BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c6925_g1_i1 len=715 path=[1:0-714]

Length=715
                                                                      Score     E

ref|XP_009761027.1|  PREDICTED: uncharacterized protein LOC104213261  82.4    2e-16   
ref|XP_009794963.1|  PREDICTED: uncharacterized protein LOC104241727  76.6    2e-14   
ref|XP_009588361.1|  PREDICTED: uncharacterized protein LOC104085944  72.4    9e-13   
ref|XP_006363714.1|  PREDICTED: uncharacterized protein LOC102602347  72.0    1e-12   
ref|XP_009623040.1|  PREDICTED: uncharacterized protein LOC104114325  70.9    3e-12   
ref|XP_006358368.1|  PREDICTED: uncharacterized protein LOC102579247  69.7    8e-12   
ref|XP_004245693.1|  PREDICTED: uncharacterized protein LOC101259274  68.9    1e-11   
ref|XP_011070037.1|  PREDICTED: uncharacterized protein LOC105155...  68.2    5e-11   
ref|XP_011070045.1|  PREDICTED: uncharacterized protein LOC105155...  67.8    5e-11   
ref|XP_011070028.1|  PREDICTED: uncharacterized protein LOC105155...  67.8    5e-11   
ref|XP_010661675.1|  PREDICTED: uncharacterized protein LOC100241...  65.9    1e-10   
ref|XP_002281385.1|  PREDICTED: uncharacterized protein LOC100241...  65.1    3e-10   Vitis vinifera
ref|XP_002509639.1|  conserved hypothetical protein                   65.5    3e-10   Ricinus communis
ref|XP_011033863.1|  PREDICTED: uncharacterized protein LOC105132212  64.3    5e-10   
ref|XP_002303541.2|  hypothetical protein POPTR_0003s11710g           64.3    5e-10   Populus trichocarpa [western balsam poplar]
ref|XP_010092855.1|  hypothetical protein L484_022450                 64.3    8e-10   
ref|XP_007040023.1|  Uncharacterized protein TCM_016107               65.1    8e-10   
emb|CDP09860.1|  unnamed protein product                              63.5    1e-09   
ref|XP_006477317.1|  PREDICTED: uncharacterized protein LOC102616014  63.5    1e-09   
ref|XP_006440446.1|  hypothetical protein CICLE_v10023705mg           63.5    1e-09   
gb|KDO63715.1|  hypothetical protein CISIN_1g044622mg                 62.8    1e-09   
gb|EYU40547.1|  hypothetical protein MIMGU_mgv1a017079mg              61.6    5e-09   
ref|XP_008437719.1|  PREDICTED: uncharacterized protein LOC103483063  60.5    1e-08   
gb|KGN50180.1|  hypothetical protein Csa_5G157390                     60.5    1e-08   
gb|KDP25574.1|  hypothetical protein JCGZ_20730                       60.5    1e-08   
ref|XP_010108098.1|  hypothetical protein L484_023184                 59.7    3e-08   
ref|XP_003534604.1|  PREDICTED: uncharacterized protein LOC100788403  59.7    3e-08   
gb|KCW72049.1|  hypothetical protein EUGRSUZ_E00491                   59.3    4e-08   
gb|KCW72048.1|  hypothetical protein EUGRSUZ_E00491                   59.3    4e-08   
ref|XP_007139987.1|  hypothetical protein PHAVU_008G075300g           58.9    6e-08   
gb|EPS64511.1|  hypothetical protein M569_10271                       57.4    1e-07   
ref|XP_006368732.1|  hypothetical protein POPTR_0001s08220g           58.2    1e-07   
ref|XP_002320732.1|  hypothetical protein POPTR_0014s06690g           58.2    1e-07   Populus trichocarpa [western balsam poplar]
gb|KHN20467.1|  hypothetical protein glysoja_037343                   57.0    3e-07   
ref|XP_007052025.1|  Homeobox-leucine zipper protein HOX9, putative   57.0    3e-07   
ref|XP_010277419.1|  PREDICTED: uncharacterized protein LOC104611866  57.0    3e-07   
ref|NP_001236921.1|  uncharacterized protein LOC100305804             57.0    3e-07   
ref|XP_008438145.1|  PREDICTED: uncharacterized protein LOC103483340  56.6    4e-07   
ref|XP_004133904.1|  PREDICTED: uncharacterized protein LOC101211719  56.2    5e-07   
ref|XP_004166247.1|  PREDICTED: uncharacterized LOC101211719          56.2    6e-07   
ref|XP_010276171.1|  PREDICTED: uncharacterized protein LOC104610982  55.1    2e-06   
gb|KDP28738.1|  hypothetical protein JCGZ_14509                       54.7    2e-06   
ref|XP_002511736.1|  conserved hypothetical protein                   55.1    2e-06   Ricinus communis
ref|XP_009757506.1|  PREDICTED: uncharacterized protein LOC104210326  54.7    2e-06   
ref|NP_001235598.1|  uncharacterized protein LOC100527916             54.7    2e-06   
emb|CBI38868.3|  unnamed protein product                              54.3    2e-06   
ref|XP_009594357.1|  PREDICTED: uncharacterized protein LOC104090865  54.3    3e-06   
ref|XP_006851488.1|  hypothetical protein AMTR_s00040p00144690        53.5    3e-06   
ref|XP_003623732.1|  hypothetical protein MTR_7g075120                53.9    3e-06   
ref|XP_007134903.1|  hypothetical protein PHAVU_010G085600g           53.5    5e-06   
ref|XP_004492646.1|  PREDICTED: putative leucine-rich repeat-cont...  53.5    5e-06   
ref|XP_007219393.1|  hypothetical protein PRUPE_ppa020346mg           53.1    6e-06   
ref|XP_011017507.1|  PREDICTED: uncharacterized protein LOC105120821  53.5    6e-06   
ref|XP_010512838.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    6e-06   
gb|KHN40134.1|  hypothetical protein glysoja_028755                   52.8    9e-06   
ref|XP_003517061.1|  PREDICTED: uncharacterized protein LOC100800538  52.8    9e-06   
ref|XP_008375831.1|  PREDICTED: uncharacterized protein LOC103439061  52.8    1e-05   
ref|XP_004306906.1|  PREDICTED: uncharacterized protein LOC101314...  52.8    1e-05   
ref|XP_009379274.1|  PREDICTED: uncharacterized protein LOC103967705  52.8    1e-05   
ref|XP_002302541.2|  hypothetical protein POPTR_0002s15060g           52.8    1e-05   Populus trichocarpa [western balsam poplar]
ref|XP_006397727.1|  hypothetical protein EUTSA_v10001694mg           52.0    1e-05   
gb|KDO85862.1|  hypothetical protein CISIN_1g047307mg                 52.0    2e-05   
ref|XP_003581196.1|  PREDICTED: uncharacterized protein LOC100822193  52.0    2e-05   
ref|XP_008232687.1|  PREDICTED: uncharacterized protein LOC103331807  52.0    2e-05   
ref|XP_006851800.1|  hypothetical protein AMTR_s00041p00014360        51.6    2e-05   
ref|XP_008343114.1|  PREDICTED: uncharacterized protein LOC103405871  51.2    3e-05   
emb|CDX95654.1|  BnaC03g25350D                                        50.8    4e-05   
ref|XP_010053887.1|  PREDICTED: uncharacterized protein LOC104442232  50.4    5e-05   
gb|EPS57691.1|  hypothetical protein M569_17126                       50.4    5e-05   
gb|EEE70065.1|  hypothetical protein OsJ_30045                        52.8    6e-05   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063700.1|  Os09g0520500                                     50.8    6e-05   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84896.1|  hypothetical protein OsI_32073                        52.4    6e-05   Oryza sativa Indica Group [Indian rice]
ref|XP_006445231.1|  hypothetical protein CICLE_v10023025mg           50.4    6e-05   
ref|XP_002882013.1|  expressed protein                                50.1    7e-05   
ref|XP_002452198.1|  hypothetical protein SORBIDRAFT_04g021620        50.4    8e-05   Sorghum bicolor [broomcorn]
ref|XP_004952636.1|  PREDICTED: uncharacterized protein LOC101777334  49.7    1e-04   
ref|XP_010049525.1|  PREDICTED: uncharacterized protein LOC104438...  50.1    1e-04   
ref|XP_010049532.1|  PREDICTED: uncharacterized protein LOC104438...  49.3    1e-04   
ref|XP_009351011.1|  PREDICTED: uncharacterized protein LOC103942550  49.7    1e-04   
gb|ACG31125.1|  hypothetical protein                                  48.5    1e-04   Zea mays [maize]
ref|XP_010325912.1|  PREDICTED: small heat shock protein hspM         49.3    1e-04   
ref|XP_011094366.1|  PREDICTED: uncharacterized protein LOC105174081  48.5    2e-04   
ref|XP_008810301.1|  PREDICTED: uncharacterized protein LOC103721752  50.1    2e-04   
ref|XP_006652259.1|  PREDICTED: uncharacterized protein LOC102700422  48.9    2e-04   
emb|CDY37042.1|  BnaA04g26200D                                        48.9    2e-04   
ref|XP_006341243.1|  PREDICTED: bromodomain-containing protein DD...  48.9    2e-04   
emb|CDY27385.1|  BnaC04g50200D                                        48.9    2e-04   
ref|XP_008363809.1|  PREDICTED: uncharacterized protein LOC103427531  48.9    2e-04   
ref|XP_008645747.1|  PREDICTED: uncharacterized protein LOC103627236  48.9    2e-04   
ref|NP_001142861.1|  uncharacterized protein LOC100275255             48.9    2e-04   Zea mays [maize]
emb|CAN61197.1|  hypothetical protein VITISV_028348                   48.9    2e-04   Vitis vinifera
ref|NP_001047020.1|  Os02g0530500                                     48.5    2e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009386004.1|  PREDICTED: uncharacterized protein LOC103973230  48.5    2e-04   
ref|XP_006295322.1|  hypothetical protein CARUB_v10024410mg           48.5    2e-04   
ref|XP_002308149.1|  hypothetical protein POPTR_0006s08320g           48.1    3e-04   Populus trichocarpa [western balsam poplar]
gb|KEH42046.1|  hypothetical protein MTR_1g060310                     48.1    3e-04   
ref|XP_010654072.1|  PREDICTED: uncharacterized protein LOC104880147  48.1    3e-04   
ref|XP_009775247.1|  PREDICTED: uncharacterized protein LOC104225179  48.1    3e-04   
gb|ACG43837.1|  hypothetical protein                                  48.5    3e-04   Zea mays [maize]
ref|XP_004516197.1|  PREDICTED: uncharacterized protein LOC101514572  48.1    3e-04   
ref|XP_006594210.1|  PREDICTED: uncharacterized protein LOC100789...  48.1    3e-04   
gb|KDP42732.1|  hypothetical protein JCGZ_23672                       48.1    3e-04   
gb|EEC73310.1|  hypothetical protein OsI_07495                        48.5    4e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_010908059.1|  PREDICTED: uncharacterized protein LOC105034544  48.9    4e-04   
tpg|DAA40572.1|  TPA: hypothetical protein ZEAMMB73_842207            49.3    4e-04   
gb|EYU35474.1|  hypothetical protein MIMGU_mgv1a017448mg              47.8    4e-04   
ref|XP_009613673.1|  PREDICTED: uncharacterized protein DDB_G0294378  47.4    5e-04   
ref|XP_007145318.1|  hypothetical protein PHAVU_007G229000g           47.4    5e-04   
ref|XP_008241253.1|  PREDICTED: uncharacterized protein LOC103339698  47.4    6e-04   
gb|ABA95824.1|  hypothetical protein LOC_Os12g05560                   47.4    6e-04   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007204541.1|  hypothetical protein PRUPE_ppa017106mg           47.4    6e-04   
gb|ACU16874.1|  unknown                                               47.4    6e-04   Glycine max [soybeans]
ref|XP_002528726.1|  conserved hypothetical protein                   47.4    6e-04   Ricinus communis
ref|XP_004975554.1|  PREDICTED: uncharacterized protein LOC101760...  47.8    7e-04   
gb|EAY94025.1|  hypothetical protein OsI_15803                        47.4    8e-04   Oryza sativa Indica Group [Indian rice]
ref|XP_008776046.1|  PREDICTED: uncharacterized protein LOC103696263  47.4    8e-04   
ref|NP_001052732.1|  Os04g0411200                                     47.4    8e-04   Oryza sativa Japonica Group [Japonica rice]
gb|KFK35287.1|  hypothetical protein AALP_AA5G265200                  47.0    9e-04   
ref|XP_006481795.1|  PREDICTED: uncharacterized protein LOC102630060  46.6    0.001   
ref|XP_006430233.1|  hypothetical protein CICLE_v10013416mg           46.6    0.001   



