++     S   T + +  ++       +   K VE+D  +  
Sbjct  69    LEQRIR--MIEDPKPSIPRSSTHGNSSQETRIKNSYHYHEKDRVLEENIKTVEIDDDI--  124

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTP  1017
                    +SK + P     P      SP  Y    S  F+D         Y F+TAQ++P
Sbjct  125   -------QSKQYSPA----PSAITEMSPRAY----SGYFED---------YNFTTAQSSP  160

Query  1018  RFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP----EL  1185
             +    +G        K   +  Y  +Y  +P YMA+T+S  +K RSQSAPKQRP    E 
Sbjct  161   QCFRFKGD-----YYKRDSLSSY--DYPLFPNYMANTESSRAKARSQSAPKQRPPELYER  213

Query  1186  GPGPRRKRVSLNEMMESRASQSGVRMQKSCSHA  1284
              P  RR RVS+            VRMQ+S SH 
Sbjct  214   QPSGRR-RVSMEG--PRNGIPRAVRMQRSSSHV  243



>ref|XP_007034845.1| Iq-domain 31 isoform 1 [Theobroma cacao]
 gb|EOY05771.1| Iq-domain 31 isoform 1 [Theobroma cacao]
Length=534

 Score =   131 bits (329),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 147/283 (52%), Gaps = 32/283 (11%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             IKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA   AQ+ 
Sbjct  141   IKIQSVFRSYLARKALNALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARARAQRI  200

Query  676   RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASRKS  855
             R    ++P  S  ++   RS          +    G E ++  K+VEMD     K S KS
Sbjct  201   RMVEESNP-ASQRQSPHRRSTPDHRFRHAYHEIDRGMEENI--KIVEMDLGDL-KGSLKS  256

Query  856   RRSKTWVPEFQ-------GNPFGPPHS---------SPLPYKISTSQDFQDLDTSQISDE  987
             R S +  P+ +          +   H+         SP P  ++   D      S   ++
Sbjct  257   RNSYSHYPQAERVVEHRFSTHYSSNHAYSKQDNYQVSPAPSALT---DMSPRACSGHFED  313

Query  988   YRFSTAQTTPRFANV----RGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRS  1155
             Y FSTAQ++P + +       S  P    +  + E    +Y  +P YMA+T+S  +K+RS
Sbjct  314   YSFSTAQSSPPYYSAISKPDPSKLPFAFPRPEYAESVSYDYPLFPNYMANTESSRAKVRS  373

Query  1156  QSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             QSAPK RP+     P R+R S+    E R     VRMQ+S SH
Sbjct  374   QSAPKSRPDSFERQPSRRRASI----EGRNVPRAVRMQRSSSH  412



>ref|XP_011073614.1| PREDICTED: protein IQ-DOMAIN 32-like, partial [Sesamum indicum]
Length=340

 Score =   128 bits (321),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 107/305 (35%), Positives = 156/305 (51%), Gaps = 38/305 (12%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQ+ FR +LARKAL  LKGLVK+QAL+RG+LVR+QA+ATL  MQAL+  QA  
Sbjct  21    EEAAAVKIQSVFRAHLARKALNALKGLVKLQALVRGHLVRRQATATLRCMQALLSVQARA  80

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFA---SLGSENDVITKVVEMDT-S  828
                ++R  ++    KS+ + K++     +  +  R F      G E+D+  K+VEMD  +
Sbjct  81    ---RARRLLMAEETKSVAQ-KQSTLRRPSQENKSRNFNQEFDRGHEDDI--KIVEMDPGN  134

Query  829   VTPKA-SRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQIS---DEYRF  996
               P A +R S  + T + +F+       HS+P+  +        D+     S   DEY  
Sbjct  135   NKPVARARNSHSNYTQLDKFEQR--TSTHSTPVKQEYQQLSPLTDMTPRTCSNHFDEYLC  192

Query  997   STAQTTPRFANVRGSNNPITLS-----KSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQS  1161
             S A ++P+  +     +   L      +  + E  +  Y  YP YMA+T+S  +KLRS S
Sbjct  193   SAALSSPQCCSAVSKPDQAMLQTFSYPRLEYAESLYNEYPFYPNYMANTKSSRAKLRSHS  252

Query  1162  APKQRP--ELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMNFKSAVIGRLGRC  1335
             APKQRP         R+R S    ME R     V+MQ+S SH           +G  G+ 
Sbjct  253   APKQRPVEMFERQTSRRRAS----MEGRNFPKAVKMQRSSSH-----------VGSTGQN  297

Query  1336  TDYPY  1350
               YP+
Sbjct  298   YQYPW  302



>ref|XP_009371968.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=468

 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 109/301 (36%), Positives = 151/301 (50%), Gaps = 54/301 (18%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  120   EEAAAIKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQAKATLRYMQALVTAQARA  179

Query  661   LAQKSR----PSIIN----HPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVE  816
               Q+ R     + +N     P++S+  N+   + N             G E ++  K VE
Sbjct  180   RTQRIRMVEDKNTVNPRHSTPRRSLQDNRSRHTYNEMD---------RGIEENI--KTVE  228

Query  817   MDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQIS-----  981
             MD   + K   KSR S ++    Q           +  + + +Q + + +T Q +     
Sbjct  229   MDLGES-KGVLKSRNS-SYSNHLQTERT---EQHRISAQYAPNQAYSNQETDQQASLALS  283

Query  982   --------------DEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGY  1107
                           ++Y F TAQ++P+     + +  S  P    +  + EP   +Y  +
Sbjct  284   TLTHRSPGACSAHFEDYSFGTAQSSPQCYSAMSKIDPSKAPFAFPRPDYGEPLSYDYPWF  343

Query  1108  PKYMASTQSFMSKLRSQSAPKQRP---ELGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
             P YMA+TQS  +K RSQSAPKQ P     GP  R++R S    ME R     VRMQ+S S
Sbjct  344   PNYMANTQSSKAKARSQSAPKQSPIDTVEGPPSRQRRAS----MEERKIPRAVRMQRSSS  399

Query  1279  H  1281
             H
Sbjct  400   H  400



>ref|XP_006363480.1| PREDICTED: protein IQ-DOMAIN 14-like [Solanum tuberosum]
Length=464

 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 112/297 (38%), Positives = 158/297 (53%), Gaps = 44/297 (15%)
 Frame = +1

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
             +  E  AA KIQA FRGYLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  Q
Sbjct  130   YALEEDAAAKIQAVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQ  189

Query  652   ATVLAQKSR---PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMD  822
             A   AQ+ R       N+P++S+ +     +++    HS + +     E D+  K+VEMD
Sbjct  190   ARARAQRIRMAEDESPNNPRQSVHRKS---TQDNKFRHSYQDY-----EEDI--KIVEMD  239

Query  823   TSVTPKASRKSRR--SKTWVPEFQGNPFGPPHS-----------SPLPYKISTSQDFQDL  963
                + K + KSR   S     E   + F   ++           SP+P  I T Q  +  
Sbjct  240   LGES-KGNTKSRNCYSNQGETERTEHRFSTHNAYTNQEHHQQIISPVPSAI-TDQSPKAY  297

Query  964   DTSQISDEYRFSTAQTTPRFANVRGSN-NPITL-----SKSMFMEP--YFRNYEGYPKYM  1119
              +    D   + T Q++P++ N   S  +P  +     ++S + EP   +  Y  YP YM
Sbjct  298   -SGHFEDYTSYPTTQSSPQYYNNTMSKPDPSRIPYSSYARSEYAEPESLYNEYPFYPSYM  356

Query  1120  ASTQSFMSKLRSQSAPKQRPE---LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             A+T+S M+K RS SAPKQRP+       P R+R S+    E R     V+MQ+S SH
Sbjct  357   ANTKSSMAKARSHSAPKQRPDQTSFERQPSRRRPSI----EGRNVPRAVKMQRSSSH  409



>emb|CAN66770.1| hypothetical protein VITISV_013810 [Vitis vinifera]
Length=570

 Score =   130 bits (328),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 107/290 (37%), Positives = 149/290 (51%), Gaps = 37/290 (13%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQAAFR +LARKAL  LKGLVK+QAL+RG LVRKQA+ATL  MQAL+  QA  
Sbjct  135   EEAAAVKIQAAFRAHLARKALCALKGLVKLQALVRGNLVRKQATATLRCMQALVTVQARA  194

Query  661   LAQKSRPSIINHP--QKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVT  834
               Q+ R +    P  Q+ + + K  +     + +  +     G E ++  K+VEMD   +
Sbjct  195   RVQRIRMTEETKPVNQRQLTQRKSTQDNRFRNTNHDK---DRGMEENI--KIVEMDQGES  249

