BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6927_g2_i1 len=551 path=[465:0-550]

Length=551
                                                                      Score     E

gb|AAG10403.1|AF233284_1  mannose-binding lectin                        138   1e-37   Convolvulus arvensis
gb|AAC49564.1|  lectin                                                  131   4e-35   Calystegia sepium
pdb|1OUW|A  Chain A, Crystal Structure Of Calystegia Sepium Agglu...    127   2e-33   
dbj|BAA14024.1|  ipomoelin                                            98.6    3e-22   Ipomoea batatas [batate]
pdb|3R50|A  Chain A, Structure Analysis Of A Wound-Inducible Lect...  98.6    3e-22   
gb|AAA87042.1|  putative 32.7 kDa jasmonate-induced protein           71.6    7e-12   Hordeum vulgare [barley]
ref|XP_006853911.1|  hypothetical protein AMTR_s00036p00183970        67.8    3e-11   
ref|XP_004298564.1|  PREDICTED: uncharacterized protein LOC101299670  70.5    9e-11   
gb|ABA93998.1|  NB-ARC domain containing protein, expressed           70.5    1e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009772163.1|  PREDICTED: putative late blight resistance p...  70.5    1e-10   
ref|XP_009772162.1|  PREDICTED: putative late blight resistance p...  70.5    1e-10   
ref|XP_009772161.1|  PREDICTED: putative late blight resistance p...  70.5    1e-10   
gb|EMS66150.1|  hypothetical protein TRIUR3_12251                     68.2    1e-10   
ref|XP_006853910.1|  hypothetical protein AMTR_s00036p00183430        66.6    1e-10   
gb|EEE52195.1|  hypothetical protein OsJ_34074                        70.1    1e-10   Oryza sativa Japonica Group [Japonica rice]
gb|AAA87041.1|  putative 32.6 kDa jasmonate-induced protein           68.2    1e-10   Hordeum vulgare [barley]
ref|NP_001066367.1|  Os12g0198700                                     67.0    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011030089.1|  PREDICTED: jacalin-related lectin 19             65.5    3e-10   
ref|XP_006853909.1|  hypothetical protein AMTR_s00036p00182710        65.5    3e-10   
ref|XP_007215056.1|  hypothetical protein PRUPE_ppa012210mg           65.5    3e-10   
gb|EAZ01021.1|  hypothetical protein OsI_23055                        68.6    3e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_002318228.2|  hypothetical protein POPTR_0012s13320g           65.9    4e-10   Populus trichocarpa [western balsam poplar]
ref|XP_008244753.1|  PREDICTED: agglutinin-like                       65.1    4e-10   
ref|XP_004298563.1|  PREDICTED: myrosinase-binding protein-like A...  67.4    5e-10   
emb|CAD40628.2|  OSJNBa0016N04.16                                     67.4    5e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008348486.1|  PREDICTED: agglutinin alpha chain-like           64.7    6e-10   
ref|NP_001052560.1|  Os04g0369100                                     67.8    6e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60834.1|  hypothetical protein OsJ_14451                        67.8    6e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009589464.1|  PREDICTED: agglutinin-like                       66.6    7e-10   
ref|XP_009398855.1|  PREDICTED: protein GOS9-like                     63.9    8e-10   
ref|XP_010230396.1|  PREDICTED: jacalin-related lectin 3-like         65.1    8e-10   
ref|XP_006343016.1|  PREDICTED: agglutinin-like                       64.3    8e-10   
gb|EMT11070.1|  hypothetical protein F775_02114                       66.2    8e-10   
ref|XP_004235622.1|  PREDICTED: jacalin-related lectin 19             64.3    8e-10   
ref|XP_008806706.1|  PREDICTED: agglutinin-like isoform X1            64.3    1e-09   
gb|EEC68267.1|  hypothetical protein OsI_36302                        67.4    1e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_004168675.1|  PREDICTED: pentatricopeptide repeat-containi...  67.4    1e-09   
ref|XP_008806712.1|  PREDICTED: agglutinin-like isoform X2            64.3    1e-09   
ref|XP_009763456.1|  PREDICTED: putative late blight resistance p...  67.4    1e-09   
dbj|BAK00987.1|  predicted protein                                    65.5    1e-09   
ref|XP_010690084.1|  PREDICTED: jacalin-related lectin 19             63.9    1e-09   
ref|XP_006663483.1|  PREDICTED: probable disease resistance RPP8-...  67.0    1e-09   
ref|XP_009763450.1|  PREDICTED: putative late blight resistance p...  67.0    1e-09   
ref|XP_009763421.1|  PREDICTED: putative late blight resistance p...  67.0    1e-09   
ref|XP_009763443.1|  PREDICTED: putative late blight resistance p...  67.0    1e-09   
ref|XP_004152769.1|  PREDICTED: pentatricopeptide repeat-containi...  66.6    2e-09   
gb|EYU45843.1|  hypothetical protein MIMGU_mgv1a014002mg              63.5    2e-09   
ref|XP_002440163.1|  hypothetical protein SORBIDRAFT_09g027055        63.5    2e-09   Sorghum bicolor [broomcorn]
gb|AAR20919.1|  jasmonate-induced protein                             64.7    2e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009769147.1|  PREDICTED: putative late blight resistance p...  66.2    2e-09   
ref|XP_010924945.1|  PREDICTED: jacalin-related lectin 19-like is...  63.2    2e-09   
gb|EMT24046.1|  hypothetical protein F775_25349                       64.7    2e-09   
ref|XP_010924946.1|  PREDICTED: jacalin-related lectin 19-like is...  63.2    2e-09   
ref|XP_003597652.1|  Agglutinin alpha chain                           65.9    3e-09   
gb|ABS82785.1|  jasmonate-induced protein                             64.3    3e-09   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006372713.1|  hypothetical protein POPTR_0017s043602g          62.8    3e-09   
ref|XP_002515891.1|  hypothetical protein RCOM_1485780                65.5    3e-09   Ricinus communis
sp|P83304.1|LEC_PARPC  RecName: Full=Mannose/glucose-specific lectin  64.7    4e-09   Parkia platycephala
ref|XP_009367509.1|  PREDICTED: agglutinin alpha chain                62.4    4e-09   
ref|XP_006647196.1|  PREDICTED: disease resistance protein RPM1-l...  65.1    5e-09   
ref|XP_006647195.1|  PREDICTED: disease resistance protein RPM1-l...  65.1    5e-09   
gb|EMS55842.1|  hypothetical protein TRIUR3_32339                     63.5    5e-09   
ref|XP_009614996.1|  PREDICTED: putative late blight resistance p...  65.1    5e-09   
ref|XP_009614994.1|  PREDICTED: putative late blight resistance p...  65.1    5e-09   
ref|XP_009614993.1|  PREDICTED: putative late blight resistance p...  65.1    5e-09   
ref|XP_009614991.1|  PREDICTED: putative late blight resistance p...  65.1    5e-09   
ref|XP_002439182.1|  hypothetical protein SORBIDRAFT_09g001880        63.5    5e-09   Sorghum bicolor [broomcorn]
ref|NP_177447.1|  Mannose-binding lectin superfamily protein          61.6    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001066495.1|  Os12g0247700                                     63.5    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|ABA94002.1|  Jacalin-like lectin domain containing protein, ex...  64.7    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEE52196.1|  hypothetical protein OsJ_34075                        64.7    7e-09   Oryza sativa Japonica Group [Japonica rice]
gb|KCW69704.1|  hypothetical protein EUGRSUZ_F03098                   62.4    7e-09   
gb|KCW69706.1|  hypothetical protein EUGRSUZ_F03098                   62.0    7e-09   
gb|EEC68269.1|  hypothetical protein OsI_36304                        64.7    7e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_009795366.1|  PREDICTED: putative late blight resistance p...  64.7    7e-09   
ref|XP_010471351.1|  PREDICTED: jacalin-related lectin 19             61.2    8e-09   
gb|EEC69076.1|  hypothetical protein OsI_37951                        62.4    9e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_008677998.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    9e-09   
ref|XP_008677994.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    9e-09   
emb|CAJ38387.1|  jacalin-domain protein                               61.2    9e-09   Plantago major [cart-track plant]
gb|AFW60405.1|  putative protein kinase superfamily protein           63.9    9e-09   
ref|XP_008677991.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    9e-09   
ref|XP_008677996.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    1e-08   
ref|XP_008677990.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    1e-08   
ref|XP_008677986.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    1e-08   
emb|CDM80625.1|  unnamed protein product                              62.8    1e-08   
ref|XP_004982894.1|  PREDICTED: salt stress-induced protein-like      60.8    1e-08   
ref|XP_008677992.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.9    1e-08   
gb|EAY82651.1|  hypothetical protein OsI_37872                        62.8    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010062570.1|  PREDICTED: jacalin-related lectin 19             62.4    1e-08   
ref|XP_006390600.1|  hypothetical protein EUTSA_v10019210mg           60.8    1e-08   
gb|KHG23822.1|  Agglutinin alpha chain                                60.8    1e-08   
ref|XP_006426466.1|  hypothetical protein CICLE_v10026553mg           61.2    1e-08   
gb|KDO58671.1|  hypothetical protein CISIN_1g037526mg                 61.2    1e-08   
ref|XP_006301377.1|  hypothetical protein CARUB_v10021789mg           60.8    1e-08   
ref|XP_008654961.1|  PREDICTED: LOC100282355 isoform X1               61.6    1e-08   
gb|KEH39536.1|  mannose-binding lectin superfamily protein            60.8    1e-08   
gb|KEH39538.1|  mannose-binding lectin superfamily protein            60.8    1e-08   
ref|XP_008654962.1|  PREDICTED: LOC100282355 isoform X2               61.6    1e-08   
gb|KEH39537.1|  mannose-binding lectin superfamily protein            60.8    1e-08   
ref|NP_001148739.1|  LOC100282355                                     61.2    1e-08   Zea mays [maize]
ref|XP_008654963.1|  PREDICTED: LOC100282355 isoform X3               61.6    1e-08   
emb|CDO97947.1|  unnamed protein product                              62.0    1e-08   
ref|XP_008654965.1|  PREDICTED: LOC100282355 isoform X4               61.2    1e-08   
ref|XP_008348484.1|  PREDICTED: agglutinin-like isoform X2            60.5    1e-08   
ref|XP_008348483.1|  PREDICTED: agglutinin-like isoform X1            60.8    1e-08   
ref|XP_011001797.1|  PREDICTED: mannose/glucose-specific lectin-l...  63.2    2e-08   
ref|XP_011001798.1|  PREDICTED: mannose/glucose-specific lectin-l...  62.8    2e-08   
gb|EEE60695.1|  hypothetical protein OsJ_14181                        58.9    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010273654.1|  PREDICTED: mannose/glucose-specific lectin-like  60.1    2e-08   
ref|XP_011001796.1|  PREDICTED: mannose/glucose-specific lectin-l...  62.8    2e-08   
ref|XP_009768641.1|  PREDICTED: putative late blight resistance p...  63.2    2e-08   
ref|XP_010654564.1|  PREDICTED: jacalin-related lectin 19-like        60.5    2e-08   
ref|XP_009768640.1|  PREDICTED: putative late blight resistance p...  63.2    2e-08   
ref|XP_009768636.1|  PREDICTED: putative late blight resistance p...  63.2    2e-08   
ref|XP_009770862.1|  PREDICTED: putative late blight resistance p...  63.2    2e-08   
ref|XP_010030903.1|  PREDICTED: agglutinin alpha chain-like           58.9    2e-08   
gb|KGN62634.1|  hypothetical protein Csa_2G362470                     62.8    2e-08   
ref|XP_011081586.1|  PREDICTED: jacalin-related lectin 19-like        61.6    2e-08   
ref|XP_009622525.1|  PREDICTED: agglutinin-like isoform X2            62.8    2e-08   
ref|XP_002888904.1|  predicted protein                                60.1    2e-08   
ref|XP_008444758.1|  PREDICTED: LOW QUALITY PROTEIN: myrosinase-b...  62.8    3e-08   
ref|XP_009622524.1|  PREDICTED: mannose/glucose-specific lectin-l...  62.4    3e-08   
emb|CBI35988.3|  unnamed protein product                              60.5    3e-08   
gb|ACF87628.1|  unknown                                               58.9    3e-08   Zea mays [maize]
ref|XP_010267066.1|  PREDICTED: jacalin-related lectin 19             60.1    3e-08   
gb|AFK34206.1|  unknown                                               59.7    3e-08   
ref|NP_001106057.1|  PL3K2                                            59.3    3e-08   Zea mays [maize]
ref|XP_010088386.1|  hypothetical protein L484_008121                 59.7    3e-08   
gb|KDP40814.1|  hypothetical protein JCGZ_24813                       59.7    4e-08   
gb|ACG29554.1|  hypothetical protein                                  59.3    4e-08   Zea mays [maize]
pdb|4MQ0|A  Chain A, Crystal Structure Of Parkia Biglobosa Seed L...  61.6    4e-08   
gb|AAB72098.1|  32 kDa protein                                        61.2    4e-08   Hordeum vulgare [barley]
ref|XP_007024409.1|  Mannose-binding lectin superfamily protein       60.8    4e-08   
ref|NP_001052399.1|  Os04g0295400                                     58.5    5e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010428208.1|  PREDICTED: jacalin-related lectin 19-like is...  58.9    5e-08   
ref|XP_004960459.1|  PREDICTED: salt stress-induced protein-like      58.5    5e-08   
gb|EAY93469.1|  hypothetical protein OsI_15270                        58.5    5e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_006597181.1|  PREDICTED: agglutinin-like isoform X1            61.6    6e-08   
ref|XP_004297619.1|  PREDICTED: agglutinin-like                       60.5    6e-08   
ref|XP_010232948.1|  PREDICTED: jacalin-related lectin 19-like        60.1    6e-08   
ref|XP_009127966.1|  PREDICTED: agglutinin                            58.5    7e-08   
ref|XP_010428207.1|  PREDICTED: jacalin-related lectin 19-like is...  59.3    7e-08   
ref|XP_009338132.1|  PREDICTED: uncharacterized protein LOC103930...  61.2    7e-08   
ref|XP_002450764.1|  hypothetical protein SORBIDRAFT_05g017250        61.6    7e-08   Sorghum bicolor [broomcorn]
ref|XP_010428206.1|  PREDICTED: jacalin-related lectin 19-like is...  59.3    8e-08   
ref|XP_009400545.1|  PREDICTED: agglutinin alpha chain                58.9    8e-08   
gb|AFW81812.1|  putative protein kinase superfamily protein           60.8    9e-08   
gb|EMT07650.1|  Horcolin                                              60.1    9e-08   
ref|XP_006372325.1|  Mannose/glucose-specific lectin family protein   60.5    1e-07   
ref|XP_008656248.1|  PREDICTED: putative receptor-like protein ki...  60.5    1e-07   
gb|EEC72970.1|  hypothetical protein OsI_06866                        61.2    1e-07   Oryza sativa Indica Group [Indian rice]
dbj|BAD23250.1|  putative LZ-NBS-LRR class RGA                        61.2    1e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010232946.1|  PREDICTED: uncharacterized protein LOC104583002  59.3    1e-07   
gb|EMS58273.1|  hypothetical protein TRIUR3_17900                     59.7    1e-07   
ref|XP_008244775.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  59.7    1e-07   
gb|EMT07330.1|  Disease resistance protein RPM1                       60.5    2e-07   
gb|KFK41744.1|  hypothetical protein AALP_AA2G166700                  57.8    2e-07   
ref|XP_010060992.1|  PREDICTED: jacalin-related lectin 3              60.1    2e-07   
ref|XP_009622528.1|  PREDICTED: agglutinin-like isoform X5            59.7    2e-07   
ref|XP_009622527.1|  PREDICTED: agglutinin-like isoform X4            59.7    2e-07   
ref|XP_009608039.1|  PREDICTED: putative late blight resistance p...  60.1    2e-07   
ref|XP_009608038.1|  PREDICTED: putative late blight resistance p...  60.1    2e-07   
ref|XP_009608035.1|  PREDICTED: putative late blight resistance p...  60.1    2e-07   
ref|XP_009622526.1|  PREDICTED: agglutinin-like isoform X3            59.3    2e-07   
gb|KHN30030.1|  Agglutinin alpha chain                                57.0    3e-07   
ref|XP_006595102.1|  PREDICTED: agglutinin                            57.0    3e-07   
ref|XP_011015046.1|  PREDICTED: mannose/glucose-specific lectin-l...  59.3    3e-07   
ref|XP_006597184.1|  PREDICTED: agglutinin-like isoform X4            57.0    3e-07   
gb|KHN32674.1|  Agglutinin alpha chain                                57.0    3e-07   
ref|XP_006663484.1|  PREDICTED: putative disease resistance RPP13...  59.7    3e-07   
ref|XP_011015045.1|  PREDICTED: mannose/glucose-specific lectin-l...  59.3    3e-07   
ref|NP_001148448.1|  jasmonate-induced protein                        57.0    3e-07   Zea mays [maize]
ref|XP_003577374.2|  PREDICTED: mannose/glucose-specific lectin-l...  59.3    3e-07   
ref|XP_009614721.1|  PREDICTED: jacalin-related lectin 19             57.4    3e-07   
ref|XP_004961357.1|  PREDICTED: agglutinin-like                       57.4    3e-07   
ref|XP_004964114.1|  PREDICTED: mannose/glucose-specific lectin-like  55.8    3e-07   
ref|XP_007216928.1|  hypothetical protein PRUPE_ppa016643mg           58.5    4e-07   
ref|XP_006663456.1|  PREDICTED: disease resistance protein RPM1-like  59.3    4e-07   
ref|XP_004984089.1|  PREDICTED: protein GOS9-like                     56.2    4e-07   
ref|XP_002893064.1|  hypothetical protein ARALYDRAFT_472198           59.3    4e-07   
ref|XP_010537548.1|  PREDICTED: LOW QUALITY PROTEIN: jacalin-rela...  56.6    4e-07   
ref|XP_010237569.1|  PREDICTED: mannose/glucose-specific lectin-l...  58.9    4e-07   
ref|XP_011074623.1|  PREDICTED: jacalin-related lectin 3              58.9    4e-07   
emb|CDP17400.1|  unnamed protein product                              58.2    4e-07   
ref|XP_009391787.1|  PREDICTED: agglutinin-like                       57.8    4e-07   
ref|XP_009588771.1|  PREDICTED: agglutinin-like                       58.2    4e-07   
gb|EMS65594.1|  hypothetical protein TRIUR3_06346                     58.2    4e-07   
ref|XP_006838698.1|  hypothetical protein AMTR_s00002p00248970        55.8    4e-07   
ref|XP_002510454.1|  hypothetical protein RCOM_1595950                58.5    5e-07   Ricinus communis
emb|CDY48032.1|  BnaA02g16250D                                        57.4    5e-07   
gb|EAY80990.1|  hypothetical protein OsI_36172                        58.9    5e-07   Oryza sativa Indica Group [Indian rice]
ref|XP_006838705.1|  hypothetical protein AMTR_s00002p00249920        58.5    5e-07   
ref|XP_004291831.1|  PREDICTED: uncharacterized protein LOC101310192  58.5    6e-07   
gb|EMS53468.1|  hypothetical protein TRIUR3_21407                     55.5    6e-07   
ref|XP_008391447.1|  PREDICTED: uncharacterized protein LOC103453663  57.8    6e-07   
ref|XP_009768586.1|  PREDICTED: jacalin-related lectin 3-like         56.6    7e-07   
gb|KDP38566.1|  hypothetical protein JCGZ_04491                       58.2    7e-07   
ref|XP_009784520.1|  PREDICTED: uncharacterized protein LOC104232941  58.5    7e-07   
ref|XP_008782839.1|  PREDICTED: agglutinin alpha chain-like           55.8    7e-07   
ref|NP_849691.1|  Mannose-binding lectin superfamily protein          57.8    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001117315.1|  Mannose-binding lectin superfamily protein       57.8    8e-07   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185041.1|  Mannose-binding lectin superfamily protein       57.8    8e-07   
ref|XP_010231090.1|  PREDICTED: jacalin-related lectin 19-like is...  56.2    9e-07   
emb|CDX82115.1|  BnaC02g21750D                                        56.6    1e-06   
gb|KCW67999.1|  hypothetical protein EUGRSUZ_F01690                   57.8    1e-06   
gb|ABA94728.1|  Jacalin-like lectin domain containing protein         57.8    1e-06   Oryza sativa Japonica Group [Japonica rice]
gb|AFW82809.1|  hypothetical protein ZEAMMB73_630227                  55.8    1e-06   
gb|EMT23136.1|  hypothetical protein F775_18655                       54.3    1e-06   
gb|KCW67998.1|  hypothetical protein EUGRSUZ_F01690                   57.8    1e-06   
ref|XP_011001803.1|  PREDICTED: mannose/glucose-specific lectin-like  57.4    1e-06   
gb|EAZ25557.1|  hypothetical protein OsJ_09383                        54.7    1e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010477196.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    1e-06   
ref|XP_010498396.1|  PREDICTED: pentatricopeptide repeat-containi...  57.8    1e-06   
ref|XP_002893063.1|  jacalin lectin family protein                    57.4    1e-06   
ref|XP_010231089.1|  PREDICTED: jacalin-related lectin 19-like is...  55.8    1e-06   
ref|XP_008783084.1|  PREDICTED: inactive protein RESTRICTED TEV M...  55.5    1e-06   
gb|KHN46147.1|  Agglutinin                                            57.0    2e-06   
ref|XP_010064569.1|  PREDICTED: jacalin-related lectin 4-like         57.4    2e-06   
ref|XP_002510452.1|  pentatricopeptide repeat-containing protein,...  57.4    2e-06   Ricinus communis
gb|EMS51533.1|  hypothetical protein TRIUR3_05238                     56.6    2e-06   
ref|XP_009782510.1|  PREDICTED: jacalin-related lectin 19             55.5    2e-06   
ref|XP_004986922.1|  PREDICTED: horcolin-like                         53.9    2e-06   
ref|XP_010231088.1|  PREDICTED: jacalin-related lectin 19-like is...  56.2    2e-06   
ref|XP_004979669.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.0    2e-06   
gb|EMT18893.1|  Disease resistance protein RPM1                       57.0    2e-06   
ref|XP_010109960.1|  hypothetical protein L484_009242                 55.1    2e-06   
ref|XP_004979671.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.0    2e-06   
ref|XP_004979670.1|  PREDICTED: mannose/glucose-specific lectin-l...  57.0    2e-06   
gb|ABA94732.1|  Jacalin-like lectin domain containing protein, ex...  57.0    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006416472.1|  hypothetical protein EUTSA_v10007145mg           56.6    2e-06   
ref|XP_008651439.1|  PREDICTED: jasmonate-induced protein isoform X1  56.2    2e-06   
gb|KHG26998.1|  Agglutinin                                            56.6    2e-06   
ref|XP_002467725.1|  hypothetical protein SORBIDRAFT_01g033090        54.3    2e-06   Sorghum bicolor [broomcorn]
emb|CAE76026.1|  B1292H11.12                                          54.7    2e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010533565.1|  PREDICTED: jacalin-related lectin 3 isoform X1   56.6    2e-06   
ref|XP_010533571.1|  PREDICTED: jacalin-related lectin 3 isoform X2   56.6    2e-06   
ref|XP_006354454.1|  PREDICTED: probable disease resistance RPP8-...  55.8    3e-06   
ref|XP_009608047.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    3e-06   
tpg|DAA60181.1|  TPA: hypothetical protein ZEAMMB73_326702            55.8    3e-06   
ref|XP_002461768.1|  hypothetical protein SORBIDRAFT_02g007760        55.8    3e-06   Sorghum bicolor [broomcorn]
gb|AAM46813.1|  hessian fly response gene 1 protein                   55.8    3e-06   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001068257.2|  Os11g0607900                                     53.1    3e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654724.1|  PREDICTED: agglutinin-like                       54.7    3e-06   
ref|NP_001104964.1|  beta-glucosidase aggregating factor precursor    55.5    3e-06   Zea mays [maize]
gb|ABJ97445.1|  beta-glucosidase aggregating factor 1                 55.5    3e-06   Zea mays [maize]
ref|XP_003615697.1|  Myrosinase-binding protein-like protein          56.2    3e-06   
gb|EMT33622.1|  Cysteine proteinase RD21a                             56.2    3e-06   
ref|XP_010477195.1|  PREDICTED: jacalin-related lectin 3-like iso...  55.8    3e-06   
ref|XP_004170416.1|  PREDICTED: LOW QUALITY PROTEIN: agglutinin-like  55.5    3e-06   
ref|NP_001141303.1|  uncharacterized protein LOC100273394             55.5    3e-06   Zea mays [maize]
ref|XP_009149456.1|  PREDICTED: agglutinin                            55.8    4e-06   
ref|XP_010477194.1|  PREDICTED: jacalin-related lectin 3-like iso...  55.8    4e-06   
gb|ACN33395.1|  unknown                                               55.5    4e-06   Zea mays [maize]
ref|XP_010459648.1|  PREDICTED: jacalin-related lectin 3 isoform X1   55.8    4e-06   
emb|CDY39357.1|  BnaC05g15300D                                        55.8    4e-06   
ref|XP_008388156.1|  PREDICTED: uncharacterized protein LOC103450568  55.8    4e-06   
dbj|BAJ88436.1|  predicted protein                                    55.8    4e-06   
gb|AAZ73661.1|  At1g19715                                             53.9    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306414.1|  hypothetical protein CARUB_v10012347mg           56.2    4e-06   
gb|AAZ73669.1|  At1g19715-like protein                                53.9    4e-06   Arabidopsis lyrata [lyrate rockcress]
dbj|BAJ85606.1|  predicted protein                                    55.8    4e-06   
ref|XP_009384722.1|  PREDICTED: agglutinin alpha chain-like isofo...  53.9    4e-06   
ref|XP_009384641.1|  PREDICTED: agglutinin alpha chain-like isofo...  53.9    4e-06   
gb|AGT16237.1|  Jacalin-like lectin domain containing protein         55.5    4e-06   
gb|AAZ73664.1|  At1g19715                                             53.5    4e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008656997.1|  PREDICTED: cysteine-rich receptor-like prote...  55.5    4e-06   
ref|XP_006473572.1|  PREDICTED: pentatricopeptide repeat-containi...  55.8    4e-06   
gb|AGT16242.1|  Jacalin-like lectin domain containing protein         55.5    5e-06   
ref|XP_008221341.1|  PREDICTED: uncharacterized protein LOC103321320  55.5    5e-06   
gb|AAZ73652.1|  At1g19715                                             53.5    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009588746.1|  PREDICTED: putative late blight resistance p...  55.8    5e-06   
ref|XP_009588743.1|  PREDICTED: putative late blight resistance p...  55.8    5e-06   
gb|AFW84361.1|  putative protein kinase superfamily protein           55.5    5e-06   
ref|XP_008778289.1|  PREDICTED: mannose/glucose-specific lectin-like  55.1    5e-06   
gb|KDO84683.1|  hypothetical protein CISIN_1g007083mg                 55.1    6e-06   
ref|XP_006654618.1|  PREDICTED: myrosinase-binding protein-like A...  55.1    6e-06   
ref|XP_010092355.1|  hypothetical protein L484_023733                 53.5    6e-06   
ref|XP_006435072.1|  hypothetical protein CICLE_v10000604mg           55.1    7e-06   
ref|XP_006473571.1|  PREDICTED: pentatricopeptide repeat-containi...  55.1    7e-06   
gb|ABC70328.1|  agglutinin isoform                                    54.7    7e-06   
ref|XP_004249154.1|  PREDICTED: jacalin-related lectin 3 isoform X2   55.1    7e-06   
gb|KDO84682.1|  hypothetical protein CISIN_1g007083mg                 55.1    7e-06   
ref|NP_001055995.1|  Os05g0508400                                     55.1    7e-06   
ref|XP_004980504.1|  PREDICTED: protein GOS9-like                     52.4    7e-06   
ref|XP_006362247.1|  PREDICTED: myrosinase-binding protein-like A...  55.1    8e-06   
sp|P82859.1|LECA_CASCR  RecName: Full=Agglutinin; AltName: Full=CCA   54.3    8e-06   
gb|AAL10685.1|  mannose-binding lectin                                52.8    8e-06   
ref|XP_010312054.1|  PREDICTED: jacalin-related lectin 3 isoform X1   55.1    8e-06   
ref|XP_010236764.1|  PREDICTED: jacalin-related lectin 19-like        52.8    8e-06   
gb|EAY98637.1|  hypothetical protein OsI_20561                        55.1    8e-06   
ref|XP_006362248.1|  PREDICTED: myrosinase-binding protein-like A...  54.7    8e-06   
ref|XP_010026053.1|  PREDICTED: jacalin-related lectin 3-like         53.9    9e-06   
gb|EEE64302.1|  hypothetical protein OsJ_19139                        55.1    9e-06   
gb|ABA94721.1|  Jacalin-like lectin domain containing protein         54.7    9e-06   
gb|EAY90359.1|  hypothetical protein OsI_11939                        52.4    1e-05   
ref|XP_007017648.1|  Mannose-binding lectin superfamily protein, ...  54.7    1e-05   
ref|XP_007017646.1|  Mannose-binding lectin superfamily protein, ...  54.7    1e-05   
gb|EMT07446.1|  hypothetical protein F775_10439                       53.9    1e-05   
ref|XP_010233169.1|  PREDICTED: jacalin-related lectin 3-like         54.7    1e-05   
ref|XP_010932970.1|  PREDICTED: mannose/glucose-specific lectin-l...  53.1    1e-05   
ref|XP_002467724.1|  hypothetical protein SORBIDRAFT_01g033080        52.4    1e-05   
ref|XP_009599288.1|  PREDICTED: jacalin-related lectin 3 isoform X1   54.7    1e-05   
ref|XP_008377187.1|  PREDICTED: uncharacterized protein LOC103440289  54.3    1e-05   
ref|XP_011028924.1|  PREDICTED: uncharacterized protein LOC105128...  54.7    1e-05   
ref|XP_006662244.1|  PREDICTED: uncharacterized protein LOC102708001  53.9    1e-05   
ref|XP_009760249.1|  PREDICTED: agglutinin-like                       53.9    1e-05   
gb|EMT07336.1|  hypothetical protein F775_29709                       53.9    1e-05   
ref|XP_009599289.1|  PREDICTED: jacalin-related lectin 3 isoform X2   54.3    1e-05   
ref|XP_008782838.1|  PREDICTED: agglutinin alpha chain-like           52.8    1e-05   
ref|XP_007222058.1|  hypothetical protein PRUPE_ppa003185mg           54.3    1e-05   
ref|XP_009608045.1|  PREDICTED: putative late blight resistance p...  54.3    1e-05   
ref|XP_009608041.1|  PREDICTED: putative late blight resistance p...  54.3    1e-05   
gb|AHW81907.1|  mannose-binding lectin                                52.0    2e-05   
gb|KFK44089.1|  hypothetical protein AALP_AA1G214700                  53.9    2e-05   
ref|XP_010664949.1|  PREDICTED: pentatricopeptide repeat-containi...  54.3    2e-05   
ref|XP_008804539.1|  PREDICTED: mannose/glucose-specific lectin-like  51.6    2e-05   
ref|XP_010910707.1|  PREDICTED: jacalin-related lectin 3-like         52.4    2e-05   
gb|AAK55472.1|AC084295_5  putative salt-induced protein               52.4    2e-05   
ref|XP_004977415.1|  PREDICTED: uncharacterized protein LOC101784...  53.5    2e-05   
ref|XP_002449838.1|  hypothetical protein SORBIDRAFT_05g024220        53.5    2e-05   
gb|EEE60415.1|  hypothetical protein OsJ_13609                        50.8    2e-05   
ref|XP_002281330.1|  PREDICTED: jacalin-related lectin 19-like        52.0    2e-05   
ref|XP_004164005.1|  PREDICTED: agglutinin-like                       52.0    2e-05   
pdb|1TOQ|A  Chain A, Crystal Structure Of A Galactose Specific Le...  51.2    2e-05   
ref|XP_008677995.1|  PREDICTED: mannose/glucose-specific lectin-l...  53.9    2e-05   
ref|XP_008677993.1|  PREDICTED: mannose/glucose-specific lectin-l...  53.9    2e-05   
gb|ABF96452.1|  Jacalin-like lectin domain containing protein, ex...  52.0    2e-05   
ref|XP_010935305.1|  PREDICTED: jacalin-related lectin 3-like         53.5    2e-05   
ref|XP_009407881.1|  PREDICTED: inactive protein RESTRICTED TEV M...  52.0    2e-05   
gb|AAB22274.1|  jacalin heavy chain, agglutinin heavy chain=Thoms...  51.2    2e-05   
sp|Q5U9T2.1|LECH_HORVU  RecName: Full=Horcolin; AltName: Full=Agg...  51.2    2e-05   
ref|XP_006651478.1|  PREDICTED: horcolin-like                         51.6    2e-05   
ref|XP_009602425.1|  PREDICTED: mannose/glucose-specific lectin-like  50.8    2e-05   
ref|XP_009771019.1|  PREDICTED: jacalin-related lectin 3 isoform X1   53.5    2e-05   
sp|P18674.2|LECA_MACPO  RecName: Full=Agglutinin alpha chain; Alt...  50.8    2e-05   
ref|XP_009771020.1|  PREDICTED: jacalin-related lectin 3 isoform X2   53.5    2e-05   
ref|XP_010932961.1|  PREDICTED: mannose/glucose-specific lectin-l...  53.1    2e-05   
emb|CBI35989.3|  unnamed protein product                              52.4    2e-05   
emb|CDM80401.1|  unnamed protein product                              52.8    2e-05   
emb|CAE76030.1|  B1292H11.16                                          50.8    3e-05   
ref|XP_002300741.2|  hypothetical protein POPTR_0002s03180g           53.1    3e-05   
emb|CDM80828.1|  unnamed protein product                              50.8    3e-05   
gb|EMT07620.1|  hypothetical protein F775_29169                       52.8    3e-05   
ref|NP_001050311.2|  Os03g0399800                                     52.0    3e-05   
ref|XP_004979688.1|  PREDICTED: mannose/glucose-specific lectin-like  52.8    3e-05   
ref|XP_004979687.1|  PREDICTED: myrosinase-binding protein-like A...  52.8    3e-05   
ref|NP_001056189.1|  Os05g0541800                                     50.8    3e-05   
ref|XP_010674585.1|  PREDICTED: uncharacterized protein LOC104890703  53.1    3e-05   
ref|XP_004490606.1|  PREDICTED: mannose/glucose-specific lectin-l...  53.1    3e-05   
ref|XP_010932865.1|  PREDICTED: jacalin-related lectin 3-like iso...  52.0    4e-05   
emb|CDM86052.1|  unnamed protein product                              52.4    4e-05   
gb|AFW74848.1|  hypothetical protein ZEAMMB73_609032                  50.4    4e-05   
ref|XP_004490607.1|  PREDICTED: mannose/glucose-specific lectin-l...  52.8    4e-05   
emb|CDM86063.1|  unnamed protein product                              52.8    4e-05   
ref|XP_010932856.1|  PREDICTED: mannose/glucose-specific lectin-l...  52.0    4e-05   
gb|EEE52450.1|  hypothetical protein OsJ_34606                        52.4    4e-05   
gb|AAA32679.1|  jacalin                                               51.6    4e-05   
ref|WP_014434222.1|  hypothetical protein                             52.4    4e-05   
ref|XP_008466548.1|  PREDICTED: agglutinin-like                       52.4    4e-05   
ref|XP_010029921.1|  PREDICTED: jacalin-related lectin 4-like iso...  52.8    5e-05   
ref|XP_010227994.1|  PREDICTED: jacalin-related lectin 3-like         52.0    5e-05   
ref|XP_006662272.1|  PREDICTED: uncharacterized protein LOC102701759  52.0    5e-05   
ref|XP_010029920.1|  PREDICTED: myrosinase-binding protein 2-like...  52.8    5e-05   
ref|XP_002883010.1|  jacalin lectin family protein                    52.4    5e-05   
pdb|1XXQ|A  Chain A, Structure Of A Mannose-Specific Jacalin-Rela...  50.4    5e-05   
ref|XP_010029918.1|  PREDICTED: jacalin-related lectin 4-like iso...  52.8    5e-05   
ref|XP_010110012.1|  hypothetical protein L484_021901                 52.4    6e-05   
ref|XP_004974871.1|  PREDICTED: mannose/glucose-specific lectin-like  51.6    6e-05   
gb|EEE59214.1|  hypothetical protein OsJ_11170                        52.0    6e-05   
ref|XP_003561042.1|  PREDICTED: jacalin-related lectin 3-like         52.0    6e-05   
ref|XP_011028923.1|  PREDICTED: jacalin-related lectin 3-like iso...  52.4    6e-05   
ref|XP_010110011.1|  hypothetical protein L484_021900                 52.4    6e-05   
pdb|3P8S|A  Chain A, Crystal Structure Of Single Chain Recombinan...  50.1    7e-05   
ref|XP_009336846.1|  PREDICTED: uncharacterized protein LOC103929382  52.0    7e-05   
gb|KDP38344.1|  hypothetical protein JCGZ_04269                       52.0    7e-05   
gb|EEE68468.1|  hypothetical protein OsJ_26865                        52.0    7e-05   
emb|CDY63700.1|  BnaC08g19180D                                        51.6    8e-05   
gb|AAA32678.1|  jacalin                                               50.8    8e-05   
emb|CBI19765.3|  unnamed protein product                              52.0    8e-05   
gb|AAA32680.1|  jacalin                                               50.8    9e-05   
sp|P18670.2|LECA_ARTIN  RecName: Full=Agglutinin alpha chain; Alt...  49.3    9e-05   
pdb|1UGW|A  Chain A, Crystal Structure Of Jacalin- Gal Complex        49.3    9e-05   
ref|XP_009110261.1|  PREDICTED: agglutinin-like                       51.6    9e-05   
gb|EMS51477.1|  Mannose/glucose-specific lectin                       51.2    9e-05   
ref|XP_009614655.1|  PREDICTED: mannose/glucose-specific lectin-like  49.7    9e-05   
emb|CDX96652.1|  BnaA08g21950D                                        51.6    1e-04   
gb|EMS46735.1|  hypothetical protein TRIUR3_02016                     51.2    1e-04   
ref|XP_007146775.1|  hypothetical protein PHAVU_006G068800g           51.6    1e-04   
pdb|4AKB|A  Chain A, Structure Of Galactose Binding Lectin From C...  49.3    1e-04   
pdb|4AK4|A  Chain A, High Resolution Structure Of Galactose Bindi...  49.3    1e-04   
gb|EMT07556.1|  hypothetical protein F775_11805                       48.9    1e-04   
ref|XP_008466547.1|  PREDICTED: uncharacterized protein LOC103503932  51.6    1e-04   
ref|NP_001183767.1|  hypothetical protein                             49.7    1e-04   
gb|AAL09163.1|  galactose-binding lectin                              50.4    1e-04   
gb|EAY92859.1|  hypothetical protein OsI_14658                        50.8    1e-04   
gb|AAB23126.1|  jacalin minor alpha'-subunit=65 kda lectin minor ...  48.9    1e-04   
emb|CDP07465.1|  unnamed protein product                              51.2    1e-04   
gb|EMT31922.1|  hypothetical protein F775_02779                       49.7    2e-04   
ref|NP_001176790.1|  Os12g0144100                                     48.1    2e-04   
ref|XP_010239309.1|  PREDICTED: LOW QUALITY PROTEIN: protein GOS9...  50.4    2e-04   
gb|AFW74847.1|  hypothetical protein ZEAMMB73_609032                  50.4    2e-04   
ref|XP_008466552.1|  PREDICTED: agglutinin-like                       49.3    2e-04   
gb|EMS65495.1|  hypothetical protein TRIUR3_18396                     50.8    2e-04   
gb|AFW74846.1|  hypothetical protein ZEAMMB73_609032                  50.1    2e-04   
gb|EEE55471.1|  hypothetical protein OsJ_03649                        50.8    2e-04   
gb|EEC71570.1|  hypothetical protein OsI_03937                        50.8    2e-04   
ref|XP_007142199.1|  hypothetical protein PHAVU_008G260500g           50.8    2e-04   
ref|XP_007142198.1|  hypothetical protein PHAVU_008G260500g           50.4    2e-04   
ref|XP_003575754.1|  PREDICTED: uncharacterized protein LOC100829827  50.4    2e-04   
ref|XP_004500273.1|  PREDICTED: agglutinin-like                       50.4    2e-04   
ref|XP_010099935.1|  hypothetical protein L484_020123                 49.7    2e-04   
ref|XP_006372328.1|  hypothetical protein POPTR_0017s00620g           48.5    2e-04   
gb|EEC79620.1|  hypothetical protein OsI_20824                        49.7    2e-04   
ref|XP_006383725.1|  hypothetical protein POPTR_0005s25400g           50.4    2e-04   
ref|XP_004147878.1|  PREDICTED: uncharacterized protein LOC101206314  50.4    2e-04   
ref|XP_008677749.1|  PREDICTED: hypothetical protein isoform X1       50.1    2e-04   
ref|XP_010029744.1|  PREDICTED: jacalin-related lectin 4-like         50.4    2e-04   
ref|XP_010928799.1|  PREDICTED: jacalin-related lectin 19-like        49.3    2e-04   
emb|CDM86053.1|  unnamed protein product                              50.1    3e-04   
ref|XP_008677750.1|  PREDICTED: hypothetical protein isoform X2       49.7    3e-04   
emb|CDM83580.1|  unnamed protein product                              50.1    3e-04   
ref|XP_010092351.1|  hypothetical protein L484_023729                 49.3    3e-04   
gb|EYU34206.1|  hypothetical protein MIMGU_mgv1a025615mg              50.1    3e-04   
ref|XP_003573736.1|  PREDICTED: jacalin-related lectin 9-like         50.1    3e-04   
ref|XP_006644795.1|  PREDICTED: mannose/glucose-specific lectin-like  50.1    3e-04   
dbj|BAA32786.3|  VER2                                                 49.7    3e-04   
gb|AAA32677.1|  jacalin                                               49.3    3e-04   
ref|XP_010099937.1|  hypothetical protein L484_020125                 49.7    3e-04   
ref|XP_011048835.1|  PREDICTED: jacalin-related lectin 3-like iso...  50.1    3e-04   
ref|XP_011048836.1|  PREDICTED: jacalin-related lectin 3-like iso...  50.1    3e-04   
gb|EMT28373.1|  hypothetical protein F775_25915                       49.7    3e-04   
gb|AFW74852.1|  hypothetical protein ZEAMMB73_609032                  49.7    4e-04   
ref|XP_004154909.1|  PREDICTED: uncharacterized protein LOC101231870  49.7    4e-04   
ref|XP_010091770.1|  hypothetical protein L484_000767                 48.1    4e-04   
ref|XP_003573652.1|  PREDICTED: horcolin-like                         47.0    4e-04   
ref|XP_003567168.1|  PREDICTED: jacalin-related lectin 3-like         49.7    4e-04   
ref|XP_010100192.1|  hypothetical protein L484_015337                 47.8    4e-04   
ref|XP_002440040.1|  hypothetical protein SORBIDRAFT_09g024950        49.7    4e-04   
gb|EYU36743.1|  hypothetical protein MIMGU_mgv1a007927mg              49.3    5e-04   
ref|XP_004970153.1|  PREDICTED: myrosinase-binding protein-like A...  49.7    5e-04   
gb|KDP38565.1|  hypothetical protein JCGZ_04490                       49.7    5e-04   
gb|ACR38528.1|  unknown                                               48.9    5e-04   
gb|ABA96465.1|  Protein GOS9, putative                                47.4    5e-04   
ref|XP_010029904.1|  PREDICTED: jacalin-related lectin 4-like         49.7    5e-04   
ref|XP_004960702.1|  PREDICTED: mannose/glucose-specific lectin-like  49.3    5e-04   
ref|XP_008648490.1|  PREDICTED: salt stress-induced protein-like      47.4    5e-04   
ref|NP_001140746.1|  hypothetical protein                             49.3    5e-04   
gb|EMS47771.1|  hypothetical protein TRIUR3_34363                     47.4    5e-04   
gb|AFW74546.1|  hypothetical protein ZEAMMB73_667809                  47.4    5e-04   
gb|KCW56858.1|  hypothetical protein EUGRSUZ_I02520                   49.7    5e-04   
ref|XP_008804538.1|  PREDICTED: uncharacterized protein LOC103717797  49.3    5e-04   
ref|XP_009413935.1|  PREDICTED: protein GOS9-like                     47.4    6e-04   
gb|ACF78865.1|  unknown                                               48.9    6e-04   
ref|XP_002439535.1|  hypothetical protein SORBIDRAFT_09g010668        47.4    6e-04   
gb|KDP26963.1|  hypothetical protein JCGZ_22259                       48.9    6e-04   
ref|XP_003578760.1|  PREDICTED: mannose/glucose-specific lectin-like  48.9    7e-04   
dbj|BAE95375.1|  lectin                                               48.9    7e-04   
gb|AAQ07258.1|  jacalin-like lectin                                   47.4    7e-04   
gb|AFW74842.1|  hypothetical protein ZEAMMB73_660308                  48.1    7e-04   
ref|XP_004980207.1|  PREDICTED: mannose/glucose-specific lectin-like  45.8    7e-04   
ref|XP_011048832.1|  PREDICTED: jacalin-related lectin 3-like iso...  48.9    7e-04   
ref|XP_003578759.1|  PREDICTED: mannose/glucose-specific lectin-like  48.5    7e-04   
gb|ACN35569.1|  unknown                                               48.5    7e-04   
tpg|DAA39774.1|  TPA: hypothetical protein ZEAMMB73_034611            47.4    7e-04   
ref|XP_011048833.1|  PREDICTED: jacalin-related lectin 3-like iso...  48.9    7e-04   
dbj|BAO09555.1|  mannose-binding lectin b                             47.4    7e-04   
ref|NP_001142347.1|  uncharacterized protein LOC100274518             48.5    8e-04   
ref|XP_004961574.1|  PREDICTED: mannose/glucose-specific lectin-like  48.9    8e-04   
ref|XP_004147859.1|  PREDICTED: myrosinase-binding protein-like A...  48.5    9e-04   
ref|XP_006383724.1|  hypothetical protein POPTR_0005s25390g           48.9    9e-04   
gb|EMT16343.1|  Cysteine-rich receptor-like protein kinase 41         48.9    9e-04   
ref|XP_008657187.1|  PREDICTED: agglutinin-like                       48.5    0.001   
ref|XP_009413293.1|  PREDICTED: protein GOS9-like                     46.6    0.001   
ref|XP_006602089.1|  PREDICTED: agglutinin-like                       48.5    0.001   