>ref|XP_009761027.1| PREDICTED: uncharacterized protein LOC104213261 [Nicotiana sylvestris]
Length=109

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 72/89 (81%), Gaps = 3/89 (3%)
 Frame = -2

Query  483  MCVGSSEWI---ICSISMHKRRPkrsrlqlyrlkrrkrreeeedmevRNLKLYMENMSIL  313
            MC+ SSEW    I  IS  K++PKRSR+Q+YR K+ + +   +DME+RNLKLYMENMSIL
Sbjct  1    MCINSSEWSKSRILYISGQKQKPKRSRIQVYRRKKSEEKLAGKDMELRNLKLYMENMSIL  60

Query  312  EENENLRKKASLLHQENLALLSQFQHRFS  226
            EENE LRKKA+LLHQENLAL+S+FQ +FS
Sbjct  61   EENEKLRKKANLLHQENLALMSEFQKKFS  89



>ref|XP_009794963.1| PREDICTED: uncharacterized protein LOC104241727 [Nicotiana sylvestris]
Length=112

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 67/92 (73%), Gaps = 6/92 (7%)
 Frame = -2

Query  483  MCVGSSEW----IICSISMHKRRPkrsrlq--lyrlkrrkrreeeedmevRNLKLYMENM  322
            MC+ S+EW     I  +   K+RPK SR+Q      ++R   +  EDME+RNLKLYMENM
Sbjct  1    MCISSAEWSSSRPIYVLMQKKQRPKLSRVQVHRLTRRKRSEEKAAEDMEMRNLKLYMENM  60

Query  321  SILEENENLRKKASLLHQENLALLSQFQHRFS  226
            SILEENE LRKKASLLHQENL+L+SQFQ +FS
Sbjct  61   SILEENEKLRKKASLLHQENLSLMSQFQKKFS  92



>ref|XP_009588361.1| PREDICTED: uncharacterized protein LOC104085944 [Nicotiana tomentosiformis]
Length=112

 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/41 (85%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMENMSILEENE LRKKASLLHQENL L+S+FQ +FS
Sbjct  52   NLKLYMENMSILEENEKLRKKASLLHQENLTLMSEFQKKFS  92