Query  835   PKASRKSRRS-------KTWVPEFQGNPFGPPHS---------SPLPYKISTSQDFQDLD  966
              K S K R S       +   P F  N +   H+         SP P  ++   D     
Sbjct  250   -KGSSKGRNSYSNHAQTERAEPRFSTN-YATNHAYSKQDNQQISPAPSALT---DMSPRA  304

Query  967   TSQISDEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQS  1134
              S   +EY F+T Q++P+     +    +  P    ++   E    +Y  +P YMA+T+S
Sbjct  305   CSGHFEEYCFTTTQSSPQCYSAVSKPDCTGVPFAFPQTDCAESLSYDYPFFPNYMANTES  364

Query  1135  FMSKLRSQSAPKQRPELGP-GPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
               +K+RS SAPKQRPE     P R+R S    ME R     +RMQ+S SH
Sbjct  365   SKAKVRSHSAPKQRPESXERQPSRRRAS----MEGRNIPRAMRMQRSSSH  410



>ref|XP_010112558.1| Protein IQ-DOMAIN 31 [Morus notabilis]
 gb|EXC34105.1| Protein IQ-DOMAIN 31 [Morus notabilis]
Length=483

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 112/335 (33%), Positives = 163/335 (49%), Gaps = 73/335 (22%)
 Frame = +1

Query  457   RGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQA  636
             RG     RE WAA+KIQ+AFRG LAR+ALR LKGLVK+QAL+RG++ RK+ +  LH MQA
Sbjct  127   RGSGAGIREEWAAVKIQSAFRGCLARRALRALKGLVKLQALVRGHIERKRTAEWLHRMQA  186

Query  637   LMRAQATVLAQK----------SRPSIINHPQKSI-------------------------  711
             LM+AQA  +  +          S+ S  +HP  +                          
Sbjct  187   LMQAQARAIGGRSQLSEFQHSNSKSSNFHHPGPATPEKFEHVIRSKSRKHDQPSLLRKSS  246

Query  712   ---------DKNKE----ARSENITSVHSGRYFAS----LGSENDVITKVVEMDTS---V  831
                      D +K     +RSE+     SG   +S      ++++   +++E+DT    +
Sbjct  247   SKSNSRTISDHDKTYSGGSRSESQLDERSGNLRSSSVRNTATDDEKSDRILEIDTGKPHI  306

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI--STSQDFQDLDTSQIS----DEYR  993
             TPK     RR+     +   + F     S   Y +   +S + Q L   ++S    +E  
Sbjct  307   TPK-----RRNLFHSSDQCSHSFTTSKDSTTHYTLPSPSSYEVQSLTPLKLSNNDVEEAS  361

Query  994   FSTAQTTPRF--ANVRGSN---NPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQ  1158
             F TA  +P+F  A+ +G++   +P T SKS     +   Y  YP YMA T+S  +KLRS 
Sbjct  362   FCTANNSPQFYSASSKGASSRRSPFTPSKSDGSRSFLSGYSDYPNYMACTESSKAKLRSL  421

Query  1159  SAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRM  1263
             SAPKQRP+       KR S++ + ESR  QSG R 
Sbjct  422   SAPKQRPQYERSSSMKRYSIHGVGESR--QSGQRF  454



>ref|XP_010462035.1| PREDICTED: protein IQ-DOMAIN 14-like [Camelina sativa]
Length=352

 Score =   127 bits (320),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 102/292 (35%), Positives = 150/292 (51%), Gaps = 53/292 (18%)
 Frame = +1

Query  457   RGGPLFC--RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             R G +     +RWAA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+A L S+
Sbjct  94    RAGDIITTKEQRWAAVKIQKVFRGSLARKALRALKGIVKLQALVRGYLVRKRAAAMLQSI  153

Query  631   QALMRAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             Q L+R Q  + +++    +          NKE  +       S   F       +   K+
Sbjct  154   QVLIRVQTAMRSKRINRCL----------NKEDSNNMFQPRQS--LFEKFDEAGERSPKI  201

Query  811   VEMDTSVTPKASRKSRRSKTWVPEFQGNPFGP--PHSSPLPYKISTSQDFQDLDTSQISD  984
             VEMD     ++S +S+         Q +  G    +     YK +      DL+ S   +
Sbjct  202   VEMDDKCKRRSSSRSKSR-------QVHNVGAMSEYEDDFVYKEN------DLELSVSDE  248

Query  985   EYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNY---EG----YPKYMASTQSFMS  1143
             +++F++AQ TPR      +NN     +   M+   +N    +G     P YM  T+SF +
Sbjct  249   KWKFASAQNTPRLLRHHAANN-----RYYVMQSPAKNVLCDDGGSLSTPGYMEKTKSFKA  303

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK------SCSH  1281
             K+RS SAP+QR E      RKR+SL+E+M S+ S +GV M +      SCS+
Sbjct  304   KVRSHSAPRQRAE------RKRLSLDEVMASKRSVTGVNMLQQQPPRYSCSY  349



>ref|XP_008777374.1| PREDICTED: protein IQ-DOMAIN 14 [Phoenix dactylifera]
Length=441

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 112/292 (38%), Positives = 154/292 (53%), Gaps = 43/292 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQAAFR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  126   EEAAAIKIQAAFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVTAQARA  185

Query  661   LAQKSRP----SIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTS  828
              AQ+ R      +I+  Q    ++     ++  S HS  Y    G++ +V  K+VEMD  
Sbjct  186   RAQRIRMVEEYKVISQRQSIYRRSP----QHPRSRHS--YEMDRGADENV--KIVEMDLG  237

Query  829   VTPKASRKSRRSKTW---------VPEFQGNPFGPPHS------SPLPYKISTSQDFQDL  963
              + + + KSR S +          +  + GN   P  +      SP P  I+   D    
Sbjct  238   ES-RGTTKSRNSYSITRTEAKDHGISAYYGNGHPPFRAEQYQQFSPAPSAIT---DMSPR  293

Query  964   DTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMS  1143
               S   +E+ F+TAQ++P++ +         LS     +  F +Y  YP YMA+T+S  +
Sbjct  294   VYSGHFEEFSFTTAQSSPQYLSA--------LSVPDATQASF-DYPFYPNYMANTESSRA  344

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             K RSQSAP+QR +      R+       +E R    GVRMQ+S SH     N
Sbjct  345   KTRSQSAPRQRTD---SYERQTSRRRPSVEGRNIPRGVRMQRSSSHVGLTAN  393



>ref|XP_010440400.1| PREDICTED: uncharacterized protein LOC104723702 [Camelina sativa]
Length=394

 Score =   127 bits (320),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 107/272 (39%), Positives = 143/272 (53%), Gaps = 55/272 (20%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E + A+KIQA +R +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  107   EEFPAVKIQACYRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  166

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
               Q+ R          I  +   R    TS+H  R  ++L  EN+   K+VEMD      
Sbjct  167   REQRIR---------LIGDSTNPR----TSIHKTR-ISNLYHENEENIKIVEMDI-----  207

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +SK + P     P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  208   ------QSKLYSPA----PSALTEMSPRAY----SSHFEDCNS--------FNTAQSSPQ  245

Query  1021  -FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP-ELGPG  1194
              F   +   N  TLS          +Y  +P YMA+TQS  +K RSQSAPKQRP E+   
Sbjct  246   CFNRFKEYYNGDTLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPAEIYEK  297

Query  1195  PR---RKRVSLNEMMESRASQSGVRMQKSCSH  1281
             P+   R+R S+ E   +      VRMQ+S S 
Sbjct  298   PQTTGRRRSSM-EAPRNNGVPRAVRMQRSSSQ  328



>ref|XP_010559033.1| PREDICTED: protein IQ-DOMAIN 14-like [Tarenaya hassleriana]
Length=405

 Score =   127 bits (320),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 140/272 (51%), Gaps = 43/272 (16%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQA FR YLARKALR LKG+VK+QAL RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  102   EEIAAMKIQAYFRSYLARKALRALKGIVKLQALARGHLVRKQATATLRCMQALITLQAKA  161

Query  661   LAQKSRPSIINHPQKSIDKNK-EARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTP  837
             L Q+ R  +I  P+ SI ++     S   T + +  ++       +   K VE+D  +  
Sbjct  162   LEQRIR--MIEDPKPSIPRSSTHGNSSQETRIKNSYHYHEKDRVLEENIKTVEIDDDI--  217

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTP  1017
                    +SK + P     P      SP  Y    S  F+D         Y F+TAQ++P
Sbjct  218   -------QSKQYSPA----PSAITEMSPRAY----SGYFED---------YNFTTAQSSP  253

Query  1018  RFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP----EL  1185
             +    +G        K   +  Y  +Y  +P YMA+T+S  +K RSQSAPKQRP    E 
Sbjct  254   QCFRFKGD-----YYKRDSLSSY--DYPLFPNYMANTESSRAKTRSQSAPKQRPPELYER  306