>gb|AAG10403.1|AF233284_1 mannose-binding lectin [Convolvulus arvensis]
Length=152

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 107/151 (71%), Gaps = 7/151 (5%)
 Frame = +3

Query  99   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEti  278
            M VPID +SGP GN+GG+FWSFRP NKINQIVI      N  PI +TFS    D SK+TI
Sbjct  1    MTVPIDTISGPWGNNGGNFWSFRPINKINQIVITYSAGNN--PIALTFSATKADGSKDTI  58

Query  279  tvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPY  458
            TVGG G D++       I    ADEY+T I GTFG ++D++  VLRSIKF TN++ +GPY
Sbjct  59   TVGGAGPDSITGTDTVDIG---ADEYVTGISGTFGIYLDNN--VLRSIKFITNLKAYGPY  113

Query  459  GPNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
            GPNVG+PF  +   G +IVGF+GR+G+YVDA
Sbjct  114  GPNVGTPFSSENVVGNEIVGFLGRSGYYVDA  144



>gb|AAC49564.1| lectin [Calystegia sepium]
Length=153

 Score =   131 bits (330),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 108/151 (72%), Gaps = 6/151 (4%)
 Frame = +3

Query  99   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEti  278
            MAVP+D +SGP GN+GG+FWSFRP NKINQIVI  GG GNN PI +TFS    D SK+TI
Sbjct  1    MAVPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNN-PIALTFSSTKADGSKDTI  59