>ref|XP_006363714.1| PREDICTED: uncharacterized protein LOC102602347 [Solanum tuberosum]
Length=115

 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 9/95 (9%)
 Frame = -2

Query  483  MCVGSSEWIICS-----ISMHKR-RPkrsrlql---yrlkrrkrreeeedmevRNLKLYM  331
            MC+ S+EW   S      SM K+ RPK SR+QL    R KR + +E + DME+RNLKLYM
Sbjct  1    MCISSTEWSNNSSRPLYFSMQKKQRPKISRVQLHRLARRKRSEGKETKVDMEMRNLKLYM  60

Query  330  ENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            ENMSIL+ENE LRKKASLLH+EN+AL+++FQ +FS
Sbjct  61   ENMSILQENEKLRKKASLLHEENIALMTEFQKKFS  95



>ref|XP_009623040.1| PREDICTED: uncharacterized protein LOC104114325 [Nicotiana tomentosiformis]
Length=110

 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 69/89 (78%), Gaps = 3/89 (3%)
 Frame = -2

Query  483  MCVGSSEW---IICSISMHKRRPkrsrlqlyrlkrrkrreeeedmevRNLKLYMENMSIL  313
            MC+ SSE     I  IS  K++PKRSR+Q++R K+ + +   +DME+RNLKLYMENMS+L
Sbjct  1    MCISSSELNASRILYISGQKQKPKRSRIQVHRRKKSEEKAAGKDMELRNLKLYMENMSML  60

Query  312  EENENLRKKASLLHQENLALLSQFQHRFS  226
            EENE LRKKA+LL QEN+AL+S+ Q +FS
Sbjct  61   EENEKLRKKANLLRQENIALMSEIQKKFS  89



>ref|XP_006358368.1| PREDICTED: uncharacterized protein LOC102579247 [Solanum tuberosum]
Length=111

 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMENMSILEENENLRKKA+LLHQENLAL S+F+ + S
Sbjct  53   NLKLYMENMSILEENENLRKKANLLHQENLALYSEFEKKVS  93



>ref|XP_004245693.1| PREDICTED: uncharacterized protein LOC101259274 [Solanum lycopersicum]
Length=115

 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 69/94 (73%), Gaps = 9/94 (10%)
 Frame = -2

Query  483  MCVGSSEWIICS-----ISMHKR-RPkrsrlql---yrlkrrkrreeeedmevRNLKLYM  331
            MC+ S+EW   S      SM K+ RPK SR+QL    R KR + +E + DME+RNLKLYM
Sbjct  1    MCISSTEWSNNSSRPLYFSMQKKQRPKISRVQLHRLARKKRGEGKETKVDMEMRNLKLYM  60

Query  330  ENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            ENMSILEENE LRKKASLLH+EN+AL+ +FQ +F
Sbjct  61   ENMSILEENEKLRKKASLLHEENIALMFEFQKKF  94



>ref|XP_011070037.1| PREDICTED: uncharacterized protein LOC105155776 isoform X2 [Sesamum 
indicum]
Length=143

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN+SILEENE LRKKA LLHQENL+L+S+F+ RFS
Sbjct  77   NLKLYMENISILEENEKLRKKACLLHQENLSLMSEFRKRFS  117



>ref|XP_011070045.1| PREDICTED: uncharacterized protein LOC105155776 isoform X3 [Sesamum 
indicum]
Length=140

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN+SILEENE LRKKA LLHQENL+L+S+F+ RFS
Sbjct  74   NLKLYMENISILEENEKLRKKACLLHQENLSLMSEFRKRFS  114



>ref|XP_011070028.1| PREDICTED: uncharacterized protein LOC105155776 isoform X1 [Sesamum 
indicum]
Length=144

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN+SILEENE LRKKA LLHQENL+L+S+F+ RFS
Sbjct  78   NLKLYMENISILEENEKLRKKACLLHQENLSLMSEFRKRFS  118



>ref|XP_010661675.1| PREDICTED: uncharacterized protein LOC100241009 isoform X1 [Vitis 
vinifera]
Length=100

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 61/85 (72%), Gaps = 2/85 (2%)
 Frame = -2

Query  483  MCVGSSEWIICSISMHKRRPkrsrlqlyrlkrrkrreeeedmevRNLKLYMENMSILEEN  304
            MC+ ++EWI        +R K    +L   +RR   + E+DME++NLKLY+EN +I+EEN
Sbjct  1    MCMSTAEWIPSRP--RTKRSKVQVHRLTSRRRRCEVQVEKDMELKNLKLYLENRNIMEEN  58

Query  303  ENLRKKASLLHQENLALLSQFQHRF  229
            E LRKKA+LLHQENLAL+S+FQ +F
Sbjct  59   EKLRKKATLLHQENLALMSEFQTKF  83



>ref|XP_002281385.1| PREDICTED: uncharacterized protein LOC100241009 isoform X2 [Vitis 
vinifera]
 emb|CBI34806.3| unnamed protein product [Vitis vinifera]
Length=99

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 62/85 (73%), Gaps = 3/85 (4%)
 Frame = -2

Query  483  MCVGSSEWIICSISMHKRRPkrsrlqlyrlkrrkrreeeedmevRNLKLYMENMSILEEN  304
            MC+ ++EWI    S  + +  + ++     +RR   + E+DME++NLKLY+EN +I+EEN
Sbjct  1    MCMSTAEWIP---SRPRTKRSKVQVHRLTRRRRCEVQVEKDMELKNLKLYLENRNIMEEN  57

Query  303  ENLRKKASLLHQENLALLSQFQHRF  229
            E LRKKA+LLHQENLAL+S+FQ +F
Sbjct  58   EKLRKKATLLHQENLALMSEFQTKF  82



>ref|XP_002509639.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51026.1| conserved hypothetical protein [Ricinus communis]
Length=108

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLY+EN SI+EENE LRKKA+LLHQENLAL+S+FQ +F 
Sbjct  50   NLKLYLENQSIVEENEKLRKKANLLHQENLALISEFQKKFP  90



>ref|XP_011033863.1| PREDICTED: uncharacterized protein LOC105132212 [Populus euphratica]
Length=106

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLY+EN SI+EENE LRKKASLLHQENLAL+S+ Q +F
Sbjct  51   NLKLYLENQSIVEENEKLRKKASLLHQENLALMSELQKKF  90



>ref|XP_002303541.2| hypothetical protein POPTR_0003s11710g [Populus trichocarpa]
 gb|EEE78520.2| hypothetical protein POPTR_0003s11710g [Populus trichocarpa]
Length=106

 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLY+EN SI+EENE LRKKASLLHQENLAL+S+ Q +F
Sbjct  51   NLKLYLENQSIVEENEKLRKKASLLHQENLALMSELQKKF  90



>ref|XP_010092855.1| hypothetical protein L484_022450 [Morus notabilis]
 gb|EXB52673.1| hypothetical protein L484_022450 [Morus notabilis]
Length=129

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN SI+EEN+ LRKKA LLHQEN ALLSQ Q +FS
Sbjct  60   NLKLYMENQSIMEENQKLRKKALLLHQENQALLSQLQQKFS  100



>ref|XP_007040023.1| Uncharacterized protein TCM_016107 [Theobroma cacao]
 gb|EOY24524.1| Uncharacterized protein TCM_016107 [Theobroma cacao]
Length=178

 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLY+EN SI+EENE LRKKA+LLHQENLAL+S FQ +F
Sbjct  122  NLKLYLENQSIIEENEKLRKKANLLHQENLALMSDFQKKF  161