Query  1186  GPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
              P  RR RVS+            VRMQ+S SH
Sbjct  307   QPSGRR-RVSMEG--PRNGIPRAVRMQRSSSH  335



>ref|XP_008673593.1| PREDICTED: protein IQ-DOMAIN 14-like [Zea mays]
 tpg|DAA53044.1| TPA: hypothetical protein ZEAMMB73_646324 [Zea mays]
 gb|AIB04903.1| orphans transcription factor, partial [Zea mays]
Length=481

 Score =   129 bits (323),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 131/338 (39%), Positives = 176/338 (52%), Gaps = 62/338 (18%)
 Frame = +1

Query  451   RGRGGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             RGR G        AA+KIQ AFR +LA+KALR LK LVK+QAL+RGYLVR+QA+ATL SM
Sbjct  134   RGRAG--------AAVKIQTAFRRFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSM  185

Query  631   QALMRAQATVL------AQKSRPSIINHP----QKSIDK--NKEARSENITSVHSGRYFA  774
             QAL+RAQA V       A  + P + +HP    + S+ +    + RSE+  + +S R  A
Sbjct  186   QALVRAQAAVRAARYSRALPALPPLHHHPPVRARFSLQERYGDDTRSEHGVAAYSRRLSA  245

Query  775   SL-----GSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPP----------  909
             S+     G   D   K+VEMDT+     +   R    W  +   +P  PP          
Sbjct  246   SIESASYGGGYDRSPKIVEMDTARPRSRASSLRTEDEWYAQSVSSPLLPPPPPPPCQHLH  305

Query  910   --HSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMF---  1074
               H  P    + TS+ F D D     ++ R +TAQ TPR A       P T ++S+    
Sbjct  306   QYHHLPPRIAVPTSRHFPDYDWC-APEKPRPATAQCTPRCA-------PPTPARSVCGAG  357

Query  1075  --MEPYFRNYEGYPKYMASTQ--SFMSKLRSQSAPKQRP----ELGPGPRRKRVSLNE-M  1227
                  Y     G P YM+ST+     S  RSQSAPKQRP    E    P RKRV L+E +
Sbjct  358   GNGGGYLAASPGCPGYMSSTRSSEAKSSSRSQSAPKQRPLEQQEQQQQPARKRVPLSEVV  417

Query  1228  MESRAS--QSGVRMQKSC---SHAQEVMNFKSAVIGRL  1326
             +E+RAS   +GV M K C   + AQ+  +F++AV+ R 
Sbjct  418   LEARASLGGAGVGMHKPCNTRAQAQDAFDFRTAVVSRF  455



>emb|CBI26300.3| unnamed protein product [Vitis vinifera]
Length=430

 Score =   128 bits (321),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 101/274 (37%), Positives = 140/274 (51%), Gaps = 39/274 (14%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQAAFR +LARKAL  LKGLVK+QAL+RG LVRKQA+ATL  MQAL+  QA  
Sbjct  135   EEAAAVKIQAAFRAHLARKALCALKGLVKLQALVRGNLVRKQATATLRCMQALVTVQARA  194

Query  661   LAQKSRPSIINHP--QKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVT  834
               Q+ R +    P  Q+ + + K  +     + +  +     G E ++  K+VEMD    
Sbjct  195   RVQRIRMTEETKPVNQRQLTQRKSTQDNRFRNTNHDK---DRGMEENI--KIVEMDQG--  247

Query  835   PKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTT  1014
                            E +GN       SP P  ++   D      S   +EY F+T Q++
Sbjct  248   ---------------ESKGN---NQQISPAPSALT---DMSPRACSGHFEEYCFTTTQSS  286

Query  1015  PRFANVRGSNN----PITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPE  1182
             P+  +     +    P    ++   E    +Y  +P YMA+T+S  +K+RS SAPKQRPE
Sbjct  287   PQCYSAVSKPDCTGLPFAFPQTDCAESLSYDYPFFPNYMANTESSKAKVRSHSAPKQRPE  346

Query  1183  -LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
                  P R+R S    ME R     +RMQ+S SH
Sbjct  347   SFERQPSRRRAS----MEGRNIPRAMRMQRSSSH  376



>ref|XP_008238822.1| PREDICTED: protein IQ-DOMAIN 14 [Prunus mume]
Length=385

 Score =   127 bits (318),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 105/292 (36%), Positives = 151/292 (52%), Gaps = 43/292 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E WAA+KIQAAFRG LAR+ALR LKGLV++QAL+RG++VRK  +A L  +QA++RAQA  
Sbjct  67    EEWAALKIQAAFRGCLARRALRALKGLVRLQALVRGHIVRKNNAARLQRLQAILRAQARA  126

Query  661   LAQKSRPSIINH---------------PQKSIDKNKEARSENITSV-----HSGRYFASL  780
                +S+ S ++H               P+K I+    +RS  +        +S R + + 
Sbjct  127   RTGRSQISELSHSRTKSSQFHQPGPATPEK-IEHPIRSRSTKLEQFSTLRRNSSRSYGTT  185

Query  781   GSE-NDVITKVVEMDTSVTPKASRKSRR----------SKTWVPEFQGNPFGPPHSS-PL  924
               E ND   +V+E+DT   P  + K R           S  +   F  +     H + P 
Sbjct  186   DDEKND---RVLEIDTG-KPFIATKRRNLFHSTHLALASDQYSHSFTTSKDSTSHQTLPS  241

Query  925   PYKISTSQDFQDLDTSQISDEYRFSTAQTTPRF--ANVRGSN---NPITLSKSMFMEPYF  1089
             P      Q    L  S+  +E  F TA ++P+F  A+ RG N   +P T ++S   + Y 
Sbjct  242   PSSCEV-QSLTPLKFSREVEEDSFCTANSSPQFHSASSRGGNSKRSPFTPTRSDGSKSYL  300

Query  1090  RNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRAS  1245
               Y  YP YMA T+S  +KLRS SAPKQRP+       KR S++   E ++S
Sbjct  301   SGYSDYPSYMACTESSKAKLRSLSAPKQRPQYERSGSAKRYSIHGSGELKSS  352



>ref|XP_007143302.1| hypothetical protein PHAVU_007G060900g [Phaseolus vulgaris]
 gb|ESW15296.1| hypothetical protein PHAVU_007G060900g [Phaseolus vulgaris]
Length=462

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 104/284 (37%), Positives = 148/284 (52%), Gaps = 31/284 (11%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR +LARKAL  L+GLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  139   EEAAAIKIQSVFRSHLARKALCALRGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARA  198

Query  661   LAQKSR---PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSV  831
               Q+ R     I N  Q+     K    +    +++       G E+++  K+VEMD   
Sbjct  199   RIQRIRMGSEGIPNQQQR-----KATHDDLFMHIYNE---MERGLEDNI--KIVEMDVGE  248

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHSS------PLPYKISTS-QDFQDLDTSQISDEY  990
                 SR S        E   + F   +S+         YK+S +     +L   + S  +
Sbjct  249   NKNNSRSSSVYHHEHQEQHDHRFSTHYSTNGSYSKEENYKVSPAPSALTELSPRECSGHF  308

Query  991   R--FSTAQTTPRF----ANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLR  1152
                FSTAQ++P+F    +    S +P +  +  + E    +Y  +P YMA+T+S  +K+R
Sbjct  309   EDCFSTAQSSPQFHSAVSRTENSKHPFSFPRPAYAESICYDYPLFPNYMANTESSRAKVR  368

Query  1153  SQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             S SAPKQRP+     P R+R S+    E R     +RMQ+S SH
Sbjct  369   SHSAPKQRPDSFEKQPSRRRASV----EGRNVPRPMRMQRSSSH  408



>ref|XP_008224258.1| PREDICTED: protein IQ-DOMAIN 14 [Prunus mume]
Length=486

 Score =   128 bits (321),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 114/316 (36%), Positives = 155/316 (49%), Gaps = 55/316 (17%)
 Frame = +1

Query  496   IKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKS  675
             +KIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA   AQ+ 
Sbjct  157   VKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARARAQRI  216

Query  676   R---------PSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTS  828
             R         P   + P++S+ +N+   + N             G E ++  K+VEMD  
Sbjct  217   RMAEDENTVIPPRHSTPRRSLQENRFWHTYNEM---------DRGMEENI--KIVEMDLG  265

Query  829   VTPK--ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQD-----------FQDLDT  969
              +     SR S  S     E   + F   H+   P +  ++QD             DL  
Sbjct  266   ESKGILKSRTSSNSNLSQTERTEHRFSTQHA---PNQAYSNQDSYNQLSPAPSALTDLSP  322