Query  279  tvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPY  458
            TVGGGG D++       I     DEYLT I GTFG ++D++  VLRSI FTTN++  GPY
Sbjct  60   TVGGGGPDSITGTEMVNIG---TDEYLTGISGTFGIYLDNN--VLRSITFTTNLKAHGPY  114

Query  459  GPNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
            G  VG+PF      G +IVGF+GR+G+YVDA
Sbjct  115  GQKVGTPFSSANVVGNEIVGFLGRSGYYVDA  145



>pdb|1OUW|A Chain A, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|B Chain B, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|C Chain C, Crystal Structure Of Calystegia Sepium Agglutinin
 pdb|1OUW|D Chain D, Crystal Structure Of Calystegia Sepium Agglutinin
Length=152

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 106/149 (71%), Gaps = 6/149 (4%)
 Frame = +3

Query  105  VPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitv  284
            VP+D +SGP GN+GG+FWSFRP NKINQIVI  GG GNN PI +TFS    D SK+TITV
Sbjct  2    VPMDTISGPWGNNGGNFWSFRPVNKINQIVISYGGGGNN-PIALTFSSTKADGSKDTITV  60

Query  285  ggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP  464
            GGGG D++       I     DEYLT I GTFG ++D++  VLRSI FTTN++  GPYG 
Sbjct  61   GGGGPDSITGTEMVNIG---TDEYLTGISGTFGIYLDNN--VLRSITFTTNLKAHGPYGQ  115

Query  465  NVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
             VG+PF      G +IVGF+GR+G+YVDA
Sbjct  116  KVGTPFSSANVVGNEIVGFLGRSGYYVDA  144



>dbj|BAA14024.1| ipomoelin [Ipomoea batatas]
Length=154

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 85/153 (56%), Gaps = 13/153 (8%)
 Frame = +3

Query  99   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggs--gnnnPIGITFSCINEDDSKE  272
            +A   DA SGP+G++GG FWSFRP   +N+IV+   GS     N I ITFS    D    
Sbjct  5    LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTD----  60

Query  273  titvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFG  452
                       +     T     + D  + EI G    +    Y+V+RSIKFTTN +E+G
Sbjct  61   -----IITVGGVGPEPLTYTETVNIDGDIIEISGMIANY--KGYNVIRSIKFTTNKKEYG  113

Query  453  PYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
            PYG N G+PF+ + PDG KIVGF G +G+YVDA
Sbjct  114  PYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDA  146



>pdb|3R50|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R50|E Chain E, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R51|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|3R52|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|A Chain A, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|B Chain B, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|C Chain C, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
 pdb|4DDN|D Chain D, Structure Analysis Of A Wound-Inducible Lectin Ipomoelin 
From Sweet Potato
Length=160

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 85/153 (56%), Gaps = 13/153 (8%)
 Frame = +3

Query  99   MAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggs--gnnnPIGITFSCINEDDSKE  272
            +A   DA SGP+G++GG FWSFRP   +N+IV+   GS     N I ITFS    D    
Sbjct  11   LAAHSDARSGPVGSNGGQFWSFRPVRPLNKIVLSFSGSPDQTLNLISITFSSNPTD----  66

Query  273  titvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFG  452
                       +     T     + D  + EI G    +    Y+V+RSIKFTTN +E+G
Sbjct  67   -----IITVGGVGPEPLTYTETVNIDGDIIEISGMIANY--KGYNVIRSIKFTTNKKEYG  119

Query  453  PYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
            PYG N G+PF+ + PDG KIVGF G +G+YVDA
Sbjct  120  PYGANAGTPFNIKIPDGNKIVGFFGNSGWYVDA  152



>gb|AAA87042.1| putative 32.7 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72097.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A E++ E+ GTFG +  D ++++ S+KF TNV+ +GP+G   G+PF   A     IVGF 
Sbjct  228  ASEFMKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIPAQKNSSIVGFF  287

Query  525  GRAGFYVDA  551
            GR+G Y+DA
Sbjct  288  GRSGIYLDA  296



>ref|XP_006853911.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
 gb|ERN15378.1| hypothetical protein AMTR_s00036p00183970 [Amborella trichopoda]
Length=126

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E++T + G + P V     V+RS+KF TN + +GPYG   G+PF F   DG  IVGF G
Sbjct  22   EEFITGVSGHYSPMVHSGTPVIRSLKFATNRKTYGPYGVEEGTPFSFPM-DGGHIVGFKG  80

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  81   RSGWYLDA  88



>ref|XP_004298564.1| PREDICTED: uncharacterized protein LOC101299670 [Fragaria vesca 
subsp. vesca]
Length=890

 Score = 70.5 bits (171),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V+RS+KF +N R FGP+G   G+PF F   DG KIVG  G
Sbjct  781  DEFLVSVSGHYCPVVYGGSPVIRSLKFESNRRTFGPFGVEEGTPFTFTV-DGGKIVGLKG  839

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  840  RGGWYLDA  847



>gb|ABA93998.1| NB-ARC domain containing protein, expressed [Oryza sativa Japonica 
Group]
Length=1384

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E+L E+ GTFG F   +  ++ S+ F TN + +GPYG   G+PFH        IVGF GR
Sbjct  1041  EFLVEVSGTFGRF-RAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFFGR  1099

Query  531   AGFYVDA  551
             AG+YVDA
Sbjct  1100  AGWYVDA  1106


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + GTFG + + SY V+ SI   TN+  +GP+G   G  F+F       IVGF G 
Sbjct  1150  ELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGH  1208

Query  531   AGFYVDA  551
             A  Y+DA
Sbjct  1209  AELYIDA  1215



>ref|XP_009772163.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009772164.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X3 [Nicotiana sylvestris]
Length=1547

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G + G  W+++  + I +I+I  G   +     I F  I E    +  T        
Sbjct  174  GPWGGTSGSEWNYKLKHPIKEILIAHGYFID----SIMFRTITE----QGTTTDSQKFGG  225

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I     EYLT I GTFG + D  + V++S+ F TN   +GP+G N G +PF
Sbjct  226  NGGRINKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  283

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF GR+GFY+DA
Sbjct  284  SLVMKEGVAIVGFHGRSGFYLDA  306


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSPFHFQAPDGKKIVGFIG  527
            E LT I GT G F  + + V++S+ FTTNV+ +GP+G    G+PF     +G  I+GF G
Sbjct  35   ERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTPFSHVMKEGGAIMGFHG  92

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  93   RCGEYLDA  100



>ref|XP_009772162.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X2 [Nicotiana sylvestris]
Length=1598

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G + G  W+++  + I +I+I  G   +     I F  I E    +  T        
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFID----SIMFRTITE----QGTTTDSQKFGG  277

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I     EYLT I GTFG + D  + V++S+ F TN   +GP+G N G +PF
Sbjct  278  NGGRINKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  335

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF GR+GFY+DA
Sbjct  336  SLVMKEGVAIVGFHGRSGFYLDA  358


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +3

Query  126  GPLGN-SGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtd  302
            GP G+ SGG  W+++  N I +I+I  G + N     I F  I E    +  T+      
Sbjct  19   GPWGDTSGGSEWNYKLKNPIKEILIAHGDAIN----SIMFRTITE----QGTTINSQKFG  70

Query  303  tlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSP  479
                + + V+ ++   E LT I GT G F  + + V++S+ FTTNV+ +GP+G    G+P
Sbjct  71   GNGGQINKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTP  128

Query  480  FHFQAPDGKKIVGFIGRAGFYVDA  551
            F     +G  I+GF GR G Y+DA
Sbjct  129  FSHVMKEGGAIMGFHGRCGEYLDA  152



>ref|XP_009772161.1| PREDICTED: putative late blight resistance protein homolog R1B-8 
isoform X1 [Nicotiana sylvestris]
Length=1599

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 51/143 (36%), Positives = 73/143 (51%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G + G  W+++  + I +I+I  G   +     I F  I E    +  T        
Sbjct  226  GPWGGTSGSEWNYKLKHPIKEILIAHGYFID----SIMFRTITE----QGTTTDSQKFGG  277

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I     EYLT I GTFG + D  + V++S+ F TN   +GP+G N G +PF
Sbjct  278  NGGRINKVVIAATPSEYLTGIKGTFGCYYD--HCVIKSLCFITNANNYGPFGSNAGGTPF  335

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF GR+GFY+DA
Sbjct  336  SLVMKEGVAIVGFHGRSGFYLDA  358


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 50/144 (35%), Positives = 76/144 (53%), Gaps = 12/144 (8%)
 Frame = +3

Query  126  GPLGN-SGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtd  302
            GP G+ SGG  W+++  N I +I+I  G + N     I F  I E    +  T+      
Sbjct  19   GPWGDTSGGSEWNYKLKNPIKEILIAHGDAIN----SIMFRTITE----QGTTINSQKFG  70

Query  303  tlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSP  479
                + + V+ ++   E LT I GT G F  + + V++S+ FTTNV+ +GP+G    G+P
Sbjct  71   GNGGQINKVVFEETPLERLTGIKGTLGRF--NGHLVVKSLCFTTNVKNYGPFGSEGGGTP  128

Query  480  FHFQAPDGKKIVGFIGRAGFYVDA  551
            F     +G  I+GF GR G Y+DA
Sbjct  129  FSHVMKEGGAIMGFHGRCGEYLDA  152



>gb|EMS66150.1| hypothetical protein TRIUR3_12251 [Triticum urartu]
Length=307

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A E++ E+ GT+G +  D ++++ S+KF TNV+ +GP+G   G+PF     +   IVGF 
Sbjct  231  ASEFVKEVSGTYGIYDADQHNIIMSLKFITNVKAYGPFGEANGTPFTIPVENNSSIVGFF  290

Query  525  GRAGFYVDA  551
            GR+G Y+DA
Sbjct  291  GRSGIYLDA  299



>ref|XP_006853910.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
 gb|ERN15377.1| hypothetical protein AMTR_s00036p00183430 [Amborella trichopoda]
Length=191

 Score = 66.6 bits (161),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E++TE+ G + P V     V+RS+KFTTN+R +GPYG   G+PF     DG  IVGF G
Sbjct  90   EEFITEVSGHYCPVVHGGTPVIRSLKFTTNMRTYGPYGVEEGTPFSCPM-DGGLIVGFKG  148

Query  528  RAGFYVDA  551
            R G+Y+D+
Sbjct  149  RNGWYLDS  156



>gb|EEE52195.1| hypothetical protein OsJ_34074 [Oryza sativa Japonica Group]
Length=1311

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 32/67 (48%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E+L E+ GTFG F   +  ++ S+ F TN + +GPYG   G+PFH        IVGF GR
Sbjct  973   EFLVEVSGTFGRF-RAALDIITSLTFVTNAQSYGPYGQREGTPFHISVQSRGCIVGFFGR  1031

Query  531   AGFYVDA  551
             AG+YVDA
Sbjct  1032  AGWYVDA  1038


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + GTFG + + SY V+ SI   TN+  +GP+G   G  F+F       IVGF G 
Sbjct  1082  ELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGH  1140

Query  531   AGFYVDA  551
             A  Y+DA
Sbjct  1141  AELYIDA  1147


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 2/68 (3%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++T++ GTFGPF +    V+ S+ F  N   ++GP+G   G+PFH        IVGF G
Sbjct  1237  EFITKVHGTFGPFGEFPI-VITSLTFINNAGHQYGPFGQGGGTPFHAPISGNGSIVGFFG  1295

Query  528   RAGFYVDA  551
               G  ++A
Sbjct  1296  HQGACLEA  1303



>gb|AAA87041.1| putative 32.6 kDa jasmonate-induced protein [Hordeum vulgare 
subsp. vulgare]
 gb|AAB72096.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 44/69 (64%), Gaps = 0/69 (0%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A E++ E+ GTFG +  D ++++ S+KF TNV+ +GP+G   G+PF         IVGF 
Sbjct  228  ASEFVKEVSGTFGIYDKDRHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIVGFF  287

Query  525  GRAGFYVDA  551
             R+G Y+DA
Sbjct  288  ARSGIYLDA  296



>ref|NP_001066367.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|ABA96667.1| jasmonate-induced protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF29386.1| Os12g0198700 [Oryza sativa Japonica Group]
 gb|EAY82558.1| hypothetical protein OsI_37779 [Oryza sativa Indica Group]
 gb|EAZ19941.1| hypothetical protein OsJ_35533 [Oryza sativa Japonica Group]
Length=307

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            + E+L E+ GTFGP+  + + V+RSIKF TN + +GP+G   G+PF     +   IVGF 
Sbjct  233  SSEFLKEVSGTFGPY--EGWKVIRSIKFVTNKKTYGPFGRQEGTPFSVPVQNNSTIVGFF  290

Query  525  GRAGFYVDA  551
            GR+G Y+D 
Sbjct  291  GRSGKYLDT  299



>ref|XP_011030089.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
 ref|XP_011030090.1| PREDICTED: jacalin-related lectin 19 [Populus euphratica]
Length=191

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT + G + P V     V+RS+ F++N R FGP+G   G+PF   + DG  IVGF G
Sbjct  84   EEYLTSVSGHYCPVVYGGSPVIRSLTFSSNKRTFGPFGVEEGTPFTL-SMDGASIVGFKG  142

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  143  RSGWYLDA  150



>ref|XP_006853909.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
 gb|ERN15376.1| hypothetical protein AMTR_s00036p00182710 [Amborella trichopoda]
Length=196

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E++TE+ G + P V     V+RS+KF T+ R +GPYG   G+PF F   DG  IVGF G
Sbjct  92   EEFITEVSGHYCPVVHGGTPVIRSLKFITSKRTYGPYGVEEGTPFSFLM-DGGLIVGFKG  150

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  151  RNGWYLDA  158



>ref|XP_007215056.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
 gb|EMJ16255.1| hypothetical protein PRUPE_ppa012210mg [Prunus persica]
Length=179

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     ++RS+KF +N R FGPYG   G+PF F   DG KIVG  G
Sbjct  82   DEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFSV-DGGKIVGLKG  140

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  141  RNGWYLDA  148



>gb|EAZ01021.1| hypothetical protein OsI_23055 [Oryza sativa Indica Group]
Length=694

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPD-GKKIVGFIG  527
            EYL EI GT GPF    + V+ S+   T +R +GPYG  VG+PFH    + G  IVGF  
Sbjct  314  EYLIEISGTVGPFTYAPHGVITSLTLVTTIRTYGPYGELVGNPFHIPMQNKGGSIVGFFA  373

Query  528  RAGFYVDA  551
            R G+YVDA
Sbjct  374  RVGWYVDA  381



>ref|XP_002318228.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
 gb|EEE96448.2| hypothetical protein POPTR_0012s13320g [Populus trichocarpa]
Length=237

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT + G + P V     V+RS+ F++N R FGP+G   G+PF   + DG  IVGF G
Sbjct  130  EEYLTSVSGHYCPVVYGGSPVIRSLAFSSNKRTFGPFGVEEGTPFTL-SMDGASIVGFKG  188

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  189  RGGWYLDA  196



>ref|XP_008244753.1| PREDICTED: agglutinin-like [Prunus mume]
Length=179

 Score = 65.1 bits (157),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     ++RS+KF +N R FGPYG   G+PF F   DG KIVG  G
Sbjct  82   DEFLVSVSGHYCPMVYGGGPIIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGKIVGLKG  140

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  141  RNGWYLDA  148



>ref|XP_004298563.1| PREDICTED: myrosinase-binding protein-like At2g25980-like [Fragaria 
vesca subsp. vesca]
Length=379

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 2/70 (3%)
 Frame = +3

Query  348  DEYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            DE+L  + G +    ++  +  VLRS+KF TN R FGP+G  VG+PF F+  DG KIVGF
Sbjct  113  DEFLVSVSGYYCGVTWIVGAPVVLRSLKFETNKRTFGPFGVEVGTPFTFRVKDGVKIVGF  172

Query  522  IGRAGFYVDA  551
             GR G+Y+DA
Sbjct  173  KGRNGWYLDA  182


 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 46/70 (66%), Gaps = 2/70 (3%)
 Frame = +3

Query  348  DEYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            +E++  + G +G   ++  +  VL S++F +N R FGP+G  VG+PF F+  DG +IVG 
Sbjct  265  NEFIVSVTGHYGGVTWIVGAPVVLLSLRFESNRRTFGPFGVQVGTPFTFRVKDGDQIVGL  324

Query  522  IGRAGFYVDA  551
             GR G+Y+DA
Sbjct  325  KGRNGWYLDA  334



>emb|CAD40628.2| OSJNBa0016N04.16 [Oryza sativa Japonica Group]
 emb|CAD40707.2| OSJNBb0042I07.4 [Oryza sativa Japonica Group]
 emb|CAH66364.1| H0607F01.9 [Oryza sativa Indica Group]
Length=477

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EY+TE+ GT GPF      V+ S+ F TN   +GP+G   G+PFH    D   IVGF  R
Sbjct  79   EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  138

Query  531  AGFYVDA  551
            AG+YVDA
Sbjct  139  AGWYVDA  145



>ref|XP_008348486.1| PREDICTED: agglutinin alpha chain-like [Malus domestica]
Length=189

 Score = 64.7 bits (156),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEY+  + G +G  V     ++RS+KF +N R FGP+G + G+PF +   DG KIVG  G
Sbjct  89   DEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTL-DGGKIVGLKG  147

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  148  RNGWYIDA  155



>ref|NP_001052560.1| Os04g0369100 [Oryza sativa Japonica Group]
 dbj|BAF14474.1| Os04g0369100 [Oryza sativa Japonica Group]
Length=770

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EY+TE+ GT GPF      V+ S+ F TN   +GP+G   G+PFH    D   IVGF  R
Sbjct  372  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  431

Query  531  AGFYVDA  551
            AG+YVDA
Sbjct  432  AGWYVDA  438



>gb|EEE60834.1| hypothetical protein OsJ_14451 [Oryza sativa Japonica Group]
Length=736

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EY+TE+ GT GPF      V+ S+ F TN   +GP+G   G+PFH    D   IVGF  R
Sbjct  338  EYVTEVSGTIGPFDRAPAGVITSLTFITNKGSYGPFGEVRGTPFHIPVQDNGSIVGFFAR  397

Query  531  AGFYVDA  551
            AG+YVDA
Sbjct  398  AGWYVDA  404



>ref|XP_009589464.1| PREDICTED: agglutinin-like, partial [Nicotiana tomentosiformis]
Length=363

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 54/166 (33%), Positives = 82/166 (49%), Gaps = 10/166 (6%)
 Frame = +3

Query  54   SSIPFALKLSSN*ETMAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIG  233
            S++P   ++  N  +       +  P G +GG  W ++  + I +I+I  G    +    
Sbjct  19   SALPILFQVKGNQVSYDQADSILVEPWGGTGGSEWYYKLKSPIKEILITHGDCIES----  74

Query  234  ITFSCINEDDSKEtitvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVL  413
            I F  + E  +    T+          R D V+I+  + EYLT I GTFG     SY V+
Sbjct  75   IMFRTVTEQGT----TIDSPKFGGDGGRRDKVVIEAASLEYLTGIKGTFGHC--GSYLVI  128

Query  414  RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
            +S+ F TN R +GP+G  +G+PF     +G  IVGF GR G Y+DA
Sbjct  129  KSLCFETNARNYGPFGSEIGTPFSLVMKEGGAIVGFHGRCGAYLDA  174


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 47/140 (34%), Positives = 71/140 (51%), Gaps = 11/140 (8%)
 Frame = +3

Query  135  GNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdtlvt  314
            GN+GG  W+++  + I +I+I  G   ++    I F  I E  +    T+          
Sbjct  233  GNTGGSEWNYKLKSHIKEILIAHGDVIDS----IMFRTITEQGT----TIDSPKFGGNGG  284

Query  315  rtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQ  491
            R + V+I +   EYL  I GTF  +   S+ V+ S+ F TN + +GP+G   G +PF F 
Sbjct  285  RREKVVIKEPPLEYLIGIKGTFRRY--GSHFVINSLCFITNAKNYGPFGSEAGGTPFSFV  342

Query  492  APDGKKIVGFIGRAGFYVDA  551
              +G  I GF GR G Y+DA
Sbjct  343  MKEGGAIEGFHGRCGAYLDA  362



>ref|XP_009398855.1| PREDICTED: protein GOS9-like [Musa acuminata subsp. malaccensis]
Length=143

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE L  I G +G F  D  S+LRS+ F +N R +GP+G   G  F  +AP G +IVGF G
Sbjct  73   DETLRSIRGHYGRF--DGVSILRSLTFVSNKRTYGPFGREEGVAFTLEAP-GSRIVGFTG  129

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  130  RSGLYLDA  137



>ref|XP_010230396.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
 ref|XP_010230397.1| PREDICTED: jacalin-related lectin 3-like [Brachypodium distachyon]
Length=246

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G +G F  D +SV+R++ F +N R  GPYG + G  F   A  G KIVGF G
Sbjct  173  DEYLTGVKGRYGQF--DGWSVIRALTFVSNRRTIGPYGTDEGMEFELPAAGGGKIVGFHG  230

Query  528  RAGFYVDA  551
            R+G  VDA
Sbjct  231  RSGGLVDA  238



>ref|XP_006343016.1| PREDICTED: agglutinin-like [Solanum tuberosum]
Length=201

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT + G + P V     V+RS+ F++N R+FGP+G   G+PF     +G +IVGF G
Sbjct  81   EEYLTSVSGYYSPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM-EGGQIVGFKG  139

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  140  RSGWYLDA  147



>gb|EMT11070.1| hypothetical protein F775_02114 [Aegilops tauschii]
Length=332

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G +G F D  + V+RS+ F +N+R +GPYG   G PF   A  G KI+GF  
Sbjct  257  DEYLTSVHGHYGQFKD--FVVIRSLTFVSNLRSYGPYGKEDGVPFALHAGPGGKIIGFHA  314

Query  528  RAGFYVDA  551
            R+G ++DA
Sbjct  315  RSGQFLDA  322



>ref|XP_004235622.1| PREDICTED: jacalin-related lectin 19 [Solanum lycopersicum]
Length=201

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 46/68 (68%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT + G + P V     V+RS+ F++N R+FGP+G   G+PF     +G +IVGF G
Sbjct  81   EEYLTSVSGYYCPVVYGGSPVIRSLTFSSNKRKFGPFGVEGGTPFSMPM-EGGQIVGFKG  139

Query  528  RAGFYVDA  551
            R+G+YVDA
Sbjct  140  RSGWYVDA  147



>ref|XP_008806706.1| PREDICTED: agglutinin-like isoform X1 [Phoenix dactylifera]
Length=200

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  82   EEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTFPM-DGGMIVGFSG  140

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  141  RSGWYLDA  148



>gb|EEC68267.1| hypothetical protein OsI_36302 [Oryza sativa Indica Group]
Length=1396

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E+L E+ GTFG F   + +++ S+ F TN + +GPYG   G+PFH        IVGF GR
Sbjct  1013  EFLVEVSGTFGRF-RAALNIITSLTFVTNAQSYGPYGQREGTPFHIPVQSSGCIVGFFGR  1071

Query  531   AGFYVDA  551
             AG+YVDA
Sbjct  1072  AGWYVDA  1078


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 38/67 (57%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + GTFG + + SY V+ SI   TN+  +GP+G   G  F+F       IVGF G 
Sbjct  1168  ELLTTVSGTFGSY-NTSYDVITSITLVTNIGCYGPFGKEKGISFNFPIQGNGSIVGFFGH  1226

Query  531   AGFYVDA  551
             A  Y+DA
Sbjct  1227  AELYIDA  1233



>ref|XP_004168675.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like, 
partial [Cucumis sativus]
Length=1090

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  922  DEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-KIVGFHG  980

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  981  RSGLYLDA  988



>ref|XP_008806712.1| PREDICTED: agglutinin-like isoform X2 [Phoenix dactylifera]
Length=197

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  79   EEFLTSVSGHYSPVVRGGSPVIRSLTFKSNERAFGPFGVEEGTPFTFPM-DGGMIVGFSG  137

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  138  RSGWYLDA  145



>ref|XP_009763456.1| PREDICTED: putative late blight resistance protein homolog R1B-23 
isoform X4 [Nicotiana sylvestris]
Length=1606