>emb|CDP09860.1| unnamed protein product [Coffea canephora]
Length=105

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLY+EN++ILEENE LRKKASLLHQENL L+S+ Q +F+
Sbjct  46   NLKLYIENITILEENEKLRKKASLLHQENLELMSEIQKKFA  86



>ref|XP_006477317.1| PREDICTED: uncharacterized protein LOC102616014 [Citrus sinensis]
Length=122

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  486  RMCVGSSEWIICSISMHKRRPkrsrlqlyrlkrrkrreeeedmevRNLKLYMENMSILEE  307
            RMC  ++  +    S  K R K         +RR   EE  DM+++N+KLY+EN SI+EE
Sbjct  35   RMCTNNTHLLPAYASKRKHRSKPKVQIYGLTRRRCEAEEGRDMQLKNIKLYLENQSIIEE  94

Query  306  NENLRKKASLLHQENLALLSQFQHRFS  226
            NE LRK+A+LLHQENLAL+S+F+ +FS
Sbjct  95   NEKLRKQANLLHQENLALMSEFRKKFS  121



>ref|XP_006440446.1| hypothetical protein CICLE_v10023705mg, partial [Citrus clementina]
 gb|ESR53686.1| hypothetical protein CICLE_v10023705mg, partial [Citrus clementina]
Length=115

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 58/87 (67%), Gaps = 0/87 (0%)
 Frame = -2

Query  486  RMCVGSSEWIICSISMHKRRPkrsrlqlyrlkrrkrreeeedmevRNLKLYMENMSILEE  307
            RMC  ++  +    S  K R K         +RR   EE  DM+++N+KLY+EN SI+EE
Sbjct  28   RMCTNNTHLLPAYASKSKHRSKPKVQIYGLTRRRCEAEEGRDMQLKNIKLYLENQSIIEE  87

Query  306  NENLRKKASLLHQENLALLSQFQHRFS  226
            NE LRK+A+LLHQENLAL+S+F+ +FS
Sbjct  88   NEKLRKQANLLHQENLALMSEFRKKFS  114



>gb|KDO63715.1| hypothetical protein CISIN_1g044622mg [Citrus sinensis]
Length=87

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 38/41 (93%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N+KLY+EN SI+EENE LRK+A+LLHQENLAL+S+F+ +FS
Sbjct  46   NIKLYLENQSIIEENEKLRKQANLLHQENLALMSEFRKKFS  86



>gb|EYU40547.1| hypothetical protein MIMGU_mgv1a017079mg [Erythranthe guttata]
Length=94

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N+KLYMEN+ IL+ENE LRKKA+LLHQENLAL+SQF   FS
Sbjct  54   NMKLYMENIIILQENEKLRKKANLLHQENLALISQFLKIFS  94



>ref|XP_008437719.1| PREDICTED: uncharacterized protein LOC103483063 [Cucumis melo]
Length=96

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NL+LY+EN +I+EENE LR+KA++LHQENLALL++FQ +F
Sbjct  50   NLQLYLENQTIIEENEKLREKANILHQENLALLTEFQKKF  89



>gb|KGN50180.1| hypothetical protein Csa_5G157390 [Cucumis sativus]
Length=96

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 37/40 (93%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NL+LY+EN +I+EENE LR+KA++LHQENLALL++FQ +F
Sbjct  50   NLQLYLENQTIIEENEKLREKANILHQENLALLTEFQKKF  89



>gb|KDP25574.1| hypothetical protein JCGZ_20730 [Jatropha curcas]
Length=112

 Score = 60.5 bits (145),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLY+EN SI+EENE LRKKA+ L QENLAL+SQFQ +F 
Sbjct  55   NLKLYLENQSIVEENEKLRKKANFLLQENLALISQFQKKFP  95



>ref|XP_010108098.1| hypothetical protein L484_023184 [Morus notabilis]
 gb|EXC17830.1| hypothetical protein L484_023184 [Morus notabilis]
Length=107

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLY+EN +I+EENE LRK A+LLHQENL+LLS+ Q +F
Sbjct  51   NLKLYLENKTIIEENEKLRKTANLLHQENLSLLSKLQKKF  90



>ref|XP_003534604.1| PREDICTED: uncharacterized protein LOC100788403 [Glycine max]
 gb|KHN29439.1| hypothetical protein glysoja_005163 [Glycine soja]
Length=111

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN +I+EENE LRK+A LLH+EN ALLSQ Q + S
Sbjct  62   NLKLYMENQTIIEENEKLRKQAMLLHKENQALLSQLQKKLS  102



>gb|KCW72049.1| hypothetical protein EUGRSUZ_E00491 [Eucalyptus grandis]
Length=103

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY EN +I+EENE LRKKA+LLHQENLALL +FQ +F
Sbjct  47   NWKLYFENRTIIEENEKLRKKANLLHQENLALLLEFQKKF  86



>gb|KCW72048.1| hypothetical protein EUGRSUZ_E00491 [Eucalyptus grandis]
Length=106

 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY EN +I+EENE LRKKA+LLHQENLALL +FQ +F
Sbjct  50   NWKLYFENRTIIEENEKLRKKANLLHQENLALLLEFQKKF  89



>ref|XP_007139987.1| hypothetical protein PHAVU_008G075300g [Phaseolus vulgaris]
 gb|ESW11981.1| hypothetical protein PHAVU_008G075300g [Phaseolus vulgaris]
Length=112

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN +I+EENE LRK+A LLH+EN ALLSQ Q + S
Sbjct  63   NLKLYMENQTIIEENEKLRKQAMLLHKENQALLSQLQKKLS  103



>gb|EPS64511.1| hypothetical protein M569_10271 [Genlisea aurea]
Length=74

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYM+NM I +ENE LRK+A LLHQEN+AL S+   RFS
Sbjct  33   NLKLYMKNMRIFKENEKLRKQAHLLHQENIALASELNKRFS  73



>ref|XP_006368732.1| hypothetical protein POPTR_0001s08220g [Populus trichocarpa]
 gb|ERP65301.1| hypothetical protein POPTR_0001s08220g [Populus trichocarpa]
Length=109

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKL +EN  I+EENE LRKKA+LL QENLAL+S+FQ +F
Sbjct  51   NLKLCLENQRIVEENEKLRKKANLLRQENLALMSEFQKKF  90



>ref|XP_002320732.1| hypothetical protein POPTR_0014s06690g [Populus trichocarpa]
 gb|EEE99047.1| hypothetical protein POPTR_0014s06690g [Populus trichocarpa]
Length=112

 Score = 58.2 bits (139),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN SI+EENE LRKKA LLHQEN ALL Q Q + S
Sbjct  60   NLKLYMENKSIIEENEKLRKKAFLLHQENQALLYQLQKKRS  100



>gb|KHN20467.1| hypothetical protein glysoja_037343 [Glycine soja]
Length=110

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN +I+EENE LRK+A LLH+EN AL SQ Q + S
Sbjct  61   NLKLYMENQTIIEENEKLRKQAMLLHKENQALSSQLQKKLS  101



>ref|XP_007052025.1| Homeobox-leucine zipper protein HOX9, putative [Theobroma cacao]
 gb|EOX96182.1| Homeobox-leucine zipper protein HOX9, putative [Theobroma cacao]
Length=106

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYM+N  I+EENE LRKKA LLHQEN  LL+Q Q + S
Sbjct  60   NLKLYMQNQIIIEENERLRKKAILLHQENQTLLAQLQKKLS  100



