BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c69224_g1_i1 len=166 path=[1:0-165]

Length=166
                                                                      Score     E

ref|XP_007155714.1|  hypothetical protein PHAVU_003G225200g             101   3e-26   
emb|CAN71467.1|  hypothetical protein VITISV_038988                   87.8    2e-19   Vitis vinifera
ref|XP_002518274.1|  conserved hypothetical protein                   84.7    1e-17   Ricinus communis
ref|XP_003588268.1|  NADH-ubiquinone oxidoreductase chain             75.1    4e-14   
ref|XP_006401949.1|  hypothetical protein EUTSA_v10015926mg           71.6    7e-14   
ref|XP_002535828.1|  conserved hypothetical protein                   60.1    4e-10   Ricinus communis
ref|XP_002517741.1|  conserved hypothetical protein                   58.5    2e-09   Ricinus communis
emb|CDY67013.1|  BnaUnng01800D                                        53.5    2e-07   



>ref|XP_007155714.1| hypothetical protein PHAVU_003G225200g [Phaseolus vulgaris]
 gb|ESW27708.1| hypothetical protein PHAVU_003G225200g [Phaseolus vulgaris]
Length=73

 Score =   101 bits (252),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 46/55 (84%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +2

Query  2    AAFFFHNKTWTIIPTFGSLRVYVHPWSGTVSFRFLPCSRYPNSRKCVHTPQTYFT  166
               FFHNKTWTIIPT GSLR+YVHPW  TVSFRF+PCSRYPNSRKCVHTPQTY T
Sbjct  3    GRLFFHNKTWTIIPTLGSLRLYVHPWLDTVSFRFIPCSRYPNSRKCVHTPQTYLT  57



>emb|CAN71467.1| hypothetical protein VITISV_038988 [Vitis vinifera]
Length=280

 Score = 87.8 bits (216),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/49 (90%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +3

Query  3    RLFSFTIRPGRLSLPSVAYEFTSIPGRVQFPFDFSLVAVTRIRASVSTP  149
            RLF FTIRPGRLSLPSVAYEFTSIPGRVQFPFDFSLVAVTRIRA    P
Sbjct  160  RLFCFTIRPGRLSLPSVAYEFTSIPGRVQFPFDFSLVAVTRIRARAPLP  208



>ref|XP_002518274.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44034.1| conserved hypothetical protein [Ricinus communis]
Length=431

 Score = 84.7 bits (208),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/51 (84%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +3

Query  6    LFSFTIRPGRLSLPSVAYEFTSIPGRVQFPFDFSLVAVTRIRASVSTPPKL  158
            LF FTIRPGRLSLPSVA +F S+P RVQFPFDFSLVAVTRIR SVSTPP L
Sbjct  81   LFFFTIRPGRLSLPSVACKFMSVPSRVQFPFDFSLVAVTRIRTSVSTPPNL  131



>ref|XP_003588268.1| NADH-ubiquinone oxidoreductase chain [Medicago truncatula]
 gb|KEH16850.1| NADH-quinone oxidoreductase protein [Medicago truncatula]
Length=556

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/36 (94%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = -1

Query  166  RKVSLGGVDTLARIRVTATREKSKGNCTRPGMDVNS  59
            R+VSLGGVDTLARIRVTATREKSKGNCT+PGMDVNS
Sbjct  207  RQVSLGGVDTLARIRVTATREKSKGNCTQPGMDVNS  242



>ref|XP_006401949.1| hypothetical protein EUTSA_v10015926mg [Eutrema salsugineum]
 gb|ESQ43402.1| hypothetical protein EUTSA_v10015926mg [Eutrema salsugineum]
Length=181

 Score = 71.6 bits (174),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 32/36 (89%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = -1

Query  166  RKVSLGGVDTLARIRVTATREKSKGNCTRPGMDVNS  59
            R+V LGGVDTLA+I+VTATREKSKGNCTRPGMDVNS
Sbjct  146  RQVCLGGVDTLAQIQVTATREKSKGNCTRPGMDVNS  181



>ref|XP_002535828.1| conserved hypothetical protein [Ricinus communis]
 ref|XP_002538850.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF23533.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF26555.1| conserved hypothetical protein [Ricinus communis]
Length=86

 Score = 60.1 bits (144),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -1

Query  154  LGGVDTLARIRVTATREKSKGNCTRPGMD  68
             GGVDTLARIRVTATREKSKGNCTRPGMD
Sbjct  8    FGGVDTLARIRVTATREKSKGNCTRPGMD  36



>ref|XP_002517741.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44673.1| conserved hypothetical protein [Ricinus communis]
Length=111

 Score = 58.5 bits (140),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -1

Query  154  LGGVDTLARIRVTATREKSKGNCTRPGMD  68
             GG+DTLA+IRVTATREKSKGNCTRPGMD
Sbjct  8    FGGMDTLAQIRVTATREKSKGNCTRPGMD  36



>emb|CDY67013.1| BnaUnng01800D [Brassica napus]
Length=187

 Score = 53.5 bits (127),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  8    FFFHNKTWTIIPTFGSLRVYVHPWSGT  88
            F FHNKTWTIIP  GSLRVYVHPWS  
Sbjct  160  FLFHNKTWTIIPNLGSLRVYVHPWSAV  186



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 516244808268