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSPFHFQAPDGKKIVGFIG  527
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G    G+PF     +G  IVGF G
Sbjct  83   EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  140

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  141  RCGAYLDA  148


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  222  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  273

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  274  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  331

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF G  G Y+DA
Sbjct  332  SLVMKEGVAIVGFHGLCGAYLDA  354



>dbj|BAK00987.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=304

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LTE+ GT     D    V+ SI+F TN++ +GP+G   G+PF F  P  KK+VGF GR
Sbjct  233  EFLTEVSGTIS---DSRCEVVESIQFVTNIQTYGPFGTQDGTPFTFSVPRYKKVVGFFGR  289

Query  531  AGFYVDA  551
             G ++DA
Sbjct  290  GGLFLDA  296



>ref|XP_010690084.1| PREDICTED: jacalin-related lectin 19 [Beta vulgaris subsp. vulgaris]
Length=189

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N R FGP+G   G+PF+F   +G +I+GF G
Sbjct  83   EEYLISVSGYYSPVVQGMTPVVRSLSFKSNRRSFGPFGVEEGTPFYFPV-EGGRIIGFKG  141

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  142  RSGWYLDS  149



>ref|XP_006663483.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Oryza brachyantha]
Length=1368

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E+L E+ GTFG F   + +V+ S+ F TN   +GPYG   G+PFH        IVGF GR
Sbjct  984   EFLLEVSGTFGRF-RTALNVMTSLTFVTNAHSYGPYGKIEGTPFHMPVQSNGCIVGFFGR  1042

Query  531   AGFYVDA  551
             AG+YVDA
Sbjct  1043  AGWYVDA  1049


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             +E++T +CGT G + + S+ V+ SI   TN+  +GP+G   G PFHF       IVGF G
Sbjct  1138  EEFITSVCGTIGSY-NTSFDVITSITLVTNIDCYGPFGQENGIPFHFPIQGNGSIVGFFG  1196

Query  528   RAGFYVDA  551
              A  YVDA
Sbjct  1197  HADIYVDA  1204



>ref|XP_009763450.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X3 [Nicotiana sylvestris]
Length=1740

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSPFHFQAPDGKKIVGFIG  527
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G    G+PF     +G  IVGF G
Sbjct  217  EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  274

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  275  RCGAYLDA  282


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT I GTFG      YSV++S+ F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  35   EYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  92

Query  531  AGFYVDA  551
             G Y+DA
Sbjct  93   CGAYLDA  99


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  356  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  407

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  408  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  465

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF G  G Y+DA
Sbjct  466  SLVMKEGVAIVGFHGLCGAYLDA  488



>ref|XP_009763421.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763428.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009763437.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X1 [Nicotiana sylvestris]
Length=1810

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSPFHFQAPDGKKIVGFIG  527
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G    G+PF     +G  IVGF G
Sbjct  287  EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  344

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  345  RCGAYLDA  352


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT I GTFG      YSV++S+ F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  105  EYLTCIKGTFG--YCGGYSVVKSLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  162

Query  531  AGFYVDA  551
             G Y+DA
Sbjct  163  CGAYLDA  169


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  426  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  477

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  478  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  535

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF G  G Y+DA
Sbjct  536  SLVMKEGVAIVGFHGLCGAYLDA  558



>ref|XP_009763443.1| PREDICTED: putative late blight resistance protein homolog R1B-12 
isoform X2 [Nicotiana sylvestris]
Length=1742

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 35/68 (51%), Positives = 45/68 (66%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN-VGSPFHFQAPDGKKIVGFIG  527
            E+LT I GT G F  D YSV++S+ FTTNV+ +GP+G    G+PF     +G  IVGF G
Sbjct  219  EHLTGIKGTLGCF--DGYSVIKSLCFTTNVKNYGPFGSEGGGTPFSLVMKEGVAIVGFHG  276

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  277  RCGAYLDA  284


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 49/143 (34%), Positives = 74/143 (52%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G +GG  W+++  + I +I+I  GG  +     I F  I E    +  T+       
Sbjct  358  GPWGGTGGSEWNYKLKSYIKEILIAHGGCID----SIMFKTITE----QGTTIDSPKFGG  409

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPF  482
               R + V+I+    EYLT I GTFG +  + + V++S+ F TN   +GP+G + G +PF
Sbjct  410  NGGRINKVVIEATPLEYLTGIKGTFGCY--NGHCVIKSLCFITNANNYGPFGSDAGGTPF  467

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 +G  IVGF G  G Y+DA
Sbjct  468  SLVMKEGVAIVGFHGLCGAYLDA  490


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 5/69 (7%)
 Frame = +3

Query  351  EYLTEICGTF-GPFVDDSYSVLRSIKFTTNVREFGPYGP-NVGSPFHFQAPDGKKIVGFI  524
            EYLT I GTF G  +   + V+ S+ F TN + +GP+G  + G+PF F   +G  I GF 
Sbjct  35   EYLTGIKGTFRGCGI---HLVINSLCFITNAKNYGPFGSKDGGTPFSFAMKEGGAIEGFQ  91

Query  525  GRAGFYVDA  551
            GR G Y+DA
Sbjct  92   GRCGAYLDA  100



>ref|XP_004152769.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Cucumis sativus]
Length=1463

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348   DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  949   DEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-KIVGFHG  1007

Query  528   RAGFYVDA  551
             R+G Y+DA
Sbjct  1008  RSGLYLDA  1015


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     +G KIVGF GR
Sbjct  1178  EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  1236

Query  531   AGFYVDA  551
              G ++DA
Sbjct  1237  KGLFLDA  1243



>gb|EYU45843.1| hypothetical protein MIMGU_mgv1a014002mg [Erythranthe guttata]
Length=204

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE LT + G + P V     V+RS+ F TN R FGP+G   G+PF     +G +IVGF G
Sbjct  84   DEILTTVTGYYSPVVHGGSPVIRSLTFKTNRRTFGPFGVEEGTPFSLPM-EGGQIVGFKG  142

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  143  RGGWYLDA  150



>ref|XP_002440163.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
 gb|EES18593.1| hypothetical protein SORBIDRAFT_09g027055 [Sorghum bicolor]
Length=206

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G + P       V+RS+ F TN+R +GP+G   G+PF F    G  IVGF G
Sbjct  83   DEYLTTVSGHYAPIAHGGSPVIRSLAFRTNLRAYGPFGAAEGTPFSFPVVGG-VIVGFYG  141

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  142  RSGWQLDA  149



>gb|AAR20919.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++ E+ GTFG +  D+++++ S+KF TNV+ +GP+G   G+ F         IVGF G
Sbjct  229  SEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFG  288

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  289  RSGIYLDA  296



>ref|XP_009769147.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1335

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  99   EYLTGIKGTFGRFY--GHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  156

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  157  RSGLYLDA  164



>ref|XP_010924945.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Elaeis 
guineensis]
Length=200

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  82   EEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEEGTPFTFPM-DGGMIVGFSG  140

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  141  RGGWYLDA  148



>gb|EMT24046.1| hypothetical protein F775_25349 [Aegilops tauschii]
Length=304

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++ E+ GTFG +  D+++++ S+KF TNV+ +GP+G   G+ F         IVGF G
Sbjct  229  SEFVKEVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFG  288

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  289  RSGIYLDA  296



>ref|XP_010924946.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Elaeis 
guineensis]
Length=197

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  IVGF G
Sbjct  79   EEFLTCVSGHYSPVVHGGSPVIRSLTFKSNQRAFGPFGVEEGTPFTFPM-DGGMIVGFSG  137

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  138  RGGWYLDA  145



>ref|XP_003597652.1| Agglutinin alpha chain [Medicago truncatula]
Length=761

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  658  NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  716

Query  528  RAGFYVDA  551
            R  +Y+D+
Sbjct  717  RGDWYLDS  724



>gb|ABS82785.1| jasmonate-induced protein [Triticum aestivum]
Length=304

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++ E+ GTFG +  D+++++ S+KF TNV+ +GP+G   G+ F         IVGF G
Sbjct  229  SEFVREVSGTFGLYGRDNHNIITSLKFVTNVKTYGPFGQAKGTTFTIPVQKNSSIVGFFG  288

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  289  RSGIYLDA  296



>ref|XP_006372713.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
 gb|ERP50510.1| hypothetical protein POPTR_0017s043602g, partial [Populus trichocarpa]
Length=173

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 68/142 (48%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG+ WS+     INQIVI          +G     I+  D+ +  +   GG + 
Sbjct  33   GPWGGQGGNPWSYMTNQGINQIVIN---------VGSNIKSISFRDTTDLDSATFGGNNP  83

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  84   NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  141

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  142  IPI-NNNTVVGFHGRAGHYLDA  162



>ref|XP_002515891.1| hypothetical protein RCOM_1485780 [Ricinus communis]
 gb|EEF46311.1| hypothetical protein RCOM_1485780 [Ricinus communis]
Length=514

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL    G + P V     V+RSI F +N R FGP+G   G+PF   + DG+++VGF G
Sbjct  405  EEYLVSASGNYCPVVYGGSPVIRSITFKSNRRTFGPFGIEEGTPFTL-SMDGRRVVGFTG  463

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  464  RSGWYLDA  471



>sp|P83304.1|LEC_PARPC RecName: Full=Mannose/glucose-specific lectin, partial [Parkia 
platycephala]
 pdb|1ZGR|A Chain A, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGR|B Chain B, Crystal Structure Of The Parkia Platycephala Seed Lectin
 pdb|1ZGS|A Chain A, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
 pdb|1ZGS|B Chain B, Parkia Platycephala Seed Lectin In Complex With 5-Bromo-4- 
Chloro-3-Indolyl-A-D-Mannose
Length=447

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPI-------GITFSCINEDDSKEtitv  284
            GP G SGGD WS+     INQI+I +G +  +            TF  +N  D+ E  TV
Sbjct  304  GPWGGSGGDPWSYTANEGINQIIIYAGSNIKSVAFKDTSGLDSATFGGVNPKDTGEKNTV  363

Query  285  ggggtdtlvtrtdtviidddADEYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYG  461
                                  EYLT I GT+G +   D ++ + S+ FTTN+  +GP+G
Sbjct  364  SINW----------------PSEYLTSISGTYGQYKFKDVFTTITSLSFTTNLATYGPFG  407

Query  462  PNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
                + F     +   +VGF GRAG Y+DA
Sbjct  408  KASATSFSIPIHN-NMVVGFHGRAGDYLDA  436


 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 69/143 (48%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G SGG++WSF+  + I +IVI    +  +    I+F   + D S           + 
Sbjct  9    GPWGGSGGNYWSFKANHAITEIVIHVKDNIKS----ISFKDASGDISGTFGGKDPRENEK  64

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
               +   +       EYL  I G++G +  +   V+RS+ F TN+  +GP+G   G    
Sbjct  65   GDEKKIKIHW---PTEYLKSISGSYGDY--NGVLVIRSLSFITNLTTYGPFGSTSGGE-S  118

Query  486  FQAPDGKK-IVGFIGRAGFYVDA  551
            F  P     +VGF GRAG+Y+DA
Sbjct  119  FSIPIADSVVVGFHGRAGYYLDA  141



>ref|XP_009367509.1| PREDICTED: agglutinin alpha chain [Pyrus x bretschneideri]
Length=189

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEY+  + G +G  V     ++RS+KF +N R FGP+G + G+PF +   D  KIVG  G
Sbjct  89   DEYIVSVTGHYGTMVYGGTPIIRSLKFQSNRRTFGPFGMDEGTPFTYTL-DRSKIVGLKG  147

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  148  RNGWYIDA  155



>ref|XP_006647196.1| PREDICTED: disease resistance protein RPM1-like isoform X2 [Oryza 
brachyantha]
Length=960

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL E+ GT GPF + S   + S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  887  EYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCIVGFFGR  945

Query  531  AGFYVDA  551
            +G Y+DA
Sbjct  946  SGTYLDA  952



>ref|XP_006647195.1| PREDICTED: disease resistance protein RPM1-like isoform X1 [Oryza 
brachyantha]
Length=1077

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             EYL E+ GT GPF + S   + S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  1004  EYLVEVIGTVGPF-NVSSEAITSLTLVTNVRSYGPFGQPQGTPFRTPLKKNSCIVGFFGR  1062

Query  531   AGFYVDA  551
             +G Y+DA
Sbjct  1063  SGTYLDA  1069



>gb|EMS55842.1| hypothetical protein TRIUR3_32339 [Triticum urartu]
Length=288

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 44/68 (65%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++ E+ GTFG +  D+++++ S+KF TN++ +GP+G   G+ F         IVGF G
Sbjct  213  SEFVKEVSGTFGLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSSIVGFFG  272

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  273  RSGIYLDA  280



>ref|XP_009614996.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009614997.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X4 [Nicotiana tomentosiformis]
Length=1313

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  55   EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  112

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  113  RSGLYLDA  120



>ref|XP_009614994.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X3 [Nicotiana tomentosiformis]
Length=1334

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  159

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  160  RSGLYLDA  167



>ref|XP_009614993.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X2 [Nicotiana tomentosiformis]
Length=1351

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  159

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  160  RSGLYLDA  167



>ref|XP_009614991.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009614992.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana tomentosiformis]
Length=1360

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG F    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGCFY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  159

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  160  RSGLYLDA  167



>ref|XP_002439182.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
 gb|EES17612.1| hypothetical protein SORBIDRAFT_09g001880 [Sorghum bicolor]
Length=304

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 41/67 (61%), Gaps = 2/67 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EY+ E+ GT+G F  +  +VL S K  TNVR +GP+    G+PF   AP    IVGF GR
Sbjct  234  EYVKEVSGTYGTF--EGITVLTSFKLVTNVRTWGPWAIENGTPFSITAPTNSSIVGFYGR  291

Query  531  AGFYVDA  551
            AG  +DA
Sbjct  292  AGRLIDA  298



>ref|NP_177447.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|Q9SSM3.1|JAL19_ARATH RecName: Full=Jacalin-related lectin 19 [Arabidopsis thaliana]
 gb|AAD55651.1|AC008017_24 Similar to jacalin [Arabidopsis thaliana]
 gb|AAX49365.1| At1g73040 [Arabidopsis thaliana]
 gb|ABR46196.1| At1g73040 [Arabidopsis thaliana]
 gb|AEE35407.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=176

 Score = 61.6 bits (148),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLTGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>ref|NP_001066495.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|ABA97248.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABB51090.1| mannose-specific jacalin-related lectin [Oryza sativa Japonica 
Group]
 dbj|BAF29514.1| Os12g0247700 [Oryza sativa Japonica Group]
 gb|EAZ20117.1| hypothetical protein OsJ_35712 [Oryza sativa Japonica Group]
Length=306

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            + E+L E+ GTFGP+  +  +V+ SI F TN + +GP+G   G+PF   A +   IVGF 
Sbjct  232  SSEFLKEVSGTFGPY--EGSTVITSINFITNKQTYGPFGRQEGTPFSVPAQNNSSIVGFF  289

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  290  GRSGKYINA  298



>gb|ABA94002.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=1386

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  345   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
             + E L E+ GTFG F     +++ S+ F TN + +GP+G   G+PFH     G +IVGF 
Sbjct  1000  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1058

Query  525   GRAGFYVDA  551
             GRAG+  DA
Sbjct  1059  GRAGWCFDA  1067


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVR-EFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+  ++ GTFGPF  +  +V+ S+ F TN   ++GP+G   G+PFH        IVGF G
Sbjct  1312  EFFVKVSGTFGPF-GEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFG  1370

Query  528   RAGFYVDA  551
             R G  ++A
Sbjct  1371  REGLCIEA  1378


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E++T + GT G +   S  V+ SI   TN   +GP+G   G PF F       IVGF G 
Sbjct  1157  EFITRVYGTIGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGH  1215

Query  531   AGFYVDA  551
             A  YVDA
Sbjct  1216  ANLYVDA  1222



>gb|EEE52196.1| hypothetical protein OsJ_34075 [Oryza sativa Japonica Group]
Length=1431

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  345   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
             + E L E+ GTFG F     +++ S+ F TN + +GP+G   G+PFH     G +IVGF 
Sbjct  1045  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1103

Query  525   GRAGFYVDA  551
             GRAG+  DA
Sbjct  1104  GRAGWCFDA  1112


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVR-EFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+  ++ GTFGPF  +  +V+ S+ F TN   ++GP+G   G+PFH        IVGF G
Sbjct  1357  EFFVKVSGTFGPF-GEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFG  1415

Query  528   RAGFYVDA  551
             R G  ++A
Sbjct  1416  REGLCIEA  1423


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 35/67 (52%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E++T + GT G +   S  V+ SI   TN   +GP+G   G PF F       IVGF G 
Sbjct  1202  EFITRVYGTIGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGH  1260

Query  531   AGFYVDA  551
             A  YVDA
Sbjct  1261  ANLYVDA  1267



>gb|KCW69704.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
 gb|KCW69705.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=230

 Score = 62.4 bits (150),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G   P V     V+RS+ F +N R FGP+G   G+PF F  P   +IVGF G
Sbjct  121  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSF--PSDGRIVGFKG  178

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  179  RSGWYLDS  186



>gb|KCW69706.1| hypothetical protein EUGRSUZ_F03098 [Eucalyptus grandis]
Length=226

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G   P V     V+RS+ F +N R FGP+G   G+PF F  P   +IVGF G
Sbjct  117  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSF--PSDGRIVGFKG  174

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  175  RSGWYLDS  182



>gb|EEC68269.1| hypothetical protein OsI_36304 [Oryza sativa Indica Group]
Length=1419

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 30/69 (43%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  345   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
             + E L E+ GTFG F     +++ S+ F TN + +GP+G   G+PFH     G +IVGF 
Sbjct  1045  SSEVLVEVSGTFGRFAGFQ-NIITSLTFVTNTQSYGPFGQREGTPFHIPVQCGGRIVGFF  1103

Query  525   GRAGFYVDA  551
             GRAG+  DA
Sbjct  1104  GRAGWCFDA  1112


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 2/68 (3%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVR-EFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+  ++ GTFGPF  +  +V+ S+ F TN   ++GP+G   G+PFH        IVGF G
Sbjct  1345  EFFVKVSGTFGPF-GEFPNVITSLTFVTNTHHQYGPFGQGGGTPFHAPMSGNGSIVGFFG  1403

Query  528   RAGFYVDA  551
             R G  ++A
Sbjct  1404  REGLCIEA  1411


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Composition-based stats.
 Identities = 27/65 (42%), Positives = 33/65 (51%), Gaps = 1/65 (2%)
 Frame = +3

Query  357   LTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAG  536
             +T + GT G +   S  V+ SI   TN   +GP+G   G PF F       IVGF G A 
Sbjct  1192  ITRVYGTSGSYNTPS-DVVTSITLVTNAGCYGPFGQENGIPFDFPVQGNGSIVGFFGHAN  1250

Query  537   FYVDA  551
              YVDA
Sbjct  1251  LYVDA  1255



>ref|XP_009795366.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795367.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795368.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795369.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795370.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795371.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795372.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795373.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795374.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
 ref|XP_009795375.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
[Nicotiana sylvestris]
Length=1346

 Score = 64.7 bits (156),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG F D S  +++S+ F TN + +GP+G    G+PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFGRFYDRS--IIKSLCFITNAKNYGPFGCEAAGTPFSLVMEEGVAIVGFHG  159

Query  528  RAGFYVDA  551
            R+G ++DA
Sbjct  160  RSGLFLDA  167



>ref|XP_010471351.1| PREDICTED: jacalin-related lectin 19 [Camelina sativa]
Length=177

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   DEYLIGVSGYYCPMVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>gb|EEC69076.1| hypothetical protein OsI_37951 [Oryza sativa Indica Group]
Length=250

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 45/69 (65%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            + E+L E+  TFGP+  +  +V+RSI F TN + +GP+G   G+PF   A +   +VGF 
Sbjct  176  SSEFLKEVSRTFGPY--EGSTVIRSINFITNKQTYGPFGRQEGTPFSVPAQNNSSVVGFF  233

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  234  GRSGKYINA  242



>ref|XP_008677998.1| PREDICTED: mannose/glucose-specific lectin-like isoform X9 [Zea 
mays]
Length=616

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  181  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  239

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  240  SGQYLYA  246


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  371  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  429

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  430  GRSGRYLNA  438



>ref|XP_008677994.1| PREDICTED: mannose/glucose-specific lectin-like isoform X6 [Zea 
mays]
Length=684

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  249  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  307

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  308  SGQYLYA  314


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  439  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  497

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  498  GRSGRYLNA  506



>emb|CAJ38387.1| jacalin-domain protein [Plantago major]
Length=197

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE LT + G   P V     V+RS+ F +N R FGP+G   GSPF F   +G +IVGF G
Sbjct  92   DEVLTSVSGHCCPVVHGGSPVIRSLTFKSNKRTFGPFGVEEGSPFSFPM-EGGQIVGFKG  150

Query  528  RAGFYVDA  551
            R G++VDA
Sbjct  151  RNGWFVDA  158



>gb|AFW60405.1| putative protein kinase superfamily protein [Zea mays]
Length=634

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  226  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  284

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  285  SGQYLYA  291


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  389  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  447

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  448  GRSGRYLNA  456



>ref|XP_008677991.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Zea 
mays]
Length=778

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  348  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  406

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  407  SGQYLYA  413


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  538  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  596

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  597  GRSGRYLNA  605



>ref|XP_008677996.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
 ref|XP_008677997.1| PREDICTED: mannose/glucose-specific lectin-like isoform X8 [Zea 
mays]
Length=652

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  217  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  275

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  276  SGQYLYA  282


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  407  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  465

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  466  GRSGRYLNA  474



>ref|XP_008677990.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Zea 
mays]
Length=781

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  346  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  404

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  405  SGQYLYA  411


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  536  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  594

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  595  GRSGRYLNA  603



>ref|XP_008677986.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677987.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677988.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
 ref|XP_008677989.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Zea 
mays]
Length=783

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  348  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  406

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  407  SGQYLYA  413


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  538  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  596

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  597  GRSGRYLNA  605



>emb|CDM80625.1| unnamed protein product [Triticum aestivum]
 emb|CDM80626.1| unnamed protein product [Triticum aestivum]
Length=307

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G +G F    + V+RS+KF +N+R +GPYG   G  F   A  G KI+GF  
Sbjct  232  DEYLTSVHGHYGQF--KGFVVVRSLKFVSNLRSYGPYGKEDGVSFALHAGPGGKIIGFHA  289

Query  528  RAGFYVDA  551
            R+G ++DA
Sbjct  290  RSGQFLDA  297



>ref|XP_004982894.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=151

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A E++ EI GT+GPF    ++V+RS+ F TN+ + GP+G    +PF     DG  +VGF 
Sbjct  78   AGEFVKEISGTYGPF--GGHTVVRSLTFVTNIGKHGPFGTPWQTPFSVPVQDGAHVVGFF  135

Query  525  GRAGFYVDA  551
            GR+G  +DA
Sbjct  136  GRSGSLLDA  144



>ref|XP_008677992.1| PREDICTED: mannose/glucose-specific lectin-like isoform X4 [Zea 
mays]
Length=760

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GPF + + +V+ S+ F TN R +GP+G   G+PFH Q  +  +IVGF GR
Sbjct  325  EFLTGVSGTSGPFKNLT-NVVTSLTFVTNTRSYGPFGKGRGTPFHIQTQNNGRIVGFFGR  383

Query  531  AGFYVDA  551
            +G Y+ A
Sbjct  384  SGQYLYA  390


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E+LT + G+ G F +   +V+ S+ F TN R +GP+G   G+ FH        IVGF 
Sbjct  515  GSEFLTGVSGSIGTF-NGHANVITSLTFVTNARSYGPFGRGRGTSFHIPVQGNGCIVGFF  573

Query  525  GRAGFYVDA  551
            GR+G Y++A
Sbjct  574  GRSGRYLNA  582



>gb|EAY82651.1| hypothetical protein OsI_37872 [Oryza sativa Indica Group]
Length=304

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            + E+L E+ GTFG +   +  V+ SIKF TNV+ +GP+G   G+PF     +   +VGF 
Sbjct  230  SSEFLKEVSGTFGTYYGSN--VITSIKFVTNVKTYGPFGKQNGTPFSIPVQNNSSVVGFF  287