Query  970   SQIS---DEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMAST  1128
                S   ++Y F TAQ++P+     + +  S  P    +    EP   +Y  +P YMA+T
Sbjct  323   GACSAHIEDYSFGTAQSSPQCYSAMSKLDPSRAPFAFPRPDNGEPLSYDYPLFPNYMANT  382

Query  1129  QSFMSKLRSQSAPKQRP----ELGPG-PRRKRVSLNEMMESRASQSGVRMQKSCSH-AQE  1290
             QS  +K RSQSAPKQRP    E  P  PRR        ME R     V+MQ+S SH +  
Sbjct  383   QSSKAKARSQSAPKQRPADSIERQPSRPRRA------SMEGRNIPRAVKMQRSSSHVSST  436

Query  1291  VMNFKSAVIGRLGRCT  1338
               N++     +L R T
Sbjct  437   AQNYQYPWYIKLDRST  452



>ref|XP_010932805.1| PREDICTED: protein IQ-DOMAIN 14 isoform X2 [Elaeis guineensis]
Length=442

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 111/292 (38%), Positives = 151/292 (52%), Gaps = 43/292 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQAAFR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  127   EEAAAIKIQAAFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRRMQALVTAQARA  186

Query  661   LAQK----SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTS  828
              AQ+        +I+  Q+SI +       +       RY   L    +   K+VEMD  
Sbjct  187   CAQRIQMVEEYKVISQ-QQSIYRRSPQHPRS-------RYSYELDRSAEENAKIVEMDLG  238

Query  829   VTPKASRKSRRS----KTWVPEFQGNPF----GPP-------HSSPLPYKISTSQDFQDL  963
              + +++ KSR S    +T   + +   +     PP         SP P  I+   D    
Sbjct  239   ES-RSTSKSRNSYSITQTETKDHRAFAYYGSARPPLRAEQYQQFSPAPSAIT---DMSPR  294

Query  964   DTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMS  1143
               S   +E+ F+TAQ++P++ +         LS S   +  F +Y  YP YMA+T+S  +
Sbjct  295   AYSGHFEEFSFTTAQSSPQYLSA--------LSASDATQASF-DYSFYPNYMANTESSRA  345

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQEVMN  1299
             K RSQSAP+QR +      R+       +E R    GVRMQ+S SH     N
Sbjct  346   KARSQSAPRQRTDTY---ERQTSRRRPSVEGRNIPRGVRMQRSSSHVGLTAN  394



>ref|XP_008391004.1| PREDICTED: protein IQ-DOMAIN 14 [Malus domestica]
Length=470

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 108/293 (37%), Positives = 147/293 (50%), Gaps = 38/293 (13%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  136   EEAAAIKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQAKATLRYMQALVTAQARA  195

Query  661   LAQKSR----PSIIN----HPQKSIDKNKEARS---------ENITSVHSGRYFASLGSE  789
              AQ+ R     + +N     P++S+ +N+   +         ENI +V        LG  
Sbjct  196   RAQRIRMVEDKNTVNPRHSTPRRSLQENRSRHTYNEMARGIEENIKTVE-----MXLGES  250

Query  790   NDVI-TKVVEMDTSVTPKASRKSRRSKTWVP-EFQGNPFGPPHSSPLPYKISTSQDFQDL  963
               ++ ++          + + + R S  + P +   N      +SP P   ST  D    
Sbjct  251   KGILKSRXSSYSNHSQTERTEQHRFSTQYAPNQAYSNQETYQQASPAP---STLTDRSPG  307

Query  964   DTSQISDEYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQ  1131
               S   ++Y F TAQ  P+     + +  S  P    +  + EP   +Y  +P YMA+T 
Sbjct  308   ACSAHFEDYSFGTAQGXPQCYSAMSKIDPSKAPFAFPRPDYGEPLSYDYPWFPNYMANTX  367

Query  1132  SFMSKLRSQSAPKQRPELG---PGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             S  +K R QSAPKQRP      P  R++R S    ME R     VRMQ+S SH
Sbjct  368   SSRAKARWQSAPKQRPIDTVERPPSRQRRAS----MEGRNIPRAVRMQRSSSH  416



>ref|XP_010932804.1| PREDICTED: protein IQ-DOMAIN 14 isoform X1 [Elaeis guineensis]
Length=443

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 150/286 (52%), Gaps = 43/286 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQAAFR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+ AQA  
Sbjct  127   EEAAAIKIQAAFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRRMQALVTAQARA  186

Query  661   LAQK----SRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTS  828
              AQ+        +I+  Q+SI +       +       RY   L    +   K+VEMD  
Sbjct  187   CAQRIQMVEEYKVISQ-QQSIYRRSPQHPRS-------RYSYELDRSAEENAKIVEMDLG  238

Query  829   VTPKASRKSRRS----KTWVPEFQGNPF----GPP-------HSSPLPYKISTSQDFQDL  963
              + +++ KSR S    +T   + +   +     PP         SP P  I+   D    
Sbjct  239   ES-RSTSKSRNSYSITQTETKDHRAFAYYGSARPPLRAEQYQQFSPAPSAIT---DMSPR  294

Query  964   DTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMS  1143
               S   +E+ F+TAQ++P++ +         LS S   +  F +Y  YP YMA+T+S  +
Sbjct  295   AYSGHFEEFSFTTAQSSPQYLSA--------LSASDATQASF-DYSFYPNYMANTESSRA  345

Query  1144  KLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             K RSQSAP+QR +      R+       +E R    GVRMQ+S SH
Sbjct  346   KARSQSAPRQRTDTY---ERQTSRRRPSVEGRNIPRGVRMQRSSSH  388



>emb|CDY45643.1| BnaA05g15100D [Brassica napus]
Length=326

 Score =   125 bits (314),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/289 (35%), Positives = 142/289 (49%), Gaps = 66/289 (23%)
 Frame = +1

Query  454   GRGGPLFC-RERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GR G +    ERWAA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+  LHS+
Sbjct  65    GRAGDIMTWEERWAAVKIQKVFRGSLARKALRALKGIVKLQALVRGYLVRKRAATMLHSI  124

Query  631   QALMRAQATVLAQKSRP-----SIINHPQKSIDK----NKEARSENITSVHSGRYFASLG  783
             QAL+R Q  V +++ R      S +  P+ S DK     +E R + I  VH         
Sbjct  125   QALIRVQTAVRSKRDRRHKKEYSHMFQPRHSFDKFDEVAREERHQKIVEVH---------  175

Query  784   SENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDL  963
                D+             K   K R++   VP  +       +     Y+ S      DL
Sbjct  176   ---DMF------------KRRPKPRQTHNLVPMSE-------YEDGFVYRGS------DL  207

Query  964   DTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFME------------PYFRNYEGY  1107
             + +   ++++F TAQ+TPR       ++    ++   M+             Y  N  G 
Sbjct  208   ELNLPKEKWKFGTAQSTPRLLTSSSHHHTANNNRYYVMQCRSKRVCGNAQSGYGMNTPG-  266

Query  1108  PKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSG  1254
             P YM +TQSF +K RS SAP +  E      R R+SL+E++ S+   SG
Sbjct  267   PGYMENTQSFKAKQRSHSAPHRLSE------RNRLSLDEVIASKNRVSG  309



>ref|XP_002312547.2| calmodulin-binding family protein [Populus trichocarpa]
 gb|EEE89914.2| calmodulin-binding family protein [Populus trichocarpa]
Length=435

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 108/293 (37%), Positives = 153/293 (52%), Gaps = 43/293 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALM------  642
             E  AA+KIQ+ FR YLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+      
Sbjct  106   EEDAAVKIQSVFRSYLARKALCALKGLVKLQALVRGHLVRKQATATLRCMQALVNVQTRA  165

Query  643   RAQATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMD  822
             RAQ   +A+  +PS  N   +   +    R  N  +        + G + + I K+VE+D
Sbjct  166   RAQRIWMAEDVKPSQRNSIHRKSTQENRIRHTNDEN--------NRGMDQENI-KIVEVD  216

Query  823   TSVTPKASRKSR-----RSKTWVPEFQ-GNPFGPPHS---------SPLPYKISTSQDFQ  957
                + K S KSR     R +T + E +    +   H+         SP P  ++   D  
Sbjct  217   VGES-KGSIKSRNGFSHRPQTDLTEHRFSTHYASNHAYLKKENHQISPAPSALT---DMS  272

Query  958   DLDTSQISDEYRFSTAQTTPRFANVRG----SNNPITLSKSMFMEPYFRNYEGYPKYMAS  1125
                 S   +E  FSTA ++P++ +       S  P  L +  + E    +Y  +P YMA+
Sbjct  273   PRACSGHFEENSFSTAHSSPQYYSAVSKPDPSRIPFALPRPEYAESLSYDYPLFPNYMAN  332

Query  1126  TQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             T+SF +K+RS SAPKQRP+     P RKR S+    E R     +RMQ+S S+
Sbjct  333   TESFRAKVRSHSAPKQRPDSFERQPSRKRASI----EGRNVPRPMRMQRSSSN  381