>ref|XP_010277419.1| PREDICTED: uncharacterized protein LOC104611866 [Nelumbo nucifera]
Length=114

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 64/95 (67%), Gaps = 9/95 (9%)
 Frame = -2

Query  483  MCVGSSEWIICSIS---MHKRRPkrsrlqlyrlk------rrkrreeeedmevRNLKLYM  331
            MC+ +SEW + S S     + RPK+S++++ RL       +++      +ME++NL+LY+
Sbjct  1    MCINASEWYLSSPSCSPARRYRPKKSKVRVRRLSRRNRRLKKEVVVVGTEMELKNLRLYL  60

Query  330  ENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            EN SI+EENE LR+KA LLHQEN AL+ + Q +FS
Sbjct  61   ENRSIIEENEKLRQKALLLHQENRALMCELQKKFS  95



>ref|NP_001236921.1| uncharacterized protein LOC100305804 [Glycine max]
 gb|ACU13670.1| unknown [Glycine max]
 gb|KHM98874.1| hypothetical protein glysoja_040095 [Glycine soja]
Length=116

 Score = 57.0 bits (136),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN SI+EENE LRK+A LLH+EN ALL Q Q + S
Sbjct  63   NLKLYMENQSIIEENEKLRKQAVLLHKENEALLFQLQKKLS  103



>ref|XP_008438145.1| PREDICTED: uncharacterized protein LOC103483340 [Cucumis melo]
Length=116

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQH  235
            NLKLYMEN SI+EENE LRKKA LLH+EN  LLSQ Q+
Sbjct  54   NLKLYMENQSIIEENERLRKKAFLLHKENQVLLSQLQN  91



>ref|XP_004133904.1| PREDICTED: uncharacterized protein LOC101211719 [Cucumis sativus]
 gb|KGN56585.1| hypothetical protein Csa_3G125520 [Cucumis sativus]
Length=115

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            NLKLYMEN SI+EENE LRKKA LLH+EN  LLSQ Q
Sbjct  53   NLKLYMENQSIIEENERLRKKAFLLHKENQVLLSQLQ  89



>ref|XP_004166247.1| PREDICTED: uncharacterized LOC101211719 [Cucumis sativus]
Length=115

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            NLKLYMEN SI+EENE LRKKA LLH+EN  LLSQ Q
Sbjct  53   NLKLYMENQSIIEENERLRKKAFLLHKENQVLLSQLQ  89



>ref|XP_010276171.1| PREDICTED: uncharacterized protein LOC104610982 [Nelumbo nucifera]
Length=110

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLY+EN SI+EENE LRKKA LLHQEN  L+ + + +FS
Sbjct  53   NLKLYLENQSIIEENEKLRKKAILLHQENRELMIELKKKFS  93



>gb|KDP28738.1| hypothetical protein JCGZ_14509 [Jatropha curcas]
Length=108

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            NLKLYM+N SI+EENE LRKKA LLHQEN ALL Q Q
Sbjct  63   NLKLYMKNKSIIEENEKLRKKALLLHQENQALLFQLQ  99



>ref|XP_002511736.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50405.1| conserved hypothetical protein [Ricinus communis]
Length=120

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLYM+N SI+EENE LRKKA  L+QEN ALL Q Q +F
Sbjct  65   NLKLYMKNKSIIEENEKLRKKAYFLNQENQALLIQLQKKF  104



>ref|XP_009757506.1| PREDICTED: uncharacterized protein LOC104210326 [Nicotiana sylvestris]
Length=110

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLY EN +I+EENE LRKKA LLHQEN AL S+ Q  F
Sbjct  65   NLKLYKENKTIIEENERLRKKALLLHQENKALFSKLQQVF  104



>ref|NP_001235598.1| uncharacterized protein LOC100527916 [Glycine max]
 gb|ACU17140.1| unknown [Glycine max]
Length=110

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN +I+EENE LRK+A LLH+ N AL SQ Q + S
Sbjct  61   NLKLYMENQTIIEENEKLRKQAMLLHKGNQALSSQLQKKLS  101



>emb|CBI38868.3| unnamed protein product [Vitis vinifera]
Length=111

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLYM N SI++ENE LR KA LLHQEN ALLSQ Q++F
Sbjct  63   NWKLYMLNQSIIQENEKLRMKALLLHQENQALLSQLQNKF  102



>ref|XP_009594357.1| PREDICTED: uncharacterized protein LOC104090865 [Nicotiana tomentosiformis]
Length=108

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/40 (70%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLY EN +I+EENE LRKKA LLHQEN AL S+ Q  F
Sbjct  63   NLKLYKENKTIIEENEKLRKKALLLHQENKALFSKLQQVF  102



>ref|XP_006851488.1| hypothetical protein AMTR_s00040p00144690 [Amborella trichopoda]
 gb|ERN13069.1| hypothetical protein AMTR_s00040p00144690 [Amborella trichopoda]
Length=72

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSC  223
            NLKLY++N SI+EENE LRKKA LL+QEN ALLS+ + + S 
Sbjct  5    NLKLYLKNRSIIEENERLRKKALLLNQENQALLSELRQKLSS  46



>ref|XP_003623732.1| hypothetical protein MTR_7g075120 [Medicago truncatula]
 gb|AES79950.1| hypothetical protein MTR_7g075120 [Medicago truncatula]
Length=95

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN +I+E+NE LRK+A LLH+EN  L+SQ Q + S
Sbjct  46   NLKLYMENQTIIEQNEKLRKQAMLLHKENQDLMSQLQMKLS  86



>ref|XP_007134903.1| hypothetical protein PHAVU_010G085600g [Phaseolus vulgaris]
 gb|ESW06897.1| hypothetical protein PHAVU_010G085600g [Phaseolus vulgaris]
Length=108

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 34/41 (83%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYM+N SI+EENE LRK+A LLH+EN  LL + Q++FS
Sbjct  60   NLKLYMKNQSIIEENEKLRKQALLLHKENETLLFELQNKFS  100



>ref|XP_004492646.1| PREDICTED: putative leucine-rich repeat-containing protein DDB_G0290503-like 
[Cicer arietinum]
Length=108

 Score = 53.5 bits (127),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN +I+EENE LRK+A LLH+EN  L++Q Q + S
Sbjct  56   NLKLYMENQTIIEENEKLRKQAMLLHKENQDLMTQLQIKLS  96



>ref|XP_007219393.1| hypothetical protein PRUPE_ppa020346mg [Prunus persica]
 gb|EMJ20592.1| hypothetical protein PRUPE_ppa020346mg [Prunus persica]
Length=98

 Score = 53.1 bits (126),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLYMEN SI+EEN+ LR+KA LL QEN AL SQ Q +
Sbjct  54   NLKLYMENQSIIEENKKLRRKALLLVQENQALFSQLQQK  92



>ref|XP_011017507.1| PREDICTED: uncharacterized protein LOC105120821 [Populus euphratica]
Length=113

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 29/41 (71%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN SI+EENE LRKKA LLHQEN AL    Q + S
Sbjct  62   NLKLYMENKSIIEENEKLRKKALLLHQENQALFYLLQKKSS  102



>ref|XP_010512838.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104788752 
[Camelina sativa]
Length=169

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSC  223
            NLKLYMEN +I+ ENE LRKKA LLHQEN AL S  Q +  C
Sbjct  125  NLKLYMENQNIIRENEKLRKKALLLHQENKALFSLLQTKKIC  166