Query  525  GRAGFYVDA  551
            GR G Y+DA
Sbjct  288  GRGGKYLDA  296



>ref|XP_010062570.1| PREDICTED: jacalin-related lectin 19 [Eucalyptus grandis]
Length=279

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G   P V     V+RS+ F +N R FGP+G   G+PF F  P   +IVGF G
Sbjct  170  DEYLVSVSGYHCPVVHGGSPVIRSLTFKSNKRTFGPFGMEHGTPFSF--PSDGRIVGFKG  227

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  228  RSGWYLDS  235



>ref|XP_006390600.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
 gb|ESQ27886.1| hypothetical protein EUTSA_v10019210mg [Eutrema salsugineum]
Length=176

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G + P V     V+RSI F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   DEYLIGVSGYYWPVVHSGSPVIRSITFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGING  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>gb|KHG23822.1| Agglutinin alpha chain [Gossypium arboreum]
Length=183

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+L  + G + P V     V+RS+ F +N R FGPYG   G+PF F   +G +I GF G
Sbjct  84   EEFLISVTGYYCPVVYGGSPVIRSLTFKSNRRTFGPYGVEEGTPFAFSV-EGARIAGFNG  142

Query  528  RAGFYVDA  551
            R+G+YVD+
Sbjct  143  RSGWYVDS  150



>ref|XP_006426466.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
 ref|XP_006466099.1| PREDICTED: agglutinin-like [Citrus sinensis]
 gb|ESR39706.1| hypothetical protein CICLE_v10026553mg [Citrus clementina]
Length=190

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+L  + G + P V     V+RS+ F +N R FGP+G   G+PF F + DG  +VGF G
Sbjct  83   EEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTF-SMDGGLVVGFKG  141

Query  528  RAGFYVDA  551
            R+G+YVDA
Sbjct  142  RSGWYVDA  149



>gb|KDO58671.1| hypothetical protein CISIN_1g037526mg, partial [Citrus sinensis]
Length=200

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+L  + G + P V     V+RS+ F +N R FGP+G   G+PF F   DG  +VGF G
Sbjct  93   EEFLISVSGHYCPVVYGGSPVIRSLTFKSNKRTFGPFGVEEGTPFTFSM-DGGLVVGFKG  151

Query  528  RAGFYVDA  551
            R+G+YVDA
Sbjct  152  RSGWYVDA  159



>ref|XP_006301377.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
 gb|EOA34275.1| hypothetical protein CARUB_v10021789mg [Capsella rubella]
Length=177

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G + P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   DEYLIGVSGYYCPLVSSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>ref|XP_008654961.1| PREDICTED: LOC100282355 isoform X1 [Zea mays]
Length=238

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  117  DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  175

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  176  RSGWQLDA  183



>gb|KEH39536.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=192

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  89   NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  147

Query  528  RAGFYVDA  551
            R  +Y+D+
Sbjct  148  RGDWYLDS  155



>gb|KEH39538.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=196

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  93   NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  151

Query  528  RAGFYVDA  551
            R  +Y+D+
Sbjct  152  RGDWYLDS  159



>ref|XP_008654962.1| PREDICTED: LOC100282355 isoform X2 [Zea mays]
 gb|AFW80927.1| hypothetical protein ZEAMMB73_478294 [Zea mays]
Length=237

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  116  DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  174

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  175  RSGWQLDA  182



>gb|KEH39537.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=181

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  78   NEYLISVSGHYYPVVRGGTPVIRSLTFKSNQRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  136

Query  528  RAGFYVDA  551
            R  +Y+D+
Sbjct  137  RGDWYLDS  144



>ref|NP_001148739.1| LOC100282355 [Zea mays]
 gb|ACG32703.1| agglutinin [Zea mays]
Length=207

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  84   DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  142

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  143  RSGWQLDA  150



>ref|XP_008654963.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
 ref|XP_008654964.1| PREDICTED: LOC100282355 isoform X3 [Zea mays]
Length=231

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  110  DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  168

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  169  RSGWQLDA  176



>emb|CDO97947.1| unnamed protein product [Coffea canephora]
Length=276

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+LT + G   P V     V+R++ F +N R FGPYG   G+PF     +G +IVGF G
Sbjct  157  DEFLTSVSGFVAPVVHGGSPVIRALTFKSNKRTFGPYGVEEGAPFSLPI-EGGQIVGFKG  215

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  216  RSGWYLDS  223



>ref|XP_008654965.1| PREDICTED: LOC100282355 isoform X4 [Zea mays]
Length=211

 Score = 61.2 bits (147),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G + P       V+RS+ F TN   +GP+G   G+PF F   DG  IVGF G
Sbjct  90   DEYLTTVSGHYAPIAPGGSPVIRSLAFRTNQGAYGPFGVAEGTPFEFPV-DGGVIVGFCG  148

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  149  RSGWQLDA  156



>ref|XP_008348484.1| PREDICTED: agglutinin-like isoform X2 [Malus domestica]
Length=174

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDS-YS-VLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            DEY+  + G +   VD   YS ++RS+KF +N R FGP+G + G+PF +   DG KIVG 
Sbjct  69   DEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTPFTYTL-DGGKIVGL  127

Query  522  IGRAGFYVDA  551
             GR G Y+DA
Sbjct  128  KGRDGLYIDA  137



>ref|XP_008348483.1| PREDICTED: agglutinin-like isoform X1 [Malus domestica]
Length=194

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDS-YS-VLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            DEY+  + G +   VD   YS ++RS+KF +N R FGP+G + G+PF +   DG KIVG 
Sbjct  89   DEYIVSVTGHYCTMVDAGIYSPIIRSLKFQSNRRTFGPFGRDQGTPFTYTL-DGGKIVGL  147

Query  522  IGRAGFYVDA  551
             GR G Y+DA
Sbjct  148  KGRDGLYIDA  157



>ref|XP_011001797.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
Length=445

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 69/142 (49%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG+ WS+     INQIVI          +G+    I+  D+ +  +   GG + 
Sbjct  305  GPWGGQGGNPWSYITNRGINQIVIN---------VGLNIKSISFRDTTDLDSATFGGNNP  355

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  356  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  413

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  414  IPI-NNNTVVGFHGRAGHYLDA  434


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 65/143 (45%), Gaps = 12/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GGD WS+R +  I +IV+R         +G   S   +D S       GG  + 
Sbjct  11   GPWGGLGGDHWSYRASGGITEIVLRV--------VGNIKSISFKDASGLVSGTFGGRGND  62

Query  306  -lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPF  482
                     I      EYL  I GT+G +      V+ S+ F TN+  +GP+G  +G  F
Sbjct  63   PNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALGETF  120

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 D   +VGF GR G+Y+DA
Sbjct  121  SIPIAD-SAVVGFHGRCGYYLDA  142


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  224  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  280

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  281  RGGHYLDA  288



>ref|XP_011001798.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 69/142 (49%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG+ WS+     INQIVI          +G+    I+  D+ +  +   GG + 
Sbjct  305  GPWGGQGGNPWSYITNRGINQIVIN---------VGLNIKSISFRDTTDLDSATFGGNNP  355

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  356  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  413

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  414  IPI-NNNTVVGFHGRAGHYLDA  434


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/149 (30%), Positives = 63/149 (42%), Gaps = 24/149 (16%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnP-------IGITFSCINEDDSKEtitv  284
            GP G  GGD WS+R +  I +IV+R  G+  +         +  TF     D +      
Sbjct  11   GPWGGLGGDHWSYRASGGITEIVLRVEGNIKSISFKDASGLVSGTFGGRGNDPNDRGEQK  70

Query  285  ggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP  464
                                  EYL  I GT+G +      V+ S+ F TN+  +GP+G 
Sbjct  71   KIEIQW--------------PSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGT  114

Query  465  NVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
             +G  F     D   +VGF GR G+Y+DA
Sbjct  115  ALGETFSIPIAD-SAVVGFHGRCGYYLDA  142


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  224  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  280

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  281  RGGHYLDA  288



>gb|EEE60695.1| hypothetical protein OsJ_14181 [Oryza sativa Japonica Group]
Length=95

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  527
            +++ EI GT G +V    +VLRS+K TT  R +GPYG P  G PF F      +I GF  
Sbjct  20   DFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITGFFV  79

Query  528  RAGFYVDA  551
            RAGF  DA
Sbjct  80   RAGFITDA  87



>ref|XP_010273654.1| PREDICTED: mannose/glucose-specific lectin-like [Nelumbo nucifera]
Length=147

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/70 (49%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFV--DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            DEYLT I GTFG      + + V+RSI+F TN R +GPYG   G+ F      G KIVGF
Sbjct  72   DEYLTSISGTFGRRWKNQNGHVVVRSIQFNTNARSYGPYGSTDGTAFSLPVKQG-KIVGF  130

Query  522  IGRAGFYVDA  551
             GR G  +D+
Sbjct  131  HGRCGADLDS  140



>ref|XP_011001796.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 69/142 (49%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG+ WS+     INQIVI          +G+    I+  D+ +  +   GG + 
Sbjct  451  GPWGGQGGNPWSYITNRGINQIVIN---------VGLNIKSISFRDTTDLDSATFGGNNP  501

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  502  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  559

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  560  IPINN-NTVVGFHGRAGHYLDA  580


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 65/143 (45%), Gaps = 12/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GGD WS+R +  I +IV+R         +G   S   +D S       GG  + 
Sbjct  11   GPWGGLGGDHWSYRASGGITEIVLRV--------VGNIKSISFKDASGLVSGTFGGRGND  62

Query  306  -lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPF  482
                     I      EYL  I GT+G +      V+ S+ F TN+  +GP+G  +G  F
Sbjct  63   PNDRGEQKKIEIQWPSEYLKSISGTYGSY--KGLLVITSLSFITNLTTYGPFGTALGETF  120

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                 D   +VGF GR G+Y+DA
Sbjct  121  SIPIAD-SAVVGFHGRCGYYLDA  142


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  224  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  280

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  281  RGGYYLDA  288


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+   GP+G   G+ F     +G  ++GF G
Sbjct  370  SEHLTSITGTYGNYA--GMVVITSLSFITNLTTHGPFGTATGTSFSIPI-EGSVVIGFHG  426

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  427  RGGHYLDA  434



>ref|XP_009768641.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X3 [Nicotiana sylvestris]
Length=1282

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG  +  S+SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  29   EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  86

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  87   RCGAYLDA  94



>ref|XP_010654564.1| PREDICTED: jacalin-related lectin 19-like [Vitis vinifera]
Length=198

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E L  + G + P V     V+RS+ F +N R FGP+G   G+PF   + DG +IVGF G
Sbjct  83   EEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVEEGTPFSL-SMDGGRIVGFQG  141

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  142  RSGWYLDA  149



>ref|XP_009768640.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X2 [Nicotiana sylvestris]
Length=1339

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG  +  S+SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  86   EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  143

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  144  RCGAYLDA  151



>ref|XP_009768636.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768638.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009768639.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1355

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG  +  S+SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  102  EYLTGIKGTFG--LCGSHSVIKSLCFITNAKNYGPFGSEAGGTPFSLVIREGGAIVGFHG  159

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  160  RCGAYLDA  167



>ref|XP_009770862.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770863.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770864.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770865.1| PREDICTED: putative late blight resistance protein homolog R1B-16 
isoform X1 [Nicotiana sylvestris]
 ref|XP_009770866.1| PREDICTED: putative late blight resistance protein homolog R1A-3 
isoform X1 [Nicotiana sylvestris]
Length=1328

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 53/153 (35%), Positives = 81/153 (53%), Gaps = 12/153 (8%)
 Frame = +3

Query  99   MAVPIDAVS-GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEt  275
            M V +D++   P G +GG  W+++  N I +I+I  G   +     I F  +    +K+ 
Sbjct  1    MHVKMDSILLEPWGGTGGSKWNYKLKNPIKEILIAHGDIID----SIMFRTV----TKKG  52

Query  276  itvggggtdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGP  455
            IT+G         +   V+I+    EYLT I GTFG +     SV++S+ F TNV+ +GP
Sbjct  53   ITIGSPKFGGNGGQISKVVIEATPLEYLTGIKGTFGHYC--GLSVIKSLCFITNVKNYGP  110

Query  456  YGPNVG-SPFHFQAPDGKKIVGFIGRAGFYVDA  551
            +G   G +PF     +G  IVGF GR G ++DA
Sbjct  111  FGCEAGGTPFSLVMKEGVAIVGFHGRCGAFLDA  143



>ref|XP_010030903.1| PREDICTED: agglutinin alpha chain-like [Eucalyptus grandis]
Length=105

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT     FG +    Y+++RS+ F +N R +GPYG  VG  FHF +  GKKIVGF G 
Sbjct  35   EYLTSFSSHFGSYF--GYTIVRSLTFFSNERTYGPYGEEVGEHFHFPSI-GKKIVGFHGS  91

Query  531  AGFYVDA  551
            +G ++D+
Sbjct  92   SGVWLDS  98



>gb|KGN62634.1| hypothetical protein Csa_2G362470 [Cucumis sativus]
Length=598

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  80   DEYLTMIRGHYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTIFSFPTTEG-KIVGFHG  138

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  139  RSGLYLDA  146


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     +G KIVGF GR
Sbjct  313  EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  371

Query  531  AGFYVDA  551
             G ++DA
Sbjct  372  KGLFLDA  378



>ref|XP_011081586.1| PREDICTED: jacalin-related lectin 19-like [Sesamum indicum]
Length=308

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLTE+ G   P      +++RS+KF +N R +GP+G    +PF F   +G  IVGF G
Sbjct  30   DEYLTEVSGHCSPLGRRGNAMVRSLKFRSNWRTYGPFGVESETPFCFPM-EGGMIVGFRG  88

Query  528  RAGFYVDA  551
            R G YVDA
Sbjct  89   RCGLYVDA  96


 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT + G   P V     V+RS+ F +N R FGP+G   G PF F   +G +IVGF G
Sbjct  225  EEFLTTVTGHCSPVVCGGSPVIRSLTFKSNRRTFGPFGVEEGVPFSFPM-EGGQIVGFKG  283

Query  528  RAGFYVDA  551
            RAG+Y+DA
Sbjct  284  RAGWYLDA  291



>ref|XP_009622525.1| PREDICTED: agglutinin-like isoform X2 [Nicotiana tomentosiformis]
Length=546

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT I GTFG     SYSV++ + F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  12   EYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  69

Query  531  AGFYVDA  551
             G Y+DA
Sbjct  70   CGAYLDA  76


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  401  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  458

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  459  RSGLYLDA  466


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  354  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  533
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  196  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  253

Query  534  GFYVDA  551
              Y+DA
Sbjct  254  RAYLDA  259



>ref|XP_002888904.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65163.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=176

 Score = 60.1 bits (144),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G +   VD    V+RS+ F +N + +GPYG   G+PF F   +G +IVG   
Sbjct  81   DEYLTGVSGYYSIVVDSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMSS  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>ref|XP_008444758.1| PREDICTED: LOW QUALITY PROTEIN: myrosinase-binding protein-like 
At3g16470 [Cucumis melo]
Length=598

 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT I G +G FV      +RS+ F +N +++GPYG   G+ F F   +G KIVGF G
Sbjct  80   DEYLTMIRGYYGSFVSFDKVFVRSLTFMSNKKKYGPYGVEQGTVFSFPTTEG-KIVGFHG  138

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  139  RSGLYLDA  146


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     +G KIVGF GR
Sbjct  313  EILTHVTGHYGPVMYMGPNVIKSLSFHTTKAKYGPFGEAQGTPFSTNVKEG-KIVGFHGR  371

Query  531  AGFYVDA  551
             G ++DA
Sbjct  372  KGLFLDA  378



>ref|XP_009622524.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Nicotiana 
tomentosiformis]
Length=569

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 42/67 (63%), Gaps = 2/67 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT I GTFG     SYSV++ + F TN + +GP+G   G+PF     +G  IVGF GR
Sbjct  35   EYLTGIKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGR  92

Query  531  AGFYVDA  551
             G Y+DA
Sbjct  93   CGAYLDA  99


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  424  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  481

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  482  RSGLYLDA  489


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  354  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  533
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  219  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  276

Query  534  GFYVDA  551
              Y+DA
Sbjct  277  RAYLDA  282



>emb|CBI35988.3| unnamed protein product [Vitis vinifera]
Length=210

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E L  + G + P V     V+RS+ F +N R FGP+G   G+PF   + DG +IVGF G
Sbjct  95   EEILISVSGHYCPVVYGGSPVIRSLTFKSNRRTFGPFGVEEGTPFSL-SMDGGRIVGFQG  153

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  154  RSGWYLDA  161



>gb|ACF87628.1| unknown [Zea mays]
Length=122

 Score = 58.9 bits (141),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE LTEI GT GP  +   ++++S+KF TN R +GPYG + G+PF  +  +   + GF G
Sbjct  48   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  106

Query  528  RAGFYVDA  551
            R+G  +DA
Sbjct  107  RSGDCLDA  114



>ref|XP_010267066.1| PREDICTED: jacalin-related lectin 19 [Nelumbo nucifera]
Length=205

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT + G + P V     V+RS+ F +N   FGP+G   G PF F   DG  I+GF G
Sbjct  83   EEFLTTVSGHYSPVVHGGTPVIRSLTFKSNQGSFGPFGVEEGMPFSFPM-DGGSIIGFWG  141

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  142  RNGWYLDA  149



>gb|AFK34206.1| unknown [Lotus japonicus]
Length=182

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V RS+ F +N R FGPYG   G+PF F   DG ++VGF G
Sbjct  78   DEFLISVSGHYCPVVRGGSPVTRSLTFKSNRRTFGPYGVEEGTPFTFSI-DGGQVVGFKG  136

Query  528  RAGFYVDA  551
            R  +Y+D+
Sbjct  137  RGDWYLDS  144



>ref|NP_001106057.1| PL3K2 [Zea mays]
 gb|ABR68026.1| PL3K2 [Zea mays]
 gb|ACF80462.1| unknown [Zea mays]
 gb|ACG30569.1| hypothetical protein [Zea mays]
Length=151

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE LTEI GT GP  +   ++++S+KF TN R +GPYG + G+PF  +  +   + GF G
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRAYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  528  RAGFYVDA  551
            R+G  +DA
Sbjct  136  RSGDCLDA  143



>ref|XP_010088386.1| hypothetical protein L484_008121 [Morus notabilis]
 gb|EXB34860.1| hypothetical protein L484_008121 [Morus notabilis]
Length=193

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+   +N R FGPYG   G+PF F    G  IVGF G
Sbjct  84   EEYLVSVSGYYCPVVHGGSPVIRSLTLKSNKRTFGPYGVEEGTPFSFPI-QGGLIVGFKG  142

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  143  RNGWYLDA  150



>gb|KDP40814.1| hypothetical protein JCGZ_24813 [Jatropha curcas]
Length=203

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+L    G + P V     V+RS+   +N R FGPYG   G+PF   + DG  IVGF+G
Sbjct  86   EEFLVSASGHYCPVVYGGSPVIRSLTLKSNRRTFGPYGVEEGTPFTL-SMDGGSIVGFMG  144

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  145  RSGWYLDS  152



>gb|ACG29554.1| hypothetical protein [Zea mays]
 gb|ACG44268.1| hypothetical protein [Zea mays]
Length=151

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE LTEI GT GP  +   ++++S+KF TN R +GPYG + G+PF  +  +   + GF G
Sbjct  77   DESLTEISGTTGPAYNID-NLVKSLKFVTNKRTYGPYGRDEGTPFRVKVMNNGHVAGFFG  135

Query  528  RAGFYVDA  551
            R+G  +DA
Sbjct  136  RSGDCLDA  143



>pdb|4MQ0|A Chain A, Crystal Structure Of Parkia Biglobosa Seed Lectin (pbl) 
In Complex With Methyl Alpha D-mannopyranoside
Length=446

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 50/150 (33%), Positives = 70/150 (47%), Gaps = 25/150 (17%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPI-------GITFSCINEDDSKEtitv  284
            GP G SGGD WS+     INQI+I +G +  +            TF  +N  D+ E  TV
Sbjct  303  GPWGGSGGDPWSYTANEGINQIIIYAGSNIKSIAFKDTSGLDSATFGGVNPKDTGEKNTV  362

Query  285  ggggtdtlvtrtdtviidddADEYLTEICGTFGPF-VDDSYSVLRSIKFTTNVREFGPYG  461
                                  EYLT I GT+G +   D ++ + S+ FTTN+  +GP+G
Sbjct  363  SIKW----------------PSEYLTSIDGTYGQYKFKDVFTTVTSLSFTTNLATYGPFG  406

Query  462  PNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
                + F     +   +VGF GRAG Y+DA
Sbjct  407  KASLTSFSIPIHN-NMVVGFHGRAGDYLDA  435


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 69/143 (48%), Gaps = 11/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G SGGD WSF+  + I +I+I    +  +    I+F     D S    T GG     
Sbjct  9    GPWGGSGGDHWSFKANHAITEILIHVKDNIKS----ISFKDAGGDIS---GTFGGKDPRE  61

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                 +  I      EYL  I G++G +  +   V+RS+ F TN+  +GP+G   G    
Sbjct  62   NKKGEEKKIGIRWPTEYLKSISGSYGDY--NGILVIRSLSFITNLTTYGPFGSTSGGE-S  118

Query  486  FQAPDGKK-IVGFIGRAGFYVDA  551
            F  P     +VGF GRAG+Y+DA
Sbjct  119  FSIPIADSVVVGFHGRAGYYLDA  141


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 3/67 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT I GT+G +    + VL S+ F TNV + GP+G   G+ F  +  +G  + GF G+
Sbjct  223  EHLTSISGTYGNY--KGFEVLTSLSFITNVTKHGPFGIASGTSFS-RPIEGSLVTGFHGK  279

Query  531  AGFYVDA  551
             G+Y+D+
Sbjct  280  GGYYLDS  286



>gb|AAB72098.1| 32 kDa protein [Hordeum vulgare subsp. vulgare]
Length=306

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 41/67 (61%), Gaps = 0/67 (0%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A E++ E+ GTFG +  D ++++ S+KF TNV+ +GP+G   G+PF         IVGF 
Sbjct  228  ASEFVKEVSGTFGIYDKDLHNIITSLKFITNVKTYGPFGEAKGTPFTIAVQKNSSIVGFF  287

Query  525  GRAGFYV  545
             R G+ +
Sbjct  288  ARTGYIL  294



>ref|XP_007024409.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
 gb|EOY27031.1| Mannose-binding lectin superfamily protein [Theobroma cacao]
Length=298

 Score = 60.8 bits (146),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+L  + G + P V     V+RS+ F +N R FGPYG   G+PF F   +G +I GF G
Sbjct  195  EEFLISVSGHYCPVVHGGGPVIRSLTFKSNQRTFGPYGVEEGTPFTFSM-EGGRIAGFNG  253

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  254  RSGWYLDS  261



>ref|NP_001052399.1| Os04g0295400 [Oryza sativa Japonica Group]
 emb|CAD40444.2| OSJNBa0041M21.2 [Oryza sativa Japonica Group]
 dbj|BAF14313.1| Os04g0295400 [Oryza sativa Japonica Group]
Length=150

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  527
            +++ EI GT G +V    +VLRS+K TT  R +GPYG P  G PF F      +I GF  
Sbjct  75   DFVMEISGTTGMWVSGMSNVLRSLKITTLKRTYGPYGNPKAGIPFSFSVDGSDRITGFFV  134

Query  528  RAGFYVDA  551
            RAGF  DA
Sbjct  135  RAGFITDA  142



>ref|XP_010428208.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Camelina 
sativa]
Length=177

 Score = 58.9 bits (141),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>ref|XP_004960459.1| PREDICTED: salt stress-induced protein-like [Setaria italica]
Length=149

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A E++ EI GT+GPF    ++V+RS+ F TNV + GP+G    +PF     D  ++VGF 
Sbjct  76   AGEFVKEISGTYGPF--GGHTVVRSLTFVTNVGKHGPFGNPGQTPFSVPVQDDARVVGFF  133