>gb|KHN15734.1| Protein IQ-DOMAIN 14 [Glycine soja]
Length=370

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 148/296 (50%), Gaps = 53/296 (18%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+AFR +LA+KAL  L+GLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  36    EEAAAIKIQSAFRSHLAKKALCALRGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARA  95

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYF---ASLGSENDVITKVVEMDTSV  831
              AQ+ +   +    K+  K++ A  +++      R+       G E+++  K+VEMD   
Sbjct  96    RAQRIQ---MGSEGKANQKHRNAAEDDLL-----RHIYNEMDRGLEDNI--KIVEMDVCE  145

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHS-------------SPLPYKISTSQ------DF  954
             +   SR S        E   N F   +S             SP P  ++ S        F
Sbjct  146   SKVNSRSSSVYHHGHQEQYDNRFSTHYSTNGSYTKEEKYKVSPAPSALTESSPRACSGHF  205

Query  955   QDLDTSQISDEYRFSTAQTTPR------FANVRGSNNPITLSKSMFMEPYFRNYEGYPKY  1116
              D           FSTAQ++P        +    S +P    +  + E    +Y  +P Y
Sbjct  206   DDC----------FSTAQSSPHPQFYSAVSRSEDSKHPFAFHRPAYAESMSYDYPLFPNY  255

Query  1117  MASTQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             MA+T+S  +K+RS SAPKQRP+     P R+R S+    E R     +RMQ+S SH
Sbjct  256   MANTESSRAKVRSHSAPKQRPDSFERQPSRRRASV----EGRNVPRPMRMQRSSSH  307



>ref|XP_006306443.1| hypothetical protein CARUB_v10012385mg [Capsella rubella]
 gb|EOA39341.1| hypothetical protein CARUB_v10012385mg [Capsella rubella]
Length=354

 Score =   125 bits (315),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/298 (35%), Positives = 152/298 (51%), Gaps = 59/298 (20%)
 Frame = +1

Query  454   GRGGPLFCR-ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSM  630
             GR G +  R +RWAA+KIQ  FRG LARKALR LKG+VK+QAL+RGYLVRK+A+A L S+
Sbjct  91    GRAGDVIKRQDRWAAVKIQKVFRGSLARKALRALKGIVKLQALVRGYLVRKRAAAMLQSI  150

Query  631   QALMRAQATVLAQKSRPSIIN--------HPQKSIDKNKEARSENITSVHSGRYFASLGS  786
             QAL+R Q T +  K     +N         P++S+DK  E                  G+
Sbjct  151   QALIRVQ-TAMRSKRISRCLNKDYGSNKFQPRQSLDKYDE------------------GA  191

Query  787   ENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLD  966
              ++   KVVE+D     ++S +S+       +         +     YK        DL+
Sbjct  192   CDERSRKVVEIDDIYKRRSSSRSKSR-----QVHNVVAMSEYEDDCVYK------GNDLE  240

Query  967   TSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYE-------GYPKYMAS  1125
              S   ++++F++AQ TPR  +   +NN     +S   +   RN           P YM  
Sbjct  241   LSFSDEKWKFASAQNTPRLMHHHAANNRYYAMQSP-AKIVCRNTSCDYGSGLSTPGYMEK  299

Query  1126  TQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQK------SCSH  1281
             T+SF +K+RS S P+QR E      R+R+SL+E+M  ++S S V M +      SCS+
Sbjct  300   TKSFKAKVRSLSVPRQRSE------RQRLSLDEVMAYKSSVSSVSMLQQQPPRYSCSY  351



>ref|XP_004247593.1| PREDICTED: protein IQ-DOMAIN 14 [Solanum lycopersicum]
Length=467

 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 109/299 (36%), Positives = 153/299 (51%), Gaps = 46/299 (15%)
 Frame = +1

Query  472   FCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQ  651
             +  E  AA KIQA FRGYLARKAL  LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  Q
Sbjct  133   YALEEDAASKIQAVFRGYLARKALNALKGLVKLQALVRGHLVRKQAAATLRCMQALVTVQ  192

Query  652   ATVLAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGS-ENDVITKVVEMDTS  828
             A   AQ+ R +   +P      N   +S +  S    ++  S    E D+  K+VEMD  
Sbjct  193   ARARAQRIRMTEEENP------NNPRQSVHRKSTQDNKFRHSYQDYEEDI--KIVEMDLG  244

Query  829   VTPKASRKSRR--SKTWVPEFQGNPFGPPHS-----------SPLPYKISTS--------  945
              + K + KSR   S     E   + F   ++           SP+P  I+          
Sbjct  245   ES-KGNTKSRNCYSNQGQTERTEHRFSTHNAYTNQEHHQHIISPVPSAITEQSPKAYSGH  303

Query  946   -QDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEP--YFRNYEGYPKY  1116
              +D+    T+  S +Y ++   + P  + +  S    + ++S + EP   +  Y  YP Y
Sbjct  304   FEDYTSYPTTHSSPQY-YNNTMSKPDPSRILYS----SYARSEYAEPESLYNEYPFYPSY  358

Query  1117  MASTQSFMSKLRSQSAPKQRPE---LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHA  1284
             MA+T+S ++K RS SAPKQRP+       P R+R S+    E R     VRMQ+S SH 
Sbjct  359   MANTKSSIAKARSHSAPKQRPDQTSFERQPSRRRPSI----EGRNVPRAVRMQRSSSHV  413



>gb|EMT31921.1| hypothetical protein F775_15466 [Aegilops tauschii]
Length=329

 Score =   124 bits (311),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 165/308 (54%), Gaps = 59/308 (19%)
 Frame = +1

Query  529   ARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKSRPSIIN-----  693
             A KALR LKGLVK+QAL+RGYLVRKQA+ATL SMQAL+RAQA + A +SR + +      
Sbjct  28    ATKALRALKGLVKLQALVRGYLVRKQAAATLQSMQALVRAQACIRAARSRAAALPTNLRV  87

Query  694   HP---------QKSIDKNKEARSEN-ITSVHSGRYFASLGSENDVITKVVEMDTS-----  828
             HP         Q+     +++RS++ +   +S R  AS+ S +    +    D       
Sbjct  88    HPTPVRPRYSLQERYSTTEDSRSDHSVAPYYSRRLSASVESSSCYGVRPEPQDRGDGHRP  147

Query  829   ------VTPKA-SRKSRRSKTWVPEFQGNPFGPPHSSPLPYKIS--TSQDFQDLDTSQIS  981
                   + P    R+ RRS T            P S   P +I+  T++ F + +     
Sbjct  148   AQVALLLAPDDLPRRQRRSAT------------PDSVSAPPRIAAPTARHFPEYE---WC  192

Query  982   DEYRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGY---PKYMASTQSFMSKLR  1152
             ++ R +TAQ+TPR+A    S  P+T +KS      + N       P YM+ TQS ++K+R
Sbjct  193   EKARPATAQSTPRYA----SYAPVTPTKSACGGYTYSNSPSTLNCPSYMSGTQSSVAKVR  248

Query  1153  SQSAPKQRPELGPGPRRKRVSLNEMM---ESRASQSGVRMQKSCSHA--QEVMNFKSAVI  1317
             SQSAPKQRPE G    RKRV L+E++   E RAS SG   Q+SC+    +E  +FK AV+
Sbjct  249   SQSAPKQRPEEGAV--RKRVPLSEVIILQEGRASLSGG-TQRSCNRPAQEEAFSFKKAVV  305

Query  1318  GRLGRCTD  1341
              R  R ++
Sbjct  306   SRFDRSSE  313



>ref|XP_006606074.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X3 [Glycine max]
Length=420

 Score =   125 bits (315),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 105/298 (35%), Positives = 150/298 (50%), Gaps = 53/298 (18%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+AFR +LA+KAL  L+GLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  143   EEAAAIKIQSAFRSHLAKKALCALRGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARA  202

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYF---ASLGSENDVITKVVEMDTSV  831
              AQ+ +   +    K+  K++ A  +++      R+       G E+++  K+VEMD   
Sbjct  203   RAQRIQ---MGSEGKANQKHRNAAEDDLL-----RHIYNEMDRGLEDNI--KIVEMDVCE  252

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHS-------------SPLPYKISTSQ------DF  954
             +   SR S        E   N F   +S             SP P  ++ S        F
Sbjct  253   SKVNSRSSSVYHHGHQEQYDNRFSTHYSTNGSYTKEEKYKVSPAPSALTESSPRACSGHF  312

Query  955   QDLDTSQISDEYRFSTAQTTPR------FANVRGSNNPITLSKSMFMEPYFRNYEGYPKY  1116
              D           FSTAQ++P        +    S +P    +  + E    +Y  +P Y
Sbjct  313   DDC----------FSTAQSSPHPQFYSAVSRSEDSKHPFAFHRPAYAESMSYDYPLFPNY  362