>gb|KHN40134.1| hypothetical protein glysoja_028755 [Glycine soja]
Length=112

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN SI+EEN+ LRK+A LLH+EN  LL Q Q + S
Sbjct  64   NLKLYMENQSIIEENQKLRKQAMLLHKENDVLLFQLQKKLS  104



>ref|XP_003517061.1| PREDICTED: uncharacterized protein LOC100800538 [Glycine max]
Length=112

 Score = 52.8 bits (125),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/41 (66%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NLKLYMEN SI+EEN+ LRK+A LLH+EN  LL Q Q + S
Sbjct  64   NLKLYMENQSIIEENQKLRKQAMLLHKENDVLLFQLQKKLS  104



>ref|XP_008375831.1| PREDICTED: uncharacterized protein LOC103439061 [Malus domestica]
 ref|XP_008364801.1| PREDICTED: uncharacterized protein LOC103428478 [Malus domestica]
Length=115

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLYMEN SI+EEN  LR+KA LL QEN AL SQ Q +
Sbjct  63   NLKLYMENQSIIEENNKLRRKALLLVQENQALFSQLQQK  101



>ref|XP_004306906.1| PREDICTED: uncharacterized protein LOC101314600 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=106

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            NLKLYMEN S++EEN  LR+KA LL QEN AL SQ Q +F
Sbjct  54   NLKLYMENKSLIEENNKLRRKALLLVQENQALFSQLQQKF  93



>ref|XP_009379274.1| PREDICTED: uncharacterized protein LOC103967705 [Pyrus x bretschneideri]
Length=112

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLYMEN SI+EEN  LR+KA LL QEN AL SQ Q +
Sbjct  63   NLKLYMENQSIIEENNKLRRKALLLVQENQALFSQLQQK  101



>ref|XP_002302541.2| hypothetical protein POPTR_0002s15060g [Populus trichocarpa]
 gb|EEE81814.2| hypothetical protein POPTR_0002s15060g [Populus trichocarpa]
Length=113

 Score = 52.8 bits (125),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLAL  253
            NLKLYMEN SI+EENE LRKKA LLHQEN AL
Sbjct  62   NLKLYMENKSIIEENEKLRKKALLLHQENQAL  93



>ref|XP_006397727.1| hypothetical protein EUTSA_v10001694mg [Eutrema salsugineum]
 gb|ESQ39180.1| hypothetical protein EUTSA_v10001694mg [Eutrema salsugineum]
Length=92

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            N++LYMEN +I++ENE LRKKA LLHQEN ALLS  Q +
Sbjct  48   NIRLYMENQNIIQENEKLRKKALLLHQENKALLSLLQTK  86



>gb|KDO85862.1| hypothetical protein CISIN_1g047307mg, partial [Citrus sinensis]
Length=101

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQ  244
            NLKLYMEN S+++ENE LR KA LLHQEN ALLSQ
Sbjct  50   NLKLYMENQSLIKENEKLRNKALLLHQENQALLSQ  84



>ref|XP_003581196.1| PREDICTED: uncharacterized protein LOC100822193 [Brachypodium 
distachyon]
Length=89

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLYM+N  IL+ENE LRKKA LL+QEN ALL++ + R +
Sbjct  5    NAKLYMQNCYILKENERLRKKAQLLNQENQALLTELKQRLA  45



>ref|XP_008232687.1| PREDICTED: uncharacterized protein LOC103331807 [Prunus mume]
Length=105

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLYMEN SI+EEN  LR+KA LL QEN AL SQ Q +
Sbjct  61   NLKLYMENQSIIEENNKLRRKALLLVQENQALFSQLQEK  99



>ref|XP_006851800.1| hypothetical protein AMTR_s00041p00014360 [Amborella trichopoda]
 gb|ERN13267.1| hypothetical protein AMTR_s00041p00014360 [Amborella trichopoda]
Length=94

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NL+LY++N  I+EENE LRKKA +L QEN ALLS+   +FS
Sbjct  45   NLELYLQNWCIIEENERLRKKALVLDQENRALLSELNKKFS  85



>ref|XP_008343114.1| PREDICTED: uncharacterized protein LOC103405871 [Malus domestica]
Length=112

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLYMEN SI+EEN  LR+KA LL QEN AL SQ Q +
Sbjct  63   NLKLYMENQSIIEENIKLRRKALLLVQENQALFSQLQQK  101



>emb|CDX95654.1| BnaC03g25350D [Brassica napus]
Length=92

 Score = 50.8 bits (120),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N+KLYMEN  I++ENE L+KKA LLHQEN AL S  Q + S
Sbjct  48   NIKLYMENQHIIQENEKLKKKAHLLHQENKALFSLLQTKTS  88



>ref|XP_010053887.1| PREDICTED: uncharacterized protein LOC104442232 [Eucalyptus grandis]
Length=100

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            NL+LY+EN SI+E NE LR++A  LH+EN ALL Q Q +F+
Sbjct  56   NLRLYVENRSIMEANERLRQRALFLHRENRALLVQLQSKFT  96



>gb|EPS57691.1| hypothetical protein M569_17126 [Genlisea aurea]
Length=100

 Score = 50.4 bits (119),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY+EN  I++ENE LRKKA LL+QEN ALL++ + R S
Sbjct  39   NSKLYLENCYIMQENERLRKKAELLNQENQALLNELKKRLS  79



>gb|EEE70065.1| hypothetical protein OsJ_30045 [Oryza sativa Japonica Group]
Length=239

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQH  235
            NLKLY+EN  ILEENE LR+KAS LH+ENLAL +  ++
Sbjct  188  NLKLYLENRCILEENERLREKASALHRENLALRADLRN  225



>ref|NP_001063700.1| Os09g0520500 [Oryza sativa Japonica Group]
 dbj|BAD46675.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF25614.1| Os09g0520500 [Oryza sativa Japonica Group]
 dbj|BAG98232.1| unnamed protein product [Oryza sativa Japonica Group]
Length=116

 Score = 50.8 bits (120),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQH  235
            NLKLY+EN  ILEENE LR+KAS LH+ENLAL +  ++
Sbjct  65   NLKLYLENRCILEENERLREKASALHRENLALRADLRN  102



>gb|EEC84896.1| hypothetical protein OsI_32073 [Oryza sativa Indica Group]
Length=221

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            NLKLY+EN  ILEENE LR+KAS LH+ENLAL +  +
Sbjct  170  NLKLYLENRCILEENERLREKASALHRENLALRADLR  206



>ref|XP_006445231.1| hypothetical protein CICLE_v10023025mg [Citrus clementina]
 gb|ESR58471.1| hypothetical protein CICLE_v10023025mg [Citrus clementina]
Length=100

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQ  244
            NLKLYMEN S+++ENE LR K  LLHQEN ALLSQ
Sbjct  49   NLKLYMENQSLIKENEKLRNKVLLLHQENQALLSQ  83



>ref|XP_002882013.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58272.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
Length=92

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLY+EN +I+ ENE LRKKA LLHQEN AL S  Q +
Sbjct  48   NLKLYVENQNIIRENEKLRKKALLLHQENKALFSLLQTK  86



>ref|XP_002452198.1| hypothetical protein SORBIDRAFT_04g021620 [Sorghum bicolor]
 gb|EES05174.1| hypothetical protein SORBIDRAFT_04g021620 [Sorghum bicolor]
Length=110

 Score = 50.4 bits (119),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRK A LL+QEN ALLS+ +HR +
Sbjct  5    NTKLYLQNCYIMKENERLRKAALLLNQENQALLSELKHRLA  45



>ref|XP_004952636.1| PREDICTED: uncharacterized protein LOC101777334 [Setaria italica]
Length=89