Query  525  GRAGFYVDA  551
            GR+G  +DA
Sbjct  134  GRSGSLLDA  142



>gb|EAY93469.1| hypothetical protein OsI_15270 [Oryza sativa Indica Group]
Length=150

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  527
            +++ EI GT G +V    +VLRS+K TT  R +GPYG P  G PF F      +I GF  
Sbjct  75   DFVMEISGTTGMWVSGMRNVLRSLKITTLKRTYGPYGNPEAGIPFSFSVDGSDRITGFFV  134

Query  528  RAGFYVDA  551
            RAGF  DA
Sbjct  135  RAGFITDA  142



>ref|XP_006597181.1| PREDICTED: agglutinin-like isoform X1 [Glycine max]
 ref|XP_006597182.1| PREDICTED: agglutinin-like isoform X2 [Glycine max]
Length=671

 Score = 61.6 bits (148),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V+ S+ F +N + FGPYG   G+PF F   DG  +VGF G
Sbjct  568  DEFLVSVSGHYCPVVRGGTPVILSLTFKSNRKTFGPYGVEEGTPFTFSI-DGGCVVGFKG  626

Query  528  RAGFYVDA  551
            R+ +Y+DA
Sbjct  627  RSDWYLDA  634



>ref|XP_004297619.1| PREDICTED: agglutinin-like [Fragaria vesca subsp. vesca]
Length=321

 Score = 60.5 bits (145),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 2/70 (3%)
 Frame = +3

Query  348  DEYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            DE+L  I G +    ++  +  VLRS+KF +N R FGP+G   G+PF F+  D  +IVGF
Sbjct  97   DEFLVSISGYYCGVTWIVGAPVVLRSLKFESNKRTFGPFGNQFGTPFTFKVKDSDRIVGF  156

Query  522  IGRAGFYVDA  551
             GR G Y+DA
Sbjct  157  KGRKGRYLDA  166


 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +3

Query  348  DEYLTEICG--TFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
            +E++  + G  ++ P++  +  V+RS+KF +N R +GP+G  VG+PF F+  DG +IVG 
Sbjct  248  NEFMVTVSGHISWVPWMSGT-RVVRSLKFDSNRRTYGPFGVQVGTPFSFRVKDGDQIVGL  306

Query  522  IGRAGFYVDA  551
             GR+G+Y+ A
Sbjct  307  RGRSGWYLYA  316



>ref|XP_010232948.1| PREDICTED: jacalin-related lectin 19-like [Brachypodium distachyon]
Length=266

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 78/179 (44%), Gaps = 19/179 (11%)
 Frame = +3

Query  33   SNKTCSLSSIPFALKLSSN*ETMAVPIDAV--SGPLGNSGGDFWS--FRPTNKINQIVIR  200
            S   CS  ++P+  K       + V + +V   GP G  GG  W        ++ ++V+R
Sbjct  93   SGSACSAVAMPYHEKAEHERTCVGVRVSSVVAMGPCGGIGGAPWEMDLHGVGRVLKLVVR  152

Query  201  sggsgnnnPIGITFSCINEDDSKEtitvggggtdtlvtrtdtviidddADEYLTEICGTF  380
             G + +   +     C   D  +E  T  GG                  DEYL  + G  
Sbjct  153  HGSAIDAMSV-----CYERDGREEQSTRWGGPGGRRSEICLQ------PDEYLAGVKGHV  201

Query  381  GPFVDDSYSVLRSIKFTTNVRE-FGPYGPNVGSPFHFQAP-DGKKIVGFIGRAGFYVDA  551
            G +  D+  V+RS+ F TN R  FGPYG   G PF   A   G +I+GF G +G Y+DA
Sbjct  202  GHY--DNCLVVRSLTFVTNARRSFGPYGKEEGVPFALPAAVAGGRIIGFFGSSGLYLDA  258



>ref|XP_009127966.1| PREDICTED: agglutinin [Brassica rapa]
Length=176

 Score = 58.5 bits (140),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGRIVGMNG  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>ref|XP_010428207.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Camelina 
sativa]
Length=218

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  122  EEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  180

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  181  RSGWYLDS  188



>ref|XP_009338132.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009338133.1| PREDICTED: uncharacterized protein LOC103930515 isoform X1 [Pyrus 
x bretschneideri]
Length=764

 Score = 61.2 bits (147),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G +        +++RS+KF +N R FGP+G   G+ F +   +G KIVG  G
Sbjct  664  DEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIQEGTTFTYNV-EGGKIVGLKG  722

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  723  RNGWYIDA  730



>ref|XP_002450764.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
 gb|EES09752.1| hypothetical protein SORBIDRAFT_05g017250 [Sorghum bicolor]
Length=1080

 Score = 61.6 bits (148),  Expect = 7e-08, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 39/67 (58%), Gaps = 0/67 (0%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             EY+ E+ GT+G        V+ S+   TN+  +GP+G   G+PFH +      IVGF GR
Sbjct  1004  EYVKEVSGTYGLCSPHPDVVITSLTLVTNLCSYGPFGQPTGTPFHTRVDKTASIVGFFGR  1063

Query  531   AGFYVDA  551
             +G Y+DA
Sbjct  1064  SGIYLDA  1070



>ref|XP_010428206.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Camelina 
sativa]
Length=224

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V+    V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  128  EEYLIGVSGYYCPVVNSGTPVIRSMTFKSNKQVYGPYGVEQGTPFTFSV-NGGRIVGMNG  186

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  187  RSGWYLDS  194



>ref|XP_009400545.1| PREDICTED: agglutinin alpha chain [Musa acuminata subsp. malaccensis]
Length=200

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT I G + P       V+RS+ F +N R FGP+G   G PF     +G  IVGF G
Sbjct  82   EEYLTTISGHYCPMAYGGSPVIRSLTFKSNQRTFGPFGVQDGIPFTLPM-EGGMIVGFSG  140

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  141  RCGWYLDA  148



>gb|AFW81812.1| putative protein kinase superfamily protein [Zea mays]
Length=503

 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+L  + GT G +     SV+RS+ F TNVR +   G  VG PF  +AP G  IVGF  R
Sbjct  429  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  488

Query  531  AGFYVDA  551
            AG ++DA
Sbjct  489  AGHFLDA  495



>gb|EMT07650.1| Horcolin [Aegilops tauschii]
Length=320

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + G +G F D    V+RS+   +N+R +G YG   G PF   A  G KI+GF  
Sbjct  245  DEYLTSVHGHYGQFKDTV--VIRSLTLVSNLRSYGSYGKEDGVPFALHAGPGGKIIGFHA  302

Query  528  RAGFYVDA  551
            R+G ++DA
Sbjct  303  RSGQFLDA  310



>ref|XP_006372325.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
 gb|ERP50122.1| Mannose/glucose-specific lectin family protein [Populus trichocarpa]
Length=446

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  306  GPWGGRGGSPWSYMTNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  356

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  357  NDIGERKTVLINWPSEHLISISGTYGKF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  414

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  415  IPI-NNNTVVGFHGRAGHYLDA  435


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 50/148 (34%), Positives = 70/148 (47%), Gaps = 13/148 (9%)
 Frame = +3

Query  114  DAVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggg  293
            D   GP G  GGD W +R ++ I  IV+R  G             I+  D++  ++   G
Sbjct  7    DVKLGPWGGLGGDRWCYRASDGITGIVLRVEG---------NIKSISFKDTRGLVSGTFG  57

Query  294  gtdt--lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPN  467
            GT         +  I      EYL  I GT+G +     +V+ S+ FTTN+   GP+G  
Sbjct  58   GTGNDPNDRGEEKKIAIQWPTEYLKSISGTYGRY-KGVLAVITSLSFTTNLTTHGPFGTA  116

Query  468  VGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
             G PF     DG  +VGF GR G+Y+DA
Sbjct  117  PGEPFSIPIADG-VVVGFHGRCGYYLDA  143


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  ++GF G
Sbjct  225  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVIGFHG  281

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  282  RGGHYLDA  289



>ref|XP_008656248.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
 ref|XP_008656249.1| PREDICTED: putative receptor-like protein kinase At4g00960 [Zea 
mays]
Length=488

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+L  + GT G +     SV+RS+ F TNVR +   G  VG PF  +AP G  IVGF  R
Sbjct  414  EFLVGVSGTTGGYAGLPTSVIRSLTFVTNVRTYRTRGAPVGDPFALEAPAGSCIVGFHAR  473

Query  531  AGFYVDA  551
            AG ++DA
Sbjct  474  AGHFLDA  480



>gb|EEC72970.1| hypothetical protein OsI_06866 [Oryza sativa Indica Group]
Length=1072

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E+L E+ GT GPF   S ++  S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  999   EFLMEVIGTVGPFNVLSEAI-TSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGR  1057

Query  531   AGFYVDA  551
             +G Y+DA
Sbjct  1058  SGTYLDA  1064



>dbj|BAD23250.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 dbj|BAD23344.1| putative LZ-NBS-LRR class RGA [Oryza sativa Japonica Group]
 gb|EAZ22703.1| hypothetical protein OsJ_06375 [Oryza sativa Japonica Group]
Length=1072

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E+L E+ GT GPF   S ++  S+   TNVR +GP+G   G+PF         IVGF GR
Sbjct  999   EFLMEVIGTVGPFNVLSEAI-TSLTLVTNVRSYGPFGQPQGTPFRTPRKKNSCIVGFFGR  1057

Query  531   AGFYVDA  551
             +G Y+DA
Sbjct  1058  SGTYLDA  1064



>ref|XP_010232946.1| PREDICTED: uncharacterized protein LOC104583002 [Brachypodium 
distachyon]
Length=250

 Score = 59.3 bits (142),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+LT + G  G      + V++S+ F +N R +GPYG + G PF   AP G +IVGF G
Sbjct  154  DEHLTCVKGLLGNHAQ--WFVVKSLTFVSNRRTYGPYGEDHGVPFELPAPAGGRIVGFHG  211

Query  528  RAGFYVDA  551
            R+G  +DA
Sbjct  212  RSGGLLDA  219



>gb|EMS58273.1| hypothetical protein TRIUR3_17900 [Triticum urartu]
Length=304

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
              E++ E  GTF  +  D+++++ S+KF TN++ +GP+G   G+ F         IVGF 
Sbjct  228  TSEFVKEFSGTFSLYGRDNHNIITSLKFVTNMKTYGPFGQAKGTTFTIPVQKNSNIVGFF  287

Query  525  GRAGFYVDA  551
            GR+G Y+DA
Sbjct  288  GRSGIYLDA  296



>ref|XP_008244775.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like [Prunus mume]
Length=343

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 44/69 (64%), Gaps = 2/69 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            DE+L  + G + P +      ++RS+KF +N R FGPYG   G+PF F   DG KIVG  
Sbjct  245  DEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGKIVGLK  303

Query  525  GRAGFYVDA  551
            GR+G+Y+DA
Sbjct  304  GRSGWYLDA  312


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 2/69 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            DEYL    G + P +      ++RS+KF +N R FGPYG   G+PF F   DG +IVG  
Sbjct  89   DEYLVGASGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGQIVGLK  147

Query  525  GRAGFYVDA  551
            GR G+Y++A
Sbjct  148  GRDGWYLNA  156



>gb|EMT07330.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=885

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E + EI GTFGP+     S+++S+   TN+R +GP+G   G+PFH +      IVGF G 
Sbjct  813  ELVLEISGTFGPY-GQFPSIIKSLMLVTNLRTYGPFGQLHGTPFHSRVKKNGTIVGFFGC  871

Query  531  AGFYVDA  551
            +G ++DA
Sbjct  872  SGEFLDA  878



>gb|KFK41744.1| hypothetical protein AALP_AA2G166700 [Arabis alpina]
Length=176

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P +     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  81   EEYLIGVSGYYCPVIHSGTPVIRSMTFKSNKQVYGPYGIEQGTPFTFSV-NGGRIVGMNG  139

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  140  RSGWYLDS  147



>ref|XP_010060992.1| PREDICTED: jacalin-related lectin 3 [Eucalyptus grandis]
 gb|KCW67893.1| hypothetical protein EUGRSUZ_F01603 [Eucalyptus grandis]
Length=598

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE LT I GT GP +    +++RSI F TN  + GP+G   G+ F  ++ +G KI+GF G
Sbjct  314  DEVLTHITGTCGPLMSMGPTIIRSIAFHTNRGKHGPFGEERGASFTSKSKEG-KIIGFHG  372

Query  528  RAGFYVDA  551
            R G ++DA
Sbjct  373  RGGLFIDA  380


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G +G   D    ++RS+ F +N + +GPYG   G  F F +  G KIVGF G
Sbjct  79   DEFLISVHGHYGKINDWGPILVRSLTFESNRKTYGPYGVQQGGSFSFPSTTG-KIVGFHG  137

Query  528  RAGFYVDA  551
            +AG+Y+DA
Sbjct  138  KAGWYLDA  145


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSY---SVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVG  518
            +E LT I G +GP   D +     +RS+ F T+  ++GP+G  VG+ F     +G K+VG
Sbjct  505  NEVLTCISGYYGPVGKDEWPQPQFIRSLTFHTSRGKYGPFGEEVGTFFTSTTTEG-KVVG  563

Query  519  FIGRAGFYVDA  551
            F GR+  Y+DA
Sbjct  564  FHGRSSLYLDA  574



>ref|XP_009622528.1| PREDICTED: agglutinin-like isoform X5 [Nicotiana tomentosiformis]
Length=460

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  315  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  372

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  373  RSGLYLDA  380


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  354  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  533
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  110  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  167

Query  534  GFYVDA  551
              Y+DA
Sbjct  168  RAYLDA  173



>ref|XP_009622527.1| PREDICTED: agglutinin-like isoform X4 [Nicotiana tomentosiformis]
Length=490

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  345  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  402

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  403  RSGLYLDA  410


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  354  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  533
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  140  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  197

Query  534  GFYVDA  551
              Y+DA
Sbjct  198  RAYLDA  203



>ref|XP_009608039.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X3 [Nicotiana tomentosiformis]
Length=1307

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  54   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  111

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  112  RCGAYLDA  119



>ref|XP_009608038.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X2 [Nicotiana tomentosiformis]
Length=1338

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  85   EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  142

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  143  RCGAYLDA  150



>ref|XP_009608035.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608036.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009608037.1| PREDICTED: putative late blight resistance protein homolog R1A-4 
isoform X1 [Nicotiana tomentosiformis]
Length=1354

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 32/68 (47%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG     S+ V++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  101  EYLTGIKGTFGRC--GSHLVIKSLCFITNAKNYGPFGSEAGGTPFSLVMREGGAIVGFHG  158

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  159  RCGAYLDA  166



>ref|XP_009622526.1| PREDICTED: agglutinin-like isoform X3 [Nicotiana tomentosiformis]
Length=539

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            E+LT I GTF  F  D +SV++S+ F TN   +GP+G   G +PF     +G  IVGF G
Sbjct  394  EHLTGIKGTFECF--DGHSVIKSLCFITNANNYGPFGSEAGGTPFSLVMKEGVAIVGFHG  451

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  452  RSGLYLDA  459


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 40/66 (61%), Gaps = 2/66 (3%)
 Frame = +3

Query  354  YLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRA  533
            YLT I GTFG +   SYSV++S+ F TN + +GP+G   G+PF     +G  I GF G  
Sbjct  189  YLTGIKGTFGRY--GSYSVIKSLCFITNAKNYGPFGFEAGTPFSLVIKEGGAIEGFHGHC  246

Query  534  GFYVDA  551
              Y+DA
Sbjct  247  RAYLDA  252


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 2/62 (3%)
 Frame = +3

Query  366  ICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAGFYV  545
            I GTFG     SYSV++ + F TN + +GP+G   G+PF     +G  IVGF GR G Y+
Sbjct  10   IKGTFGRC--GSYSVIKFLCFITNAKNYGPFGCEAGTPFSLVMKEGGAIVGFHGRCGAYL  67

Query  546  DA  551
            DA
Sbjct  68   DA  69



>gb|KHN30030.1| Agglutinin alpha chain, partial [Glycine soja]
Length=180

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V+RS+ F +N R FGPYG   G+ F F + DG  +VGF G
Sbjct  77   DEFLVSVSGHYCPVVRGGTPVIRSLTFKSNHRTFGPYGVEEGTLFTF-SIDGGCVVGFKG  135

Query  528  RAGFYVDA  551
            R  +Y+DA
Sbjct  136  RGDWYLDA  143



>ref|XP_006595102.1| PREDICTED: agglutinin [Glycine max]
Length=181

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V+RS+ F +N R FGPYG   G+ F F + DG  +VGF G
Sbjct  78   DEFLVSVSGHYCPVVRGGTPVIRSLTFKSNHRTFGPYGVEEGTLFTF-SIDGGCVVGFKG  136

Query  528  RAGFYVDA  551
            R  +Y+DA
Sbjct  137  RGDWYLDA  144



>ref|XP_011015046.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Populus 
euphratica]
 ref|XP_011015047.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Populus 
euphratica]
Length=445

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  305  GPWGGRGGSPWSYITNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  355

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  356  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  413

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  414  IPI-NNNTVVGFHGRAGHYLDA  434


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  + GF G
Sbjct  224  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVTGFHG  280

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  281  RGGHYLDA  288



>ref|XP_006597184.1| PREDICTED: agglutinin-like isoform X4 [Glycine max]
Length=181

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V+ S+ F +N + FGPYG   G+PF F   DG  +VGF G
Sbjct  78   DEFLVSVSGHYCPVVRGGTPVILSLTFKSNRKTFGPYGVEEGTPFTFSI-DGGCVVGFKG  136

Query  528  RAGFYVDA  551
            R+ +Y+DA
Sbjct  137  RSDWYLDA  144



>gb|KHN32674.1| Agglutinin alpha chain, partial [Glycine soja]
Length=181

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G + P V     V+ S+ F +N + FGPYG   G+PF F   DG  +VGF G
Sbjct  78   DEFLVSVSGHYCPVVRGGTPVILSLTFKSNRKTFGPYGVEEGTPFTFSI-DGGCVVGFKG  136

Query  528  RAGFYVDA  551
            R+ +Y+DA
Sbjct  137  RSDWYLDA  144



>ref|XP_006663484.1| PREDICTED: putative disease resistance RPP13-like protein 3-like 
[Oryza brachyantha]
Length=1366

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E L E+ GTFG F+    +++ S+ F TN R +GPYG   G+PF         IVGF GR
Sbjct  980   EILVEVSGTFGRFIGFQ-NIITSLTFVTNTRSYGPYGQRKGTPFDIPVQGSGCIVGFFGR  1038

Query  531   AGFYVDA  551
             AG+ VDA
Sbjct  1039  AGWCVDA  1045


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 39/69 (57%), Gaps = 1/69 (1%)
 Frame = +3

Query  345   ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
             + E++T + GT G +   S  V+ SI   TNV  +GP+G   G PF+F      +IVGF 
Sbjct  1133  SSEFITRVSGTIGSYNTPS-DVVTSITLVTNVGCYGPFGQENGIPFNFPVQGNGRIVGFF  1191

Query  525   GRAGFYVDA  551
             G A  YVDA
Sbjct  1192  GHADLYVDA  1200



>ref|XP_011015045.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Populus 
euphratica]
Length=591

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/142 (32%), Positives = 66/142 (46%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  451  GPWGGRGGSPWSYITNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  501

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+PF 
Sbjct  502  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTPFS  559

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  560  IPINN-NTVVGFHGRAGHYLDA  580


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 39/68 (57%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  + GF G
Sbjct  224  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVTGFHG  280

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  281  RGGYYLDA  288


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 38/68 (56%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E+LT I GT+G +      V+ S+ F TN+  +GP+G   G+ F     +G  + GF G
Sbjct  370  SEHLTSITGTYGDYA--GMVVITSLAFQTNLTTYGPFGNATGTSFSIPI-EGSVVTGFHG  426

Query  528  RAGFYVDA  551
            R G Y+DA
Sbjct  427  RGGHYLDA  434



>ref|NP_001148448.1| jasmonate-induced protein [Zea mays]
 gb|ACG31498.1| jasmonate-induced protein [Zea mays]
Length=184

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 42/71 (59%), Gaps = 5/71 (7%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  518
             E LTE+ GT G  + D ++V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  108  SEVLTELSGTIG--IVDGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIVG  165

Query  519  FIGRAGFYVDA  551
            F  RAG Y+DA
Sbjct  166  FFARAGVYLDA  176



>ref|XP_003577374.2| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Brachypodium 
distachyon]
Length=588

 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GP+      V++S+ F T    +GP+G   G+PF         IVGF  R
Sbjct  191  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  250

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  251  AGWYLDA  257



>ref|XP_009614721.1| PREDICTED: jacalin-related lectin 19 [Nicotiana tomentosiformis]
Length=221

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT + G + P V     V+RS+ F++N R FGP+G   G+ F     +G +IVGF GR
Sbjct  87   EYLTGVSGYYCPVVYGGSPVIRSLTFSSNRRTFGPFGVEEGTRFSLPM-EGGQIVGFKGR  145

Query  531  AGFYVDA  551
            +G+Y+DA
Sbjct  146  SGWYLDA  152



>ref|XP_004961357.1| PREDICTED: agglutinin-like [Setaria italica]
Length=208

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+LT + G + P       V+RS+ F +N R +GP+G   G+ F F   DG  IVGF G
Sbjct  83   DEHLTGVSGHYSPIAAGGSPVIRSLAFRSNQRAYGPFGVAEGAAFTFPV-DGGVIVGFCG  141

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  142  RSGWQLDA  149



>ref|XP_004964114.1| PREDICTED: mannose/glucose-specific lectin-like [Setaria italica]
Length=118

 Score = 55.8 bits (133),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 38/68 (56%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++ EI  TFG F  D   V+ S+KF TNVR FGP+   +G+PF         IVGF  
Sbjct  45   SEFVKEISRTFGTF--DGAIVVTSLKFVTNVRTFGPWSRGIGTPFSVPVQSRSGIVGFFA  102

Query  528  RAGFYVDA  551
              G Y+DA
Sbjct  103  HVGKYLDA  110



>ref|XP_007216928.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
 gb|EMJ18127.1| hypothetical protein PRUPE_ppa016643mg, partial [Prunus persica]
Length=351

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            DE+L  + G + P +      ++RS+KF +N R FGPYG   G+PF F   DG KIVG  
Sbjct  253  DEFLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGKIVGLK  311

Query  525  GRAGFYVDA  551
            GR G+Y+DA
Sbjct  312  GRDGWYLDA  320


 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            DE+L  + G + P +      ++RS+KF +N R FGPYG   G+PF F   DG +IVG  
Sbjct  98   DEHLVGVSGHYCPMMFGIGPRLIRSLKFQSNRRTFGPYGIEEGTPFTFTV-DGGQIVGLK  156

Query  525  GRAGFYVDA  551
            GR G+Y+DA
Sbjct  157  GRDGWYLDA  165



>ref|XP_006663456.1| PREDICTED: disease resistance protein RPM1-like [Oryza brachyantha]
Length=1102

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E++ E+ GT+GPF     SV+ S++  TN+R +GP+G   G+ F  +      IVGF G 
Sbjct  1030  EFVKEVSGTYGPFFSFP-SVITSLQLRTNIRSYGPFGEPKGTTFRTRVKQNGSIVGFFGH  1088

Query  531   AGFYVDA  551
             +  Y+DA
Sbjct  1089  STVYIDA  1095



>ref|XP_004984089.1| PREDICTED: protein GOS9-like [Setaria italica]
Length=151

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 41/69 (59%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A EY+TE+ GT GP + D+   + S+KF TN   +GP+G   G+PF+    D   +V   
Sbjct  77   ASEYVTEVAGTIGP-IGDAPHTISSLKFVTNRATYGPFGRGAGTPFNVPL-DNASVVAMF  134

Query  525  GRAGFYVDA  551
             RAG Y+DA
Sbjct  135  ARAGDYLDA  143



>ref|XP_002893064.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69323.1| hypothetical protein ARALYDRAFT_472198 [Arabidopsis lyrata subsp. 
lyrata]
Length=1490

 Score = 59.3 bits (142),  Expect = 4e-07, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  1198  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQIDEG-KVVGFLGR  1256