Query  1117  MASTQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQ  1287
             MA+T+S  +K+RS SAPKQRP+     P R+R S+    E R     +RMQ+S SH++
Sbjct  363   MANTESSRAKVRSHSAPKQRPDSFERQPSRRRASV----EGRNVPRPMRMQRSSSHSR  416



>gb|KFK43744.1| hypothetical protein AALP_AA1G167200 [Arabis alpina]
Length=384

 Score =   125 bits (313),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 109/274 (40%), Positives = 142/274 (52%), Gaps = 58/274 (21%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQA FR +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  104   EEIAAVKIQACFRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQA--  161

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
                K+R   I     S  K    R    TS+H  R   +L  E +   K+VEMD      
Sbjct  162   ---KAREQRIRMIGDSTPKTTNPR----TSIHKTR-INNLYHECEENIKIVEMDN-----  208

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                   +S+ + P     P      SP  Y    S  F+D ++        F+TAQ++P+
Sbjct  209   ------QSRLYSPA----PSAITEMSPRAY----SSHFEDCNS--------FNTAQSSPQ  246

Query  1021  FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP-ELGPGP  1197
                 +   N  TLS          +Y  +P YMA+TQS  +K RSQSAPKQRP E+   P
Sbjct  247   CFRFKEYCNGDTLSS--------YDYPLFPNYMANTQSSKAKARSQSAPKQRPAEIYEKP  298

Query  1198  --RRKRVSLNEMMESRASQSG----VRMQKSCSH  1281
                R+R S+       A ++G    VRMQ+S S 
Sbjct  299   ISGRRRSSME------APRNGVPRAVRMQRSSSQ  326



>ref|XP_004166570.1| PREDICTED: uncharacterized LOC101212161 [Cucumis sativus]
Length=431

 Score =   125 bits (314),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 105/272 (39%), Positives = 142/272 (52%), Gaps = 28/272 (10%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKALR L+GLVK+QAL RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  127   EEAAAIKIQSTFRSYLARKALRALRGLVKLQALARGHLVRKQAKATLRCMQALITAQARA  186

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ  R  +I        + +   +E++   H G  +A+  +E +V  K+VEMD  V  K
Sbjct  187   RAQ--RIKMIEATNNLSYQRQPFLAESVND-HFG--YANHAAEENV--KIVEMD-RVEYK  238

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                K+R S   V       F   H S +P   S   D      S   ++Y   T Q++P+
Sbjct  239   RGSKNRTSYEHV-------FATNHVSQVP---SAKTDIDARGCSGHFEDYSICTVQSSPQ  288

Query  1021  FANVR-----GSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPE-  1182
                 +       + PI  S    M+     Y  +P YMA+T+S  +K RSQSAPK RPE 
Sbjct  289   DYLAKSKPDLSESGPIGFSTPECMQSMSFEYPMFPSYMANTKSSRAKARSQSAPKTRPES  348

Query  1183  LGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
                 P R++ S     E ++    V++Q+S S
Sbjct  349   FERQPSRRKAS----TEGKSIPKAVQIQRSAS  376



>ref|XP_009335283.1| PREDICTED: protein IQ-DOMAIN 14-like [Pyrus x bretschneideri]
Length=482

 Score =   126 bits (316),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 111/316 (35%), Positives = 156/316 (49%), Gaps = 46/316 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKAL  L+GLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  150   EEAAAIKIQSVFRSYLARKALCALRGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARA  209

Query  661   LAQKSR----PSIIN----HPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVE  816
              AQ+ R     + +N     P++S+ +N+   + N             G E ++  K+VE
Sbjct  210   RAQRIRMVEDENTVNPRHSTPRRSLQENRSRHTYNEI---------DRGMEENI--KIVE  258

Query  817   MDTSVTPKASRKSRRSK----TWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISD  984
             MD   + K   KSR S     +     + + F   ++    Y    +        S ++D
Sbjct  259   MDIGES-KGILKSRNSSYSNHSLTERTEQHRFSTQYAPNQAYSNQETNQQVSPAPSVLTD  317

Query  985   ----------EYRFSTAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMA  1122
                       E  F T Q++P+     + +  S  P    +  + EP   +Y  +P YMA
Sbjct  318   RSPGACSAHFENSFGTVQSSPQCYSAMSKIDPSRAPFAFPRPDYGEPLSYDYPFFPNYMA  377

Query  1123  STQSFMSKLRSQSAPKQRPELG---PGPRRKRVSLNEMMESRASQSGVRMQKSCSH-AQE  1290
             +TQS  +K RSQSAPKQRP      P  R +R S    ME R     +RMQ+S SH +  
Sbjct  378   NTQSSKAKARSQSAPKQRPIDTVERPPSRPRRTS----MEGRNIPRAMRMQRSSSHVSST  433

Query  1291  VMNFKSAVIGRLGRCT  1338
               N++     +L R T
Sbjct  434   AQNYQYPWYMKLDRST  449



>ref|XP_008438624.1| PREDICTED: protein IQ-DOMAIN 14 [Cucumis melo]
Length=434

 Score =   125 bits (314),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 147/300 (49%), Gaps = 63/300 (21%)
 Frame = +1

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
              G +   E  AAIKIQ+ FR YLARKAL  LKGLVK+QA++RG+LVR++A+ TL  MQAL
Sbjct  117   NGKVNAIEEAAAIKIQSVFRSYLARKALCALKGLVKLQAMVRGHLVRQRATETLRCMQAL  176

Query  640   MRAQATV------LAQKSRP---------------SIINHPQKSIDKNKEARSENITSVH  756
             + AQA        LA+ S+P               S I  P + ID+  E   ENI    
Sbjct  177   VTAQARARTQRIKLAEDSKPTAYQWHSSHRKSFQESRIRQPHQEIDREME---ENI----  229

Query  757   SGRYFASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI  936
                             K+VEMD       S K+R S +         +     SP P   
Sbjct  230   ----------------KIVEMDLG----GSLKNRNSYSHYAYSNQENY---RLSPAP---  263

Query  937   STSQDFQDLDTSQISDEYRFSTAQTTPR-FANVRGSNN---PITLSKSMFMEPYFRNYEG  1104
             S   D      S   ++Y ++TAQ++P+ F+ +  S+    P    +S + E    +Y  
Sbjct  264   SAMTDMSPRTYSGHFEDYAYATAQSSPQCFSAMAKSDQNRLPFEFPRSEYAESLSYDYPL  323

Query  1105  YPKYMASTQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             +P YMA+T+S  +K RSQSAPK RPE     P R+R S+    E R     VRMQ+S SH
Sbjct  324   FPNYMANTESSKAKARSQSAPKARPESFERQPSRRRASV----EGRNIPRAVRMQRSSSH  379



>ref|XP_003556065.1| PREDICTED: protein IQ-DOMAIN 14-like isoform X1 [Glycine max]
Length=468

 Score =   125 bits (315),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 105/296 (35%), Positives = 148/296 (50%), Gaps = 53/296 (18%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+AFR +LA+KAL  L+GLVK+QAL+RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  143   EEAAAIKIQSAFRSHLAKKALCALRGLVKLQALVRGHLVRKQAKATLRCMQALVTAQARA  202

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYF---ASLGSENDVITKVVEMDTSV  831
              AQ+ +   +    K+  K++ A  +++      R+       G E+++  K+VEMD   
Sbjct  203   RAQRIQ---MGSEGKANQKHRNAAEDDLL-----RHIYNEMDRGLEDNI--KIVEMDVCE  252

Query  832   TPKASRKSRRSKTWVPEFQGNPFGPPHS-------------SPLPYKISTSQ------DF  954
             +   SR S        E   N F   +S             SP P  ++ S        F
Sbjct  253   SKVNSRSSSVYHHGHQEQYDNRFSTHYSTNGSYTKEEKYKVSPAPSALTESSPRACSGHF  312

Query  955   QDLDTSQISDEYRFSTAQTTPR------FANVRGSNNPITLSKSMFMEPYFRNYEGYPKY  1116
              D           FSTAQ++P        +    S +P    +  + E    +Y  +P Y
Sbjct  313   DDC----------FSTAQSSPHPQFYSAVSRSEDSKHPFAFHRPAYAESMSYDYPLFPNY  362

Query  1117  MASTQSFMSKLRSQSAPKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             MA+T+S  +K+RS SAPKQRP+     P R+R S+    E R     +RMQ+S SH
Sbjct  363   MANTESSRAKVRSHSAPKQRPDSFERQPSRRRASV----EGRNVPRPMRMQRSSSH  414



>gb|KEH43814.1| IQ calmodulin-binding motif protein [Medicago truncatula]
Length=455