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRK A LL+QEN ALLS+ +HR +
Sbjct  5    NTKLYLQNCYIMKENERLRKAALLLNQENQALLSELKHRLA  45



>ref|XP_010049525.1| PREDICTED: uncharacterized protein LOC104438138 isoform X1 [Eucalyptus 
grandis]
 gb|KCW89198.1| hypothetical protein EUGRSUZ_A01509 [Eucalyptus grandis]
Length=104

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N  LY++N  I++ENE LRKKA LL+QEN ALLSQ ++ FS
Sbjct  29   NSDLYLQNCYIMQENERLRKKAQLLNQENQALLSQLKNNFS  69



>ref|XP_010049532.1| PREDICTED: uncharacterized protein LOC104438138 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010049540.1| PREDICTED: uncharacterized protein LOC104438138 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010049544.1| PREDICTED: uncharacterized protein LOC104438138 isoform X2 [Eucalyptus 
grandis]
Length=80

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N  LY++N  I++ENE LRKKA LL+QEN ALLSQ ++ FS
Sbjct  5    NSDLYLQNCYIMQENERLRKKAQLLNQENQALLSQLKNNFS  45



>ref|XP_009351011.1| PREDICTED: uncharacterized protein LOC103942550 [Pyrus x bretschneideri]
Length=112

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHR  232
            NLKLYMEN  I+EEN  LR+KA LL QEN AL SQ Q +
Sbjct  63   NLKLYMENQIIIEENNKLRRKALLLIQENQALFSQLQQK  101



>gb|ACG31125.1| hypothetical protein [Zea mays]
Length=55

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSCV  220
            NLKLY+EN  I+ ENE LR++AS L +ENLALL     R + V
Sbjct  5    NLKLYLENRCIIAENERLRERASALRRENLALLQNLSSRTAAV  47



>ref|XP_010325912.1| PREDICTED: small heat shock protein hspM [Solanum lycopersicum]
 ref|XP_010325913.1| PREDICTED: small heat shock protein hspM [Solanum lycopersicum]
 ref|XP_010325914.1| PREDICTED: small heat shock protein hspM [Solanum lycopersicum]
 ref|XP_010325915.1| PREDICTED: small heat shock protein hspM [Solanum lycopersicum]
Length=88

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I+ ENE LRKKA LL+QEN  LLS+ +HR S
Sbjct  5    NSKLYLQNCYIMAENERLRKKAELLNQENQQLLSELKHRLS  45



>ref|XP_011094366.1| PREDICTED: uncharacterized protein LOC105174081 [Sesamum indicum]
Length=66

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSCV  220
            N KLY+EN  I++ENE LRKKA LL+QEN ALL++ + R +  
Sbjct  5    NSKLYLENCYIMQENERLRKKAELLNQENQALLNELKQRLAAA  47



>ref|XP_008810301.1| PREDICTED: uncharacterized protein LOC103721752 [Phoenix dactylifera]
Length=158

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            NLKLY+EN  I+EENE LRKKA LL QEN ALLS  +
Sbjct  105  NLKLYLENRCIMEENERLRKKALLLRQENQALLSHLR  141



>ref|XP_006652259.1| PREDICTED: uncharacterized protein LOC102700422 [Oryza brachyantha]
Length=91

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + R +
Sbjct  5    NAKLYLQNCYIMKENERLRKKALLLNQENQALLSELKQRLA  45



>emb|CDY37042.1| BnaA04g26200D [Brassica napus]
Length=92

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            N++LYMEN  +++ENE LRKKA +LHQEN ALLS  Q
Sbjct  48   NIRLYMENQYMIQENEKLRKKALILHQENKALLSLLQ  84



>ref|XP_006341243.1| PREDICTED: bromodomain-containing protein DDB_G0271118-like [Solanum 
tuberosum]
Length=90

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I+ ENE LRKKA LL+QEN  LLS+ +HR S
Sbjct  5    NSKLYLQNCYIMAENERLRKKAELLNQENQQLLSELKHRLS  45



>emb|CDY27385.1| BnaC04g50200D [Brassica napus]
Length=92

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            N++LYMEN  +++ENE LRKKA +LHQEN ALLS  Q
Sbjct  48   NIRLYMENQYMIQENEKLRKKALILHQENKALLSLLQ  84



>ref|XP_008363809.1| PREDICTED: uncharacterized protein LOC103427531 [Malus domestica]
Length=82

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>ref|XP_008645747.1| PREDICTED: uncharacterized protein LOC103627236 [Zea mays]
 gb|AFW71666.1| hypothetical protein ZEAMMB73_915625 [Zea mays]
Length=96

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRK A LL+QEN ALLS+ +HR +
Sbjct  5    NTKLYLQNCYIMKENERLRKAALLLNQENQALLSELKHRLA  45



>ref|NP_001142861.1| uncharacterized protein LOC100275255 [Zea mays]
 gb|ACG27134.1| hypothetical protein [Zea mays]
Length=113

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSCV  220
            NLKLY+EN  I+ ENE LR++AS L +ENLALL     R + V
Sbjct  63   NLKLYLENRCIIAENERLRERASALRRENLALLRNLSSRTAAV  105



>emb|CAN61197.1| hypothetical protein VITISV_028348 [Vitis vinifera]
Length=114

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  42   NSKLYLQNCYIIQENERLRKKAQLLNQENQALLSELKQKLS  82



>ref|NP_001047020.1| Os02g0530500 [Oryza sativa Japonica Group]
 dbj|BAD25448.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF08934.1| Os02g0530500 [Oryza sativa Japonica Group]
Length=86

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY++N  +L+ENE LRK A LL+QEN ALLS+ +HR 
Sbjct  5    NTKLYLQNCYMLKENERLRKAAVLLNQENQALLSELKHRL  44



>ref|XP_009386004.1| PREDICTED: uncharacterized protein LOC103973230 [Musa acuminata 
subsp. malaccensis]
Length=89

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLS  247
            NLKLY+EN  I+EEN  LRKKA LL QEN ALLS
Sbjct  39   NLKLYLENRCIMEENRRLRKKAFLLRQENTALLS  72



>ref|XP_006295322.1| hypothetical protein CARUB_v10024410mg [Capsella rubella]
 gb|EOA28220.1| hypothetical protein CARUB_v10024410mg [Capsella rubella]
Length=93

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLS  247
            NLKLYMEN +I+ ENE LR+KA LLHQEN AL S
Sbjct  48   NLKLYMENQNIIRENEKLREKALLLHQENKALFS  81



>ref|XP_002308149.1| hypothetical protein POPTR_0006s08320g [Populus trichocarpa]
 gb|EEE91672.1| hypothetical protein POPTR_0006s08320g [Populus trichocarpa]
Length=77

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>gb|KEH42046.1| hypothetical protein MTR_1g060310 [Medicago truncatula]
Length=72

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY+EN  I++ENE LRKKA LL++EN  LLSQ + + S
Sbjct  5    NSKLYLENCYIMQENEKLRKKAKLLNEENQVLLSQLKQKLS  45



>ref|XP_010654072.1| PREDICTED: uncharacterized protein LOC104880147 [Vitis vinifera]
 ref|XP_010654073.1| PREDICTED: uncharacterized protein LOC104880147 [Vitis vinifera]
 emb|CBI30282.3| unnamed protein product [Vitis vinifera]
Length=77

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIIQENERLRKKAQLLNQENQALLSELKQKLS  45