Query  531   AGFYVDA  551
              G ++D+
Sbjct  1257  EGLFLDS  1263


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/69 (46%), Positives = 43/69 (62%), Gaps = 5/69 (7%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVL--RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
             EYL  I GT+G F  D +  L  RS+ F +N R++GP+G   G+ F      G KIVGF 
Sbjct  971   EYLISINGTYGSF--DVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIVGFH  1027

Query  525   GRAGFYVDA  551
             G+AG+Y+DA
Sbjct  1028  GKAGWYLDA  1036



>ref|XP_010537548.1| PREDICTED: LOW QUALITY PROTEIN: jacalin-related lectin 19 [Tarenaya 
hassleriana]
Length=178

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  +   + P V    SV+R + F +N RE+G YG   G+PF F   +G +I+G  G
Sbjct  83   DEYLISMSRYYCPVVHXGSSVIRVLTFKSNKREYGTYGVEQGTPFIFSV-EGGRIIGLNG  141

Query  528  RAGFYVDA  551
            R+G Y+D+
Sbjct  142  RSGXYLDS  149



>ref|XP_010237569.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Brachypodium 
distachyon]
Length=690

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + GT GP+      V++S+ F T    +GP+G   G+PF         IVGF  R
Sbjct  293  EFLTVVSGTIGPYDSAPAGVIKSLTFITTAGRYGPFGEEKGTPFQIPVQSNGSIVGFFAR  352

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  353  AGWYLDA  359



>ref|XP_011074623.1| PREDICTED: jacalin-related lectin 3 [Sesamum indicum]
Length=670

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 44/68 (65%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+L  + G +G   +  + ++RS+ F +N R++GP+G   G+ F      G KIVGF+G
Sbjct  79   DEFLISVHGYYGSLQERGHVIIRSLTFESNKRKYGPFGVEKGTYFTSSTTHG-KIVGFVG  137

Query  528  RAGFYVDA  551
            +AG+Y+DA
Sbjct  138  KAGWYLDA  145


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 36/67 (54%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + G   P +     V++S+ F T   ++GPYG   G  F  +  +G  +VGF GR
Sbjct  324  EILTHLTGYHAPTMIMGPDVIKSLTFHTTKGKYGPYGEEQGEFFSTKLKEGSMVVGFHGR  383

Query  531  AGFYVDA  551
             G +VDA
Sbjct  384  KGLFVDA  390



>emb|CDP17400.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 44/69 (64%), Gaps = 4/69 (6%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFI  524
             EYLT I GT+G F  +   V+ S+ F TN + +GP+G P+ G  F    PDG  IVGF 
Sbjct  98   SEYLTSITGTYGDF--NGLLVIYSLSFVTNQKAYGPFGSPSSGQAFS-SPPDGNVIVGFH  154

Query  525  GRAGFYVDA  551
            GR+G+Y+DA
Sbjct  155  GRSGWYIDA  163


 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 70/143 (49%), Gaps = 12/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G   G+ WS+ PT+ I +I++          +G     I+  D+   I+   GG D 
Sbjct  177  GPWGGPVGNPWSYIPTDGIKEIIMD---------VGRNIRAISFADANGFISGKFGGKDP  227

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPF  482
                 +  I      EYLT I GTFG F  D   V+ S+ F TN + +GP+G  N G  F
Sbjct  228  NNIGKEEKITIQWPSEYLTSIKGTFGNFNGDV--VIYSLSFITNNKTYGPFGSANSGQAF  285

Query  483  HFQAPDGKKIVGFIGRAGFYVDA  551
                P G  +VGF G +G+++DA
Sbjct  286  TASPPAGNVVVGFHGMSGWFIDA  308



>ref|XP_009391787.1| PREDICTED: agglutinin-like [Musa acuminata subsp. malaccensis]
Length=256

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G +G  +   Y V++S+ F TN R +GP+G   G+PF   A  G++IVGF  
Sbjct  186  DEYLACLSGRYG--ICGGYLVIKSLTFATNKRTYGPFGVEDGAPFKLDA-GGQRIVGFFA  242

Query  528  RAGFYVDA  551
            RAG ++DA
Sbjct  243  RAGQFLDA  250



>ref|XP_009588771.1| PREDICTED: agglutinin-like [Nicotiana tomentosiformis]
Length=345

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYG-PNVGSPFHFQAPDGKKIVGFIG  527
            EYLT I GT G     S+ V++S+ F TN + +GP+G    G+PF     +G  IVGF G
Sbjct  84   EYLTGIKGTLGHH--GSHLVVKSLSFITNAKNYGPFGTEGGGTPFSLVMKEGGAIVGFHG  141

Query  528  RAGFYVDA  551
            R+G Y+DA
Sbjct  142  RSGLYLDA  149



>gb|EMS65594.1| hypothetical protein TRIUR3_06346 [Triticum urartu]
Length=314

 Score = 58.2 bits (139),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 40/67 (60%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EY+ E+ G++  + D S  VL S+K  TN   +GP+G   G+PF    P+   +VGF GR
Sbjct  239  EYVKELSGSYTMWADFSQIVLTSLKLVTNFNTYGPFGKGAGTPFKADIPENSIVVGFHGR  298

Query  531  AGFYVDA  551
            A  +V+A
Sbjct  299  AARFVNA  305



>ref|XP_006838698.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
 gb|ERN01267.1| hypothetical protein AMTR_s00002p00248970 [Amborella trichopoda]
Length=149

 Score = 55.8 bits (133),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 40/68 (59%), Gaps = 7/68 (10%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE +  + G F P       ++RS  F+TN R  GPYG  +G+PF F   DG K+VGF G
Sbjct  21   DETIMSLSGHFEP------KLMRSPSFSTNRRTSGPYGLQIGTPFSFSMTDG-KVVGFHG  73

Query  528  RAGFYVDA  551
            RA  Y++A
Sbjct  74   RASDYLNA  81



>ref|XP_002510454.1| hypothetical protein RCOM_1595950 [Ricinus communis]
 gb|EEF52641.1| hypothetical protein RCOM_1595950 [Ricinus communis]
Length=540

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/68 (49%), Positives = 46/68 (68%), Gaps = 2/68 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            E LT ICG +G F  +DS SV++S+ F TN  ++GP+G  VG+ F     +G KIVGF G
Sbjct  447  ETLTSICGYYGSFTGEDSNSVIKSLTFYTNKGKYGPFGEEVGTFFTSSNTEG-KIVGFHG  505

Query  528  RAGFYVDA  551
            R+G Y++A
Sbjct  506  RSGCYLNA  513


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVL-RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            DEYL  + G +G  V+    VL RS+ F TN R++GP+G   G+ F F    G+ +VGF 
Sbjct  83   DEYLVSVSGHYGSVVEYYGPVLVRSLMFQTNRRKYGPFGIQQGTQFSFPLTGGQ-VVGFH  141

Query  525  GRAGFYVDA  551
            GR+ +Y+D+
Sbjct  142  GRSSWYLDS  150



>emb|CDY48032.1| BnaA02g16250D [Brassica napus]
Length=230

 Score = 57.4 bits (137),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G   P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  135  EEYLIGVSGYCCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGRIVGMNG  193

Query  528  RAGFYVDA  551
            R+G+Y+D+
Sbjct  194  RSGWYLDS  201



>gb|EAY80990.1| hypothetical protein OsI_36172 [Oryza sativa Indica Group]
Length=1081

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E +TE+ GT GPF     SV+ S++  TN+R +GP+G   G+ F  +      IVGF GR
Sbjct  1009  EIVTEVSGTCGPF-SQFPSVVTSLQLVTNLRSYGPFGQAKGTKFRTRVKQNGSIVGFFGR  1067

Query  531   AGFYVDA  551
             +  Y+DA
Sbjct  1068  STIYLDA  1074



>ref|XP_006838705.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
 gb|ERN01274.1| hypothetical protein AMTR_s00002p00249920 [Amborella trichopoda]
Length=610

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 26/68 (38%), Positives = 45/68 (66%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E LT + G +GP      +++RS+ F TN++++GP+G   G+ F F    G K+VGF G
Sbjct  80   EEVLTWLSGHYGPMSSGCPTIIRSLTFQTNLKKYGPFGVQQGTHFSFTMSGG-KVVGFHG  138

Query  528  RAGFYVDA  551
            R+G+++D+
Sbjct  139  RSGWHLDS  146


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I G +G        V++S+ F T   ++GPYG   G  F  Q+  G +IVGF GR
Sbjct  321  EILTYITGNYGAAFLMGPMVIKSLTFHTTKGQYGPYGDQQGMSFSSQSVAG-RIVGFHGR  379

Query  531  AGFYVDA  551
            +G+Y+DA
Sbjct  380  SGWYLDA  386



>ref|XP_004291831.1| PREDICTED: uncharacterized protein LOC101310192 [Fragaria vesca 
subsp. vesca]
Length=642

 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E LT I GTFGP +    +V++S+ F T  ++ GPYG   G+ F  Q  +G KIVG  G
Sbjct  317  NEILTHITGTFGPVMGMGPNVIKSMSFHTTKKKHGPYGEEQGTQFSTQLREG-KIVGIHG  375

Query  528  RAGFYVDA  551
            R G ++DA
Sbjct  376  RTGLFLDA  383


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 40/68 (59%), Gaps = 0/68 (0%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E+LT   G +G   +     LRSI F +N R +GP+G   G+ F      G KIVGF G
Sbjct  80   EEFLTSFHGYYGKISEWGTVSLRSITFKSNKRSYGPFGMEQGTYFSLPVTTGNKIVGFHG  139

Query  528  RAGFYVDA  551
            ++G+YVDA
Sbjct  140  KSGWYVDA  147



>gb|EMS53468.1| hypothetical protein TRIUR3_21407 [Triticum urartu]
Length=135

 Score = 55.5 bits (132),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+ T + G +G F  D   V+RS+ F +N R FGPYG   G PF   A  G KI+GF  
Sbjct  54   DEHFTGVVGHYGEF--DGSFVVRSLTFVSNARSFGPYGQEDGVPFALPAAGG-KILGFHA  110

Query  528  RAGFYVDA  551
            R+G  +DA
Sbjct  111  RSGRRLDA  118



>ref|XP_008391447.1| PREDICTED: uncharacterized protein LOC103453663 [Malus domestica]
Length=353

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 41/68 (60%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G +        +++RS+KF +N R FGP+G   G+ F +   +G KIVG  G
Sbjct  246  DEYLVSVTGNYCLLAYGGTAIIRSLKFQSNRRTFGPFGIEEGTTFTYNV-EGGKIVGLKG  304

Query  528  RAGFYVDA  551
            R G+Y+DA
Sbjct  305  RNGWYIDA  312



>ref|XP_009768586.1| PREDICTED: jacalin-related lectin 3-like [Nicotiana sylvestris]
Length=225

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 10/75 (13%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG--------SPFHFQAPDGK  506
            EYLT I GTFG   D S  V++S+ F TN + +GP+G + G        +PF     +G 
Sbjct  125  EYLTGINGTFGH--DGSDLVIKSLCFITNAKSYGPFGSSYGPFGSMVGGTPFSLVMKEGV  182

Query  507  KIVGFIGRAGFYVDA  551
             IVGF GR+G Y+DA
Sbjct  183  AIVGFHGRSGLYLDA  197



>gb|KDP38566.1| hypothetical protein JCGZ_04491 [Jatropha curcas]
Length=545

 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 2/68 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            E LT +CG +G    DD  +V+RS+ F TN  ++GP+G  VGS F     +G KIVGF G
Sbjct  449  EILTSVCGYYGSLTGDDCNTVIRSLTFYTNKGKYGPFGEEVGSFFTSAKTEG-KIVGFHG  507

Query  528  RAGFYVDA  551
            R+G Y++A
Sbjct  508  RSGCYLNA  515


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  I G +G  VD    ++RS+ F +N R++GP+G  +G+ F F    G K++GF G
Sbjct  81   DEYLVTIIGHYGSVVDYGPILVRSLVFESNRRKYGPFGIQMGTDFSFPLTGG-KVIGFHG  139

Query  528  RAGFYVDA  551
            R  +Y+D+
Sbjct  140  RCSWYLDS  147



>ref|XP_009784520.1| PREDICTED: uncharacterized protein LOC104232941, partial [Nicotiana 
sylvestris]
Length=1047

 Score = 58.5 bits (140),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 31/68 (46%), Positives = 43/68 (63%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-NVGSPFHFQAPDGKKIVGFIG  527
            EYLT I GTFG     S+ V++S+ F TN + +GP+G  + G+PF     +G  IVGF G
Sbjct  94   EYLTGINGTFG--YGGSHLVIKSLCFITNAKSYGPFGSKDGGTPFSLVMKEGVAIVGFHG  151

Query  528  RAGFYVDA  551
             +G Y+DA
Sbjct  152  CSGLYLDA  159



>ref|XP_008782839.1| PREDICTED: agglutinin alpha chain-like [Phoenix dactylifera]
Length=191

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT + G +GP       V+RS+ F TN   +GPYG   G+PFHF    G K  GF GR
Sbjct  80   EYLTSLTGYYGPIEQKGPPVIRSLTFQTNGTTYGPYGREEGTPFHFNFQTGVKFGGFHGR  139

Query  531  A  533
             
Sbjct  140  C  140



>ref|NP_849691.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 gb|AAL32575.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL91614.1| At1g19720/F14P1_33 [Arabidopsis thaliana]
 gb|AAN15429.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE29888.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=595

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  304  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQMDEG-KVVGFLGR  362

Query  531  AGFYVDA  551
             G ++D+
Sbjct  363  EGLFLDS  369


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  77   EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  135

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  136  AGWYLDA  142



>ref|NP_001117315.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 gb|AAG12566.1|AC007797_26 Unknown protein [Arabidopsis thaliana]
 gb|AEE29889.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=571

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  280  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQMDEG-KVVGFLGR  338

Query  531  AGFYVDA  551
             G ++D+
Sbjct  339  EGLFLDS  345


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  53   EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  111

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  112  AGWYLDA  118



>ref|NP_001185041.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
 sp|F4HQX1.1|JAL3_ARATH RecName: Full=Jacalin-related lectin 3; AltName: Full=Mannose-binding 
lectin superfamily protein [Arabidopsis thaliana]
 gb|AEE29890.1| Mannose-binding lectin superfamily protein [Arabidopsis thaliana]
Length=601

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  310  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQMDEG-KVVGFLGR  368

Query  531  AGFYVDA  551
             G ++D+
Sbjct  369  EGLFLDS  375


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL  + GT+G F       +RS+ F +N R++GP+G + G+ F      G KI+GF G+
Sbjct  83   EYLISVNGTYGSFDVWGTICVRSLTFESNRRKYGPFGVDSGTFFAL-PKSGSKIIGFHGK  141

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  142  AGWYLDA  148



>ref|XP_010231090.1| PREDICTED: jacalin-related lectin 19-like isoform X3 [Brachypodium 
distachyon]
Length=224

 Score = 56.2 bits (134),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-----NVGSPFHFQAPDGKKI  512
            DE+LT + G +GP      +V+RS+ F T+   +GP+G         +PF F A DG  I
Sbjct  87   DEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAGPTADGGTTPFEF-AVDGGVI  145

Query  513  VGFIGRAGFYVDA  551
            VGF GR+G+ +DA
Sbjct  146  VGFCGRSGWQLDA  158



>emb|CDX82115.1| BnaC02g21750D [Brassica napus]
Length=250

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYL  + G + P V     V+RS+ F +N + +GPYG   G+PF F   +G +IVG  G
Sbjct  155  EEYLIGVSGYYCPVVHSGTPVIRSMTFKSNKQVYGPYGVEQGTPFSFSV-NGGRIVGMNG  213

Query  528  RAGFYVDA  551
            R+ +Y+D+
Sbjct  214  RSSWYLDS  221



>gb|KCW67999.1| hypothetical protein EUGRSUZ_F01690 [Eucalyptus grandis]
Length=1154

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT I G      D +  V++S+KF TN + +GP+G   G  FHF   DG KIVGF G
Sbjct  386  NEYLTSISGHIRD--DQTPIVIQSLKFHTNRKTYGPFGSEQGESFHFPQVDGAKIVGFHG  443

Query  528  RAGFYVDA  551
            + G ++D+
Sbjct  444  KCGKHLDS  451



>gb|ABA94728.1| Jacalin-like lectin domain containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ12138.1| hypothetical protein OsJ_02021 [Oryza sativa Japonica Group]
Length=837

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 40/69 (58%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            + E+L  + GT GPF   S  V+ S+ F TNVR +GP+G   G+PF        KIVGF 
Sbjct  762  SSEFLVRVFGTIGPF-RASRCVVTSVTFVTNVRSYGPFGQGGGTPFDVPMQSNGKIVGFF  820

Query  525  GRAGFYVDA  551
            G A  YV+A
Sbjct  821  GHARSYVEA  829



>gb|AFW82809.1| hypothetical protein ZEAMMB73_630227 [Zea mays]
Length=195

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +E++ E+ GT+G F  +  + L S++F T+ R +GP+G   G+ F   AP G  +VGF G
Sbjct  121  NEHIREVSGTYGTF--EGATTLTSLRFITSTRAWGPWGTENGTRFCITAPIGSSVVGFYG  178

Query  528  RAGF-YVDA  551
            RAG   VDA
Sbjct  179  RAGTRLVDA  187



>gb|EMT23136.1| hypothetical protein F775_18655 [Aegilops tauschii]
Length=118

 Score = 54.3 bits (129),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 39/69 (57%), Gaps = 2/69 (3%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A  Y+TEI GT G F  D   ++ S+K  T+      YG   G+PF     DG KIVGF 
Sbjct  45   ATNYVTEISGTVGKFGTDD--IVTSLKIVTSKGVTKTYGSGTGTPFRVPVLDGGKIVGFF  102

Query  525  GRAGFYVDA  551
            GRAG ++DA
Sbjct  103  GRAGAFLDA  111



>gb|KCW67998.1| hypothetical protein EUGRSUZ_F01690 [Eucalyptus grandis]
Length=1237

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT I G      D +  V++S+KF TN + +GP+G   G  FHF   DG KIVGF G
Sbjct  386  NEYLTSISGHIRD--DQTPIVIQSLKFHTNRKTYGPFGSEQGESFHFPQVDGAKIVGFHG  443

Query  528  RAGFYVDA  551
            + G ++D+
Sbjct  444  KCGKHLDS  451



>ref|XP_011001803.1| PREDICTED: mannose/glucose-specific lectin-like [Populus euphratica]
Length=446

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 65/142 (46%), Gaps = 12/142 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G  GG  WS+     INQIVI          +G     I+  D+    +   GG + 
Sbjct  306  GPWGGRGGSPWSYMTNRGINQIVIH---------VGSNIKSISFRDTTGLDSATFGGENP  356

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
                    ++ +   E+L  I GT+G F   +   + S+ FTTN   +GP+G   G+ F 
Sbjct  357  NDIGERKTVLINWPSEHLISISGTYGNF--STLLTITSLSFTTNRATYGPFGTGSGTAFS  414

Query  486  FQAPDGKKIVGFIGRAGFYVDA  551
                +   +VGF GRAG Y+DA
Sbjct  415  IPINN-NTVVGFHGRAGHYLDA  435



>gb|EAZ25557.1| hypothetical protein OsJ_09383 [Oryza sativa Japonica Group]
Length=126

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E++T++ GT GPF   S SV+ SI FTTN   +GP+G   G+ F         IVGF G
Sbjct  52   SEFVTKVYGTIGPFGKFS-SVITSIHFTTNADRYGPFGQGTGTRFEAPMHSDGSIVGFFG  110

Query  528  RAGFYVDA  551
            R   YVDA
Sbjct  111  RTSSYVDA  118



>ref|XP_010477196.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
isoform X3 [Camelina sativa]
Length=1240

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  950   EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  1008

Query  531   AGFYVDA  551
              G ++DA
Sbjct  1009  EGLFLDA  1015


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL  + GT+G F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  723  EYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGK  781

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  782  AGWYIDA  788



>ref|XP_010498396.1| PREDICTED: pentatricopeptide repeat-containing protein At1g19720-like 
[Camelina sativa]
Length=1235

 Score = 57.8 bits (138),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351   EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
             E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  945   EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  1003

Query  531   AGFYVDA  551
              G ++DA
Sbjct  1004  EGLFLDA  1010


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 51/176 (29%), Positives = 76/176 (43%), Gaps = 13/176 (7%)
 Frame = +3

Query  24   GTKSNKTCSLSSIPFALKLSSN*ETMAVPIDAVSGPLGNSGGDFWSFRPTNKINQIVIRs  203
            G K N+  +L+SI  A  L  N +    P  A  GP G   G  W       + QI+I  
Sbjct  621  GIKPNRG-TLASIILAHGLMGNIDEGKKP--ASVGPWGGQSGHAWDDGMYTTVRQIIIGH  677

Query  204  ggsgnnnPIGITFSCINEDDSKEtitvggggtdtlvtrtdtviidddADEYLTEICGTFG  383
                     G +   I  +  K   +V          +    +  D   EYL  + GT+G
Sbjct  678  ---------GSSIDSIQVEYEKNGSSVWSEKRGGKGGKKIDNVKLDYPHEYLISVNGTYG  728

Query  384  PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGRAGFYVDA  551
             F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+AG+Y+DA
Sbjct  729  SFDAWGNTCVRSLTLESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGKAGWYIDA  783



>ref|XP_002893063.1| jacalin lectin family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69322.1| jacalin lectin family protein [Arabidopsis lyrata subsp. lyrata]
Length=596

 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + GT+GP +    +V++S+ F TN  + GPYG   G  F  Q  +G K+VGF+GR
Sbjct  304  EVLTHVTGTYGPLMYMGPNVIKSLTFRTNRGKHGPYGEEQGPSFTHQIDEG-KVVGFLGR  362

Query  531  AGFYVDA  551
             G ++D+
Sbjct  363  EGLFLDS  369


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL  I GT+G F       +RS+ F +N R++GP+G   G+ F      G KIVGF G+
Sbjct  77   EYLISINGTYGSFDVWGTLCVRSLTFESNRRKYGPFGVESGTFFAL-PKSGSKIVGFHGK  135

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  136  AGWYLDA  142



>ref|XP_010231089.1| PREDICTED: jacalin-related lectin 19-like isoform X2 [Brachypodium 
distachyon]
Length=225

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-----NVGSPFHFQAPDGKKI  512
            DE+LT + G +GP      +V+RS+ F T+   +GP+G         +PF F A DG  I
Sbjct  88   DEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAGPTADGGTTPFEF-AVDGGVI  146

Query  513  VGFIGRAGFYVDA  551
            VGF GR+G+ +DA
Sbjct  147  VGFCGRSGWQLDA  159



>ref|XP_008783084.1| PREDICTED: inactive protein RESTRICTED TEV MOVEMENT 1-like [Phoenix 
dactylifera]
Length=209

 Score = 55.5 bits (132),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 34/61 (56%), Gaps = 0/61 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT + G +GP       V+RS+ F TN   +GPYG   G+PFHF    G K  GF GR
Sbjct  80   EYLTSLTGYYGPIEQKGPLVIRSLTFETNGTTYGPYGQEEGTPFHFNFLTGVKFGGFHGR  139

Query  531  A  533
             
Sbjct  140  C  140



>gb|KHN46147.1| Agglutinin [Glycine soja]
Length=597

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I G +GP +    SV+RS+ F T  R++GPYG   G+ F  +  +G KIVG  GR
Sbjct  311  EALTHISGYYGPLMYMGPSVIRSLTFHTTKRKYGPYGEEQGTYFTTKVKEG-KIVGIHGR  369

Query  531  AGFYVDA  551
             G ++DA
Sbjct  370  KGLFLDA  376


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 43/143 (30%), Positives = 67/143 (47%), Gaps = 12/143 (8%)
 Frame = +3

Query  126  GPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdt  305
            GP G +GG  W     + + Q+VI           G     I  +  K+  ++       
Sbjct  14   GPWGGNGGSRWDDGIYSGVRQLVIVH---------GTGIDSIQIEYDKKGSSIWSEKHGG  64

Query  306  lvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFH  485
               R    +  D  +E+LT+I G +G       + +RS+ F +N + +GP+G  +G+  +
Sbjct  65   SGGRKTDKVKLDCPNEFLTKIHGYYGSSNQRGPNFVRSLSFESNKKTYGPFGVELGT--Y  122