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 150/279 (54%), Gaps = 24/279 (9%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA+KIQ  FR +LARKALR L+GLVK+QAL+RG+LVRKQA ATL  MQ L+ AQA  
Sbjct  135   EDAAAVKIQCVFRSHLARKALRALRGLVKLQALIRGHLVRKQAKATLRCMQDLVTAQARA  194

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ+ R  +++  +  ++      ++    +++       G E+++  K+VEMD   + K
Sbjct  195   RAQRIR--MVSEGKPHLNHRNAMENDLFRQIYNE---MDRGLEDNI--KIVEMDFCES-K  246

Query  841   ASRKSRRSKTWVPEFQGNP----FGPPHSSPLPYKISTS-QDFQDLDTSQISDEYR--FS  999
              +  SR S      ++ +         ++    YK+S +     +L     S  +   FS
Sbjct  247   GNSTSRSSSVNRQHYEQSENRYSINGSYTKEENYKVSPAPSALTELSPKACSGHFEDCFS  306

Query  1000  TAQTTPR----FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAP  1167
             TAQ++P+     +    SN+P    +  + E    +Y  YP YMA+T+S  +K+RSQSAP
Sbjct  307   TAQSSPQCYSAISKTDESNHPFAFPRPSYAEQMSYDYPLYPSYMANTESSRAKVRSQSAP  366

Query  1168  KQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             KQRP+       R+R+S+    E R     VRMQ+S S 
Sbjct  367   KQRPDSFERQLSRRRISV----EGRNVPRPVRMQRSSSQ  401



>gb|EPS60953.1| hypothetical protein M569_13848, partial [Genlisea aurea]
Length=233

 Score =   121 bits (304),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 106/287 (37%), Positives = 146/287 (51%), Gaps = 69/287 (24%)
 Frame = +1

Query  529   ARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQKSRPSIINHPQKS  708
             ARKA R L+GLVKIQAL+RG+LVRKQA+ATLH +QAL+R Q+ + A+K R    +HP   
Sbjct  1     ARKASRALRGLVKIQALVRGFLVRKQATATLHGIQALIRVQSAIRARKCR----SHPPD-  55

Query  709   IDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPKASRKSRRSKTWVPEFQ  888
              D N EA   +I+S              +   K+VE+DT+    A+              
Sbjct  56    -DDNNEAEVSSISSRRLSSPL-------ETSPKIVEIDTAAGLTAN--------------  93

Query  889   GNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPRFANVRGSNNPITLSKS  1068
              NP  PP             D+ + +  Q    Y  +TAQ+TPRF            +KS
Sbjct  94    SNP-SPP-------------DWGEFEEEQ-HGAYCSATAQSTPRFGT--------PPAKS  130

Query  1069  MFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGP--------GPRRKRVSLNE  1224
              F E    +      YMA T SF +KLRSQSAPKQRP+  P           ++RVSL E
Sbjct  131   CFGEKQQHS------YMAKTMSFKAKLRSQSAPKQRPQQQPYDEDAYAYACVKRRVSLRE  184

Query  1225  -MMESRASQSGVRMQKSCSHAQEVMN----FKSAVIGRLGRCTDYPY  1350
              M+ESR+S SGVR   S       ++    F++AV+G++G+  D+ +
Sbjct  185   VMVESRSSLSGVRTVTSGGGGGSRLDTAAVFRNAVMGKIGKSCDFSF  231



>gb|KGN61670.1| hypothetical protein Csa_2G222130 [Cucumis sativus]
Length=458

 Score =   125 bits (314),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 143/272 (53%), Gaps = 28/272 (10%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKALR L+GLVK+QAL RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  154   EEAAAIKIQSTFRSYLARKALRALRGLVKLQALARGHLVRKQAKATLRCMQALITAQARA  213

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ  R  +I        + +   +E++   H G  +A+  +E +V  K+VEMD  V  K
Sbjct  214   RAQ--RIKMIEATNNLSYQRQPFLAESVND-HFG--YANHAAEENV--KIVEMD-RVEYK  265

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                K+R S   V       F   H S +P   S   D      S   ++Y   T Q++P+
Sbjct  266   RGSKNRTSYEHV-------FATNHVSQVP---SAKTDIDARGCSGHFEDYSICTVQSSPQ  315

Query  1021  --FANVR---GSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPE-  1182
                A  +     + PI  S    M+     Y  +P YMA+T+S  +K RSQSAPK RPE 
Sbjct  316   DYLAKSKPDLSESGPIGFSTPECMQSMSFEYPMFPSYMANTKSSRAKARSQSAPKTRPES  375

Query  1183  LGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
                 P R++ S     E ++    V++Q+S S
Sbjct  376   FERQPSRRKAS----TEGKSIPKAVQIQRSAS  403



>ref|XP_004145422.1| PREDICTED: uncharacterized protein LOC101212161 [Cucumis sativus]
Length=431

 Score =   125 bits (313),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 106/272 (39%), Positives = 143/272 (53%), Gaps = 28/272 (10%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKALR L+GLVK+QAL RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  127   EEAAAIKIQSTFRSYLARKALRALRGLVKLQALARGHLVRKQAKATLRCMQALITAQARA  186

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ  R  +I        + +   +E++   H G  +A+  +E +V  K+VEMD  V  K
Sbjct  187   RAQ--RIKMIEATNNLSYQRQPFLAESVND-HFG--YANHAAEENV--KIVEMD-RVEYK  238

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTPR  1020
                K+R S   V       F   H S +P   S   D      S   ++Y   T Q++P+
Sbjct  239   RGSKNRTSYEHV-------FATNHVSQVP---SAKTDIDARGCSGHFEDYSICTVQSSPQ  288

Query  1021  --FANVR---GSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRPE-  1182
                A  +     + PI  S    M+     Y  +P YMA+T+S  +K RSQSAPK RPE 
Sbjct  289   DYLAKSKPDLSESGPIGFSTPECMQSMSFEYPMFPSYMANTKSSRAKARSQSAPKTRPES  348

Query  1183  LGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
                 P R++ S     E ++    V++Q+S S
Sbjct  349   FERQPSRRKAS----TEGKSIPKAVQIQRSAS  376



>ref|XP_010552067.1| PREDICTED: protein IQ-DOMAIN 14-like [Tarenaya hassleriana]
Length=313

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 154/286 (54%), Gaps = 58/286 (20%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AA++IQA FR YLARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  6     EEAAALRIQAYFRSYLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  65

Query  661   -------LAQKSRPSIINHPQKSIDK--NKEARSENITSVHSGRYFASLGSENDVITKVV  813
                    + ++++PS   +P+ S  +  ++E R +NI              EN+   K+V
Sbjct  66    REQRMIRMIEETKPS---NPRSSTHRKSSQENRIKNIY------------HENEENIKIV  110

Query  814   EMDTSVTPKASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI--STSQDFQDLDTSQISDE  987
             EMD   + + S    R+ +   E   + + P  SS +      + S  F+D ++      
Sbjct  111   EMDMR-SEQYSNDPIRNFSSKHEQMFHQYSPAASSAITEMTPRAYSGHFEDYNS------  163

Query  988   YRFSTAQTTPRFANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAP  1167
               F+TAQ +P+    +  +N  +LS           Y   P YMA+T+S  +K+RS SAP
Sbjct  164   --FTTAQNSPQCFRFKDYSNGDSLSSY--------EYSLCPNYMANTKSSRAKVRSHSAP  213

Query  1168  KQRP----ELGPGPRRKRVSLNEMMESRASQSG----VRMQKSCSH  1281
             KQRP    E  P  RR RVS    MES  S++G    VRMQ+S SH
Sbjct  214   KQRPPELYERQPSGRR-RVS----MES--SRNGVPRAVRMQRSSSH  252



>ref|XP_007145905.1| hypothetical protein PHAVU_007G277500g [Phaseolus vulgaris]
 gb|ESW17899.1| hypothetical protein PHAVU_007G277500g [Phaseolus vulgaris]
Length=429

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 104/281 (37%), Positives = 143/281 (51%), Gaps = 30/281 (11%)
 Frame = +1

Query  490   AAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATVLAQ  669
             AAI+IQ+ FR YLARKAL  L+G+VK+QAL+RG+LVRKQA  TL  MQAL+ AQA    Q
Sbjct  123   AAIQIQSVFRSYLARKALCALRGIVKLQALVRGHLVRKQARETLRCMQALVIAQARARVQ  182

Query  670   KSRPSIINHPQKSIDKNKEARSENI--TSVHSGRYFASLGSENDVITKVVEMDTSVTPKA  843
             ++R        +++   +    +N     + SG     L  E +   K+VEM  +V    
Sbjct  183   RARIVSEGKVHQNLSPYRRTTEDNFMYNEMESG-----LELEENA--KIVEM--AVWEAK  233