>ref|XP_009775247.1| PREDICTED: uncharacterized protein LOC104225179 [Nicotiana sylvestris]
 ref|XP_009775248.1| PREDICTED: uncharacterized protein LOC104225179 [Nicotiana sylvestris]
 ref|XP_009775249.1| PREDICTED: uncharacterized protein LOC104225179 [Nicotiana sylvestris]
Length=81

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N+ I+ ENE LRKKA LL+QEN  LL++ +HR S
Sbjct  5    NSKLYLQNVYIMAENERLRKKAELLNQENQQLLNELKHRLS  45



>gb|ACG43837.1| hypothetical protein [Zea mays]
Length=108

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSCV  220
            NLKLY+EN  I+ ENE LR++AS L +ENLALL     R + V
Sbjct  58   NLKLYLENRCIIAENERLRERASALRRENLALLQNLSSRTAAV  100



>ref|XP_004516197.1| PREDICTED: uncharacterized protein LOC101514572 [Cicer arietinum]
Length=77

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>ref|XP_006594210.1| PREDICTED: uncharacterized protein LOC100789735 isoform X1 [Glycine 
max]
 ref|XP_006594211.1| PREDICTED: uncharacterized protein LOC100789735 isoform X2 [Glycine 
max]
 ref|XP_006594212.1| PREDICTED: uncharacterized protein LOC100789735 isoform X3 [Glycine 
max]
 ref|XP_006594213.1| PREDICTED: uncharacterized protein LOC100789735 isoform X4 [Glycine 
max]
 gb|KHN14992.1| hypothetical protein glysoja_037119 [Glycine soja]
Length=77

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>gb|KDP42732.1| hypothetical protein JCGZ_23672 [Jatropha curcas]
Length=77

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>gb|EEC73310.1| hypothetical protein OsI_07495 [Oryza sativa Indica Group]
 gb|EEE57118.1| hypothetical protein OsJ_06996 [Oryza sativa Japonica Group]
Length=115

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY++N  +L+ENE LRK A LL+QEN ALLS+ +HR 
Sbjct  34   NTKLYLQNCYMLKENERLRKAAVLLNQENQALLSELKHRL  73



>ref|XP_010908059.1| PREDICTED: uncharacterized protein LOC105034544 [Elaeis guineensis]
Length=143

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  74   NSKLYLQNWYIIKENERLRKKAQLLNQENQALLSELKQKLS  114



>tpg|DAA40572.1| TPA: hypothetical protein ZEAMMB73_842207 [Zea mays]
Length=178

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSCV  220
            NLKLY+EN  I+ ENE LR++AS L +ENLALL     R + V
Sbjct  128  NLKLYLENRCIIAENERLRERASALRRENLALLQNLSSRTAAV  170



>gb|EYU35474.1| hypothetical protein MIMGU_mgv1a017448mg [Erythranthe guttata]
Length=74

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY+EN  I++ENE LRKKA LL+QEN ALL++ + R 
Sbjct  5    NSKLYLENCYIMQENERLRKKAELLNQENQALLNELKQRL  44



>ref|XP_009613673.1| PREDICTED: uncharacterized protein DDB_G0294378, partial [Nicotiana 
tomentosiformis]
Length=64

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N+ I+ ENE LRKKA +L+QEN  LL++ +HR S
Sbjct  5    NSKLYLQNVYIMAENERLRKKAEILNQENQQLLNELKHRLS  45



>ref|XP_007145318.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris]
 ref|XP_007145319.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris]
 ref|XP_007145320.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris]
 gb|ESW17312.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris]
 gb|ESW17313.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris]
 gb|ESW17314.1| hypothetical protein PHAVU_007G229000g [Phaseolus vulgaris]
Length=75

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>ref|XP_008241253.1| PREDICTED: uncharacterized protein LOC103339698 [Prunus mume]
 ref|XP_008241254.1| PREDICTED: uncharacterized protein LOC103339698 [Prunus mume]
Length=77

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>gb|ABA95824.1| hypothetical protein LOC_Os12g05560 [Oryza sativa Japonica Group]
 gb|EAY82276.1| hypothetical protein OsI_37485 [Oryza sativa Indica Group]
 gb|EAZ19664.1| hypothetical protein OsJ_35240 [Oryza sativa Japonica Group]
Length=81

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQF  241
            NLKLY+EN+ I+EENE LR+KA  L+QEN ALL++ 
Sbjct  5    NLKLYLENVYIMEENERLRRKAQALNQENKALLAKL  40



>ref|XP_007204541.1| hypothetical protein PRUPE_ppa017106mg [Prunus persica]
 gb|EMJ05740.1| hypothetical protein PRUPE_ppa017106mg [Prunus persica]
Length=77

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>gb|ACU16874.1| unknown [Glycine max]
 gb|KHN13505.1| hypothetical protein glysoja_038743 [Glycine soja]
Length=78

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + S
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLS  45



>ref|XP_002528726.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33638.1| conserved hypothetical protein [Ricinus communis]
Length=77

 Score = 47.4 bits (111),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + +
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLT  45



>ref|XP_004975554.1| PREDICTED: uncharacterized protein LOC101760762 isoform X1 [Setaria 
italica]
Length=122

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALL++ + R +
Sbjct  24   NAKLYLQNCYIMKENERLRKKALLLNQENQALLTELKQRLA  64



>gb|EAY94025.1| hypothetical protein OsI_15803 [Oryza sativa Indica Group]
Length=96

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY++N  I++ENE LRKKA LL+QEN ALL++ + R 
Sbjct  5    NAKLYLQNCYIMKENERLRKKALLLNQENQALLTELKQRL  44



>ref|XP_008776046.1| PREDICTED: uncharacterized protein LOC103696263 [Phoenix dactylifera]
Length=113

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/37 (68%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQ  238
            NLKLY+EN  I+EENE LR+KA LL QEN ALLS  +
Sbjct  62   NLKLYLENRCIMEENERLREKALLLRQENQALLSNLR  98



>ref|NP_001052732.1| Os04g0411200 [Oryza sativa Japonica Group]
 dbj|BAF14646.1| Os04g0411200 [Oryza sativa Japonica Group]
Length=99

 Score = 47.4 bits (111),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRF  229
            N KLY++N  I++ENE LRKKA LL+QEN ALL++ + R 
Sbjct  5    NAKLYLQNCYIMKENERLRKKALLLNQENQALLTELKQRL  44



>gb|KFK35287.1| hypothetical protein AALP_AA5G265200 [Arabis alpina]
Length=87

 Score = 47.0 bits (110),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFSCV  220
            N KL++EN +I+ ENE L+KKA LLHQEN AL S    + S V
Sbjct  41   NWKLFVENQNIIRENEALKKKAILLHQENNALFSMLHSKLSSV  83



>ref|XP_006481795.1| PREDICTED: uncharacterized protein LOC102630060 [Citrus sinensis]
Length=76

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + +
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLA  45



>ref|XP_006430233.1| hypothetical protein CICLE_v10013416mg [Citrus clementina]
 gb|ESR43473.1| hypothetical protein CICLE_v10013416mg [Citrus clementina]
 gb|KDO61118.1| hypothetical protein CISIN_1g047813mg [Citrus sinensis]
Length=74

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = -2

Query  348  NLKLYMENMSILEENENLRKKASLLHQENLALLSQFQHRFS  226
            N KLY++N  I++ENE LRKKA LL+QEN ALLS+ + + +
Sbjct  5    NSKLYLQNCYIMKENERLRKKAQLLNQENQALLSELKQKLA  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1166488890696