Query  486  FQAP-DGKKIVGFIGRAGFYVDA  551
            F  P  G KIVGF GR G+YVDA
Sbjct  123  FSVPLTGAKIVGFHGRCGWYVDA  145


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            +E LT I G +GP   D+ + +++S+ F T+  ++GP+G  VG  F     +G K+VGF 
Sbjct  507  NEVLTCISGYYGPIAKDEQHIIMKSLTFNTSRGKYGPFGEEVGKFFTSTTTEG-KVVGFH  565

Query  525  GRAGFYVDA  551
            GR+  Y+DA
Sbjct  566  GRSSLYLDA  574



>ref|XP_010064569.1| PREDICTED: jacalin-related lectin 4-like [Eucalyptus grandis]
Length=989

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            +EYLT I G      D +  V++S+KF TN + +GP+G   G  FHF   DG KIVGF G
Sbjct  175  NEYLTSISGHIRD--DQTPIVIQSLKFHTNRKTYGPFGSEQGESFHFPQVDGAKIVGFHG  232

Query  528  RAGFYVDA  551
            + G ++D+
Sbjct  233  KCGKHLDS  240



>ref|XP_002510452.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
 gb|EEF52639.1| pentatricopeptide repeat-containing protein, putative [Ricinus 
communis]
Length=1218

 Score = 57.4 bits (137),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I GT+GP +    ++++S+ F TN  + GP+G   G  F  + P+G KIVGF G+
Sbjct  932  EILTHISGTYGPLMFMGPNIIKSLTFYTNKGKHGPFGDEQGPSFSTK-PNGGKIVGFHGK  990

Query  531  AGFYVDA  551
             G ++DA
Sbjct  991  EGLFLDA  997


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 27/68 (40%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYL  + G +G         +RS+ F +N R +GP+G   G+ F F    G +IVGF G
Sbjct  701  DEYLASVSGHYGSLNQWGPVFVRSLTFQSNKRTYGPFGVEQGTYFSFPMTGG-RIVGFHG  759

Query  528  RAGFYVDA  551
            + G++VDA
Sbjct  760  KGGYFVDA  767


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Composition-based stats.
 Identities = 28/68 (41%), Positives = 43/68 (63%), Gaps = 2/68 (3%)
 Frame = +3

Query  351   EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E LT I G +GP   D+  +V++S+ F T+  ++GP+G  +G+ F     +G K+VGF G
Sbjct  1128  EVLTRISGYYGPASRDERPTVVKSLTFYTSRGQYGPFGEEIGTFFTSTTTEG-KVVGFHG  1186

Query  528   RAGFYVDA  551
             R G Y+DA
Sbjct  1187  RCGAYLDA  1194



>gb|EMS51533.1| hypothetical protein TRIUR3_05238 [Triticum urartu]
Length=304

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 40/68 (59%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+LT + G +G        V+RS+ F T    +GP+G   G+PF F A +G  IVG  G
Sbjct  173  DEHLTAVSGRYGAVAPGGSPVIRSLAFRTERAAYGPFGAAEGTPFEF-AVEGGVIVGLCG  231

Query  528  RAGFYVDA  551
            R+G+ +DA
Sbjct  232  RSGWQLDA  239



>ref|XP_009782510.1| PREDICTED: jacalin-related lectin 19 [Nicotiana sylvestris]
Length=209

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT + G + P V     V+RS+  ++N R FGP+G   G+ F     +G +IVGF GR
Sbjct  87   EYLTGVSGYYCPVVYGGSPVIRSLTVSSNRRTFGPFGVEEGTRFSLPM-EGGQIVGFKGR  145

Query  531  AGFYVDA  551
            +G+Y+DA
Sbjct  146  SGWYLDA  152



>ref|XP_004986922.1| PREDICTED: horcolin-like [Setaria italica]
Length=132

 Score = 53.9 bits (128),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LTE+ GTF          + S+ F TN+R+ GP+G   G+PF     DG +IV   GR
Sbjct  55   EFLTEVSGTFAYIGTQPTDAVTSLTFVTNLRKHGPFGDVDGTPFSVPVRDGGRIVALFGR  114

Query  531  AGFYVDA  551
               Y+DA
Sbjct  115  GWDYIDA  121



>ref|XP_010231088.1| PREDICTED: jacalin-related lectin 19-like isoform X1 [Brachypodium 
distachyon]
Length=259

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 43/73 (59%), Gaps = 6/73 (8%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP-----NVGSPFHFQAPDGKKI  512
            DE+LT + G +GP      +V+RS+ F T+   +GP+G         +PF F A DG  I
Sbjct  122  DEHLTAVSGRYGPVAQGGAAVIRSLAFRTDRAAYGPFGAGPTADGGTTPFEF-AVDGGVI  180

Query  513  VGFIGRAGFYVDA  551
            VGF GR+G+ +DA
Sbjct  181  VGFCGRSGWQLDA  193



>ref|XP_004979669.1| PREDICTED: mannose/glucose-specific lectin-like isoform X1 [Setaria 
italica]
Length=844

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + G+ G F +   +V+ S+ F TNVR +GP+G   G  FH        IVGF GR
Sbjct  616  EFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFFGR  674

Query  531  AGFYVDA  551
            AG Y+DA
Sbjct  675  AGRYLDA  681


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+L  + G+ G F +    V+ S+ F TN R +GP+G   G PFH Q      IVGF G 
Sbjct  402  EFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFFGH  460

Query  531  AGFYVDA  551
            +  Y++A
Sbjct  461  SRRYLEA  467



>gb|EMT18893.1| Disease resistance protein RPM1 [Aegilops tauschii]
Length=809

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 26/67 (39%), Positives = 39/67 (58%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E L E+ GT G +     +V+ S+   T+ R +GP+G   G PF  +A     I+GF GR
Sbjct  736  EILKEVSGTVGSY-GALTNVITSLTLVTSARTYGPFGKGDGIPFSMEAASNSSIIGFFGR  794

Query  531  AGFYVDA  551
            +G+Y+DA
Sbjct  795  SGWYLDA  801



>ref|XP_010109960.1| hypothetical protein L484_009242 [Morus notabilis]
 gb|EXC24956.1| hypothetical protein L484_009242 [Morus notabilis]
Length=204

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 45/70 (64%), Gaps = 3/70 (4%)
 Frame = +3

Query  351  EYLTEICGTFG--PFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            E +T + G  G  P+   +  V+RSIKFTTN   +GPYG   G+PF+ Q PDG  I GF 
Sbjct  127  ERITGVSGHVGVVPYDPTTTPVVRSIKFTTNENIYGPYGVEEGTPFNAQIPDGAFISGFE  186

Query  525  GRA-GFYVDA  551
            GR+ G+Y+++
Sbjct  187  GRSNGYYLNS  196



>ref|XP_004979671.1| PREDICTED: mannose/glucose-specific lectin-like isoform X3 [Setaria 
italica]
Length=793

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + G+ G F +   +V+ S+ F TNVR +GP+G   G  FH        IVGF GR
Sbjct  565  EFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFFGR  623

Query  531  AGFYVDA  551
            AG Y+DA
Sbjct  624  AGRYLDA  630


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+L  + G+ G F +    V+ S+ F TN R +GP+G   G PFH Q      IVGF G 
Sbjct  351  EFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFFGH  409

Query  531  AGFYVDA  551
            +  Y++A
Sbjct  410  SRRYLEA  416



>ref|XP_004979670.1| PREDICTED: mannose/glucose-specific lectin-like isoform X2 [Setaria 
italica]
Length=823

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LT + G+ G F +   +V+ S+ F TNVR +GP+G   G  FH        IVGF GR
Sbjct  595  EFLTGVSGSIGSF-NTLVNVITSLTFVTNVRNYGPFGKGRGPHFHIPMESNGCIVGFFGR  653

Query  531  AGFYVDA  551
            AG Y+DA
Sbjct  654  AGRYLDA  660


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+L  + G+ G F +    V+ S+ F TN R +GP+G   G PFH Q      IVGF G 
Sbjct  402  EFLIGVSGSIGSF-NGLKKVITSLTFVTNARSYGPFGRARGRPFHIQVQSHGCIVGFFGH  460

Query  531  AGFYVDA  551
            +  Y++A
Sbjct  461  SRRYLEA  467



>gb|ABA94732.1| Jacalin-like lectin domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=597

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E+LTEI GT GP+V     V++S+   TN   +GP+G   G+ FH    +G  IVGF GR
Sbjct  362  EFLTEISGTTGPYVCAVADVVKSLTLVTNSGSYGPFGQGGGTAFHTSQSNG-SIVGFFGR  420

Query  531  AGFYVDA  551
            AG ++ +
Sbjct  421  AGGFLHS  427


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            E++  + GT G F     +V+ S+KFTTN+ R +GPYG   G+PF     D   IVGF G
Sbjct  522  EHIKGLSGTVGSF-GMLQNVITSLKFTTNLNRTYGPYGKGGGTPFVVPVEDAASIVGFFG  580

Query  528  RAGFYVDA  551
            RAG  V+A
Sbjct  581  RAGPCVEA  588



>ref|XP_006416472.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
 gb|ESQ34825.1| hypothetical protein EUTSA_v10007145mg [Eutrema salsugineum]
Length=594

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYLT + GT+G F    +  +RS+ F +N +++GP+G   G+ F     D  KI+GF G+
Sbjct  77   EYLTSVRGTYGSFDVWGHLCVRSLTFESNRKKYGPFGVESGTYFALPKLD-SKIIGFHGK  135

Query  531  AGFYVDA  551
            AG+YVDA
Sbjct  136  AGWYVDA  142


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + GT+GP +    +V++S+ F TN+ + GP+G   G  F  +  +G K+VGF+GR
Sbjct  304  EVLTHVTGTYGPLMYMGPNVIKSLTFHTNLGKHGPFGEEQGPSFAHKIDEG-KVVGFLGR  362

Query  531  AGFYVDA  551
             G ++D+
Sbjct  363  EGLFLDS  369



>ref|XP_008651439.1| PREDICTED: jasmonate-induced protein isoform X1 [Zea mays]
 gb|ACL53153.1| unknown [Zea mays]
 tpg|DAA60180.1| TPA: beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  518
             E LTE+ GT G    D ++V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIVG  287

Query  519  FIGRAGFYVDA  551
            F  RAG Y+DA
Sbjct  288  FFARAGVYLDA  298



>gb|KHG26998.1| Agglutinin [Gossypium arboreum]
Length=600

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I GTF P +    +V+RS+ F TN  + GPYG   G  F  +  +G KIVGF+GR
Sbjct  314  EILTHITGTFAPLMYMGPNVIRSLTFYTNKGKHGPYGDEQGPSFTNKMNEG-KIVGFLGR  372

Query  531  AGFYVDA  551
             G ++DA
Sbjct  373  EGLFLDA  379


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/68 (40%), Positives = 40/68 (59%), Gaps = 3/68 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DE+LT I G +G        ++RS+ F +N + +GP+G   G+ F        KIVGF G
Sbjct  78   DEFLTSIHGYYGSLNQRGPIIVRSLTFHSNRKAYGPFGIEQGTSFSMNK---GKIVGFRG  134

Query  528  RAGFYVDA  551
            R+G+Y+DA
Sbjct  135  RSGWYLDA  142



>ref|XP_002467725.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
 gb|EER94723.1| hypothetical protein SORBIDRAFT_01g033090 [Sorghum bicolor]
Length=149

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 42/69 (61%), Gaps = 1/69 (1%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
            A EY+TE+ G+ GP  D ++++  S+KF TN   +GP+G   G+PF+    +   +VG  
Sbjct  74   AHEYVTEVAGSVGPIGDLTHTI-TSLKFVTNRGTYGPFGRGDGTPFNVPVLNNGSVVGMF  132

Query  525  GRAGFYVDA  551
             RA  Y+DA
Sbjct  133  ARADQYLDA  141



>emb|CAE76026.1| B1292H11.12 [Oryza sativa Japonica Group]
 gb|EAZ29534.1| hypothetical protein OsJ_13607 [Oryza sativa Japonica Group]
Length=183

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 42/74 (57%), Gaps = 5/74 (7%)
 Frame = +3

Query  345  ADEYLTEICGTFGPFVDDSYSVLRSIKFTTNV-REFGPYG----PNVGSPFHFQAPDGKK  509
            ADE +T + GT G F D    V+ S+ F TN  + +GPYG       G+PF     +G  
Sbjct  102  ADEQVTSVEGTIGRFRDVDEPVITSLTFRTNAGKTYGPYGGASDKQAGTPFSIPVDNGGV  161

Query  510  IVGFIGRAGFYVDA  551
            +VGF GRAG+ +DA
Sbjct  162  VVGFWGRAGWLIDA  175



>ref|XP_010533565.1| PREDICTED: jacalin-related lectin 3 isoform X1 [Tarenaya hassleriana]
Length=601

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + GT+G F       +RS+ F +N R++GP+G   G+ F     +  KIVGF G
Sbjct  82   DEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSLPKSEA-KIVGFHG  140

Query  528  RAGFYVDA  551
            + G+Y+DA
Sbjct  141  KTGWYLDA  148


 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I GT+G  +    +V+RS+ F TN  + GPYG   G  F  +  +G KIVGF+GR
Sbjct  313  EVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGEG-KIVGFLGR  371

Query  531  AGFYVDA  551
             G ++DA
Sbjct  372  EGLFLDA  378



>ref|XP_010533571.1| PREDICTED: jacalin-related lectin 3 isoform X2 [Tarenaya hassleriana]
Length=598

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 1/68 (1%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            DEYLT + GT+G F       +RS+ F +N R++GP+G   G+ F     +  KIVGF G
Sbjct  79   DEYLTSVHGTYGSFDVWGTLCVRSLTFESNRRKYGPFGSESGTYFSLPKSEA-KIVGFHG  137

Query  528  RAGFYVDA  551
            + G+Y+DA
Sbjct  138  KTGWYLDA  145


 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I GT+G  +    +V+RS+ F TN  + GPYG   G  F  +  +G KIVGF+GR
Sbjct  310  EVLTRITGTYGSLMYMGPNVIRSLTFYTNKGKHGPYGEEQGPSFTNKIGEG-KIVGFLGR  368

Query  531  AGFYVDA  551
             G ++DA
Sbjct  369  EGLFLDA  375



>ref|XP_006354454.1| PREDICTED: probable disease resistance RPP8-like protein 4-like 
[Solanum tuberosum]
Length=303

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 64/140 (46%), Gaps = 12/140 (9%)
 Frame = +3

Query  135  GNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvggggtdtlvt  314
            G SGG  W++RP   + QIV++          G+    I    S+E   +          
Sbjct  161  GGSGGSHWNYRPKGVVKQIVVKH---------GLIIDSIMFKSSEENGVMESKTFGGSGG  211

Query  315  rtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQ-  491
               T I  D   EYLT + GT+G +    Y +++SIK  TN+   GP G  + +  +F  
Sbjct  212  HLTTEINIDSPSEYLTGLSGTYGLY--GPYLIIKSIKLHTNLSHHGPMGSVIETDTNFSF  269

Query  492  APDGKKIVGFIGRAGFYVDA  551
               G  +VGF G +G ++DA
Sbjct  270  IMQGGVVVGFHGFSGLFLDA  289



>ref|XP_009608047.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104102120 
[Nicotiana tomentosiformis]
Length=1799

 Score = 56.6 bits (135),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 29/68 (43%), Positives = 42/68 (62%), Gaps = 3/68 (4%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVG-SPFHFQAPDGKKIVGFIG  527
            EYL  I GTFG +    +SV++S+ F TN + +GP+G   G +PF     +G  IVGF G
Sbjct  67   EYLKGINGTFGCYY--GHSVIKSLCFITNAKNYGPFGCEAGGTPFSLVMKEGVAIVGFHG  124

Query  528  RAGFYVDA  551
            R+  Y++A
Sbjct  125  RSELYLNA  132



>tpg|DAA60181.1| TPA: hypothetical protein ZEAMMB73_326702 [Zea mays]
Length=297

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 41/71 (58%), Gaps = 5/71 (7%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  518
             E LTE+ GT G    D ++V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  170  SEVLTELSGTIGNV--DGHTVITSIKFVTSLKTYGPFGAWGDGSDTPFAIPVQQGSAIVG  227

Query  519  FIGRAGFYVDA  551
            F  RAG Y+DA
Sbjct  228  FFARAGVYLDA  238



>ref|XP_002461768.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
 gb|EER98289.1| hypothetical protein SORBIDRAFT_02g007760 [Sorghum bicolor]
Length=361

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 41/68 (60%), Gaps = 2/68 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
             E +TE+ GT G F D++  V+ SIKF TN++ +GP+G    +PF      G  IVGF  
Sbjct  232  SEVVTEVSGTVGNFYDNT--VITSIKFVTNLQTYGPWGDGQDAPFTIPVQPGSGIVGFFA  289

Query  528  RAGFYVDA  551
            RAG  +DA
Sbjct  290  RAGDCLDA  297



>gb|AAM46813.1| hessian fly response gene 1 protein [Triticum aestivum]
Length=345

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 2/70 (3%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDS--YSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGF  521
             E +TE+ GT G F +D+  Y+ + S+  TTN R +GP+G    +PF     D   IVGF
Sbjct  265  SEIVTEVSGTVGIFAEDNVEYNAIASLTITTNHRPYGPFGETQSTPFSVPVQDNNNIVGF  324

Query  522  IGRAGFYVDA  551
               AG YV+A
Sbjct  325  FACAGKYVEA  334



>ref|NP_001068257.2| Os11g0607900 [Oryza sativa Japonica Group]
 dbj|BAF28620.2| Os11g0607900, partial [Oryza sativa Japonica Group]
Length=107

 Score = 53.1 bits (126),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 36/69 (52%), Gaps = 4/69 (6%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVL-RSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFI  524
             EYLT I GT        Y V+  S+   TN R +GPYG   G+PF         IVGF 
Sbjct  23   SEYLTGISGTIA---SSPYGVIITSLTLVTNTRTYGPYGQVGGTPFQIPIQIKGSIVGFF  79

Query  525  GRAGFYVDA  551
            GR G+YVDA
Sbjct  80   GRVGWYVDA  88



>ref|XP_006654724.1| PREDICTED: agglutinin-like [Oryza brachyantha]
Length=200

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/70 (43%), Positives = 42/70 (60%), Gaps = 3/70 (4%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYS-VLRSIKFTTNVREFGPYGPNV-GSPFHFQAPDGKKIVGF  521
            +EY+T + G + P         +RS+ FTTN RE+GP+G    G+PF F   DG  +VGF
Sbjct  76   EEYVTTVSGHYAPVAAHGGEPAIRSLAFTTNRREYGPFGAAAEGTPFTFPV-DGGAVVGF  134

Query  522  IGRAGFYVDA  551
             GR+G  +DA
Sbjct  135  WGRSGRQLDA  144



>ref|NP_001104964.1| beta-glucosidase aggregating factor precursor [Zea mays]
 gb|AAF71261.2|AF232008_1 beta-glucosidase aggregating factor precursor [Zea mays]
Length=306

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  518
             E LTE+ GT G    D  +V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIVG  287

Query  519  FIGRAGFYVDA  551
            F  RAG Y+DA
Sbjct  288  FFARAGVYLDA  298



>gb|ABJ97445.1| beta-glucosidase aggregating factor 1 [Zea mays]
Length=306

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 40/71 (56%), Gaps = 5/71 (7%)
 Frame = +3

Query  348  DEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGP---NVGSPFHFQAPDGKKIVG  518
             E LTE+ GT G    D  +V+ SIKF T+++ +GP+G       +PF      G  IVG
Sbjct  230  SEVLTELSGTIGNV--DGLTVITSIKFVTSLKTYGPFGAWGNGSDTPFAIPVQQGSAIVG  287

Query  519  FIGRAGFYVDA  551
            F  RAG Y+DA
Sbjct  288  FFARAGVYLDA  298



>ref|XP_003615697.1| Myrosinase-binding protein-like protein [Medicago truncatula]
 gb|AES98655.1| mannose-binding lectin superfamily protein [Medicago truncatula]
Length=604

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 67/146 (46%), Gaps = 12/146 (8%)
 Frame = +3

Query  117  AVSGPLGNSGGDFWSFRPTNKINQIVIRsggsgnnnPIGITFSCINEDDSKEtitvgggg  296
            A  GP G +GG  W     + + Q+V+           G     I  +  K+  ++    
Sbjct  16   ASVGPWGGNGGSRWDDGIYSGVRQLVVVH---------GTGIDSIQIEYDKKGSSIWSEK  66

Query  297  tdtlvtrtdtviidddADEYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGS  476
                       +  D  DE+LT + G +G      ++++RS+ F +N + +GP+G   G+
Sbjct  67   HGGTGGNKTDKVKLDYPDEFLTSVHGYYGSLNQWGHNLVRSLSFESNKKTYGPFGVEQGT  126

Query  477  PFHFQAP-DGKKIVGFIGRAGFYVDA  551
              +F  P  G KIVGF GR G+Y+DA
Sbjct  127  --YFSVPMTGAKIVGFHGRCGWYLDA  150


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I G  GP +    +V+RS+ F T  R++GP+G   G+ F  +  +G KIVG  GR
Sbjct  318  EVLTYISGYHGPLMYMGPAVIRSLTFHTTKRKYGPFGEEQGTYFTTKVKEG-KIVGIHGR  376

Query  531  AGFYVDA  551
             G ++DA
Sbjct  377  KGLFLDA  383


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 42/68 (62%), Gaps = 2/68 (3%)
 Frame = +3

Query  351  EYLTEICGTFGPFV-DDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIG  527
            E LT I G +G    D+ ++V++S+ F T+  ++GPYG  VG  F     +G K+VGF G
Sbjct  515  EVLTCISGYYGSITKDEKHTVIKSLTFHTSRGQYGPYGEEVGKFFTSTTTEG-KVVGFHG  573

Query  528  RAGFYVDA  551
            R+  Y+DA
Sbjct  574  RSSLYLDA  581



>gb|EMT33622.1| Cysteine proteinase RD21a [Aegilops tauschii]
Length=857

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 40/67 (60%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT I G +GP +    + +RS+ F TN R +GPYG   G+ F     DG ++VGF GR
Sbjct  582  EVLTHITGYYGPTIIMGPTAVRSLTFHTNRRRYGPYGDEYGTYFSTSFADG-RVVGFHGR  640

Query  531  AGFYVDA  551
             G+Y+D 
Sbjct  641  EGWYIDG  647



>ref|XP_010477195.1| PREDICTED: jacalin-related lectin 3-like isoform X2 [Camelina 
sativa]
Length=573

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + GT+GP V    +V++S+ F TN  + GP+G   G  F  +  +G K+VGF+GR
Sbjct  283  EVLTHVTGTYGPLVYLGPNVIKSLTFRTNKGKHGPFGEEHGPTFTHKIDEG-KVVGFLGR  341

Query  531  AGFYVDA  551
             G ++DA
Sbjct  342  EGLFLDA  348


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/67 (40%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            EYL  + GT+G F     + +RS+   +N R++GP+G   G+ F      G KI+GF G+
Sbjct  56   EYLISVNGTYGSFDAWGNTCVRSLILESNHRKYGPFGCESGTFFAL-PKSGSKIIGFHGK  114

Query  531  AGFYVDA  551
            AG+Y+DA
Sbjct  115  AGWYIDA  121



>ref|XP_004170416.1| PREDICTED: LOW QUALITY PROTEIN: agglutinin-like, partial [Cucumis 
sativus]
Length=348

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 1/67 (1%)
 Frame = +3

Query  351  EYLTEICGTFGPFVDDSYSVLRSIKFTTNVREFGPYGPNVGSPFHFQAPDGKKIVGFIGR  530
            E LT + G +GP +    +V++S+ F T   ++GP+G   G+PF     DG KIVGF GR
Sbjct  57   EILTHVTGHYGPVMYMGPNVIKSLTFHTTKAKYGPFGEAQGTPFSTNVKDG-KIVGFHGR  115

Query  531  AGFYVDA  551
             G ++DA
Sbjct  116  KGLFLDA  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 572029174332