Query  844   SRKSRRSKTWVPEFQGNPFGPPHSSPLPYKI----------STSQDFQDLDTSQISDEYR  993
             +    R+ T   E   + F   +SS   Y            ST  +      S   +E  
Sbjct  234   ANLRGRNNTVNHELSDHRFCAYYSSNGSYSKEENCNASPAPSTLTELSPRAYSGHFEECS  293

Query  994   FSTAQTTPRFAN----VRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQS  1161
             FSTAQ++P + +    V  +  P  L K  + EP   +Y  +P YMA+T+S  +K RSQS
Sbjct  294   FSTAQSSPYYCSAVSRVDNTKLPFALPKPAYTEPMSYDYPLFPNYMANTESSRAKSRSQS  353

Query  1162  APKQRPE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCSH  1281
             APK RP+     P R+R S    ME R     VRMQ+S SH
Sbjct  354   APKARPDSFERQPSRRRAS----MEGRNVPRPVRMQRSSSH  390



>ref|XP_007210506.1| hypothetical protein PRUPE_ppa005786mg [Prunus persica]
 gb|EMJ11705.1| hypothetical protein PRUPE_ppa005786mg [Prunus persica]
Length=444

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 103/292 (35%), Positives = 149/292 (51%), Gaps = 43/292 (15%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E WAA+KIQAAFRG LAR+ALR LKGLV++QAL+RG++ RK  +A L  +QA++RAQA  
Sbjct  126   EEWAALKIQAAFRGCLARRALRALKGLVRLQALVRGHIARKNNAARLQRLQAILRAQARA  185

Query  661   LAQKSRPSIINH---------------PQKSIDKNKEARSENITSVHSGR------YFAS  777
                +S+ S ++H               P+K  +    +RS  +    + R      Y  +
Sbjct  186   RTGRSQISELSHSRTKSSQFHQPGPATPEK-FEHPIRSRSTKLEQFSTLRRNISRSYGTT  244

Query  778   LGSENDVITKVVEMDTSVTPKASRKSRR----------SKTWVPEFQGNPFGPPHSSPLP  927
                +ND   +V+E+DT   P  + K R           S  +   F  +     H + LP
Sbjct  245   DDEKND---RVLEIDTG-KPYIATKRRNLFHSTHLALASDQYSHSFTTSKDSTSHQT-LP  299

Query  928   YKISTS-QDFQDLDTSQISDEYRFSTAQTTPRFANV--RGSN---NPITLSKSMFMEPYF  1089
                S   Q    L  S+  +E  F TA ++P+F +   RG N   +P T ++S   + Y 
Sbjct  300   SPSSCEVQSLTPLKFSREVEEDSFCTANSSPQFYSTSSRGGNSKRSPFTPTRSDGSKSYL  359

Query  1090  RNYEGYPKYMASTQSFMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRAS  1245
               Y  YP YMA T+S  +KLRS SAPKQRP+       KR S++   ES++S
Sbjct  360   SGYSDYPSYMACTESSKAKLRSLSAPKQRPQYERSGSAKRYSIHGFGESKSS  411



>ref|XP_008449323.1| PREDICTED: uncharacterized protein LOC103491236 [Cucumis melo]
Length=462

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 103/275 (37%), Positives = 148/275 (54%), Gaps = 30/275 (11%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E  AAIKIQ+ FR YLARKALR L+GLVK+QAL RG+LVRKQA ATL  MQAL+ AQA  
Sbjct  154   EEAAAIKIQSIFRSYLARKALRALRGLVKLQALARGHLVRKQAKATLRCMQALITAQARA  213

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKVVEMDTSVTPK  840
              AQ  R  +I        + +   +E++   H G  +A+  +E ++  K+VEMD  V  K
Sbjct  214   RAQ--RIKMIEATNNLSYQRQPFLAESVNEDHFG--YANHAAEENI--KIVEMD-HVEYK  266

Query  841   ASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQIS---DEYRFSTAQT  1011
                K+R S   V  F  +   P H S +P  ++      D+D    S   ++Y   T Q+
Sbjct  267   RGSKNRTSYEQV--FATH--HPHHVSQVPSALT------DIDARGCSGHFEDYSICTVQS  316

Query  1012  TPRFANVR-----GSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQR  1176
             +P+    +       ++PI  S    ++     Y  +P YMA+T+S  +K RSQSAPK R
Sbjct  317   SPQDYLAKSKPDPSKSSPIGFSTRECIQSMSFEYPMFPSYMANTESSRAKARSQSAPKTR  376

Query  1177  PE-LGPGPRRKRVSLNEMMESRASQSGVRMQKSCS  1278
             PE     P R++ S     E ++    +++Q+S S
Sbjct  377   PESFERQPSRRKAS----TEGKSIPKAMQIQRSAS  407



>ref|NP_193211.2| protein IQ-domain 19 [Arabidopsis thaliana]
 gb|AEE83494.1| protein IQ-domain 19 [Arabidopsis thaliana]
Length=387

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 97/235 (41%), Positives = 126/235 (54%), Gaps = 51/235 (22%)
 Frame = +1

Query  481   ERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQALMRAQATV  660
             E +AAIKIQA +R +LARKALR LKGLVK+QAL+RG+LVRKQA+ATL  MQAL+  QA  
Sbjct  104   EEFAAIKIQACYRSHLARKALRALKGLVKLQALVRGHLVRKQATATLRCMQALITLQAKA  163

Query  661   LAQKSRPSIINHPQKSIDKNKEARSENI-TSVHSGRYFASLGSENDVITKVVEMDTSVTP  837
               Q+ R  +I              S N  TS+H  R   +   EN+   K+VEMD     
Sbjct  164   REQRIR--MIG-----------GDSTNPRTSIHKTR-INNFYHENEENIKIVEMDI----  205

Query  838   KASRKSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLDTSQISDEYRFSTAQTTP  1017
                    +SK + P     P      SP  Y    S  F+D ++        F+TAQ++P
Sbjct  206   -------QSKMYSPA----PSALTEMSPRAY----SSHFEDCNS--------FNTAQSSP  242

Query  1018  R-FANVRGSNNPITLSKSMFMEPYFRNYEGYPKYMASTQSFMSKLRSQSAPKQRP  1179
             + F+  +   N  TLS          +Y  +P YMA+TQS  +K RSQSAPKQRP
Sbjct  243   QCFSRFKEYYNGDTLSSY--------DYPLFPNYMANTQSSKAKARSQSAPKQRP  289



>dbj|BAK07793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score =   123 bits (309),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 155/310 (50%), Gaps = 42/310 (14%)
 Frame = +1

Query  460   GGPLFCRERWAAIKIQAAFRGYLARKALRCLKGLVKIQALLRGYLVRKQASATLHSMQAL  639
             G  +  RE  AA+ IQ AFRGYLARKALR L+ LVK+QAL+RGYLVRKQA+ TLH +QAL
Sbjct  81    GEQVGAREETAAVLIQKAFRGYLARKALRALRSLVKLQALVRGYLVRKQAATTLHRLQAL  140

Query  640   MRAQATVLAQKS---RPSIINHPQKSIDKNKEARSENITSVHSGRYFASLGSENDVITKV  810
             MR QA   A KS   R S+    ++ I ++   R+      H  R   S  S  +   ++
Sbjct  141   MRLQADSRAFKSASYRKSMEQ--ERIIAQDARMRTPPAKPGHRRRLSDSTDSNYERSPRI  198

Query  811   VEMDTS-VTPKASR-------KSRRSKTWVPEFQGNPFGPPHSSPLPYKISTSQDFQDLD  966
             VEMDT  +  ++SR         R S    P+    P   P S   P ++ST ++ + + 
Sbjct  199   VEMDTCHLRSRSSRIVSGRYAADRSSGRLTPDL--APPISPRSVKQPPRVSTRREREPVR  256

Query  967   TSQISDEYRFSTAQTTPRFANVRGS---NNPITLSKSMFMEP-YFRNYEGYPKYMASTQS  1134
              ++        TAQ TPRF+        ++P      +   P + R+    P+YMA T S
Sbjct  257   HAK--------TAQNTPRFSGPDAPYAYDSPAKSVDGLAARPLWHRDLLASPRYMAGTAS  308

Query  1135  FMSKLRSQSAPKQRPELGPGPRRKRVSLNEMMESRASQSGVRMQKSCSHAQE-VMNFKSA  1311
               ++LR QSAP+Q P   P     R SL +       +  V  + +C+  Q   + F S+
Sbjct  309   SAARLRCQSAPRQ-PAEAP-----RASLTQ-------RDAVPRKSTCTRTQHGGLCFHSS  355

Query  1312  VIGRLGRCTD  1341
                R  RC+D
Sbjct  356   DATR-ARCSD  364



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4744209259384